3SSLA

Engineered high-affinity halide-binding protein derived from yfp: iodide complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
236
structure length
231
Chain Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMRQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYAQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Determination of engineered chloride-binding site structures in fluorescent proteins reveals principles of halide recognition
rcsb
source organism Aequorea victoria
molecule tags Halide binding protein
total genus 56
structure length 231
sequence length 236
ec nomenclature
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sslA00
1EMLA 2YE1A 2EMNA 4OJ0A 2DD7A 4Q9WA 4J8AA 4W76A 2HCGA 5HZOA 5BQLA 5DRFA 3H1OA 2DDDA 4IK3A 1B9CA 2DD9A 5EXCI 3UFZA 1EMMA 4ZF5A 5DTZA 5KTGA 3OGOA 1GFLA 1YZWA 3E5TA 4R6DA 3DQJA 5EB7A 4AS8A 4W6MA 3VHTA 2QLHA 4IK9A 3RWAA 3SSPA 4H3NA 2WSNA 2HGYA 5FVIA 5EJUA 4EN1A 3WLDA 3SG6A 4ZFSA 4W6RA 3DQNA 3CGLA 4W7RA 2A47A 1GL4A 5LTQA 3VK1A 3CB9A 2QLGA 3DQ5A 1KYPA 3SG4A 3RWTA 4JRBA 1EMKA 2Z6ZA 2G3OA 5DTLA 4DXOA 3DQ4A 3LA1A 1EMBA 3DPWA 3E5VA 3SSKA 1H6RA 3BXAA 3WCKA 2H9WA 4TZAA 4NWSA 2EMDA 4L12A 4XVPA 2OKWA 5HBDA 3U8AA 4Q7TA 5J2OA 4W6BA 2VZXA 1Q4DA 2AWJA 1ZGPA 3LVAA 4IK8A 3WLCA 4EDSA 5DRGA 1RRXA 3DQ6A 3NT9A 4W6PA 2WHUA 1C4FA 1RMPA 4PPJA 3O77A 2Z1OA 4XOVA 2Q57A 5LK4A 2AHAA 3P8UA 2A50B 3LVCA 3ADFA 1Q4CA 2IE2A 3GJ2A 5FVFA 3SSYA 3DQFA 3DQ2A 2YE0A 5HZUA 1OXEA 3UG0A 3EK8A 3H1RA 5LTPA 1JC1A 1KYRA 3SG5A 2IB5A 3NF0A 4LJCA 4W7FA 4W6TA 3ST3A 3LS3A 1JC0A 2AWLA 4W73A 4P76A 1XMZA 3ZULA 1YJFA 2HGDA 3DQKA 3DQOA 3PJ5A 5HW9A 2G6EA 3W1DA 1MOUA 4H48A 3M22A 5DQMA 3DQIA 2QLIA 1YHGA 2WISA 3DQEA 3U0NA 5DPHA 1HUYA 2B3PA 1OXFA 3W1CA 2VADA 3DPXA 4I2YA 3GEXA 2H8QA 2GX0A 1F0BA 3E5WA 3I19A 4P1QA 2OKYA 2P4MA 2Z6YA 2A52B 1H4UA 2G5ZB 3NEZA 3DPZA 5DQBA 2V4EA 5EXBA 2ZO6A 3IR8A 3EVRA 2ZMWA 3SRYA 4GOBA 2WURA 3SSTA 5H88A 2H5OA 4HE4A 3KCTA 3ZUFA 3GL4A 4OGSA 4W6KA 1EMAA 1W7SA 4W69A 2G16B 2G6XA 2H6VA 4RYWA 4DXQA 4DXIA 4KPIA 4W6JA 4W6IA 3P28A 3LSAA 4W6FA 4Z4KA 1ZGQA 3S05A 2FZUA 3DQMA 5H87A 4W7XA 2YDZA 3SVEA 3SSVA 3LVDA 1MYWA 4KAGA 2QU1A 2H5QA 4DXPA 3EKJA 4GESB 2OTEA 2V4EC 2DUHA 5LTRA 3AI4A 4Z4MA 3SVOA 4W6LA 1EMFA 3O78A 3ST2A 4R6BA 2HRSA 4PPKA 3OSQA 3SSHA 1QYFA 3BX9A 2G6YA 2Y0GA 2DDCA 4ZF3A 2DUIA 2OTBA 3LF4B 4TZGA 3SG7A 2HPWA 4DKNA 3GB3A 3SVUA 1QYQA 5F9GA 4ZBLA 2WHTA 2G3DB 2A48A 4GF6B 5DTXA 3DQ7A 4IZNA 1XAEA 1G7KA 2ARLA 4W75A 1MOVA 2H5PA 3NT3A 4W7CA 3CFAA 2Q6PA 2WHSA 3DQ8A 5DU0A 5DTYA 5HZSA 1W7TA 4KF5A 4XOWA 1CV7A 4OY4A 3SVRA 4LJBA 4DXNA 2HQZA 2ZO7A 2VVJA 2QT2A 4LJDA 1F09A 3PJ7A 2AH8A 2OGRA 2VAEA 4RTCA 4W6UA 3K1KA 4W6DA 4LW5A 3VICA 2GX2A 3CD1A 2O24A 2OJKA 1BFPA 3LF3A 2GW3A 4N3DA 3DQ9A 3ST0A 4KW8A 1OXDA 3CD9A 2EMOA 4JFGA 5BT0A 2C9JA 3ED8A 3EVPA 4W6GA 4KW4A 4RYSA 4LQUA 5FVGA 1YJ2A 4XL5A 4W77A 4W7EA 3PIBA 2YFPA 2DUEA 3DQHA 4HVFA 3SSLA 3TMRA 1UISA 3DQAA 2WSOA 3GJ1A 3CFFA 1ZUXA 4H3MA 3EKHA 2HQKA 4EULA 3G9AA 3BXCA 3VHTB 5DY6A 1Q4EA 3DQLA 4U2VA 4W6NA 3CBEA 1YHHA 4KGFA 1EMGA 2ZMUA 4L1IA 2HFCA 2O2BA 4JEOA 5HZTA 4ANJA 3DQUA 3IP2A 4B5YA 1Q73A 1W7UA 3SG2A 1QY3A 2QLEA 2QLGB 2WIQA 3SV5A 2A53B 4OQWA 2DUFA 4XGYA 3CFHA 4J88A 2QRFA 3SVNA 2AWKA 4W6OA 4DXMA 5DPGA 4EDOA 2BTJA 4LQTA 1RM9A 4W7AA 1S6ZA 4PFEA 2VVHA 4HQCA 4JC2A 3ST4A 1XQMA 4H3LA 4W6HA 3KCSA 3U0LA 4Q9XA 3U8CA 1RMOA 1EMCA 2IB6A 4HQ9A 2JADA 3EK4A 4IK4A 4UTSA 4DKMA 4KEXA 3SS0A 1Z1QA 3MGFA 3SVBA 1YFPA 3BXBA 5AQBB 5EXUA 4IK1A 2O29A 1ZGOA 2ICRA 2FL1A 2G2SB 1Q4AA 3U0MA 4W7DA 3A8SA 3SVDA 3PJBA 4ORNA 1XA9A 4HQ8A 2DUGA 4J89A 4IK5A 4Q7UA 1YHIA 2B3QA 5T3IA 1EMEA 2H5RA 3EK7A 4AR7A 3AI5A 4OHSA 3DQ3A 1Q4BA 5DPIA 1KP5A 1JBYA 1GGXA 5DPJA 5EB6A 3SG3A 3V3DA 4KF4A 3EVUA 5FHVA 2C9IA 2AWMA 5HGEA 3U8PA 4JGEA 4PPLA 5BTTB 4W74A 2GW4B 1HCJA 2HJOA 3M24A 4ZIOA 4ZB1A 4ZF4A 4JF9A 4B30B 1Z1PA 5H89A 4W6SA 2PXWA 4KA9A 2RH7A 2A46A 4H47A 2A54B 4ZINA 3DQCA 2Z6XA 3NEDA 3AKOA 3SVSA 4KGEA 1RMMA 3SVCA 4W6AA 2QZ0A 3EVVA 2IOVA 1JBZA 3DQDA 4KF5C 3OSRA 4L13A 3DQ1A 2V4EB 2POXA 4W6CA 4KW9A 3ZUJA 4EMQA 2VVIA 5EBJA 5BTTA 3ZTFA 4Q7RA 4LJDC 1QXTA 2PXSA 2A56B 4W72A 4B30A 1XSSA 3TMTA 3U0KA 5EHUA 1KYSA 2FWQA 4BDUA 1QYOA
chains in the Genus database with same CATH superfamily
1EMLA 2YE1A 2EMNA 4OJ0A 2DD7A 4Q9WA 4J8AA 4W76A 2HCGA 5HZOA 5BQLA 5DRFA 3H1OA 2DDDA 4IK3A 1B9CA 2DD9A 5EXCI 3UFZA 1EMMA 4ZF5A 5DTZA 5KTGA 3OGOA 1GFLA 1YZWA 3E5TA 4R6DA 3DQJA 5EB7A 4AS8A 4W6MA 3VHTA 2QLHA 4IK9A 3RWAA 3SSPA 4H3NA 2WSNA 2HGYA 5FVIA 5EJUA 4EN1A 3WLDA 3SG6A 4ZFSA 4W6RA 3DQNA 3CGLA 4W7RA 2A47A 1GL4A 5LTQA 3VK1A 3CB9A 2QLGA 3DQ5A 1KYPA 3SG4A 3RWTA 4JRBA 1EMKA 2Z6ZA 2G3OA 5DTLA 4DXOA 3DQ4A 3LA1A 1EMBA 3DPWA 3E5VA 3SSKA 1H6RA 3BXAA 3WCKA 2H9WA 4TZAA 4NWSA 2EMDA 4L12A 4XVPA 2OKWA 5HBDA 3U8AA 4Q7TA 5J2OA 4W6BA 2VZXA 1Q4DA 2AWJA 1ZGPA 3LVAA 4IK8A 3WLCA 4EDSA 5DRGA 1RRXA 3DQ6A 3NT9A 4W6PA 2WHUA 1C4FA 1RMPA 4PPJA 3O77A 2Z1OA 4XOVA 2Q57A 5LK4A 2AHAA 3P8UA 2A50B 3LVCA 3ADFA 1Q4CA 2IE2A 3GJ2A 5FVFA 3SSYA 3DQFA 3DQ2A 2YE0A 5HZUA 1OXEA 3UG0A 3EK8A 3H1RA 5LTPA 1JC1A 1KYRA 3SG5A 2IB5A 3NF0A 4LJCA 4W7FA 4W6TA 3ST3A 3LS3A 1JC0A 2AWLA 4W73A 4P76A 1XMZA 3ZULA 1YJFA 2HGDA 3DQKA 3DQOA 3PJ5A 5HW9A 2G6EA 3W1DA 1MOUA 4H48A 3M22A 5DQMA 3DQIA 2QLIA 1YHGA 2WISA 3DQEA 3U0NA 5DPHA 1HUYA 2B3PA 1OXFA 3W1CA 2VADA 3DPXA 4I2YA 3GEXA 2H8QA 2GX0A 1F0BA 3E5WA 3I19A 4P1QA 2OKYA 2P4MA 2Z6YA 2A52B 1H4UA 2G5ZB 3NEZA 3DPZA 5DQBA 2V4EA 5EXBA 2ZO6A 3IR8A 3EVRA 2ZMWA 3SRYA 4GOBA 2WURA 3SSTA 5H88A 2H5OA 4HE4A 3KCTA 3ZUFA 3GL4A 4OGSA 4W6KA 1EMAA 1W7SA 4W69A 2G16B 2G6XA 2H6VA 4RYWA 4DXQA 4DXIA 4KPIA 4W6JA 4W6IA 3P28A 3LSAA 4W6FA 4Z4KA 1ZGQA 3S05A 2FZUA 3DQMA 5H87A 4W7XA 2YDZA 3SVEA 3SSVA 3LVDA 1MYWA 4KAGA 2QU1A 2H5QA 4DXPA 3EKJA 4GESB 2OTEA 2V4EC 2DUHA 5LTRA 3AI4A 4Z4MA 3SVOA 4W6LA 1EMFA 3O78A 3ST2A 4R6BA 2HRSA 4PPKA 3OSQA 3SSHA 1QYFA 3BX9A 2G6YA 2Y0GA 2DDCA 4ZF3A 2DUIA 2OTBA 3LF4B 4TZGA 3SG7A 2HPWA 4DKNA 3GB3A 3SVUA 1QYQA 5F9GA 4ZBLA 2WHTA 2G3DB 2A48A 4GF6B 5DTXA 3DQ7A 4IZNA 1XAEA 1G7KA 2ARLA 4W75A 1MOVA 2H5PA 3NT3A 4W7CA 3CFAA 2Q6PA 2WHSA 3DQ8A 5DU0A 5DTYA 5HZSA 1W7TA 4KF5A 4XOWA 1CV7A 4OY4A 3SVRA 4LJBA 4DXNA 2HQZA 2ZO7A 2VVJA 2QT2A 4LJDA 1F09A 3PJ7A 2AH8A 2OGRA 2VAEA 4RTCA 4W6UA 3K1KA 4W6DA 4LW5A 3VICA 2GX2A 3CD1A 2O24A 2OJKA 1BFPA 3LF3A 2GW3A 4N3DA 3DQ9A 3ST0A 4KW8A 1OXDA 3CD9A 2EMOA 4JFGA 5BT0A 2C9JA 3ED8A 3EVPA 4W6GA 4KW4A 4RYSA 4LQUA 5FVGA 1YJ2A 4XL5A 4W77A 4W7EA 3PIBA 2YFPA 2DUEA 3DQHA 4HVFA 3SSLA 3TMRA 1UISA 3DQAA 2WSOA 3GJ1A 3CFFA 1ZUXA 4H3MA 3EKHA 2HQKA 4EULA 3G9AA 3BXCA 3VHTB 5DY6A 1Q4EA 3DQLA 4U2VA 4W6NA 3CBEA 1YHHA 4KGFA 1EMGA 2ZMUA 4L1IA 2HFCA 2O2BA 4JEOA 5HZTA 4ANJA 3DQUA 3IP2A 4B5YA 1Q73A 1W7UA 3SG2A 1QY3A 2QLEA 2QLGB 2WIQA 3SV5A 2A53B 4OQWA 2DUFA 4XGYA 3CFHA 4J88A 2QRFA 3SVNA 2AWKA 4W6OA 4DXMA 5DPGA 4EDOA 2BTJA 4LQTA 1RM9A 4W7AA 1S6ZA 4PFEA 2VVHA 4HQCA 4JC2A 3ST4A 1XQMA 4H3LA 4W6HA 3KCSA 3U0LA 4Q9XA 3U8CA 1RMOA 1EMCA 2IB6A 4HQ9A 2JADA 3EK4A 4IK4A 4UTSA 4DKMA 4KEXA 3SS0A 1Z1QA 3MGFA 3SVBA 1YFPA 3BXBA 5AQBB 5EXUA 4IK1A 2O29A 1ZGOA 2ICRA 2FL1A 2G2SB 1Q4AA 3U0MA 4W7DA 3A8SA 3SVDA 3PJBA 4ORNA 1XA9A 4HQ8A 2DUGA 4J89A 4IK5A 4Q7UA 1YHIA 2B3QA 5T3IA 1EMEA 2H5RA 3EK7A 4AR7A 3AI5A 4OHSA 3DQ3A 1Q4BA 5DPIA 1KP5A 1JBYA 1GGXA 5DPJA 5EB6A 3SG3A 3V3DA 4KF4A 3EVUA 5FHVA 2C9IA 2AWMA 5HGEA 3U8PA 4JGEA 4PPLA 5BTTB 4W74A 2GW4B 1HCJA 2HJOA 3M24A 4ZIOA 4ZB1A 4ZF4A 4JF9A 4B30B 1Z1PA 5H89A 4W6SA 2PXWA 4KA9A 2RH7A 2A46A 4H47A 2A54B 4ZINA 3DQCA 2Z6XA 3NEDA 3AKOA 3SVSA 4KGEA 1RMMA 3SVCA 4W6AA 2QZ0A 3EVVA 2IOVA 1JBZA 3DQDA 4KF5C 3OSRA 4L13A 3DQ1A 2V4EB 2POXA 4W6CA 4KW9A 3ZUJA 4EMQA 2VVIA 5EBJA 5BTTA 3ZTFA 4Q7RA 4LJDC 1QXTA 2PXSA 2A56B 4W72A 4B30A 1XSSA 3TMTA 3U0KA 5EHUA 1KYSA 2FWQA 4BDUA 1QYOA
chains in the Genus database with same CATH topology
1EMLA 2YE1A 2EMNA 4OJ0A 2DD7A 4Q9WA 4J8AA 4W76A 2HCGA 5HZOA 5BQLA 5DRFA 3H1OA 2DDDA 4IK3A 1B9CA 2DD9A 5EXCI 3UFZA 1EMMA 4ZF5A 5DTZA 5KTGA 3OGOA 1GFLA 1YZWA 3E5TA 4R6DA 3DQJA 5EB7A 4AS8A 4W6MA 3VHTA 2QLHA 4IK9A 3RWAA 3SSPA 4H3NA 2WSNA 2HGYA 5FVIA 5EJUA 4EN1A 3WLDA 3SG6A 4ZFSA 4W6RA 3DQNA 3CGLA 4W7RA 2A47A 1GL4A 5LTQA 3VK1A 3CB9A 2QLGA 3DQ5A 1KYPA 3SG4A 3RWTA 4JRBA 1EMKA 2Z6ZA 2G3OA 5DTLA 4DXOA 3DQ4A 3LA1A 1EMBA 3DPWA 3E5VA 3SSKA 1H6RA 3BXAA 3WCKA 2H9WA 4TZAA 4NWSA 2EMDA 4L12A 4XVPA 2OKWA 5HBDA 3U8AA 4Q7TA 5J2OA 4W6BA 2VZXA 1Q4DA 2AWJA 1ZGPA 3LVAA 4IK8A 3WLCA 4EDSA 5DRGA 1RRXA 3DQ6A 3NT9A 4W6PA 2WHUA 1C4FA 1RMPA 4PPJA 3O77A 2Z1OA 4XOVA 2Q57A 5LK4A 2AHAA 3P8UA 2A50B 3LVCA 3ADFA 1Q4CA 2IE2A 3GJ2A 5FVFA 3SSYA 3DQFA 3DQ2A 2YE0A 5HZUA 1OXEA 3UG0A 3EK8A 3H1RA 5LTPA 1JC1A 1KYRA 3SG5A 2IB5A 3NF0A 4LJCA 4W7FA 4W6TA 3ST3A 3LS3A 1JC0A 2AWLA 4W73A 4P76A 1XMZA 3ZULA 1YJFA 2HGDA 3DQKA 3DQOA 3PJ5A 5HW9A 2G6EA 3W1DA 1MOUA 4H48A 3M22A 5DQMA 3DQIA 2QLIA 1YHGA 2WISA 3DQEA 3U0NA 5DPHA 1HUYA 2B3PA 1OXFA 3W1CA 2VADA 3DPXA 4I2YA 3GEXA 2H8QA 2GX0A 1F0BA 3E5WA 3I19A 4P1QA 2OKYA 2P4MA 2Z6YA 2A52B 1H4UA 2G5ZB 3NEZA 3DPZA 5DQBA 2V4EA 5EXBA 2ZO6A 3IR8A 3EVRA 2ZMWA 3SRYA 4GOBA 2WURA 3SSTA 5H88A 2H5OA 4HE4A 3KCTA 3ZUFA 3GL4A 4OGSA 4W6KA 1EMAA 1W7SA 4W69A 2G16B 2G6XA 2H6VA 4RYWA 4DXQA 4DXIA 4KPIA 4W6JA 4W6IA 3P28A 3LSAA 4W6FA 4Z4KA 1ZGQA 3S05A 2FZUA 3DQMA 5H87A 4W7XA 2YDZA 3SVEA 3SSVA 3LVDA 1MYWA 4KAGA 2QU1A 2H5QA 4DXPA 3EKJA 4GESB 2OTEA 2V4EC 2DUHA 5LTRA 3AI4A 4Z4MA 3SVOA 4W6LA 1EMFA 3O78A 3ST2A 4R6BA 2HRSA 4PPKA 3OSQA 3SSHA 1QYFA 3BX9A 2G6YA 2Y0GA 2DDCA 4ZF3A 2DUIA 2OTBA 3LF4B 4TZGA 3SG7A 2HPWA 4DKNA 3GB3A 3SVUA 1QYQA 5F9GA 4ZBLA 2WHTA 2G3DB 2A48A 4GF6B 5DTXA 3DQ7A 4IZNA 1XAEA 1G7KA 2ARLA 4W75A 1MOVA 2H5PA 3NT3A 4W7CA 3CFAA 2Q6PA 2WHSA 3DQ8A 5DU0A 5DTYA 5HZSA 1W7TA 4KF5A 4XOWA 1CV7A 4OY4A 3SVRA 4LJBA 4DXNA 2HQZA 2ZO7A 2VVJA 2QT2A 4LJDA 1F09A 3PJ7A 2AH8A 2OGRA 2VAEA 4RTCA 4W6UA 3K1KA 4W6DA 4LW5A 3VICA 2GX2A 3CD1A 2O24A 2OJKA 1BFPA 3LF3A 2GW3A 4N3DA 3DQ9A 3ST0A 4KW8A 1OXDA 3CD9A 2EMOA 4JFGA 5BT0A 2C9JA 3ED8A 3EVPA 4W6GA 4KW4A 4RYSA 4LQUA 5FVGA 1YJ2A 4XL5A 4W77A 4W7EA 3PIBA 2YFPA 2DUEA 3DQHA 4HVFA 3SSLA 3TMRA 1UISA 3DQAA 2WSOA 3GJ1A 3CFFA 1ZUXA 4H3MA 3EKHA 2HQKA 4EULA 3G9AA 3BXCA 3VHTB 5DY6A 1Q4EA 3DQLA 4U2VA 4W6NA 3CBEA 1YHHA 4KGFA 1EMGA 2ZMUA 4L1IA 2HFCA 2O2BA 4JEOA 5HZTA 4ANJA 3DQUA 3IP2A 4B5YA 1Q73A 1W7UA 3SG2A 1QY3A 2QLEA 2QLGB 2WIQA 3SV5A 2A53B 4OQWA 2DUFA 4XGYA 3CFHA 4J88A 2QRFA 3SVNA 2AWKA 4W6OA 4DXMA 5DPGA 4EDOA 2BTJA 4LQTA 1RM9A 4W7AA 1S6ZA 4PFEA 2VVHA 4HQCA 4JC2A 3ST4A 1XQMA 4H3LA 4W6HA 3KCSA 3U0LA 4Q9XA 3U8CA 1RMOA 1EMCA 2IB6A 4HQ9A 2JADA 3EK4A 4IK4A 4UTSA 4DKMA 4KEXA 3SS0A 1Z1QA 3MGFA 3SVBA 1YFPA 3BXBA 5AQBB 5EXUA 4IK1A 2O29A 1ZGOA 2ICRA 2FL1A 2G2SB 1Q4AA 3U0MA 4W7DA 3A8SA 3SVDA 3PJBA 4ORNA 1XA9A 4HQ8A 2DUGA 4J89A 4IK5A 4Q7UA 1YHIA 2B3QA 5T3IA 1EMEA 2H5RA 3EK7A 4AR7A 3AI5A 4OHSA 3DQ3A 1Q4BA 5DPIA 1KP5A 1JBYA 1GGXA 5DPJA 5EB6A 3SG3A 3V3DA 4KF4A 3EVUA 5FHVA 2C9IA 2AWMA 5HGEA 3U8PA 4JGEA 4PPLA 5BTTB 4W74A 2GW4B 1HCJA 2HJOA 3M24A 4ZIOA 4ZB1A 4ZF4A 4JF9A 4B30B 1Z1PA 5H89A 4W6SA 2PXWA 4KA9A 2RH7A 2A46A 4H47A 2A54B 4ZINA 3DQCA 2Z6XA 3NEDA 3AKOA 3SVSA 4KGEA 1RMMA 3SVCA 4W6AA 2QZ0A 3EVVA 2IOVA 1JBZA 3DQDA 4KF5C 3OSRA 4L13A 3DQ1A 2V4EB 2POXA 4W6CA 4KW9A 3ZUJA 4EMQA 2VVIA 5EBJA 5BTTA 3ZTFA 4Q7RA 4LJDC 1QXTA 2PXSA 2A56B 4W72A 4B30A 1XSSA 3TMTA 3U0KA 5EHUA 1KYSA 2FWQA 4BDUA 1QYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EML A;  2YE1 A;  2EMN A;  4OJ0 A;  2DD7 A;  4Q9W A;  4J8A A;  4W76 A;  2HCG A;  5HZO A;  5BQL A;  5DRF A;  3H1O A;  2DDD A;  4IK3 A;  1B9C A;  2DD9 A;  5EXC I;  3UFZ A;  1EMM A;  4ZF5 A;  5DTZ A;  5KTG A;  3OGO A;  1GFL A;  1YZW A;  3E5T A;  4R6D A;  3DQJ A;  5EB7 A;  4AS8 A;  4W6M A;  3VHT A;  2QLH A;  4IK9 A;  3RWA A;  3SSP A;  4H3N A;  2WSN A;  2HGY A;  5FVI A;  5EJU A;  4EN1 A;  3WLD A;  3SG6 A;  4ZFS A;  4W6R A;  3DQN A;  3CGL A;  4W7R A;  2A47 A;  1GL4 A;  5LTQ A;  3VK1 A;  3CB9 A;  2QLG A;  3DQ5 A;  1KYP A;  3SG4 A;  3RWT A;  4JRB A;  1EMK A;  2Z6Z A;  2G3O A;  5DTL A;  4DXO A;  3DQ4 A;  3LA1 A;  1EMB A;  3DPW A;  3E5V A;  3SSK A;  1H6R A;  3BXA A;  3WCK A;  2H9W A;  4TZA A;  4NWS A;  2EMD A;  4L12 A;  4XVP A;  2OKW A;  5HBD A;  3U8A A;  4Q7T A;  5J2O A;  4W6B A;  2VZX A;  1Q4D A;  2AWJ A;  1ZGP A;  3LVA A;  4IK8 A;  3WLC A;  4EDS A;  5DRG A;  1RRX A;  3DQ6 A;  3NT9 A;  4W6P A;  2WHU A;  1C4F A;  1RMP A;  4PPJ A;  3O77 A;  2Z1O A;  4XOV A;  2Q57 A;  5LK4 A;  2AHA A;  3P8U A;  2A50 B;  3LVC A;  3ADF A;  1Q4C A;  2IE2 A;  3GJ2 A;  5FVF A;  3SSY A;  3DQF A;  3DQ2 A;  2YE0 A;  5HZU A;  1OXE A;  3UG0 A;  3EK8 A;  3H1R A;  5LTP A;  1JC1 A;  1KYR A;  3SG5 A;  2IB5 A;  3NF0 A;  4LJC A;  4W7F A;  4W6T A;  3ST3 A;  3LS3 A;  1JC0 A;  2AWL A;  4W73 A;  4P76 A;  1XMZ A;  3ZUL A;  1YJF A;  2HGD A;  3DQK A;  3DQO A;  3PJ5 A;  5HW9 A;  2G6E A;  3W1D A;  1MOU A;  4H48 A;  3M22 A;  5DQM A;  3DQI A;  2QLI A;  1YHG A;  2WIS A;  3DQE A;  3U0N A;  5DPH A;  1HUY A;  2B3P A;  1OXF A;  3W1C A;  2VAD A;  3DPX A;  4I2Y A;  3GEX A;  2H8Q A;  2GX0 A;  1F0B A;  3E5W A;  3I19 A;  4P1Q A;  2OKY A;  2P4M A;  2Z6Y A;  2A52 B;  1H4U A;  2G5Z B;  3NEZ A;  3DPZ A;  5DQB A;  2V4E A;  5EXB A;  2ZO6 A;  3IR8 A;  3EVR A;  2ZMW A;  3SRY A;  4GOB A;  2WUR A;  3SST A;  5H88 A;  2H5O A;  4HE4 A;  3KCT A;  3ZUF A;  3GL4 A;  4OGS A;  4W6K A;  1EMA A;  1W7S A;  4W69 A;  2G16 B;  2G6X A;  2H6V A;  4RYW A;  4DXQ A;  4DXI A;  4KPI A;  4W6J A;  4W6I A;  3P28 A;  3LSA A;  4W6F A;  4Z4K A;  1ZGQ A;  3S05 A;  2FZU A;  3DQM A;  5H87 A;  4W7X A;  2YDZ A;  3SVE A;  3SSV A;  3LVD A;  1MYW A;  4KAG A;  2QU1 A;  2H5Q A;  4DXP A;  3EKJ A;  4GES B;  2OTE A;  2V4E C;  2DUH A;  5LTR A;  3AI4 A;  4Z4M A;  3SVO A;  4W6L A;  1EMF A;  3O78 A;  3ST2 A;  4R6B A;  2HRS A;  4PPK A;  3OSQ A;  3SSH A;  1QYF A;  3BX9 A;  2G6Y A;  2Y0G A;  2DDC A;  4ZF3 A;  2DUI A;  2OTB A;  3LF4 B;  4TZG A;  3SG7 A;  2HPW A;  4DKN A;  3GB3 A;  3SVU A;  1QYQ A;  5F9G A;  4ZBL A;  2WHT A;  2G3D B;  2A48 A;  4GF6 B;  5DTX A;  3DQ7 A;  4IZN A;  1XAE A;  1G7K A;  2ARL A;  4W75 A;  1MOV A;  2H5P A;  3NT3 A;  4W7C A;  3CFA A;  2Q6P A;  2WHS A;  3DQ8 A;  5DU0 A;  5DTY A;  5HZS A;  1W7T A;  4KF5 A;  4XOW A;  1CV7 A;  4OY4 A;  3SVR A;  4LJB A;  4DXN A;  2HQZ A;  2ZO7 A;  2VVJ A;  2QT2 A;  4LJD A;  1F09 A;  3PJ7 A;  2AH8 A;  2OGR A;  2VAE A;  4RTC A;  4W6U A;  3K1K A;  4W6D A;  4LW5 A;  3VIC A;  2GX2 A;  3CD1 A;  2O24 A;  2OJK A;  1BFP A;  3LF3 A;  2GW3 A;  4N3D A;  3DQ9 A;  3ST0 A;  4KW8 A;  1OXD A;  3CD9 A;  2EMO A;  4JFG A;  5BT0 A;  2C9J A;  3ED8 A;  3EVP A;  4W6G A;  4KW4 A;  4RYS A;  4LQU A;  5FVG A;  1YJ2 A;  4XL5 A;  4W77 A;  4W7E A;  3PIB A;  2YFP A;  2DUE A;  3DQH A;  4HVF A;  3SSL A;  3TMR A;  1UIS A;  3DQA A;  2WSO A;  3GJ1 A;  3CFF A;  1ZUX A;  4H3M A;  3EKH A;  2HQK A;  4EUL A;  3G9A A;  3BXC A;  3VHT B;  5DY6 A;  1Q4E A;  3DQL A;  4U2V A;  4W6N A;  3CBE A;  1YHH A;  4KGF A;  1EMG A;  2ZMU A;  4L1I A;  2HFC A;  2O2B A;  4JEO A;  5HZT A;  4ANJ A;  3DQU A;  3IP2 A;  4B5Y A;  1Q73 A;  1W7U A;  3SG2 A;  1QY3 A;  2QLE A;  2QLG B;  2WIQ A;  3SV5 A;  2A53 B;  4OQW A;  2DUF A;  4XGY A;  3CFH A;  4J88 A;  2QRF A;  3SVN A;  2AWK A;  4W6O A;  4DXM A;  5DPG A;  4EDO A;  2BTJ A;  4LQT A;  1RM9 A;  4W7A A;  1S6Z A;  4PFE A;  2VVH A;  4HQC A;  4JC2 A;  3ST4 A;  1XQM A;  4H3L A;  4W6H A;  3KCS A;  3U0L A;  4Q9X A;  3U8C A;  1RMO A;  1EMC A;  2IB6 A;  4HQ9 A;  2JAD A;  3EK4 A;  4IK4 A;  4UTS A;  4DKM A;  4KEX A;  3SS0 A;  1Z1Q A;  3MGF A;  3SVB A;  1YFP A;  3BXB A;  5AQB B;  5EXU A;  4IK1 A;  2O29 A;  1ZGO A;  2ICR A;  2FL1 A;  2G2S B;  1Q4A A;  3U0M A;  4W7D A;  3A8S A;  3SVD A;  3PJB A;  4ORN A;  1XA9 A;  4HQ8 A;  2DUG A;  4J89 A;  4IK5 A;  4Q7U A;  1YHI A;  2B3Q A;  5T3I A;  1EME A;  2H5R A;  3EK7 A;  4AR7 A;  3AI5 A;  4OHS A;  3DQ3 A;  1Q4B A;  5DPI A;  1KP5 A;  1JBY A;  1GGX A;  5DPJ A;  5EB6 A;  3SG3 A;  3V3D A;  4KF4 A;  3EVU A;  5FHV A;  2C9I A;  2AWM A;  5HGE A;  3U8P A;  4JGE A;  4PPL A;  5BTT B;  4W74 A;  2GW4 B;  1HCJ A;  2HJO A;  3M24 A;  4ZIO A;  4ZB1 A;  4ZF4 A;  4JF9 A;  4B30 B;  1Z1P A;  5H89 A;  4W6S A;  2PXW A;  4KA9 A;  2RH7 A;  2A46 A;  4H47 A;  2A54 B;  4ZIN A;  3DQC A;  2Z6X A;  3NED A;  3AKO A;  3SVS A;  4KGE A;  1RMM A;  3SVC A;  4W6A A;  2QZ0 A;  3EVV A;  2IOV A;  1JBZ A;  3DQD A;  4KF5 C;  3OSR A;  4L13 A;  3DQ1 A;  2V4E B;  2POX A;  4W6C A;  4KW9 A;  3ZUJ A;  4EMQ A;  2VVI A;  5EBJ A;  5BTT A;  3ZTF A;  4Q7R A;  4LJD C;  1QXT A;  2PXS A;  2A56 B;  4W72 A;  4B30 A;  1XSS A;  3TMT A;  3U0K A;  5EHU A;  1KYS A;  2FWQ A;  4BDU A;  1QYO A; 
#chains in the Genus database with same CATH topology
 1EML A;  2YE1 A;  2EMN A;  4OJ0 A;  2DD7 A;  4Q9W A;  4J8A A;  4W76 A;  2HCG A;  5HZO A;  5BQL A;  5DRF A;  3H1O A;  2DDD A;  4IK3 A;  1B9C A;  2DD9 A;  5EXC I;  3UFZ A;  1EMM A;  4ZF5 A;  5DTZ A;  5KTG A;  3OGO A;  1GFL A;  1YZW A;  3E5T A;  4R6D A;  3DQJ A;  5EB7 A;  4AS8 A;  4W6M A;  3VHT A;  2QLH A;  4IK9 A;  3RWA A;  3SSP A;  4H3N A;  2WSN A;  2HGY A;  5FVI A;  5EJU A;  4EN1 A;  3WLD A;  3SG6 A;  4ZFS A;  4W6R A;  3DQN A;  3CGL A;  4W7R A;  2A47 A;  1GL4 A;  5LTQ A;  3VK1 A;  3CB9 A;  2QLG A;  3DQ5 A;  1KYP A;  3SG4 A;  3RWT A;  4JRB A;  1EMK A;  2Z6Z A;  2G3O A;  5DTL A;  4DXO A;  3DQ4 A;  3LA1 A;  1EMB A;  3DPW A;  3E5V A;  3SSK A;  1H6R A;  3BXA A;  3WCK A;  2H9W A;  4TZA A;  4NWS A;  2EMD A;  4L12 A;  4XVP A;  2OKW A;  5HBD A;  3U8A A;  4Q7T A;  5J2O A;  4W6B A;  2VZX A;  1Q4D A;  2AWJ A;  1ZGP A;  3LVA A;  4IK8 A;  3WLC A;  4EDS A;  5DRG A;  1RRX A;  3DQ6 A;  3NT9 A;  4W6P A;  2WHU A;  1C4F A;  1RMP A;  4PPJ A;  3O77 A;  2Z1O A;  4XOV A;  2Q57 A;  5LK4 A;  2AHA A;  3P8U A;  2A50 B;  3LVC A;  3ADF A;  1Q4C A;  2IE2 A;  3GJ2 A;  5FVF A;  3SSY A;  3DQF A;  3DQ2 A;  2YE0 A;  5HZU A;  1OXE A;  3UG0 A;  3EK8 A;  3H1R A;  5LTP A;  1JC1 A;  1KYR A;  3SG5 A;  2IB5 A;  3NF0 A;  4LJC A;  4W7F A;  4W6T A;  3ST3 A;  3LS3 A;  1JC0 A;  2AWL A;  4W73 A;  4P76 A;  1XMZ A;  3ZUL A;  1YJF A;  2HGD A;  3DQK A;  3DQO A;  3PJ5 A;  5HW9 A;  2G6E A;  3W1D A;  1MOU A;  4H48 A;  3M22 A;  5DQM A;  3DQI A;  2QLI A;  1YHG A;  2WIS A;  3DQE A;  3U0N A;  5DPH A;  1HUY A;  2B3P A;  1OXF A;  3W1C A;  2VAD A;  3DPX A;  4I2Y A;  3GEX A;  2H8Q A;  2GX0 A;  1F0B A;  3E5W A;  3I19 A;  4P1Q A;  2OKY A;  2P4M A;  2Z6Y A;  2A52 B;  1H4U A;  2G5Z B;  3NEZ A;  3DPZ A;  5DQB A;  2V4E A;  5EXB A;  2ZO6 A;  3IR8 A;  3EVR A;  2ZMW A;  3SRY A;  4GOB A;  2WUR A;  3SST A;  5H88 A;  2H5O A;  4HE4 A;  3KCT A;  3ZUF A;  3GL4 A;  4OGS A;  4W6K A;  1EMA A;  1W7S A;  4W69 A;  2G16 B;  2G6X A;  2H6V A;  4RYW A;  4DXQ A;  4DXI A;  4KPI A;  4W6J A;  4W6I A;  3P28 A;  3LSA A;  4W6F A;  4Z4K A;  1ZGQ A;  3S05 A;  2FZU A;  3DQM A;  5H87 A;  4W7X A;  2YDZ A;  3SVE A;  3SSV A;  3LVD A;  1MYW A;  4KAG A;  2QU1 A;  2H5Q A;  4DXP A;  3EKJ A;  4GES B;  2OTE A;  2V4E C;  2DUH A;  5LTR A;  3AI4 A;  4Z4M A;  3SVO A;  4W6L A;  1EMF A;  3O78 A;  3ST2 A;  4R6B A;  2HRS A;  4PPK A;  3OSQ A;  3SSH A;  1QYF A;  3BX9 A;  2G6Y A;  2Y0G A;  2DDC A;  4ZF3 A;  2DUI A;  2OTB A;  3LF4 B;  4TZG A;  3SG7 A;  2HPW A;  4DKN A;  3GB3 A;  3SVU A;  1QYQ A;  5F9G A;  4ZBL A;  2WHT A;  2G3D B;  2A48 A;  4GF6 B;  5DTX A;  3DQ7 A;  4IZN A;  1XAE A;  1G7K A;  2ARL A;  4W75 A;  1MOV A;  2H5P A;  3NT3 A;  4W7C A;  3CFA A;  2Q6P A;  2WHS A;  3DQ8 A;  5DU0 A;  5DTY A;  5HZS A;  1W7T A;  4KF5 A;  4XOW A;  1CV7 A;  4OY4 A;  3SVR A;  4LJB A;  4DXN A;  2HQZ A;  2ZO7 A;  2VVJ A;  2QT2 A;  4LJD A;  1F09 A;  3PJ7 A;  2AH8 A;  2OGR A;  2VAE A;  4RTC A;  4W6U A;  3K1K A;  4W6D A;  4LW5 A;  3VIC A;  2GX2 A;  3CD1 A;  2O24 A;  2OJK A;  1BFP A;  3LF3 A;  2GW3 A;  4N3D A;  3DQ9 A;  3ST0 A;  4KW8 A;  1OXD A;  3CD9 A;  2EMO A;  4JFG A;  5BT0 A;  2C9J A;  3ED8 A;  3EVP A;  4W6G A;  4KW4 A;  4RYS A;  4LQU A;  5FVG A;  1YJ2 A;  4XL5 A;  4W77 A;  4W7E A;  3PIB A;  2YFP A;  2DUE A;  3DQH A;  4HVF A;  3SSL A;  3TMR A;  1UIS A;  3DQA A;  2WSO A;  3GJ1 A;  3CFF A;  1ZUX A;  4H3M A;  3EKH A;  2HQK A;  4EUL A;  3G9A A;  3BXC A;  3VHT B;  5DY6 A;  1Q4E A;  3DQL A;  4U2V A;  4W6N A;  3CBE A;  1YHH A;  4KGF A;  1EMG A;  2ZMU A;  4L1I A;  2HFC A;  2O2B A;  4JEO A;  5HZT A;  4ANJ A;  3DQU A;  3IP2 A;  4B5Y A;  1Q73 A;  1W7U A;  3SG2 A;  1QY3 A;  2QLE A;  2QLG B;  2WIQ A;  3SV5 A;  2A53 B;  4OQW A;  2DUF A;  4XGY A;  3CFH A;  4J88 A;  2QRF A;  3SVN A;  2AWK A;  4W6O A;  4DXM A;  5DPG A;  4EDO A;  2BTJ A;  4LQT A;  1RM9 A;  4W7A A;  1S6Z A;  4PFE A;  2VVH A;  4HQC A;  4JC2 A;  3ST4 A;  1XQM A;  4H3L A;  4W6H A;  3KCS A;  3U0L A;  4Q9X A;  3U8C A;  1RMO A;  1EMC A;  2IB6 A;  4HQ9 A;  2JAD A;  3EK4 A;  4IK4 A;  4UTS A;  4DKM A;  4KEX A;  3SS0 A;  1Z1Q A;  3MGF A;  3SVB A;  1YFP A;  3BXB A;  5AQB B;  5EXU A;  4IK1 A;  2O29 A;  1ZGO A;  2ICR A;  2FL1 A;  2G2S B;  1Q4A A;  3U0M A;  4W7D A;  3A8S A;  3SVD A;  3PJB A;  4ORN A;  1XA9 A;  4HQ8 A;  2DUG A;  4J89 A;  4IK5 A;  4Q7U A;  1YHI A;  2B3Q A;  5T3I A;  1EME A;  2H5R A;  3EK7 A;  4AR7 A;  3AI5 A;  4OHS A;  3DQ3 A;  1Q4B A;  5DPI A;  1KP5 A;  1JBY A;  1GGX A;  5DPJ A;  5EB6 A;  3SG3 A;  3V3D A;  4KF4 A;  3EVU A;  5FHV A;  2C9I A;  2AWM A;  5HGE A;  3U8P A;  4JGE A;  4PPL A;  5BTT B;  4W74 A;  2GW4 B;  1HCJ A;  2HJO A;  3M24 A;  4ZIO A;  4ZB1 A;  4ZF4 A;  4JF9 A;  4B30 B;  1Z1P A;  5H89 A;  4W6S A;  2PXW A;  4KA9 A;  2RH7 A;  2A46 A;  4H47 A;  2A54 B;  4ZIN A;  3DQC A;  2Z6X A;  3NED A;  3AKO A;  3SVS A;  4KGE A;  1RMM A;  3SVC A;  4W6A A;  2QZ0 A;  3EVV A;  2IOV A;  1JBZ A;  3DQD A;  4KF5 C;  3OSR A;  4L13 A;  3DQ1 A;  2V4E B;  2POX A;  4W6C A;  4KW9 A;  3ZUJ A;  4EMQ A;  2VVI A;  5EBJ A;  5BTT A;  3ZTF A;  4Q7R A;  4LJD C;  1QXT A;  2PXS A;  2A56 B;  4W72 A;  4B30 A;  1XSS A;  3TMT A;  3U0K A;  5EHU A;  1KYS A;  2FWQ A;  4BDU A;  1QYO A; 
#chains in the Genus database with same CATH homology
 1EML A;  2YE1 A;  2EMN A;  4OJ0 A;  2DD7 A;  4Q9W A;  4J8A A;  4W76 A;  2HCG A;  5HZO A;  5BQL A;  5DRF A;  3H1O A;  2DDD A;  4IK3 A;  1B9C A;  2DD9 A;  5EXC I;  3UFZ A;  1EMM A;  4ZF5 A;  5DTZ A;  5KTG A;  3OGO A;  1GFL A;  1YZW A;  3E5T A;  4R6D A;  3DQJ A;  5EB7 A;  4AS8 A;  4W6M A;  3VHT A;  2QLH A;  4IK9 A;  3RWA A;  3SSP A;  4H3N A;  2WSN A;  2HGY A;  5FVI A;  5EJU A;  4EN1 A;  3WLD A;  3SG6 A;  4ZFS A;  4W6R A;  3DQN A;  3CGL A;  4W7R A;  2A47 A;  1GL4 A;  5LTQ A;  3VK1 A;  3CB9 A;  2QLG A;  3DQ5 A;  1KYP A;  3SG4 A;  3RWT A;  4JRB A;  1EMK A;  2Z6Z A;  2G3O A;  5DTL A;  4DXO A;  3DQ4 A;  3LA1 A;  1EMB A;  3DPW A;  3E5V A;  3SSK A;  1H6R A;  3BXA A;  3WCK A;  2H9W A;  4TZA A;  4NWS A;  2EMD A;  4L12 A;  4XVP A;  2OKW A;  5HBD A;  3U8A A;  4Q7T A;  5J2O A;  4W6B A;  2VZX A;  1Q4D A;  2AWJ A;  1ZGP A;  3LVA A;  4IK8 A;  3WLC A;  4EDS A;  5DRG A;  1RRX A;  3DQ6 A;  3NT9 A;  4W6P A;  2WHU A;  1C4F A;  1RMP A;  4PPJ A;  3O77 A;  2Z1O A;  4XOV A;  2Q57 A;  5LK4 A;  2AHA A;  3P8U A;  2A50 B;  3LVC A;  3ADF A;  1Q4C A;  2IE2 A;  3GJ2 A;  5FVF A;  3SSY A;  3DQF A;  3DQ2 A;  2YE0 A;  5HZU A;  1OXE A;  3UG0 A;  3EK8 A;  3H1R A;  5LTP A;  1JC1 A;  1KYR A;  3SG5 A;  2IB5 A;  3NF0 A;  4LJC A;  4W7F A;  4W6T A;  3ST3 A;  3LS3 A;  1JC0 A;  2AWL A;  4W73 A;  4P76 A;  1XMZ A;  3ZUL A;  1YJF A;  2HGD A;  3DQK A;  3DQO A;  3PJ5 A;  5HW9 A;  2G6E A;  3W1D A;  1MOU A;  4H48 A;  3M22 A;  5DQM A;  3DQI A;  2QLI A;  1YHG A;  2WIS A;  3DQE A;  3U0N A;  5DPH A;  1HUY A;  2B3P A;  1OXF A;  3W1C A;  2VAD A;  3DPX A;  4I2Y A;  3GEX A;  2H8Q A;  2GX0 A;  1F0B A;  3E5W A;  3I19 A;  4P1Q A;  2OKY A;  2P4M A;  2Z6Y A;  2A52 B;  1H4U A;  2G5Z B;  3NEZ A;  3DPZ A;  5DQB A;  2V4E A;  5EXB A;  2ZO6 A;  3IR8 A;  3EVR A;  2ZMW A;  3SRY A;  4GOB A;  2WUR A;  3SST A;  5H88 A;  2H5O A;  4HE4 A;  3KCT A;  3ZUF A;  3GL4 A;  4OGS A;  4W6K A;  1EMA A;  1W7S A;  4W69 A;  2G16 B;  2G6X A;  2H6V A;  4RYW A;  4DXQ A;  4DXI A;  4KPI A;  4W6J A;  4W6I A;  3P28 A;  3LSA A;  4W6F A;  4Z4K A;  1ZGQ A;  3S05 A;  2FZU A;  3DQM A;  5H87 A;  4W7X A;  2YDZ A;  3SVE A;  3SSV A;  3LVD A;  1MYW A;  4KAG A;  2QU1 A;  2H5Q A;  4DXP A;  3EKJ A;  4GES B;  2OTE A;  2V4E C;  2DUH A;  5LTR A;  3AI4 A;  4Z4M A;  3SVO A;  4W6L A;  1EMF A;  3O78 A;  3ST2 A;  4R6B A;  2HRS A;  4PPK A;  3OSQ A;  3SSH A;  1QYF A;  3BX9 A;  2G6Y A;  2Y0G A;  2DDC A;  4ZF3 A;  2DUI A;  2OTB A;  3LF4 B;  4TZG A;  3SG7 A;  2HPW A;  4DKN A;  3GB3 A;  3SVU A;  1QYQ A;  5F9G A;  4ZBL A;  2WHT A;  2G3D B;  2A48 A;  4GF6 B;  5DTX A;  3DQ7 A;  4IZN A;  1XAE A;  1G7K A;  2ARL A;  4W75 A;  1MOV A;  2H5P A;  3NT3 A;  4W7C A;  3CFA A;  2Q6P A;  2WHS A;  3DQ8 A;  5DU0 A;  5DTY A;  5HZS A;  1W7T A;  4KF5 A;  4XOW A;  1CV7 A;  4OY4 A;  3SVR A;  4LJB A;  4DXN A;  2HQZ A;  2ZO7 A;  2VVJ A;  2QT2 A;  4LJD A;  1F09 A;  3PJ7 A;  2AH8 A;  2OGR A;  2VAE A;  4RTC A;  4W6U A;  3K1K A;  4W6D A;  4LW5 A;  3VIC A;  2GX2 A;  3CD1 A;  2O24 A;  2OJK A;  1BFP A;  3LF3 A;  2GW3 A;  4N3D A;  3DQ9 A;  3ST0 A;  4KW8 A;  1OXD A;  3CD9 A;  2EMO A;  4JFG A;  5BT0 A;  2C9J A;  3ED8 A;  3EVP A;  4W6G A;  4KW4 A;  4RYS A;  4LQU A;  5FVG A;  1YJ2 A;  4XL5 A;  4W77 A;  4W7E A;  3PIB A;  2YFP A;  2DUE A;  3DQH A;  4HVF A;  3SSL A;  3TMR A;  1UIS A;  3DQA A;  2WSO A;  3GJ1 A;  3CFF A;  1ZUX A;  4H3M A;  3EKH A;  2HQK A;  4EUL A;  3G9A A;  3BXC A;  3VHT B;  5DY6 A;  1Q4E A;  3DQL A;  4U2V A;  4W6N A;  3CBE A;  1YHH A;  4KGF A;  1EMG A;  2ZMU A;  4L1I A;  2HFC A;  2O2B A;  4JEO A;  5HZT A;  4ANJ A;  3DQU A;  3IP2 A;  4B5Y A;  1Q73 A;  1W7U A;  3SG2 A;  1QY3 A;  2QLE A;  2QLG B;  2WIQ A;  3SV5 A;  2A53 B;  4OQW A;  2DUF A;  4XGY A;  3CFH A;  4J88 A;  2QRF A;  3SVN A;  2AWK A;  4W6O A;  4DXM A;  5DPG A;  4EDO A;  2BTJ A;  4LQT A;  1RM9 A;  4W7A A;  1S6Z A;  4PFE A;  2VVH A;  4HQC A;  4JC2 A;  3ST4 A;  1XQM A;  4H3L A;  4W6H A;  3KCS A;  3U0L A;  4Q9X A;  3U8C A;  1RMO A;  1EMC A;  2IB6 A;  4HQ9 A;  2JAD A;  3EK4 A;  4IK4 A;  4UTS A;  4DKM A;  4KEX A;  3SS0 A;  1Z1Q A;  3MGF A;  3SVB A;  1YFP A;  3BXB A;  5AQB B;  5EXU A;  4IK1 A;  2O29 A;  1ZGO A;  2ICR A;  2FL1 A;  2G2S B;  1Q4A A;  3U0M A;  4W7D A;  3A8S A;  3SVD A;  3PJB A;  4ORN A;  1XA9 A;  4HQ8 A;  2DUG A;  4J89 A;  4IK5 A;  4Q7U A;  1YHI A;  2B3Q A;  5T3I A;  1EME A;  2H5R A;  3EK7 A;  4AR7 A;  3AI5 A;  4OHS A;  3DQ3 A;  1Q4B A;  5DPI A;  1KP5 A;  1JBY A;  1GGX A;  5DPJ A;  5EB6 A;  3SG3 A;  3V3D A;  4KF4 A;  3EVU A;  5FHV A;  2C9I A;  2AWM A;  5HGE A;  3U8P A;  4JGE A;  4PPL A;  5BTT B;  4W74 A;  2GW4 B;  1HCJ A;  2HJO A;  3M24 A;  4ZIO A;  4ZB1 A;  4ZF4 A;  4JF9 A;  4B30 B;  1Z1P A;  5H89 A;  4W6S A;  2PXW A;  4KA9 A;  2RH7 A;  2A46 A;  4H47 A;  2A54 B;  4ZIN A;  3DQC A;  2Z6X A;  3NED A;  3AKO A;  3SVS A;  4KGE A;  1RMM A;  3SVC A;  4W6A A;  2QZ0 A;  3EVV A;  2IOV A;  1JBZ A;  3DQD A;  4KF5 C;  3OSR A;  4L13 A;  3DQ1 A;  2V4E B;  2POX A;  4W6C A;  4KW9 A;  3ZUJ A;  4EMQ A;  2VVI A;  5EBJ A;  5BTT A;  3ZTF A;  4Q7R A;  4LJD C;  1QXT A;  2PXS A;  2A56 B;  4W72 A;  4B30 A;  1XSS A;  3TMT A;  3U0K A;  5EHU A;  1KYS A;  2FWQ A;  4BDU A;  1QYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...