3SSNA

Myce methyltransferase from the mycinamycin biosynthetic pathway in complex with mg, sah, and mycinamycin vi
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
390
structure length
386
Chain Sequence
EFDEATVQDVVRLAGGHDSELRELTQKYDPAMISRLLVAEILSRCPPPSNDTPVLVELAIVHGSERFRHFLRVVRDSPIRPVGADEGFVGMLVEYELTELLRELFGVTHERPAGVRGTKLFPYLTDDEEAVEQIGTYLLAAQQGTEAVLAGCGSRKPDLSELSSRYFTPKFGFLHWFTPHYDRHFRDYRNQQVRVLEIGVGGYKHPEWGGGSLRMWKSFFPRGQIYGLDIMDKSHVDELRIRTIQGDQNDAEFLDRIARRYGPFDIVIDDGSHINAHVRTSFAALFPHVRPGGLYVIEDMWTAYWPGFGGQADPQECSGTSLGLLKSLIDAIQHQELPSSPGYVDRNIVGLHVYHNVAFVEKGRNDEGGIPTWIPRDFESLVQASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
pubmed doi rcsb
source organism Micromonospora griseorubida
molecule tags Transferase/antibiotic
molecule keywords Methyltransferase
total genus 131
structure length 386
sequence length 390
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.238: Mycinamicin VI 2''-O-methyltransferase.
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17843 MycE_N MycE methyltransferase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.30 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A Nonspecific Lipid-transfer Protein; Chain A 3ssnA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ssnA02
1QAQA 5DM0A 3GRUA 1MHTA 4PYLA 2ZZMA 1XDUA 3FRHA 2PJDA 1BC5A 5CD1A 2QYOA 2P7HA 5CVUA 3EVFA 1I9GA 2AS0A 2PWYA 1NE2A 4QVGA 5ICGA 2XYVA 4PCLA 2CWWA 4P7GA 5HOQA 2ZW9A 5F2KA 3FUUA 2AR0A 4IV0A 2OY0A 3SX0A 3T7RA 5EIWA 2BR5A 3AXTA 3GJYA 4FP9A 3G2PA 1B42A 3KQWA 1G8AA 4V0RA 5ICEA 2ZIGA 3CJTA 4RTJA 5K0GA 3SSNA 2ZBRA 3M70A 3E8SA 4DF3A 2P1DA 3MQ2A 3IV6A 4C4AA 3GIWA 4CKEA 2N47A 4GOND 2HWKA 5DLYA 3GGDA 3A25A 3LBYA 2IH2A 4HC4A 3M4XA 2BR4A 2P3QA 5MHTA 4PYOA 2EX4A 5E8RA 3DMFA 4E31A 4M38A 1SKMA 1IXKA 2B25A 3P71T 5HIKA 2QRVB 4M36A 3PFHA 1L1EA 3EVZA 3C3YA 3MGGA 2P3LA 3T0IA 5CUQA 2Z6UA 2AN4A 3HNRA 2G8NA 2OB1A 1R00A 2XBMA 3FRIA 1INLA 2IGTA 3BKXA 3TQSA 5GP1A 5KQSA 5IH3A 3DLCA 2WK1A 3ELUA 3E23A 4AZSA 3B3GA 3DR5A 3LL7A 5EHIA 3UJ9A 3KR9A 3GWZA 5EKXA 1AV6A 4KWCA 2HNKA 2ZWVA 2AOUB 3IEIA 3WSTA 5JUWA 3HCDA 4CTKA 2ONYA 4P7KA 4HH4A 2GAFA 1KYWA 3A7EA 5E1DA 5F2OA 5P8WA 1YFJA 1RJDA 2EJTA 2PGXA 4PGGA 3THSA 2G70A 2YUIA 3TM4A 5KQRA 1SQFA 3OFKA 4XUDA 5K8VA 4YUWA 1JG1A 2I6GA 4HG2A 5K0NA 1P1CA 2EJUA 2I62A 2OB2A 3OPNA 4CWAA 4CXMA 3FTEA 3FTFA 2CMHA 3SMQA 2H11A 3G2OA 1BKYA 4FT4A 4OBWA 3B3FA 1JQDA 3A7DA 4X41A 2AOUA 2QY6A 4EMSA 3KQOA 3KQQA 1RI4A 1WY7A 4C05A 1VE3A 4GUAA 3LKZA 2PSSA 3KQSA 4C08A 2UYCA 3T7SA 5DWQA 5KVAA 1G60A 2AVNA 3P9IA 3CJQA 4XCXA 3ER9A 3KR0A 2O05A 2H00A 1VBFA 1WZNA 4KDCA 5FUBA 4ISCA 5CIYA 5T67A 1WG8A 1KXZA 3KQVA 3BWBA 3FPGA 4MQ4A 2PT6A 2IH5A 5K09A 3FPJA 5E2AA 1JG2A 1DUSA 2HV9A 2VP3A 1G55A 2JHCA 1L3BA 2PXXA 3CKKA 3JWIA 2IDJA 3FUXA 2NYUA 3EVDA 3KPUA 3C6MA 3VYWA 1N7JA 4QQKA 3E7PA 3SXJA 3UZUA 2E5WA 5HEKA 4XUEA 3NWEA 3DTNA 1N7IA 1ZQ9A 2B78A 3LCCA 3OFJA 3EGVA 2PWPA 4RTQA 3OCJA 3D2LA 2JHPA 4PINA 5GWXA 3OE5A 5EOVA 5BP7A 5FA8A 1ZKDA 2YVLA 3ANXA 2P40A 5BW4A 1V39A 3ORHA 4YV1A 2IBSA 2GS9A 3R6TA 4PIPA 3G8AA 3UJ8A 1SUIA 2AOTA 3KHKA 4KDRA 4KW7A 5HIIA 3L8DA 3DULA 2ZULA 4PYQA 3UBTA 2C7OA 1P39A 4Y2HA 2QE6A 5FQNA 2ZBQA 3MTEA 2PXAA 1QYRA 3Q87B 3NWBA 1MJFA 5FHRA 1QAMA 2ESRA 2ZBPA 3G5TA 2HR1A 3TOSA 3PB3A 5FWDA 5B1SA 1JR4A 2IPXA 3SVZA 3ELWA 3OU6A 3AWIA 1YZHA 2AVDA 5GM1A 3A26A 1ORHA 1ORIA 3SGLA 5DM2A 2YXDA 1KYZA 5ERGB 3P9KA 2NXJA 3FYDA 3SSOA 1U2ZA 3DH0A 2BM8A 3REOA 3SM3A 3P2EA 1KPGA 2PV0A 3CJRA 2B9EA 2OKCA 3X0DA 4C04A 2JJQA 5EEHA 4BLVA 5IKMA 5E9JA 2DPMA 2PT9A 3GRYA 3LDGA 2JHAA 1KHHA 3EEYA 3BWCA 2WA1A 2ZWAA 3NVMB 1L9KA 2Z6AA 4WVLA 2G1PA 3KQPA 1EJ6A 2FK8A 4BP1A 3VC2A 3P97A 1D2GA 2B2CA 3KR1A 9MHTA 4FS8A 1XJ5A 1VLMA 3JWJA 4PWYA 4Y30A 4QQNA 4BP3A 1OR8A 4F86A 5GINE 2I7CA 4E32A 4MHTA 3AXSA 3BT7A 1VIDA 2OO3A 4GC9A 3V8VA 2UYOA 4F85A 1UFKA 4PGHA 3EVBA 5EMKA 5BXYA 3V97A 1M0EA 2XYRA 4E30A 2NXCA 2PVCA 4RTPA 3HTXA 5CCXA 1XXLA 5DX1A 4ER6A 2FHPA 3EVEA 3HCAA 2AN5A 4R8SA 5EIFA 3FUVA 3MB5A 5GOZA 5ICFA 4EKIA 2HTEA 3O31A 3JWHA 2OZVA 3F4KA 1XDZA 2NNWB 1R8XA 1ZHFA 4F84A 4RTSA 3G8BA 2R3SA 1FPQA 3RODA 1FJXA 2V7EA 3LX6A 4RWZA 2AOVA 2V74B 2I9KA 3DMGA 4X60A 4MTLA 4ER0A 3R24A 5EHGA 4OQDA 3JWGA 2BM9A 3G7UA 3MCTA 1Y8CA 3NJRA 3TRKA 5LQJA 4EVIA 3EVGA 1AQIA 1R6AA 3FYCA 4ER3A 1WXXA 3ERCA 4JXJA 2VDVE 2EFJA 2ZFUA 1JSXA 1M6EX 1F3LA 1R8YA 3MTIA 2P35A 1RJFA 4DA4A 1I4WA 1IM8A 2ZVJA 3QOWA 3OU7A 5C1IA 4YUXA 1YB2A 4YV2A 1FP2A 3PX2A 4GBED 3O4FA 4HSGA 5EPEA 4FR0A 4E2XA 5K05A 1ZG3A 4E2YA 5F2NA 3EEOA 2HMYB 2DULA 3U81A 4CTJA 3MHTA 4PYMA 4HGYA 3G2QA 1SUSA 2A14A 3A4TA 3RW9A 3TKYA 3NMUF 4RVHA 4GOMD 4LG1A 4GF5A 3CBGA 1KPIA 5DTRA 1YZ3A 5EZQA 3R9XB 2O06A 3HA3A 1NKVA 1NV9A 3IHTA 3UJBA 1FP1D 1BOOA 2YQZA 2P41A 2ZSUA 3BZBA 3H2BA 3QOXA 5DTQA 5E9WA 5HIJA 4PYNA 3MERA 2WA2A 5KS2A 3HCFA 1R74A 2H1RA 5GIPE 1DCTA 3EMDA 3O7WA 5HILA 3KKZA 4QDJA 2JG3A 2O0LA 5D1NA 3LSTA 5JR3A 2FPOA 3LGAA 5EMJA 1RJEA 3R0QA 2C7QA 3BKWA 4OBXA 5CM2Z 4CKBA 4HTFB 3B89A 3E05A 2PBFA 1EG2A 1VL5A 2XYQA 1XCLA 3BUSA 4DQ0A 5FQOA 3HA7A 4M37A 5H02A 1FBNA 3RIEA 2FCAA 3TKAA 1N2XA 3BXOA 4EQZA 5K01A 1WS6A 3P2KA 4RTNA 3OZRA 3TLJA 3CVOA 3KPWA 4YMHA 4RTMA 5HZMA 5EQJB 2O07A 3BGVA 2VDWA 3LKDA 1X1DA 4FSDA 1Q0SA 4V0QA 3DLIA 4KVZA 3I58A 3Q7EA 3GRRA 2ZCJA 5CVEA 4KIGA 1O9GA 3GU3A 5EZSA 4ER5A 4RX1A 2CMGA 3LDUA 4H0NA 3NTVA 4DMGA 2QM3A 4RTRA 4UOEA 2P7IA 4KIFA 2K4MA 2IIPA 3HCEA 3FUTA 1JG4A 4P7JA 4C03A 4GOOD 4PIMA 4ER7A 4FGZA 4R6WA 3GXOA 2XVAA 1JTFA 2PXCA 3UA4A 2O57A 3HVHA 3DXXA 5FCDA 5K0LA 5EMMA 4GOLD 2ZTHA 1TPYA 2Y1WA 1YUBA 2YXEA 4KRGA 3DOUA 3KQYA 4E33A 4DZRA 3LCUA 3TR6A 5DTMA 2PY6A 2NP7A 5FHQA 3NVKI 3M6XA 5FTWA 4X63A 5DX8A 5K0CA 2UYHA 1RI1A 4HGZA 1Z3CA 2FYTA 2ZZKA 5FA5A 5M5BA 5LSAA 5E1OA 3EVAA 4RTLA 2BH2A 1ZGJA 4U7TB 1EJ0A 1F38A 3FTDA 1ZGAA 3NDJA 4IKPA 4B17A 2Q41A 4R8RA 2Y1XA 3FUWA 2PKWA 1P1BA 4O29A 3PLAE 1AQJA 2IH4A 2NP6A 5GM2A 3AY0A 5LR6A 1TW2A 3NW9A 3G5LA 1NV8A 1NBIA 2CL5A 4RVDA 3LCVB 5DM4A 3SR4A 4POOA 3C3PA 5K03A 2VS1A 1I1NA 1X1BA 3ME5A 4QDKA 1G6Q1 2XVMA 5CVJA 2C7RA 5C9ZA 2VDUE 3UJCA 4PYIA 5CVVA 3ELDA 4YUZA 4CKCA 5EC8A 1RI5A 3FPFA 3I53A 1KIAA 4YUYA 3G88A 5EGSA 5K0JA 3EVCA 1D2HA 3EGIA 2YX1A 3KPJA 3P9CA 3HP7A 4A6EA 3G2MA 4ATNA 4BY9E 4PCAA 4RVFA 2JH8A 1EIZA 1R18A 1JSZA 1X1CA 4LWPA 5EKUA 4DCGA 2YXLA 3BWYA 2P8JA 2YR0A 1WXWA 4E70A 1EQAA 1DL5A 2P3OA 1XDSA 4DKJA 3MCZA 4BLWA 2ADMA 3CCFA 3M6WA 1JQ3A 4A6DA 4OQEA 2NXEA 5LQAA 1PJZA 5LQNA 3LDFA 4RVGA 1KR5A 3UJDA 1VP9A 2GA9A 3KPYA 1SQGA 4MWZA 4OA8A 4C06A 4YV0A 5LQRA 4AZTA 3ER8A 3FTCA 2IP2A 1KP9A 3DXZA 5DRYA 4K6MA 1IY9A 1NBHA 2BZGA 2AOTB 2YTZA 2F8LA 3HM2A 2UZ4A 5FWAA 1SVUA 3OE4A 3ELYA 2B3TA 1QAOA 4QTTB 4EK9A 4HRAA 2IBTA 2LD4A 5FULA 3GRZA 3ID6C 3UJ7A 4EKGA 4FSXA 1KPHA 4P7FA 3VSEA 4RTOA 2G71A 3THRA 4X1OA 2PLWA 3GDHA 4ZTBA 2PX2A 1JG3A 3LBFA 4YMGA 1EAMA 3EGEA 2PX8A 4QTUB 3TPZA 3GRVA 3T7TA 3DXYA 4G56A 4E2WA 3KU1A 4HTFA 1SG9A 5FADA 1G38A 1NT2A 3DUWA 5LQCA 4QVKA 1JQEA 3UJ6A 5ICCA 1NW3A 5LQKA 4IWNA 3OZSA 5DXAA 4AZWA 1PRYA 2VZ9A 4E2ZA 5BW5A 4PNEA 1VP3A 5GIOE 1BHJA 3B5IA 5U4XA 3KR2A 1VPTA 3I9FA 2OXTA 1RI2A 5DX0A 3UJAA 1M6YA 3PS9A 5E1BA 5E1MA 5DSTA 1G8SA 1X1AA 3QV2A 1NW7A 3LHDA 4R6XA 1XCJA 3EPPA 3P2IA 4GQBA 3A27A 4DCMA 4GEKA 5E9QA 2JH9A 5EEGA 1HMYA 3HEMA 4U7PB 3TFWA 3K0BA 3P8ZA 4XUCA 4AX8A 5LQUA 1VQ1A 5K0EA 1QANA 3CC8A 3TM5A 2CKDA 3B3JA 3C0KA 1NW6A 1H1DA 4OA5A 5DM1A 2OBFA 3M33A 3MAGA 2ONZA 3S68A 4C07A 1YFLA 1O54A 3I64A 5HIMA 4AZVA 5G02A 3OU2A 3IYLW 4FZVA 4QPPA 3M6VA 2AOWA 1L3CA 3GNLA 5DSXA 4YUVA 1JTEA 3G89A 3R3HA 1D2CA 3UFBA 1L3IA 2EG5A 3CGGA 5E2BA 4L7VA 2GPYA 3UWPA 4MIKA 5T6BA 3GCZA 3FPEA 1HNNA 3BGIA 2IDKA 5C0OE 2AOXA 1P91A 4QPNA 5EVJA 3PTAA 3AJDA 2KW5A 3KPVA 2ERCA 3PT9A 4IV8A 4PONA 5T64A 2OYRA 3TMAA 1Q0TA 5KYGA 1NW5A 2NXNA 3BWMA 1QZZA 3HCCA 5EG5A 2PX4A 2BR3A 2IFTA 1UIRA 3PVCA 4DM3A 4FT2A 4BLUA 1RI3A 4NECA 3BGDA 2R6ZA 3HA5A 4AUKA 10MHA 3EMBA 4P58A 2FK7A 5DRTA 2UYQA 4WXHA 3C6KA 2AZTA 2ZLBA 1T43A 2Z6QA 1TW3A 3M6UA 3UA3A 4LECA 3OZTA 3FPHA 3FZGA 1NW8A 5CVDA 3HVKA 4OX9Y 4PYJA 2FRXA 1X19A 3PX3A 4PYKA 3VC1A 3HVIA 3PFGA 4R05A 5DXJA 3B7PA 3LPMA 8MHTA 3NDIA 1XVAA 3GO4A 2QRVA 4RV9A 5D1HA 2ORED 3I5UA 2GB4A 2C7PA 3HCBA 1AF7A 2ZZNA 3KQTA 3K6RA 2PX5A 3HVJA 3KQMA 3DMHA 5DPMA 5E8JA 1XTPA 4M7RA 1RJGA 2ZIEA 2ZIFA 3P9NA 4RSRA 4GC5A 5DT2A 2G72A 1O9HA 3SSMA 4RYLA 5K0BA 4X61A 2AN3A 5CCBA 5EMLA 4RTKA 7MHTA 3DP7A 1YF3A 2GH1A 5HFJA 3LECA 4Z2YA 2GLUA 4LWOA 2OPBA 1UWVA 5K0FA
chains in the Genus database with same CATH superfamily
3VOSA 3PC2A 4DJEC 1GHTA 5IN5A 1XDUA 1VC2A 3G9UA 3I4CA 3QU5A 1Q15A 4H7DA 3ZYZA 5FV4A 1KYVA 3UCEA 2A57A 3BMCB 4HQRA 3ANTA 2V03A 5FPYA 3ULKA 2WUFA 1NFQA 3IRVA 4KN6A 3AHGA 4Q5IA 1T2VA 4V24A 1QRDA 1SUEA 2RGYA 5J23A 4TMZA 1R8JA 2FTKE 3N2GB 1O0SA 4MGZR 3AXTA 3E9QA 5A06A 1SUPA 4MWGA 4BVAA 4DA9A 2TRSB 4M3NA 3VISA 4EX6A 2AD5A 5CXUA 1R3DA 1QIEA 2PUFA 1CNMA 1MMFB 5C37A 5CEFA 5TVGA 4DLZA 2ZSFA 3IV6A 1G8HA 4ZVLA 1PZ4A 3NOVA 5JJCA 3LX8A 3LBYA 1BQEA 2WBLC 5LXTF 1WVIA 5MHTA 4FW9A 4M6WA 2FXVA 1AXEA 5B4UA 1EEXB 1KAGA 1JV2B 4R1PA 4LV6A 1PWYE 2E6KA 1QHIA 1T0BA 3NUGA 1NVVQ 3M5WA 2P9HA 1G3RA 4IJWA 1DVRA 1XI2A 1KMQA 1H2FA 1OILA 3GG2A 4HN2A 1E7MA 1SPBS 2HT6A 4OHWA 1E5VA 4PGMA 2XY4A 4JDPA 3H11B 4A1FA 1VE1A 1RFLA 2ZYHA 3A6ZA 1WETA 3RT9A 5JXHA 3KOOA 3KKQA 4IO1A 3NVAA 1DT3A 1DMRA 5EMHA 1U7PA 2RGXA 5HFAA 4HNUA 1CF2O 1YVRA 1JR6A 2AWNA 5DV9A 2JHFA 4YYEA 2G5TA 2WVHA 3J81k 2C31A 1I1OA 3X1XA 4BDSA 3TLBA 1NKTA 5EL0A 3GFRA 1H2RS 4K3UA 1NW9B 2P6NA 2WIKA 3IOCA 3FFAA 2QRZA 3SJCA 4ZK2A 1IBSA 1Z0AA 4PGGA 5DMXA 2X9QA 3NHBA 3PWTA 5SY6A 4ZGWA 2C2OA 1XF1A 3PBKA 3SZRA 1UBHS 5D7BA 2I62A 5ED4A 1G17A 4OL0A 4AJ2A 2F7SA 4UEQA 2NV6A 3WGHA 4M0CA 2CWDA 2HC9A 5LZ5A 2PUAA 2OXCA 1NDUA 2VA9A 4LDRA 4KHPB 2P30A 2ZWPA 1W1UA 3KQOA 5KKAA 5AT1A 3ZOZA 1ZC4A 1WV0A 3KJFA 1UXGA 5EWLB 5EJAA 3CB2A 1KE1A 1DTWA 1RPNA 3W5UA 4I3HA 2JJ8A 3RYTC 2XYPA 1ODCA 2ZUEA 4D4KA 5DWQA 3ETEA 4UU8A 1BWRA 2ZJ1A 3P9IA 5JFOA 4FCVA 3IAM1 5G4LA 2I33A 2O4UX 1SHJA 2QRJA 3M4NA 3FSRA 5KTOA 1VBFA 3IR5A 2OSVA 2ZRMA 3N2KB 1CDZA 1SWWA 5JYCA 4JWTA 4D02A 1MUUA 3B6IA 4NCKA 3WLEA 1RRCA 4D9FA 5GQSA 2IDJA 2IHNA 2NYUA 3IP7A 3NCTA 3R3XA 2EQBA 1N7JA 3ZDDA 1QTQA 3F5DA 3IAS6 2R11A 3R0JA 1EFAA 4XSVA 1GGNA 3I2FA 4I1IA 4RJIA 3EGVA 4ZODA 3RFXA 1IEQA 4F60A 2YH2A 2PBLA 1PGOA 2YHIB 3E3OA 3PXGA 1PL6A 1BFDA 4FYWA 3W3ZB 1CR2A 1I10A 2CLLB 4DAEA 3ZQ4A 5CHEA 4LJLA 2O6HA 1W25A 3KJGA 3G8AA 4B2YA 1N6HA 4YRZA 4DV7B 2AOTA 3JVIA 1LUAA 3LPAA 4JVMA 4KW7A 4A2PA 4UBNA 4A26A 1N2CE 1Y8RB 1L7BA 4C7OB 2XBLA 3DFFA 1R0WA 1DCKA 1LI4A 1M67A 3GI1A 1DKPA 3NP7A 3UPDA 1T5DX 3TCKA 1VJ1A 1FFSA 2ZDQA 2PFGA 4HYEA 3T9CA 4D92A 5KVVA 5EHNA 2GAOA 3GW8A 1YZHA 2V96A 1EK5A 3HGTA 1E1QD 1C7JA 1DTWB 2J6HA 4ZEWA 2VUTA 4PLVA 3NB0A 2XW6A 3FYDA 3P5BA 3HUFA 3REOA 3VPDA 3LT5A 4N76A 1JHDA 2WSYB 1JN0A 2GPSA 3AM4A 2JAQA 4JBWA 1Z25A 5BUZA 1G8YA 3HACA 2G8LA 5C5IA 4JITA 2G1JA 4A0GA 4E08A 2EZ9A 3QQ5A 1C1DA 5FUWA 1JHAA 3N87A 3QIVA 1K5PA 4LYAA 4G4SP 2V1XA 1JLHA 1NTRA 5U4QA 3AF4A 3WWZA 4FBLA 3P97A 5CLGA 4BAZA 4GM4A 1D4OA 2X7JA 1SQSA 2I3GA 1DIBA 3EA0A 2D2EA 4K9QA 4P3KA 3PHBE 3VYRB 2JEYA 4HEJA 1LJLA 4TMTA 2W90A 3UHPA 1VLMA 3EB9A 3HH8A 1BE6A 3Q0IA 2PVPA 3VTZA 4JZKA 3WKCA 1CY8A 4ENTA 3OIFA 3AXSA 2OO3A 4KLNA 2H31A 3O8OB 3QPCA 4WKBA 1EXVA 4G85A 4UUBA 1J25A 2ECFA 1X2EA 2XQIA 3HTXA 4RK4A 5F7OA 1XQ6A 2D8MA 1Q77A 3PNQA 1SU8A 3GLTA 2GI4A 3IULA 2I1VB 1UC8A 1NQTA 3A2MA 1M2KA 4CGYA 1XALA 3RROA 3UY4A 2PS0A 4ND6A 3G8BA 1Z83A 4HEA1 4M55A 2J8ZA 3W4KA 4AKEA 1Z26A 3ESXA 4J6FA 1HYHA 3CW9A 3ONVA 2H48A 2SCUB 4X60A 4W6ZA 4BCBA 4E4TA 5LZ2A 3TW6A 3FYUB 1EBBA 3TRHA 3QHAA 1ZCFA 5EIBC 4CDGA 3RC2A 2ZUWA 3MCTA 2QSYA 2AE2A 1MZVA 4KRFA 3FAZA 1K66A 2W2MA 5C1BA 3L8HA 2CHGA 3GJ4A 3VVLA 2RONA 1C7ZA 4BFWA 1WCV1 2PCLA 1IAQA 1O1YA 1XBTA 4QUAA 2OXRA 1OXVA 2XAAA 4IGEA 3ZE6A 1CJUC 4AC9A 2R84A 4WACA 1LBEA 2ZJ5A 3L4JA 2FPIA 4RCVA 3RFVA 3KJZA 5L4NA 3N7UA 4FNMA 3NHSA 1E9BA 4FXOA 5CW2A 1LC3A 5C8YA 4BFVA 2JAWA 2XCIA 4M8NE 3LRTA 1M1UA 4HNGA 3D8BA 4Q21A 3T1OA 3T9FA 1GXSB 2I29A 4OXNA 3RW9A 3NMUF 4KN9S 3KT8A 4GF5A 2VDMB 4EHFA 3QU7A 4L57A 5EN4A 1K7XB 2LIPA 2NU8B 3VU9B 4YH1A 1Z7GA 5J4KA 2YQZA 3IVGA 1QH8B 3GN2A 1Z4NA 3QOXA 4FOOA 4MH0R 5DTQA 5HIJA 1G9XA 3MERA 1SVWA 3RJZA 2QJWA 5K7SA 1O94C 3MA0A 5CT6A 5KNDA 1HT1E 4MKIA 3AT1A 3DV2A 5HNKA 2IU0A 5H9VA 3F6RA 4IPTA 1UBNA 1Z16A 3FMOB 1C4KA 4MYCA 2QQ0A 3L0CA 4HQLA 5TNXA 5JXGA 1TUGA 2HO5A 4DXDA 1O87A 4BL5A 2J9GA 4Y6LA 3KZKA 2NVBA 4WVFA 3H4MA 1I3OA 3F5MA 1ISGA 1RMQA 5H02A 1IWOA 3ER8A 3BRWA 2ACKA 3HZHA 2CDRA 1I2AA 2FWNA 1DX6A 2V8OA 2ILTA 3DAYA 3ZWKA 5DHRA 1T9CA 3TIIA 1Z06A 2FDCA 4QYMA 1XCOA 3HJCA 1NHWA 1SRRA 4FDMA 4I4LA 4KVZA 4RHXA 4AO6A 4GI7A 3HBNA 1OC2A 1CK4A 4UUMA 1ZU4A 3AG5A 1XTKA 1RYEA 3IOBA 4NOLA 4AZ3A 4J0DA 4NXNB 3RC8A 1CUSA 1TNDA 3HR8A 1TO6A 5LZ7A 3L07A 1FL9A 2BF4A 5DI9A 5LA6A 2HZBA 3CLVA 5BSGA 4C03A 1AZWA 3LL4A 5I9BA 3KZCA 2Q1XA 4MA5A 4Y67A 2XI4A 5IFKA 2QZ9A 3N0XA 3EVNA 1XWFA 4LNAA 4AS3A 1OOEA 3WSWA 4TQUS 3UKDA 4G8DA 1GQOA 3PEFA 2XGSA 4IH9A 3E58A 4IXTA 4JIGA 4LNUB 4KLAA 4DC9A 1E9VA 4IYRA 1D09A 4RW0A 5FFMA 4ZDWA 2Z5LA 3EIEA 3GVCA 2B4AA 4O8ZA 1Q0PA 4GKJB 1GRCA 3OFVA 1P0FA 3EEQA 4HQFA 2VHTA 3DD5A 3ZIAD 1CEEA 2XT9A 2EBFX 2YC2C 3MOIA 4CLOB 2IEZA 3NO4A 2CJYA 1RXEA 4IKPA 3K20A 3LMKA 5REQA 3NHWA 4O8CA 3BREA 1KU6A 2IIBA 2WTAA 4HDMB 2VJOA 5AM1A 5B5SA 5M7EA 4JP3A 4NS4A 1W35A 2VP5A 4Q66C 4HZIA 2WWFA 3DWEX 4U2DA 1NBIA 1W581 5TXGA 2I4MA 2G6TA 5JROA 3O4GA 1QLJA 2CNOA 1ENYA 3R3UA 1UPXA 4OB7A 3WLOA 4MQ6A 2YJNA 1JEYB 1UOPA 3WB2A 2KSIA 2AXPA 3TXXA 1SZPA 3ABIA 4F1JA 3I09A 3JU3A 3AL0C 4IHQA 4ZVQA 2HLDA 1EPUA 4JYPA 3WWDA 3THYB 1YK1A 1G21A 1HFWA 4LJ4A 1W73A 3NC4A 4KBYA 4ZXPA 2P8JA 3CN7A 3L8GA 3NDPA 5I9LA 2XKKA 1N36B 3ZDBA 1JQJC 2W2NA 5DB4A 1XDSA 1E2LA 2WWWA 1E0AA 1LNQA 1Z8DA 4OVKA 4DPLA 4G36A 1V8FA 2YY5A 4IZIA 2FMFA 4A6DA 2EVWX 4PY2A 2TMGA 2V7WA 3W2GA 1T2CA 1P81A 1W4LA 4LK2A 1XNHA 4AZTA 5BR7A 2VHQA 1XTSA 2ACEA 2FE1A 4M60A 3VNSA 2XWSA 3IKMB 3VR3A 3M3DA 4RF2A 3OJXA 1KERA 4JLVA 4JBXA 2B4RO 2Q5FA 4OP2A 5I8WA 2V7TA 3GNQA 2YQ4A 4QC2A 1YK0A 2ZIZA 3B6JA 5DHPA 4X66B 1IY2A 4W5NA 2XCTB 1O5IA 2XXAB 4UTXA 2G71A 1DOAA 3M0EA 1VPDA 3IP9A 2PL3A 1JG3A 1J42A 1H6AA 3RUEA 1XLTC 2QJRA 2QR3A 3BJZA 3L4EA 4C1NA 1I2ZA 3DXYA 4QDTA 3LDAA 2H06A 3WBFA 4F4CA 5LWQA 4DR3B 3G0HA 5UKDA 1IHUA 1E0DA 1FVOA 2BGLA 3FF4A 3O2QB 4QPDA 2QPTA 5LQCA 3KSAC 3KKLA 3MC1A 5IFLA 1KL7A 3Q3GE 1ZMTA 4NPHA 1WULS 5TMDA 4LZOA 5KC8A 5KNCH 3O90A 1MAVA 4Y1FA 4DLWA 2AH5A 2HQ1A 2QROA 3M4YA 5AHWA 2RCYA 4M8IA 4R1QA 1H94A 3F8TA 3N6XA 1NOIA 1M6YA 1EXDA 4QB9A 3N8DA 4QGSA 4ACBA 4KO4S 2DPHA 3BFJA 1BX0A 3I73A 2L42A 1WQ4A 1U9IA 2C2MA 3EZYA 5TEWA 3BRQA 3BJIC 1KEKA 5DMHA 3G5AA 2EZ4A 1Y5LA 4KLRA 4MW5A 4NDZA 4PRLA 5EEGA 3FMPB 3P8ZA 4AX8A 2BYTA 3C5CA 5AM4A 4LFBB 4TL8A 5CXSA 5DM1A 3DPIA 4Q7JB 4B34A 2OBFA 4WL0A 4EY7A 1ZK0A 1DZ3A 2VBIA 1JJAA 3DZHA 3MBIA 1S1CA 3MEQA 1YFLA 4L4SA 2EYQA 1Q92A 4QJIA 5HF9A 4I55A 1Q12A 2QTAA 3AKYA 4NBVA 3DUFA 1RPJA 4LXQA 4Q48A 3LWDA 2BMEA 2HTFA 3UWPA 4RV4A 2QVZX 3TG2A 4LF7B 2AZXA 4M0EA 4I7EA 2PZJA 2Y76A 4I5EA 1IN5A 3C3JA 4QPNA 5KYYB 2QTWB 1FFXB 2HDOA 2IYOA 2XVYA 3GZTB 1EUDA 2XVXA 4FE3A 2H6EA 8GPBA 4HDCA 4JGIA 1DJQA 3PVCA 4FT2A 4XW2A 1CNEA 4XPIB 1A9QA 4P2GA 2JGNA 1QX4A 4LSZA 3I9NA 1K98A 2JGLA 1QXSA 2CD9A 3P0JA 1O0BA 4LJ6A 4EJFA 3FKQA 4KUGA 2PJRA 3H0CA 4BNZA 1NBMA 3E5RA 5FTMA 1UEXC 5DOZA 2E4XA 3P94A 4MV7A 4P22A 1B00A 1V8PA 2P3SA 3CLUC 3K94A 4HUJA 3CXRA 4B82A 1GTVA 3CH7A 2VNHA 3NM4A 4CQMD 1ATIA 2BKEA 1VJGA 2B8NA 5GTDA 1XVAA 1RAFA 5FL7D 4UDYX 3VJMA 1HM5A 5DISB 1T6NA 4RHUA 3EDQA 2FPIB 3KQMA 2I2BA 1A4XA 1OTYA 4UM5A 3QTLA 5DPMA 4NULA 1UBJS 3AYZB 5J9FA 5DT2A 2ZIEA 4RV5A 1XVIA 2X6TA 4IFEA 1JLKA 2EEPA 2GD6A 3B9RA 3R5FA 4JKYA 4PV7A 4X61A 3V4LA 2PX0A 1TQHA 2GH1A 5H0IA 2VDLB 2I7DA 3ADBA 4G4JA 2XD4A 4DNQA 4MAFA 3A6GA 1G1AA 3KOYA 1MIOB 2Q62A 1ND6A 2VDKB 2YZ7A 3D59A 1QO0D 4M8LA 1KZHA 1M34B 2QYOA 1U3UA 2ZYWX 3EX7C 1LPPA 1PJ8A 2XVZA 3QEKA 2PWYA 4ALMA 4C5BA 1J0CA 2PJZA 4CIDA 4E1VA 5AM3A 4NDNE 3UCFA 2QEQA 1PQPA 1RZUA 5I51A 4PN7A 3I2IA 4TV9F 4AUEA 1M10A 4URFA 3VJKA 3N07A 1UOOA 2LUOA 4F92B 1VMAA 3EQ9A 3QFTA 4FP9A 4L5CA 1A5BB 3TXAA 1RQLA 1AH2A 3CJTA 3A1NA 4BB6A 3INYA 3BN8A 1L5LA 5BMVA 4B4VA 3P0FA 1AKTA 1MDFA 4JFAA 4KO1S 2IXBA 2HCRA 4F4HA 3PJGA 1ZH0A 4ESEA 2H29A 1BH6A 4RPCA 4IRUB 2JRLA 1E3DA 4RFSA 1NONA 1T9DA 1MIHA 3LW7A 2WSLA 4HRXA 1MX9A 2BL4A 1K88A 2ZE6A 5K3FB 1P75A 3U09A 3IEXA 4S05A 2IHYA 2OGWA 4OJNA 1SKYE 3VR6D 3DL2A 1MB9A 3GAZA 1OYYA 1SK9A 3HV2A 2OWDA 3L1JA 1YJAA 4QYTA 1FDSA 2RJNA 3S3TA 1T9AA 4NYIQ 3VDRA 2DH5A 4BO4A 4CFYA 1JLLA 2XBMA 2G40A 3MYRA 1ZVJA 1S8OA 2XSZD 3WXBA 3OT4A 1Q83A 4HUTA 3EZGA 1TTTA 4IIGA 5HKOA 1RWQA 3EAGA 5G41A 3C3CA 3ELUA 1JDSA 2F4NA 2OCXA 4BO2A 3NONA 2Z58A 5I48A 2AOUB 1LPBB 1RVV1 3H2YA 3L7YA 4TTTS 4P7KA 3D3JA 1TFRA 3WOHA 5HX7A 2GN8A 5CA1F 5IVHA 2DC1A 2IYAA 3E1SA 2IUFA 4OK6A 1M2WA 3DJFA 2N42A 2ECPA 2XTMA 3O4JA 4HRYA 4KQWA 3CG0A 3A1SA 3U7JA 4F8JA 3IE1A 2EERA 4J8PA 3L93A 5I5GA 4ZVPA 3I30X 2MMCA 3K16A 5IKOA 5BY2A 3QXSA 1BQ4A 5JDIC 1VGQA 1ZSVA 2Z0MA 2NVUA 2VYVA 2WYOA 1BKYA 4LW8A 2P5SA 4ZU1X 3WRWA 4PSUA 4E03A 2BFFB 4W5WA 3RU9A 4CLOA 1FZTA 1MABA 1FUUA 3FOCA 1DXYA 1VSUA 5JZVA 3MTBA 3G2JA 1OUMA 1J07A 3TJZA 1GITA 2O8CB 4YXWD 4UHDA 1CUVA 2REOA 1SVLA 3NKLA 4OF4A 5IANA 2R1UA 4C4SA 3ONWA 2X5KO 4UMVA 1EM8B 3L43A 3ZW7A 1XGKA 3KR0A 4LJRA 1GU1A 2OFPA 2PCJA 4IKEA 2Q4EA 4YREA 1YH3A 1JEYA 1HURA 1ZA2A 4HQ0A 4IUDS 3BWBA 2DKFA 4AMGA 6REQA 3VKWA 2R00A 3PC6A 3AY6A 3OF2A 1JHQA 2Q2QA 3L7IA 2Y68A 2DBQA 4WOCA 3VYWA 2V3WA 4BN0A 5BOSA 1Z6PA 4A0SA 4GT1A 1C8BA 1SRQA 4BNUA 4X1KB 2A94A 2ZJ8A 2NYVA 2VUUA 4A9AA 1I7NA 1S2DA 2XNCA 4MMXB 3IA2A 1RC8A 2HMVA 3ORHA 1I1QB 4F06A 5HWSA 1ZMRA 2HNAA 1XTVA 4DYDA 1JBEA 1IATA 5CYOA 5A62A 1BEUB 3I23A 4NAUA 4P9NA 2B8WA 1HDGO 3VZBA 2E9SA 3TFQA 3AL2A 1ECFA 1EB9A 2HCBA 4FYYA 1PQYA 4X1YA 3SCZA 4HATA 5EHXA 1FVFA 2R7NA 4HWRA 3ZDXB 2GX6A 3O83A 4FYPA 3F6EX 1TVKA 2BFAA 4IFIA 1P80A 1UPTA 2HHAA 3G5TA 4LNUA 4MGIR 4YTEA 1QO7A 4DPMA 4K6CA 5BUSA 4M83A 4YP6A 1O96A 4I55F 3B51X 3LUJA 4KQEA 3ETCA 2NVOA 2V6IA 4TV8F 1GWNA 3FYUA 3U48A 3M6FA 5A7GA 1QDUA 2JFXA 3DCIA 3IUQA 3KVNA 4OMUA 1SM4A 4PNHA 1EDDA 2WWRA 3VZSA 5L45A 2BM0A 2VCYA 1SKYB 1U2ZA 3VDMA 3SM3A 4HX2A 5ISMA 3E15A 1OFTA 2D1TA 2ZB7A 1AK9A 1YOVA 5JS2A 3VR6H 3ZK7A 2B9EA 2AC2A 3TZEA 5AW4A 2MCFA 3FR8A 3VVBA 2C99A 2J3JA 3LWZA 1C9MA 2BBOA 3D6TB 3OA0A 4HRVA 4Q7QA 4RKEA 1OGIA 3DBVO 4JIMA 4MARA 2F1IA 3R7NA 3SEQA 3W2EA 4ASUD 1FNDA 3BWCA 4ZCLA 5WRFA 3AEUB 3Q7QA 3T94A 1FUIA 1XKTA 2PMDA 3UMRA 2OVFA 4PS0A 3IXLA 1E3QA 1PR6A 4U2KA 1XZGA 3S5JA 3CZRA 3O74A 4J4TA 4TMFA 4TMXA 3VH2A 3M49A 4RK5A 3UO8B 1PUIA 1PFWA 1ETHA 3KR1A 2W8ZA 3OQVA 3PF8A 3WYDA 4KWHA 5A3JA 1KA9H 2O2YA 1CUUA 2AQIA 5F35A 1HDRA 3AKCA 3CIOA 4WY8A 2VUIB 2F3SA 2ZYTX 1YAJA 3PP8A 3I3OA 2WVAA 1LRKA 4OLJA 4CEHB 1MG5A 2V65A 3T7DA 3EAQA 1NFRA 3O92A 4JLKA 3RSSA 2XB9A 1U8TA 3L8EA 2L69A 3KKMA 4LHEA 4ZTZB 2C2XA 2FHPA 2RARA 5GOZA 1MO5A 2XIQA 4MXDA 1IM5A 3ITEA 5K0ZA 4QM6A 1T6XA 4WECA 4XSHA 1W34A 2OZVA 3K0KA 3F4KA 4ZVRA 3FDIA 2JJ1D 4GQIA 4A0QA 5JAZA 2AOVA 2V74B 3Q5DA 3ZV4A 1ECPA 2R6HA 5IARA 1QK5A 5DEIA 5GJBA 3OJLA 1SXJC 3V8BA 4QXOA 2Q0QA 3CT6A 3FWZA 4Q6WA 2C1XA 1LRLA 2YCLA 2H54A 4PEVA 5DWVA 5F73A 3TOCA 4ER3A 3ADCA 1MX3A 3RS8A 1RZRD 2XD9A 5TF0A 1BU8A 1MVNA 3NYQA 4CQLA 1JHUA 2D1YA 3DMNA 4DILA 1BKSB 3N05A 2KHZA 1A7JA 3RF7A 3SPXA 4E5MA 2BAGA 1YB2A 3G2NA 4HL6A 3SSAA 4Z0TA 3VQTA 2PIDA 2BFEA 3ENKA 1CFZA 5A7FA 3ZW8A 3R5SA 2ZBDA 1QP7A 5JSUA 3EEOA 4KAFA 2P9EA 1GJRA 3U81A 2F59A 3WLIA 4F4FA 4AI6A 4LRUA 3R6LA 2V9PA 1I2BA 2YZKA 4NQZA 3HBMA 5DBOA 2WWYA 5JCZA 1RE1A 2QD4A 1FNMA 4RVHA 2HU8A 3H8SA 2J5BA 3QPAA 4FLMA 5EZQA 4BUZA 3IHTA 3ZXYA 1OI3A 4KN5A 1UC4B 1UDAA 2RFLA 1V5FA 3Q3CA 1KI6B 3IT0A 1C3JA 4OATA 4ZCTA 3BXPA 3ZDCA 2F62A 1Z4QA 1JAYA 3FTPA 2OXIA 3O7WA 4UHEA 2GTHA 1LX6A 5KX5B 3MTJA 4QUEA 5KAPA 3IEMA 2YW9A 3FDZB 1PQ4A 1P6QA 5I8PA 3W1VA 2VPPA 4QYWA 4IDEA 1YRLA 1KI9A 2F3TA 1EGHA 1B8VA 4BLPA 3AUJB 2C83A 3RO7A 1EQ2A 1ZIDA 3GBSA 2Z3WA 3UB2A 2RH4A 3CURA 1AKMA 3H42B 5J63A 5JEEA 3PHJA 4IDNA 4DDVA 1LDBA 1PGPA 1L2TA 2QYTA 3OZUA 2REQA 2XQFA 3D5TA 4N6GA 3PQ6A 4OPMA 1Z7BA 4KXUA 4U6SA 4URVR 5C8YF 1KSJA 4ZOLA 3EOAI 4JP2A 1BMDA 4WCDA 2FPGB 1M1NA 1RXYA 1V9CA 3G8CA 3K9GA 4N5NA 3GLIA 1LQTA 2OBMA 1PIWA 4DIMA 3SWWA 1ISSA 3IUNA 5ALTA 2P7IA 3OOJA 2QRHA 3R9KA 1W5SA 5EJ2A 2IU3A 1M2OA 3LYAA 1ZCBA 4FJ0A 3TZ6A 3B85A 1Y7HA 1JTFA 3QBEA 4BU1A 3QVJA 3UA4A 2O8EB 3OETA 1X6VA 4P3XA 4YACA 1E3WA 4IVQA 5EWJB 1A9ZA 2ZB8A 3KJEA 4H3VA 4EHHA 3DKPA 3H1BA 3K15A 2PEZA 3GUHA 3NYRA 1MT0A 4TN1A 4E4YA 3AOGA 1KJQA 4FW8A 3D6AA 2R4QA 3CEAA 2A7QA 1TLLA 2D06A 3H5RA 1NP6A 2ZIAA 3HJBA 4KFTA 4MQEB 3L0DA 4HH0A 3R5HA 1YXMA 4Y6QA 1XJCA 2UYHA 3KL4A 3F8WA 3WA6A 4BZXA 2FYTA 2TYSB 4GNKA 3CLHA 5TT1A 4PZ0A 3K5HA 3HP4A 5IG2A 1I0ZA 5DBEX 4X90A 1MIOA 3RREA 1B76A 1L7VC 4JOBA 4RPHA 5SY9A 2OQ2A 5D3KA 2Y1XA 3FUWA 2J33A 1VGRA 3IHKA 1G21E 2GJ8A 1A69A 2O8DA 4A82A 4QBGB 3RS3A 2C4TA 3WQSB 3CSSA 3N58A 1VKHA 2E0IA 1A2KC 2XF8A 3PD7A 4MB2A 4OHZA 5JTUA 3NHRA 1CDEA 2OGSA 4U4AA 5CVVA 3GLHE 1UDBA 2J3IA 1EKXA 4Y6OA 5FP0A 3I6MA 5JISA 5ECGC 1WR8A 2WM8A 1XRNA 1D2HA 5B53A 1Z82A 2YX1A 1UKAA 4A6EA 4DCMA 1X0XA 3RLIA 4BNWA 4XUGB 4V38A 1JSZA 3A9UA 5ANRB 4C0HA 4CVNA 4Y2SA 2YXLA 4E5UA 3COYA 3MWDA 3W5JA 4JMLA 2XT6A 3NIFB 2A0UA 2W6OA 1QKIA 3O82A 5EZYB 3H8JA 3W8FA 1YBVA 1G8MA 5IDYA 4OQEA 3ZWBA 3P4XA 4PXSA 3WLQA 3LA6A 3V42A 4EG3A 1RLJA 1U2PA 3GEMA 4KBFA 4QYIA 3UB4A 3PFFA 2HXSA 1V47A 2IP2A 4NYJQ 3IVXA 2Q6VA 1EH5A 3E9MA 3KM0A 1PSDA 2CJPA 1P1JA 3PPVA 2UZ4A 1LWNA 2SKCA 2YVQA 1MKYA 4I5DA 4U7HA 3ZVLA 4ZEMA 4AKGA 2L19A 3HK2A 4ZOAA 3VHXA 1CJMA 5FULA 1L5RA 1U7XA 3ASYA 4UDOA 1QDLB 1GGEA 3UAVA 4EKGA 3WGNA 3CXUA 2C5AA 3JZMA 1XP8A 1YQDA 3QVWA 4IGAA 4KX3A 5CIQA 5ALKA 1JJBA 1FB5A 1JPJA 2GHRA 3THRA 3WIVA 6REQB 2PLWA 1K8XB 4K88A 3W4JA 3G9XA 4F8YA 1V6SA 3DG9A 2WABA 1EVEA 1X7HA 2X19A 1V4NA 2CYBA 4OUKX 1A9RA 1XL0A 2B6NA 4O2AA 2I3DA 3IUPA 4HTFA 3V55A 4BZQA 1GUDA 1G38A 1NT2A 1GZ5A 2VYND 2JCGA 4QO8A 2C7BA 4D3FA 5A4AA 4PO3X 1NFFA 4B7UA 1Z2AA 2BBTA 3DBIA 3TIVA 4UD6A 3OTIA 4KPYA 1P6XA 1QZUA 2H57A 4TRMA 4AYWA 4E2ZA 1GG2A 1BCRB 3BD7A 2JLSA 3FKSD 5GV7A 5JNLA 4JYCA 5LQDA 2VPWA 1Y6ZA 1O89A 1ABFA 2E7ZA 2OXTA 3TZKA 2CVQA 1UBTS 5EMNA 2PRJA 3EUWA 5E1BA 1E1CA 2BT4A 4K1XA 3RHTA 2ZTLA 4PLFA 4REQB 3R9WA 1J2YA 5HF5A 1MO4A 3I0NA 1A88A 1DJOA 1RPTA 2WYVA 3RIGA 1E5DA 1L4LA 3AUYA 3COSA 2DTXA 2IHKA 1TLFA 2UVPA 1NBAA 3W5HA 3RAJA 3AYXB 3MAGA 3JALA 2J9FB 4EY5A 5DP2A 2C0PA 4ZI5A 4M0FA 3W2TA 4YRFA 5HXAA 1A96A 2W2XA 4QKQA 4WA7A 5B1IA 5DSXA 2AYXA 3LQ1A 1JDZA 3DMDA 3G89A 4IXWA 5FLXA 4DLXA 4RJ2A 5ELXA 2C57A 2WSMA 2CE7A 2B35A 2I4NA 4TVSA 1EGVB 4X7MA 2XDQB 2QTTA 2RHRA 1YRQA 5C0OE 5ESDA 3AW8A 2DWOA 2R8PA 3OY7A 3DO6A 1G0OA 2HV2A 4IV8A 4OTZA 3TMAA 1HYQA 1U0NA 4GI3A 2M1XA 2I34A 4Q18A 3H99A 4P54A 2BGRA 3U4IA 3FBGA 1VFNA 3VAAA 1ZJWA 1P9RA 2FK7A 4RFSB 3C97A 4L4RA 2J09A 1NQXA 4B2PA 4LMBA 1LPNA 5IDQA 5DTIA 4P0TA 4FOLA 1BDBA 4QFMA 4BGVA 2BUCA 3H4IA 4KQMA 2NIPA 2QG9A 1JMYA 2FMKA 1V8DA 3R3ZA 3K8OE 1YTLA 3SEAA 3LH5A 3WO1A 8MHTA 1IM2A 3LPMA 2F4VB 2C1ZA 1QGED 4RPIA 2JLBA 2BZ1A 4QHTA 5KOJA 3LQ4A 3P96A 3U9SA 2GYUA 1WD5A 4TM8A 1T8RA 4PRYA 4HFRA 2C7PA 1UQRA 2PD4A 1XQXA 3ETGA 3OOWA 1Y4UA 1CZKA 4NBKA 1XTPA 2QA5A 3NV9A 4N8DA 4RS4A 5EKSA 5EUQB 4CQJA 3W77A 4J1QA 2HD4A 4Y2VA 2ZRNA 4PZZA 3DHEA 1O6ZA 3F98A 2NO1A 4BVGA 4RTJA 1KI3A 1IDOA 3A6JA 2UV8A 1JHMA 5DM0A 5H3LA 5JVDF 3FOWA 2O2SA 1N5JA 2UYYA 3JQAD 5C80A 2OR3A 2GEJA 2C20A 2XB2A 1SQ0A 1YSCA 1N0IA 5CX1B 4KKXB 3LU1A 3UVEA 4F97A 3C48A 3ZVNA 3OX1A 2VF5X 2XCOA 3P0RA 4HH3C 1IL0A 2W6QA 5AI9A 2DG2A 2VHZA 3GUUA 4PGFA 5CA1A 5CR9A 3LUHA 2OY0A 5CU7A 2NZVG 2VJCA 4G5RA 4KV9A 3SX0A 5ITWA 1VJRA 3ZJTA 3GJYA 4G1MB 1CLEA 1VIMA 1TTHA 5B3LA 2FEXA 4XVUA 3T5AA 1OVMA 3DL0A 5JT1A 1QVWA 2X2PA 3M70A 3IKLA 4IFTA 1NUTA 3RIHA 1ZDMA 2VP0A 4DFDA 1R3UA 5KYKA 2RGCA 1GD1O 4QELA 4U5XA 2YCBA 5DLYA 2QMEA 2QTCA 2H08A 1UXJA 1FU8A 2ERYA 4RJKA 3ABRB 3L0PA 1T9GS 3A3YA 3QLTA 5TDHA 5KDDA 4DV5B 1HXHA 1K5GA 2KS6A 5DW3A 5JCOC 2B25A 3MSXA 2P77A 1HK7A 2I6TA 3ICWA 2FETA 3LUAA 4JLAA 4EPTA 2JVIA 1NIJA 1PHPA 3WDSA 5DM70 1Z75A 2OZLB 1F8UA 3KLOA 1I30A 1AOXA 1FJ2A 3O7MA 2Y99A 2G8NA 2BHNA 3Q3HA 4FJ2A 3ZGNA 2XTAA 2IGTA 2BWJA 2QLTA 3ETNA 5F2EA 4IJMA 3RC7A 1R4AA 3OEHD 3AL3A 3DLCA 4RK7A 1NGSA 3DDNA 3QVGA 4ZT7A 1OAOC 2VTBB 4MNTA 2WE7A 2ZSJA 4QG7A 1K1EA 2RG1A 4JJ7A 2VWQA 3RVLA 5BQ3A 4KWCA 2V59A 4UKDA 5TX7A 2WJ3A 2FFHA 3OX3A 3STVA 3WVNA 2GILA 1H4QA 1HLDA 3R44A 4Y2PA 4ZANA 5H80A 4CCSA 3H2IA 2HOQA 4N3AA 3GFBA 5KWIA 4HDRB 4IHAA 4IOMA 3IIIA 3CVXA 4TSRA 3DM9B 1EWKA 2ZE8A 1LA2A 3SZUA 1FXWF 1QIMA 1QTRA 4HG2A 3ONEA 4WIAA 4OAOA 5DCLA 5ULLA 4XWAA 4OBWA 4XJXA 2A8YA 1OH5A 3B3FA 4X41A 3FGPA 3A4LA 2JIRA 4FBGA 4L5AA 4WGFA 2XGJA 1J8YF 1P4JA 1WSDA 1Y5IA 2JFVA 2QRPA 3PNPA 3K96A 5EJIA 5HA5A 3ZZMA 4Z1MA 1KFKB 1EFKA 4PR3A 3V9AA 3SAJA 2IK8A 1L7EA 3BH6A 3KQSA 4JBNA 5EFZA 1NG9A 1BXRA 1PJ3A 4MWCA 4EHAA 3DE1X 1H3EA 3E0XA 4TVKA 1V37A 1XXHE 3H6KA 1KJNA 2WJJA 4YDHB 2XOKD 2Q3CA 4RJTA 5JQGF 4ICIA 4R0VA 2PAFA 4R8VA 3HN6A 1PQWA 1VTKA 2LR0A 1P0CA 5BW6B 3W3AD 2FNAA 1FJHA 3DEKA 2X76A 4RZIA 3UT0A 4Z8XA 1U7UA 4U3JA 2BJVA 1ZYUA 3AF3A 3K0AA 3FUXA 1KK3A 3SXJA 5BORA 2PH1A 5HEKA 1KIFA 1IB0A 2X5NA 3C3BA 2OK7A 1QS0B 2ZSBA 1CUFA 1NKSA 4HAXA 1KOGA 2FPGA 4Z99A 3U7QB 4R2HA 2VRCD 1LH0A 4L15A 5IJ0A 4ID3A 5AKZA 2G4LA 1UDCA 4WT7A 3OQIA 4QYSA 3SQOA 4JBYA 5HIIA 5IBPA 2AGVA 1OIWA 2ZULA 3BSWA 5KQMA 3CF2A 5HG0A 3UEOA 3CNHA 3QNWA 4PNPA 1V8OA 4NV0A 5B3JC 2F67A 5DLPA 5FQNA 2QLLA 2JFZA 2JB9A 1OYOA 3MTEA 3IURA 4ZCPA 2H2AA 4BFYA 4CMHA 1UMKA 2IEIA 3GUZA 3BQMB 2BJWA 1U5AA 2EFEB 2Y0DA 2C82A 1SBYA 3TOSA 1JR4A 1UT8A 2IPXA 3SE7A 1JEQB 5DNAA 4XWOA 3C5HA 5EKTA 3U40A 4YRGA 5AI4A 1N2EA 3PEYA 3AWIA 2HKIA 3DLTA 2Y0EA 3P45A 3QTTA 2F90A 4ZRMA 1PNRA 4NYJR 2NXJA 4OKSA 3PKIA 4IDQA 2E37A 1PR9A 2R85A 3DEIA 4ZQCB 1BD4A 5AM5A 1R12A 5D5HA 3TVDA 3V4ZA 4QLBA 9LDBA 3PQ4A 4GXTA 4WLOA 3A1VA 4OO3A 2BM1A 1IY1A 2QZPA 1RCFA 4HLNA 3EG9B 1HH4A 1N8NA 1Y9ZA 3EEYA 2A5DA 1TM7E 4N3GA 3ZZNA 4ZVOA 2EV9A 3KHTA 2E85A 3K1YA 4DIOA 5DASA 5HF6A 1I4LD 3C3KA 3NIBA 4YJKA 3K1AB 3BICA 5DNWA 3GFVA 1GZ3A 1Z2OX 3L05A 4O4JB 3SZOA 1G3MA 5HZKA 4W5OA 4HDRA 4GKKB 4J9UE 1UBUS 4XRGA 4MWOA 1OXKB 2H4FA 2O2IA 2E5LB 1CU1A 3F7NA 4JJFA 4HH1A 4RKYA 4DIFA 5EIOA 2F8MA 4HAWA 4HVAA 3AEYA 3LBNA 3COPA 1YGYA 4CU5A 2HA6A 4CT5A 5ALEA 4IIFA 2WIAA 4BQSA 3Q0TA 2Q5IA 1NX6A 4F85A 3NTQA 1GFZA 3BE4A 5MFZA 4EI8A 2VYFA 2GD2A 3B9BA 2WKRA 5CCXA 3EVEA 1OWMA 3NHFA 3DEAA 2OESA 5EJFA 4EKIA 4EJSB 4MYTA 4JASB 5FYDA 3ZD7A 1B6GA 1R8XA 1ZL2A 1XV5A 3W7BA 1FRVA 4J90A 4HNQA 3TR0A 3T8YA 1XAIA 1OYWA 3T15A 4MAMA 1J90A 4MTLA 4ER0A 1IBMB 3M3PA 5IT5A 4ZQEA 2W00A 2BM9A 1R16A 5L3QB 1BO6A 4F2WA 2CNKA 4WNAB 5LBTA 3GDGA 2C2BA 2UUPA 2JA1A 1WXXA 3MIIA 1CRQA 1L8OA 2C5GA 5CYFA 4Q4JA 1QBKC 1KY4A 3RASA 3D6NB 4DJAA 1PSZA 5F3DA 2NPFA 5DP1A 1UR5A 1WO8A 1FRZA 2P6MA 1YCHA 1L5YA 1TXGA 3OU7A 1FP2A 2VWGA 4IIDA 4MW2A 4O4HA 2E4AA 4RZQA 3KSMA 1A50B 3MG9A 3PYMA 3OIWA 4G1FA 4J7CA 3DZJA 4J03A 1WL8A 5K3AA 4ZCIA 4D46A 1QHNA 3A9WA 1P2VA 3BWVA 3B2NA 1R50A 3E22A 4RMIA 4A5OA 1IHDA 1ZMOA 3IOEA 1JKJA 1GPNA 1KH2A 2PBRA 2ZR9A 3CQ9A 3TEJA 3TUJC 4CI9A 2PGOA 3TKYA 4QWMA 4B7CA 5GONF 3L1HA 4WINA 1ULUA 2QPAA 3VX3A 1GZHB 2GZMA 3CX8A 3SS8A 5KYXA 3O8QB 4RGQA 2BFCA 4HN9A 5HUHA 2P41A 5EQDA 1DE0A 3DOEA 4J7AA 4J9VA 4KQ2A 3UHJA 1QIGA 4CMIA 4D3XA 1OTXA 4WESB 1T1RA 5BNWA 3GLFB 5LIPA 2X8JB 4N3BA 1M6WA 3AUTA 2R00C 1P0QA 1FNSA 5C8DA 2Z3ZA 1NJ6A 3R0QA 3PE6A 3W2FA 3L7AA 1H65A 4AJ9A 1I4EB 4QLAA 3LUCA 1FS4A 3T3EA 4ZZ0A 2IXAA 1PV1A 1A8IA 2PFKA 2M98A 4YP5A 3NYIA 3EGDB 1N2XA 1KJYA 1ISHA 2OHFA 2O2HA 2BHRA 3C3EA 4FVTA 4KZPA 4BCDA 5BSHA 5AIBA 4RTMA 5HZMA 1LBQA 1R27A 3NATA 2XMCA 1AO3A 3JWEA 1DQYA 5ALRA 4QOIA 5KYWA 4BPBA 2AC4A 1A82A 4YRPA 1I0LA 1XTQA 5KZMB 5CVEA 4XR9A 3TQFA 5GZ1A 2V7QA 3G1TA 3RJ9A 3ZXIA 3NBXX 4ZT3A 4RX1A 5BSUA 3KT0A 1TGVA 3EZFA 4H0NA 4PX2A 4JA2A 1N9KA 1RM3A 1CQIA 1NPYA 2GN1A 3NANA 4HAOA 1M0WA 2IY7A 3ONDA 2C8VA 5ALJA 5K8IA 3D5QA 3EQZA 3F1LA 5FB3A 4CF4A 4CKWA 1V3UA 2X40A 3WYNA 3D1JA 4COKA 4QYIB 2OZPA 4JK3A 5H4GA 3QYAA 4C76A 6ADHA 2C61A 4CL0A 3HO8A 4O2BF 3GJQA 3KXLA 4IWYA 3U7EB 1L7NA 4GP7A 5K3DA 4BAUA 1QH1B 4M4SA 4RWEA 5CA0F 5C1DA 5CG1A 2GTIA 2PLRA 3KB8A 2P65A 3AQIA 3ROZA 3VU9A 2OAGA 3TECE 1A9YA 1VHWA 2D7CA 1HG0A 1NMXA 4KIWA 1OH8A 1ETUA 1Z3CA 3CONA 3JASB 4Y0AA 4BLRA 2AXQA 2O23A 4OLBA 3EBPA 3SFZA 3DT6A 1N6OA 4Q12A 3W8NA 3WB0A 4Q7LA 4Z54A 4G5QA 4DUZB 4BASA 1MA3A 3HN7A 4IH1A 4Q4LA 3NDJA 4IMRA 3I42A 3QX8A 3LNCA 3GFOA 4JLUA 1GNPA 1FDOA 4C21A 1JALA 4Q00A 1DO0A 1DO8A 1Z73A 3KWFA 5D3ZA 1FDRA 3T5CA 1Z4LA 4EO9A 1K3UB 1KEUA 2OO7A 2QMHA 3T5TA 3RIYA 4HDNB 5LPNA 3DMYA 1KI8A 4IGIA 1C1HA 4JLMA 1B15A 4M0UA 1L7PA 2IW3A 3R4CA 4IIHA 3CUEF 3UJCA 4EW1A 1EVJA 3ELDA 3ESBA 3NEPX 3OIGA 4UE6A 4WCFB 1E0JA 4CKCA 1PJTA 3D3WA 4NOMA 3U3XA 4JQSA 2R48A 5KQLA 3HJFA 5K0JA 4YCAA 1GNSA 4ZN6A 1O57A 2O0MA 2FU5C 2DY1A 1OKKD 3DT8A 2WJIA 4RD3A 5IM4F 3VDNB 4IDPA 1TMKA 1Z63A 3BD8A 5BV1A 4PCAA 3FKJA 4OQQA 1JFRA 1WB6A 1UFQA 1X1CA 1X14A 3GPBA 2G1AA 4NFLA 2AX3A 4IIJF 3BWYA 1H22A 1Z6AA 3OCCA 3QVSA 2FSPA 1U7DA 1YHNA 2GYVA 1KE2A 3VPHA 3WV5A 2I4TA 1D7OA 1VYTA 3U9TA 1X70A 4B8WA 2GZ3A 2NU9A 4OYHA 2QZZA 2H18A 5G0UA 3A70A 4HX5A 2JGRA 2AEMA 1W75A 3GPDG 4JELA 4K6MA 2UUOA 4X6YA 2C78A 2YHIA 3RM3A 4DLBA 1BMFA 3HM2A 2NNLD 5J3JA 4H7KA 2BUBA 2HF7A 1K4YA 3QWBA 4ENWA 5BN3A 3FJOA 1I4TD 2J3QA 3DCJA 3I1FA 4HRAA 2IBTA 1CQIB 4E7OA 2D6FA 1CUZA 3BC1A 2QG4A 2W2TA 2VPQA 1WKCA 1KVTA 3BK7A 4ZTBA 1UWKA 1U81A 3K32A 3JQEA 5LU9A 3B1ZA 1XXHA 5AOBA 5EERA 2WF8A 1BWPA 1C7FA 4KK3A 3UWDA 4EPYA 1DEKA 4MX8A 4LQDA 1XNJA 1YHZA 2PLAA 1U9CA 4D5GA 3BMQB 2Q3FA 4D44A 3IPXA 2OA0A 1WHTB 3DYVA 4WCFA 5ICCA 2B7LA 3HL4A 1EP9A 5DXAA 2RI6A 4HO1X 1KMHA 3JVEA 3WP0A 2PO5A 2XUDA 2VZ9A 1Q5PA 1W29A 2WZCA 3LRXA 4BUJA 3O4IA 4DCJA 4GPAA 4FN5A 2RGNC 4LDQA 1KKUA 5D5PA 3UJAA 3DKIA 4HAVA 3LVFO 5GOTA 1X1AA 3IT1A 5AVUA 5FAKA 1KP2A 1OWPA 3PEVA 1NW7A 4WK2B 1KI6A 3EPPA 4EBFA 7REQA 4YPOA 3MM4A 3DMPA 4CM7A 4W5TA 2DUWA 3IMKA 5EP3A 1SH7A 3CW8X 5ARCA 1VQ1A 3X43A 3WK6A 3PTLA 3ZNNA 2E4ZA 2Q9UA 5CLFA 4RD4A 2ONZA 2HA4A 7AT1A 3GLFE 3UYKA 3PWSA 3A1UA 3FDZA 1C7RA 3L0BA 4FZVA 4C9BA 1ZCAA 1QPZA 3NRBA 3QLVC 3LY7A 1PT8A 1UZUA 3A9RA 3PQ7A 1YQUA 4ZP1A 1V3TA 3CVWA 4NZPA 2Z2ZA 3AF6A 4UHFA 1C80A 3CZMA 4M0LA 4TQ9A 1S02A 1YZTA 2BGKA 3JQAA 3OC6A 3KZVA 2Q1UA 4PC3A 4IIUA 4L5BA 4AKIA 3JR3A 3ROKA 4EJSC 2A84A 5CT4A 2HT1A 3PJEA 3ET4A 2H2HA 3E3LA 3V00A 3PT9A 1Q0TA 2X2FA 1JJFA 1GEGA 4JVNA 1NXSA 4RAOA 1XWWA 2HM7A 4W7IA 2GAAA 2BR3A 3O26A 4KO2S 5AOCA 4H4DA 4QASA 1M75A 1JHZA 2GERA 2R6ZA 2UZAA 2GN4A 1JIKA 1UBOS 1VA4A 4U0KA 4ZV4A 3TI9A 4B74A 4DBLE 3OEED 2BHSA 2YWDA 4FLEA 1FTSA 2PEYA 1ZK1A 5BQOA 3PSHA 1XEFA 3HYNA 4DWVA 1UBMS 2J4CA 3OZTA 4X7PA 3PQEA 4F7WA 4D4HA 2ZCUA 2C3MA 3FZGA 5CVDA 5IJAA 4XYEA 1ISIA 2GJAA 2FRXA 1RYZA 2QP9X 4PYKA 5IMSA 4OM8A 5HE9A 4K5QA 4F4JA 3B7PA 4Y2QA 1E2MA 4CTNA 4XYBA 5A4KA 1EVLA 3VI4B 4YMSA 4FZ5A 4O4JF 2HXGA 3I0MA 2IV3A 2XUKA 2WZQA 2QV7A 2VR1A 3CLSD 1TA4A 3TE7A 1V35A 2PJUA 1ZNXA 2H5IA 1M9NA 4MKRA 1TJ5A 3E5MA 3P9NA 4LGMA 4ARSA 4MJXA 3PJRA 1E7SA 1D5WA 3PQ3A 4I50A 4JENA 3HB5X 3SG0A 3TO5A 3WLNA 3DQPA 4PFJA 3NP9A 2BCJQ 5LZ8A 4KQ9A 5J40A 2P9CA 4DWWA 4Z4CA 2BFCB 4L5JA 3FRHA 2G0TA 4X95A 5CD1A 3ROEA 5CVUA 4YAUA 1MNQA 2PSHA 4OJYA 3FFWA 4N47A 3WK9A 1J1ZA 4J16C 1G8PA 5D87A 5AW9A 1R6UA 3ZLJA 3A04A 4CU2A 4GVXA 3VHRA 5ICGA 4XIIA 5IC4A 5IF3A 3TLEA 4E22A 1IN8A 1UXOA 1JWBB 1XQVA 1BU5A 3C1AA 3HKCB 3HN2A 3L0IB 3RTEA 5KYUB 1KAQA 1Y6GA 1K3TA 4LC9A 2GKGA 1YOVB 3ANLA 2EDCA 4N3NA 3WGGA 5JBIA 3ANSA 4JXXA 3ORRA 4HGPA 3CCBA 4MUJA 3NTLA 2H92A 4QLOA 1LVUA 4MMZB 2AG8A 2P6UA 3WK5A 3TIGA 5CEJA 3PXEA 1NM5C 2FZ4A 2PQ2A 1GPKA 1W49A 2Q9CA 3MAAC 3RGWS 4DCVA 3X2FA 3DVRX 1ZVMA 3ESDA 3OPQA 2LCFA 3ZHOA 3U7IA 1W19A 2DFVA 2QN8A 5HPYB 3F7TA 2QX6A 2WHXA 3DONA 3QIAA 1ZM2A 4BNKA 4XLZA 3RYIB 3MGGA 5AQ1A 2VQ6A 2JZOA 3GPCA 2ZSEA 3CUWA 5A3VA 5CUQA 3MGBA 4PPNA 5LYYA 4F0JA 6LDHA 5J43A 2F8SA 1QGZA 5JDCA 2DJ5A 3KDAA 5I4CA 2JGDA 3AESB 2CL7X 4PTZA 3EF1A 3FFXA 2PMCA 3K9CA 2WIFA 4K9SA 4P4SB 1D6JA 4QPCA 1HE1C 9LDTA 2Y4NA 4NAHA 1JNXX 1XA0A 2IYFA 4F4DA 3KR9A 3JALB 3MAJA 4D8VA 3KJIA 5LUBA 1KSHA 4DIDA 1IH8A 1YDMA 2J07A 3K31A 5JUWA 1VE5A 1XDBA 2FR0A 3BRSA 1ESEA 1T36A 3R7DA 2VP2A 4NNOA 4LSWA 1C2TA 1BKDR 3L02A 2V7BA 1GUZA 2WJVA 1RHJA 2QMQA 3S81A 2P9QA 3KWLA 3F46A 4Y98A 4UVDA 5AXDA 1TQ6A 1AGXA 3DDSA 3F2VA 2GVZC 4KO8A 1GA4A 3MMPA 4ES6A 2QDKA 3V33A 1U3TA 2AFIA 5AFSA 2VHXA 4YUAA 2WM3A 4AJIA 1BCRA 1EWVA 5JCPA 3ELBA 1TA9A 3H0EA 1FP4B 5G1PA 8AT1A 1JHOA 5CK4A 4P36A 1SELA 4WEOA 2OFWA 3WA7A 2NPOA 1REQA 3CX4A 1RTKA 3N0VA 5I9TA 3ZHCA 5KVCA 4YJ2B 3S2FA 1K86A 5JZOA 1UZNA 3N8IA 1SUFA 2XJ9A 2Q3LA 2YWRA 2W7TA 1JKXA 3OLYA 4MQ4A 2PT6A 1RXIA 3WNZA 1WP9A 2V7PA 4JLDA 2HV9A 1G55A 3BZUA 5D7NA 4Z8YA 2G76A 4LXUA 1HYEA 3TNFA 4OQNA 1Z38A 1Q0HA 2A78A 3AMVA 4KMRA 1WUYA 5EFOA 2GEUA 4DLNA 3NWEA 3FYUC 3AKZA 1P0MA 3KEGA 1O94D 3FNIA 3OE5A 3IKJA 4AM8A 4CM8A 1UJNA 3QEMB 4OKNA 2V55B 2DF8A 3P26A 4P4TA 4YP7A 3U3JA 3WGTA 2WQ6A 3D0OA 5K2MA 3HS3A 2EATA 1IZ8A 1SUIA 1TEHA 4KIJA 5HDQA 3GLHA 4JI2B 1JAZA 4H77A 1NE7A 1R0LA 3UBTA 3CZ4A 4NEHB 3ZTWA 3P9ZA 7MDHA 3S7ZA 2SBTA 4ZI2A 3C6BA 3UMGA 4E14A 2ZJYA 2CXOA 2G4CA 2A59A 1WXEA 1I2CA 3BK1A 1LLQA 3DVSX 4YASA 2GXAA 4OL9A 2VJBA 4CM3A 3RWOA 1D2AA 2O3TA 3F7MA 3RVDA 3U6BA 3PT5A 1HQKA 3DCNA 4R0MA 3DEJA 1EDEA 1GZ7A 4EGQA 3CX6A 3ZU4A 2XRYA 2H1FA 5IAAA 1HFEL 2FFAA 3P9YA 2EL7A 3ZLVA 3DEHA 1UKCA 2EFDB 3DH0A 2QQEA 3ZDRA 2DFTA 3AFNA 3G23A 1DINA 3QBVA 4LZPA 5L7YA 4F3YA 1RQNA 3L7NA 2WHPB 2ZT6A 4YQZA 4DA8A 4UAGA 2I4LA 1QG6A 2Q6LA 2C5FA 4XIJA 2GCPA 3D4IA 2K5UA 3ZNPA 2JF0A 2CMKA 2GBLC 3AFHA 1A97A 4CM5A 4MI1A 1OTHA 4I0WB 4JYMA 1GCUA 4L74A 2H7CA 3ZE2B 4NL4H 4IOKA 3ZC3A 1RLOA 2FW1A 5C51B 1U5CA 1YBHA 2B2CA 1LS6A 5IWAB 1E2GA 4G5YA 4ZT6A 2X1VA 1Z2DA 4QUKA 3KYCA 4UOZA 5C8YB 4R16A 1CJCA 4FS8A 1F17A 4INAA 1ZJ6A 1N1MA 3FX2A 2ZUDA 3FVRA 4LZWA 1NATA 4EJ2A 2IUUA 3HCPA 1X13A 4Q4HB 3T3GA 3PTZA 3FBTA 3HMKA 3JQGA 5FTNA 2A0YA 5IABA 4RA9B 3KU4A 1BROA 1UBSB 5CNKA 5IKPA 1JLSA 1ENPA 4WKNA 3VU3A 2D0PB 1U80A 1UK8A 2CVHA 4LXHA 4ME6A 3ET5A 2AN5A 3JD3A 4PANA 3JQAB 1N2HA 3EISA 5E7JA 4C22A 2H1IA 4G5HA 4C4ZA 4DC0A 3QI7A 2ZU6A 5F7XA 1O77A 1NVAA 3D8UA 3DVAA 3PFBA 5E3HA 2MYUA 4QJBA 4HXGA 1MC8A 1QGDA 1RQ2A 4ZHQB 1F2DA 4BEBA 1H2WA 3HP1A 5TF4A 3CVYA 1XZJA 1N5IA 4D3SA 4FINA 2Y9MB 2HCTA 5BSWA 1T8UA 1U2SA 3I28A 4G5SA 3CVVA 2OG2A 3OT5A 3T7CA 2JFBA 2RK4A 2OSBA 2P6OA 2I2AA 2JD0A 3QSGA 1BS2A 3K6JA 3GT7A 3VOBA 2EF1A 2NSYA 4YJHB 1P8JA 3MWJA 1WSAA 3O3MB 4B8ZA 4IIEA 1FNCA 2QD2A 3R8CA 3TN7A 5L3SB 1L4NA 1KNXA 2PWAA 3K6SB 1VXOA 1DO2A 2HA0A 2IPAB 1QZTA 1V1MA 1B0PA 1ZIYA 1F4PA 4RMNA 4B6JA 4E2XA 5SZIA 4E2YA 1WPGA 5F2NA 1D6SA 1H3NA 2DBVO 1YCDA 4HGYA 4PYMA 1LGYA 2Z95A 1H8ED 1EHIA 1MN6A 3NRCA 4R1NA 1AXRA 4KRXA 5CFRA 1CR1A 4GBMA 4IY1A 3VOAA 4DLLA 4I50B 2JIQA 1IBCA 1UAGA 3W5AA 2OCPA 5KDOA 1FMFA 4MWBA 3GF4A 3B1YA 4X5OA 5EWMA 4X6XA 2DWCA 2H1RA 1C0KA 5C34B 2CDBA 2FE4A 2W2LA 3EEIA 3EMDA 4QDJA 3RUAA 4EHKA 5IXYA 2O3UA 4TKZA 2DB3A 4NCNA 2NQ8A 5H3CA 5AUNB 1IRXA 3CH6A 3L06A 3QA9A 4IS2A 2OCYC 3GAFA 3UW1A 1BXRB 1EE9A 4A2CA 4YBZA 2C7QA 3EFBA 4BECA 1D04A 3ZDQA 4HTFB 2H4WA 3ISTA 5CB8A 2GXQA 1DELA 4EELA 4OBBA 2C9MA 3RABA 1RWWA 1CERA 2IYVA 5ESWA 4DQ0A 5KOIA 3B12A 3QRWA 5REQB 1D0SA 3IP1A 3IB3A 4UUPA 1YS4A 1IEVA 1FSFA 3E03A 2OZEA 3QKRA 4QTXA 1VE6A 4RLHA 2IZ5A 1X7GA 4WWHA 5LXTA 3RSCA 1MU0A 3MUEA 4QXQA 2AW5A 4EAAA 1ZGGA 4Q3CA 3C6XA 3QBJA 3ZGYA 1O94A 1US8B 1UP6A 3O8DA 4PYRA 3K2EA 3IVCA 3KO8A 1O9GA 3H05A 1SBTA 3MQFA 1XMIA 2EWMA 3VPCA 2VRWA 2R8BA 1TQ8A 2DR0A 4IM7A 4FMDB 3VR4A 1J24A 4QNNA 4G0MA 1IXZA 4EVRA 3OY2A 3IPAA 5IPFA 5ENVA 1FFYA 4XWYA 3ODPA 3S1AB 3ETJA 3O8BA 2IEGA 1XEWX 2KSHA 5TQ0B 4CV0A 4QJ5A 4DJJA 3AHFA 4DMRA 1USVA 4PAOA 2NBMA 1NL3A 1Q50A 2V7UA 1LLFA 1T5HX 1DX4A 4D4IA 3AFGA 3JYHA 4L85A 3F1KA 4FYHA 1YUBA 3BGWA 1BXGB 2NN3C 2Y1OA 2R1TB 2WG1A 4KRGA 1NJ8A 4OBEA 4BGIA 4DZRA 1KQ3A 3I12A 5JNWA 2X2OA 1W6UA 2BMJA 3SZGA 1P61B 4LXIA 5FHQA 5K0CA 2GGSA 4L78A 4DCOA 2J6BA 1EK0A 5LVAA 1U3FA 3C3DA 4HGZA 1F6DA 1P44A 2A9OA 3B1WA 3DOJA 5C8VA 5BSRA 5LSAA 2VI5A 4S2UA 4REOA 1WU7A 4MVJH 4Z9XA 3S28A 1ABEA 5KX5A 3EFHA 5FUVA 4W5JA 5FI5A 2B2NA 3R6GA 2P9JA 2VRCA 3AI1A 3NEAA 4PS1A 2YFQA 3ZOKA 2VXOA 4R8RA 1DWUA 1JVNA 3EGCA 3R5JA 3ENNA 4P86A 2DFKB 3RC9A 1QS0A 1Y0BA 3R5KA 1QFJA 1WUJS 1XD2B 2H9IA 3GJ0A 1M7GA 4Q16A 1RJ9A 3ZQUA 2IH4A 3CV3A 1Y4SA 2HPVA 3ZI7A 3HXMA 1WUTA 2JCYA 4Q7EA 2HDNB 1P7ZA 2ATCA 2VS1A 4ZJZA 4R9VA 3AVPA 1NVKA 3ME5A 1TLTA 4PAWA 1E79D 4XM0A 3ZLTA 2REBA 1J8VA 1Q6ZA 2L2QA 4WLEA 4NH0A 2I9PA 3C2QA 5HVNA 3FPFA 3MT8A 1AT1A 5JZ9A 1PK7A 4INZA 1EVQA 2RKOA 4H6WA 1PEYA 1CUGA 3EGIA 2NU8A 5KMGB 2NU6B 3TAUA 2A5FA 3FGZA 3NX4A 4DXAA 2WWHA 4IBOA 4IX1A 4BP9A 3HDVA 1KZ9A 1NSTA 2C54A 3P7MA 3O3NB 1H8HA 3EE6A 4AF7A 2JLWA 1ZO8A 2CDNA 2BVNA 4MO9A 5GONB 2J3DA 5F1KA 1C2YA 2IVZA 5JWRA 5MGNA 5A6SB 1Q14A 5AUQA 2F00A 2OYSA 2UZ1B 5F1OA 5L4LA 1E4EB 4RVGA 1OC4A 4B3JA 4G9GA 4NH4A 2JIBA 3QLUA 5AKHA 2FLVA 4MYRA 3MJEA 1E7QA 1QWSA 4DW8A 4EG1A 1AZTA 2AOTB 3I9LA 4NKRA 3I92A 4IYJA 2JGDB 3CA8A 3OMWA 4I4CA 4KU4A 3AHIA 3ZQKA 4BFLA 5JXJA 5KO2A 5AI0A 4QTTB 1A9OA 4RU1A 4BBZA 2ZQ5A 3CR8A 3GRZA 2X8JA 1OD6A 4WK6A 5FF9A 2WINI 1ZSNA 2YV5A 3NBZC 1TX4B 1SBQA 2WUVA 1HOTA 3GD5A 4U7WA 3GLIB 5KQGA 1PVOA 4B40A 3FROA 4IWXA 3QX9A 3GDHA 4GX2A 3D7LA 4BNGA 1EAMA 1G8FA 2WYWA 5F12A 3E3MA 3LPCA 5J5VA 3FNGA 2QP4A 1QGYA 2A58A 2VATA 2A1UB 2VQ3A 3N2KA 5GJVC 1YKFA 2NZ8A 3RDPA 1EHYA 2IRWA 3QF7A 1ULHA 3G5UA 2HV8A 4R1TA 1LPSA 5CBPA 3I04A 3VR6A 4R5HA 1EWRA 5JC1A 2RDMA 3TQCA 1U65A 5GIOE 2DEUA 1ZEJA 4LVUA 3ZEIA 2EBUA 4EPVA 4RDXA 2OL4A 2A92A 3IDAA 4YQEA 2EFYA 4UHKA 3AJ9A 5JYDA 1SD1A 1WB4A 1P9LA 3UF0A 4S1NA 1XQYA 2WF5A 3TW8B 5JAIA 3MFQA 3T4XA 1RP7A 2ZU0C 3WQRA 4GQBA 4YCMA 4JI7B 3G0CA 3M9WA 4DMHA 1AQNA 3IS3A 4ZCQA 2YS7A 3BD9A 3CC8A 2FMIA 2Z2XA 3GT0A 4RLFA 4WD3A 2PGDA 5EINA 3TLKA 3S68A 3VSBA 3I45A 1SULA 5G02A 4PX9A 5JMPA 3UOAB 2NQTA 4D0RA 4EDHA 4FZJA 4YAJA 3L6UA 3SKXA 1XD2A 3P20A 3JVDA 4LRTB 2QAGB 1Q17A 4GL4A 1T2FA 1E8DA 2IU6A 4MIKA 1AZLA 2VYVD 2VDOB 1Z08A 1GT91 1OV4A 3BN3A 4M9ZA 4YONB 3THOA 1W2WB 4B5LA 3OTGA 2Q1TA 4H3SA 2GM5A 1LNSA 2HA2A 2KW5A 2PM8A 4J07A 5JE8A 1GNLA 1VJDA 2VT7A 2FPKA 1JQ5A 5JH7F 1QJ4A 1TMGE 1H6CA 1I01A 2F9MA 2IFTA 2QXTA 1IUKA 1XCBA 2CXNA 2XNHA 1AQUA 3JARA 4PQYA 5DHSA 5FI3A 2PZKA 1IOWA 3NOOA 3EMBA 2D0IA 4OGWA 5D85A 1D2MA 2NT4A 5JZMA 2P67A 4I8DA 4A16A 4C30A 1GPBA 3QJYA 3GGJA 5LMCA 4V0LA 4AVYA 2G09A 1S3FA 3DE0X 4JEIA 3X44A 2HA7A 3OJFA 3ZJUA 4YJGB 2FQWA 1VJ0A 2DWPA 5LD2C 2JLAA 1X19A 5JD3A 4KREA 4DDTA 1WXDA 5ALMA 5KTNA 1II0A 1BYUA 3GGOA 4W1PA 2R4TA 1YQTA 4GI1A 3HKBA 3I5UA 3V8MA 3QFHA 4NMHA 1F60A 2KMLA 3HVJA 5KU1A 1XIVA 1Z74A 1AKWA 1CLUA 2OHJA 3PFNA 4GP6A 1OX4B 3OLZA 4F4UA 1H2ZA 1I3KA 1N1GA 4HNRA 4BBAA 3F6PA 4GD3Q 5HFJA 3O03A 4RMJA 5JZSA 3AUFA 2FX2A 1XPOA 1WF3A 1QGUB 1O6FA 4X6UA 1L4BA 2BD0A 2CLIB 3CTPA 1MHTA 4PYLA 3KCQA 5HJ5A 2BY4A 4IS3A 4HR7A 3CZ5A 4MDYA 2Q0XA 4YWJA 2AS0A 4UFNA 2C0LB 1A5AB 4O5OA 4QBKA 3TSWA 2XECA 1CWUA 3E48A 4PCLA 4YRDA 5B1EA 3L4SO 4AT1A 3GFPA 1GN9A 2I6QA 2ZW9A 5F2KA 1SIBE 4WJZA 1C44A 2A1IA 3FVWA 4LHVA 1PBNA 2O2JA 3HPQA 5F1YA 4KPGA 2QE7D 1NBME 1B42A 4N12A 1NU6A 1G8AA 3W6UA 3AG6A 4FBMA 2I1LA 1J5PA 2YWFA 4U1RA 4JBIA 3CR3C 1Y5RA 4LF4B 1GSOA 4XCVA 1A98A 1FLVA 4KH0A 2P1DA 1J5XA 2VQDA 3MWYW 3EGWA 2ODBA 4AN0A 4FILA 4CKEA 2ZYAA 5IJ9A 5B2EA 4RHTA 5LLSA 4YP0A 4CG0A 5IHXA 3ORFA 2ZRLA 3U49A 1W4AA 1AJEA 5AP9A 4YJGA 4X3PA 4ZVNA 2RHTA 4N65A 3VBEA 4MKXA 5CDYA 4H60A 2R87A 4E31A 5BWCA 2IV7A 2BGWA 3IP3A 4RCYA 5KYYA 2UZ3A 1GNTA 4E51A 3RI3A 4DUGA 2WKWA 1NYTA 4DGSA 4HV4A 4G0UA 3WAJA 4LQCA 1VHQA 3TLMA 1E3WB 5T7BA 3CLTD 1KMNA 2AN4A 2C3OA 2V7VA 3G49A 3HNRA 3BKXA 2CFSA 2NSHA 2ZRBA 1IU9A 3IPCA 1NIPA 2O52A 5KYVA 1IXYA 3RRFA 3DO8A 1A76A 4MRVA 3GP8A 2CX7A 2B92A 4CUKA 2ZUUA 5JALA 5EKXA 1U0OC 5HBGA 5GADl 3OZCA 3RRBA 1CG6A 3UY5A 2MR6A 4BB5A 1RWKA 4CKBB 1NXTA 2FWJA 1URPA 2Q29A 1ILEA 1BFUA 4YRSA 3B8HA 5ER9A 1CVIA 1W85A 5EXDA 2Z4SA 5KJ6A 2G70A 5LA6F 3IDZA 3W5SA 4Q3BA 4XD7A 3FMFA 1YA4A 2DT5A 2C8KA 2EU8A 3GOHA 4AECA 1W5FA 2OB2A 3FTFA 4FDVA 1LJ8A 5LB2A 1IUOA 5KAMA 1XTIA 1O96B 2NX2A 2WIBA 3II6X 4CIXA 1F9EA 1T6BY 1PFGA 2PBZA 4Q34A 2OUKA 2PLNA 3CUSA 5HQ3A 6Q21A 1ZUNA 3QK7A 4TQAA 1BA2A 4ZOEA 4Z86A 3NI2A 3O1HB 5FOTA 4C08A 2BZ0A 2VBFA 1SPXA 5K20A 1B8UA 4II2A 1RKUA 2OEPA 3ETDA 2IC5A 3I37X 1YU6A 3PGXA 5ALFA 5LKAA 3CPHA 1E3JA 2A33A 4MI3A 2GM4A 4UMEA 4ISCA 1GDTA 4CN8A 3FZEA 3R7WB 3RRZA 1TUBB 3KTFA 2DLDA 3RGGA 4YA6A 4ZO6A 3BB1A 3GZNB 1F2UB 3HJRA 1Y7IA 3IJ5A 5DN9A 2GRJA 4YCBA 3IP8A 3T7KA 1KGSA 1IPFA 2DUUA 4DIBA 2D2IA 4C7OA 4WZ6A 1HLPA 1ZQ9A 3JQFA 2DHEA 2PWPA 3YASA 3AZPA 1WUHS 1QKKA 4E5KA 1WXHA 1NT4A 5FA8A 1ZKDA 1STOA 1X7ZB 3HO6A 4D8UA 2QUZA 5I01A 3H86A 4Q9IA 1C0PA 3R6TA 4HVLA 3JQ8A 4AMYA 1SOMA 5LP1A 3B1JA 1PL8A 3PNOA 1IUPA 2FSVA 3E9DA 4NBTA 2XMGA 3GCDA 1IYZA 1TT7A 2AZDA 4K9LA 4HHEA 3X1JA 3PYLA 4BZWA 2ZXUA 1W0JD 4MGYR 3UIEA 1Y3HA 1E3EA 2XE7A 4FB4A 3WXMA 2HW8A 1GGFA 1QHSA 1TKBA 1WMEA 1Z37A 2VZ8A 2I6FA 2IITA 3TOZA 4D45A 2PK3A 2HR1A 2DCMA 2G6BA 1CQPA 3HY4A 3PB3A 5FUQA 3R7AA 1OA0A 4WBNB 1V7ZA 1CUJA 1DC5A 1SKAA 4XVCA 2BGIA 3KLPX 1D0VA 2ZXEA 1N5OX 1PN3A 4NMLA 5K4AA 3UBMA 3GJRA 3VTFA 1MF7A 2QOEA 4EY8A 4ERXA 1IBKB 4U9UA 1U0TA 3CZPA 1FVXA 2YXBA 1MR3F 4OMDA 4MS3B 4H08A 3C6QA 5CLIA 5AKXA 1P2UA 4YJ2F 2FFJA 3D54D 3N8HA 1OYVA 4D26A 1P7PA 3FMVA 3W90A 1Y9JA 4UDNA 5BMVB 3PPXA 4XX0A 5EEHA 3LW8A 2PMBA 2GBPA 1H2BA 2QPOA 3GVXA 4IXDA 1PLLA 4RXUA 1O95A 1C7IA 2ZWAA 4X45A 3MWLA 3ZXSA 1MC1A 2JZNA 3H5NA 1BMQA 4U6QA 5T57A 2G1PA 2HK9A