3SSNA

Myce methyltransferase from the mycinamycin biosynthetic pathway in complex with mg, sah, and mycinamycin vi
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
390
structure length
386
Chain Sequence
b'EFDEATVQDVVRLAGGHDSELRELTQKYDPAMISRLLVAEILSRCPPPSNDTPVLVELAIVHGSERFRHFLRVVRDSPIRPVGADEGFVGMLVEYELTELLRELFGVTHERPAGVRGTKLFPYLTDDEEAVEQIGTYLLAAQQGTEAVLAGCGSRKPDLSELSSRYFTPKFGFLHWFTPHYDRHFRDYRNQQVRVLEIGVGGYKHPEWGGGSLRMWKSFFPRGQIYGLDIMDKSHVDELRIRTIQGDQNDAEFLDRIARRYGPFDIVIDDGSHINAHVRTSFAALFPHVRPGGLYVIEDMWTAYWPGFGGQADPQECSGTSLGLLKSLIDAIQHQELPSSPGYVDRNIVGLHVYHNVAFVEKGRNDEGGIPTWIPRDFESLVQASS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase
molecule tags Transferase/antibiotic
source organism Micromonospora griseorubida
publication title A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
pubmed doi rcsb
total genus 131
structure length 386
sequence length 390
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.238: Mycinamicin VI 2''-O-methyltransferase.
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17843 MycE_N MycE methyltransferase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.30 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A Nonspecific Lipid-transfer Protein; Chain A 3ssnA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ssnA02
2IPXA 2ZBRA 4QDJA 3VC2A 3EVGA 3R0QA 4QPNA 3DMFA 4IV0A 2EJTA 4E30A 4ER7A 5HZMA 4M36A 2JHAA 1X1AA 2NYUA 2PXAA 4LG1A 5K0BA 5CCBA 5CVVA 4C06A 4ER3A 3OZRA 5KVAA 2AN4A 2V74B 3MTEA 1R18A 3SVZA 5BW4A 3HCFA 1EQAA 1UFKA 5EHGA 2P8JA 2P40A 2ZZKA 3MCTA 3DXXA 3WSTA 4DCGA 5EZSA 1N7IA 2Y1XA 4YUWA 4LECA 4M38A 5K0JA 1PJZA 3I58A 3CKKA 4DMGA 1KPHA 3LBYA 5K09A 5LQUA 5DSXA 1I9GA 5KS2A 4RSRA 1X19A 5FCDA 2G70A 3R3HA 1L9KA 4RVDA 2OKCA 3HCCA 3HCDA 2NXCA 1D2HA 4R6WA 3HTXA 5HIMA 3BKXA 3CJTA 2G1PA 1RI4A 3M6WA 5DLYA 3CC8A 1JG3A 4EKGA 2XBMA 5H02A 3NVKI 5GM2A 3VSEA 5D1HA 1WZNA 2ZVJA 2B9EA 2GAFA 3KR2A 3GRRA 4QQNA 3KPVA 3G8AA 1P39A 3GNLA 3LHDA 5CCXA 3PTAA 1T43A 5E2AA 3R9XB 1WXWA 5FHQA 4YUVA 4LWOA 5K05A 1WS6A 1X1CA 3EGIA 4GEKA 2ZZMA 3R24A 4E32A 3EEOA 1TPYA 3CJRA 5D1NA 3UJCA 3P9KA 4XUEA 4RTQA 4PYIA 1R6AA 3FTDA 3KQYA 2IGTA 1Z3CA 2PT6A 3HCEA 1DCTA 4P7FA 2PX5A 3NVMB 4C4AA 2OB1A 1SVUA 3OCJA 5LQJA 4R05A 3FRHA 3BWCA 3LDGA 1M0EA 1RI3A 3NJRA 5FQNA 1UWVA 3OU2A 1XDSA 1I1NA 3G5TA 3OE4A 3GO4A 4E2WA 4GOND 2FRXA 4A6EA 3UJ9A 1VP3A 3UA4A 5DPMA 5GWXA 3NTVA 3P97A 1N2XA 3BZBA 4HGYA 3EMDA 4R6XA 2BM9A 4GUAA 3SR4A 3A27A 3GJYA 2ZIFA 4KIFA 5DM4A 1L3IA 1QAOA 4E70A 3HA3A 4M37A 3HNRA 4OBXA 4IV8A 3R6TA 5KQSA 1AF7A 2LD4A 1TW2A 2YX1A 2ONZA 5DXJA 2UYCA 4X63A 3ERCA 2GB4A 2VDWA 1JSZA 3LCUA 4PYLA 3DOUA 3B7PA 5DTQA 1WG8A 2JJQA 2XVAA 1G8SA 3M6VA 2JG3A 4AZVA 1NBHA 2P41A 3T7TA 1YB2A 5C1IA 4YUXA 4C04A 5E2BA 5BW5A 5DTMA 1B42A 2QYOA 4C08A 3EVAA 3TLJA 5DTRA 1L3BA 3BUSA 4RTMA 4OX9Y 1UIRA 2IP2A 3DR5A 5EEGA 5FQOA 4H0NA 1EJ6A 5U4XA 4POOA 3KPYA 9MHTA 1VLMA 4RTLA 3PX3A 1XCLA 5CIYA 1YUBA 1DUSA 1JG4A 3AXTA 3PVCA 1O54A 3U81A 2ADMA 5FWDA 2PWYA 3ELWA 5M5BA 1Q0TA 3P2IA 1INLA 2Q41A 1NW8A 3TMAA 5EIFA 2P1DA 5HFJA 3B5IA 4P58A 4CTJA 3BWBA 3EGVA 4FGZA 3CJQA 1H1DA 2FPOA 5C9ZA 2AS0A 1JTEA 4FT4A 2Y1WA 4PINA 2BM8A 3FUXA 1NT2A 3UJDA 4BP3A 4DCMA 1SQGA 3P9CA 1ZGAA 2OB2A 1SKMA 1XDUA 2HNKA 3LX6A 1X1DA 4EMSA 3MTIA 2IFTA 3BGIA 4K6MA 5CM2Z 1NW5A 1BOOA 1HNNA 1KHHA 3DULA 5DX8A 1SQFA 1ZG3A 3OZSA 3SM3A 2NNWB 1QYRA 2PX4A 3DUWA 2HV9A 3FZGA 3EVFA 5E9JA 3BXOA 3PX2A 10MHA 2HR1A 4RTPA 3QV2A 3CGGA 3PLAE 3GRVA 3IHTA 5HIIA 5ERGB 3UA3A 4XCXA 1JG1A 2I6GA 3HVKA 1G60A 1WY7A 1EIZA 3JWGA 4RTSA 3FPGA 1VBFA 3GRYA 2B78A 4QPPA 5T64A 2C7OA 2IH2A 4C03A 2NP6A 2NP7A 2NXNA 3A7EA 1JR4A 3KQTA 3PFHA 4OQEA 2V7EA 5LQAA 3FUTA 4Y2HA 2IBTA 2AOUA 2GA9A 2E5WA 4HH4A 1V39A 2ESRA 3DXYA 3I64A 4U7PB 5E1BA 5C0OE 2VP3A 5EIWA 1RI5A 3LDUA 1IM8A 4DA4A 3DP7A 2C7RA 3FTFA 2QRVA 4ER0A 3OU6A 4P7KA 5EEHA 1KIAA 3LDFA 4PCAA 3P2EA 2OZVA 4F86A 5HIKA 4PWYA 8MHTA 3UZUA 3K6RA 2DPMA 1L1EA 1NW7A 3HA7A 5P8WA 1RJGA 1PRYA 3I5UA 2AOTB 3MGGA 3S68A 2Z6QA 3LECA 3MHTA 3C3YA 3KHKA 5GIPE 1BHJA 4HGZA 3TM4A 1XXLA 3NWBA 1QZZA 3G2OA 4B17A 2YXDA 3KPWA 5E9WA 4EQZA 3RW9A 3FTCA 3UFBA 3DMHA 4EKIA 3DLCA 3IYLW 2PX2A 7MHTA 5EG5A 1M6YA 3IEIA 2FYTA 4LWPA 3T0IA 3G89A 3P9NA 5EKUA 2AVNA 2O06A 2NXJA 1NBIA 2PXCA 2XYRA 4QTUB 3T7SA 3V97A 3KQQA 4IKPA 1VL5A 1X1BA 3KR0A 5G02A 4E2YA 3CCFA 4WXHA 2ZIGA 3CBGA 3JWHA 4RYLA 4PIPA 1G6Q1 1VIDA 2C7PA 2BR5A 3SSMA 3MAGA 1FPQA 3THRA 3LSTA 3FYDA 4DF3A 4GOMD 3KQSA 2JH9A 2PY6A 1MJFA 4CKEA 4PYMA 5EMKA 3VC1A 2GLUA 5CD1A 2IIPA 3GU3A 3O31A 3BWMA 4RV9A 1BC5A 3HM2A 3NDJA 1I4WA 5BXYA 3HEMA 5E8RA 1JSXA 5FA8A 3MERA 3OFJA 5B1SA 3SMQA 3B89A 5EC8A 1EAMA 5CVJA 5CVEA 2B2CA 2WA2A 3KQPA 4QVGA 3EVZA 4PYQA 3JWIA 2UYQA 4RTRA 2IH4A 4AX8A 2XYVA 3A25A 3E05A 5FUBA 3EMBA 4V0QA 3M6UA 5ICFA 4ATNA 3AWIA 3HVIA 5K03A 1RJDA 5K8VA 4YUZA 5E1DA 2N47A 3M33A 4KDRA 4C05A 5F2KA 1YZHA 3ELYA 3AJDA 3ER8A 3G88A 4M7RA 4CWAA 4DQ0A 4RVFA 5EZQA 2GS9A 2WK1A 2NXEA 1U2ZA 2P3QA 3HCBA 4ISCA 1FP1D 2YXEA 4OQDA 4ER6A 3D2LA 2Z6AA 4BY9E 4GC9A 1YFLA 3IV6A 1JG2A 2XVMA 3ER9A 3C0KA 5LSAA 2PX8A 2OY0A 4PYKA 1ORIA 2AR0A 5CUQA 5HOQA 3QOXA 3TM5A 1EG2A 4RTOA 3I53A 5CVUA 2EG5A 3C3PA 3GRZA 4KVZA 1RI1A 4X41A 1D2GA 3ELDA 5DWQA 5E1MA 4E2ZA 2ORED 2JHCA 1G8AA 2PGXA 3LCCA 3AXSA 3FUUA 3HVHA 3EEYA 5EMLA 3NMUF 3LCVB 2B25A 2P7HA 3LKDA 5DSTA 2AOVA 3SX0A 4BLUA 5LQNA 3O4FA 4HC4A 5KYGA 2YQZA 2ZBPA 2EJUA 1KPGA 1O9GA 1KYZA 1R74A 3FUWA 3M4XA 3P71T 1JQEA 4FZVA 4GF5A 2GH1A 4QTTB 5IKMA 2PSSA 3G5LA 3Q87B 5JR3A 4HG2A 3SSOA 3E23A 1DL5A 5GIOE 3ORHA 4FS8A 2CMHA 2ZWAA 1NW6A 4Y30A 3REOA 1QANA 5F2OA 4KRGA 3CVOA 2O0LA 1P1CA 4YMGA 4L7VA 4YV0A 2CMGA 4PCLA 4ZTBA 1N7JA 3LGAA 1Y8CA 3P8ZA 4QQKA 3A4TA 4OBWA 5FADA 2PVCA 2ZULA 3KKZA 3SSNA 3KQMA 5LQCA 4MHTA 4U7TB 2H00A 2P3LA 5FA5A 4KW7A 2PLWA 3K0BA 5K0NA 2OXTA 4YV1A 4X1OA 5LQRA 3C6KA 1TW3A 2AOXA 4HRAA 2OPBA 3OZTA 1FBNA 4PIMA 4AZSA 1AQIA 4RTNA 3BT7A 4PGHA 2R6ZA 2FCAA 1F3LA 2PV0A 4BLWA 2I9KA 5K0GA 2PT9A 5K0LA 3BKWA 3FRIA 2PWPA 5DM0A 2WA1A 4PYOA 2UYOA 4HTFA 4FSDA 3EVEA 2YTZA 1MHTA 5K0FA 3PB3A 2P7IA 4DKJA 2AOTA 1JQ3A 2QM3A 2OO3A 1AV6A 2G71A 1QAMA 4MIKA 2H1RA 5EMJA 5E1OA 3MCZA 3KR9A 2YUIA 2PKWA 4YV2A 2I7CA 4Z2YA 4XUCA 3TKAA 3UJ7A 3P2KA 3THSA 1NE2A 5DX0A 4O29A 3DH0A 3G2QA 1OR8A 2AOUB 1R8XA 4PGGA 2ZSUA 3GCZA 5DT2A 3M70A 2QY6A 2FHPA 4QDKA 5EPEA 2VZ9A 2ZZNA 3AY0A 5DM2A 4RWZA 1QAQA 3TOSA 1YFJA 1FJXA 3TR6A 2ZWVA 5EKXA 1O9HA 4E2XA 3BGVA 1G38A 2F8LA 2VS1A 2IBSA 5F2NA 5GP1A 5GM1A 2ZIEA 5T67A 1NV8A 2K4MA 2O07A 4GC5A 4EK9A 1SUSA 3EVBA 3TRKA 5KQRA 3LBFA 3B3GA 4HSGA 3HA5A 4MTLA 3BWYA 3GRUA 3TPZA 3FYCA 2YVLA 2DULA 3A7DA 1JTFA 5ICEA 5HIJA 3G2PA 1R00A 1XJ5A 2ZFUA 3G7UA 2P3OA 3LKZA 2VDVE 2PBFA 1KYWA 3LL7A 4X61A 5BP7A 4CXMA 4MWZA 1NKVA 4PONA 2AOWA 1VPTA 4AUKA 3TFWA 4UOEA 4G56A 3UWPA 1IY9A 5JUWA 4DM3A 5LR6A 4WVLA 2BR3A 4P7GA 4CKCA 2PJDA 3EVDA 3FTEA 2CL5A 3E8SA 2ERCA 3V8VA 4P7JA 5EVJA 5IH3A 3GIWA 2AN3A 4GOOD 2FK8A 1ORHA 3C6MA 4FR0A 4CTKA 3F4KA 5E8JA 3ANXA 2JH8A 2JHPA 1KXZA 3UBTA 3FPJA 3KU1A 4CKBA 4RVGA 5MHTA 3G2MA 4RVHA 2R3SA 2BH2A 4GQBA 4V0RA 2O57A 4DZRA 1D2CA 4GOLD 3PS9A 1F38A 2ONYA 3GGDA 1RI2A 1EJ0A 3NDIA 4YUYA 3HVJA 3NWEA 4FT2A 1XCJA 4EVIA 1NW3A 2HWKA 5GOZA 3UJ8A 2QRVB 3X0DA 3DXZA 1M6EX 3EGEA 3O7WA 4KDCA 1KPIA 2GPYA 3EPPA 3UJBA 1ZGJA 3B3FA 3GXOA 3I9FA 4F85A 3OPNA 1G55A 2QE6A 1P91A 3L8DA 4GBED 4PYNA 5FTWA 1Q0SA 1RJEA 2IDJA 3FPHA 3RIEA 3H2BA 3HP7A 2ZCJA 3E7PA 4KWCA 4R8SA 2UZ4A 1XTPA 3ME5A 1ZHFA 3EVCA 5HEKA 2C7QA 3KPUA 1FP2A 4RTKA 1ZQ9A 1JQDA 1XVAA 5K0CA 5E9QA 3KR1A 1BKYA 1SUIA 3UJAA 3DMGA 5DM1A 1SG9A 4E33A 5K0EA 2PXXA 2XYQA 4C07A 4ER5A 2AN5A 3FPFA 4A6DA 5DXAA 2KW5A 4FP9A 3TQSA 1AQJA 4KIGA 3DLIA 4AZTA 1YZ3A 1ZKDA 2ZBQA 3PFGA 3GDHA 4BP1A 2CKDA 2I62A 2P35A 3KQVA 3ELUA 3ID6C 2IH5A 2ZW9A 3Q7EA 4F84A 3QOWA 4RTJA 2AVDA 3UJ6A 3B3JA 5K01A 3KPJA 3MB5A 3MQ2A 4XUDA 5DRTA 4QVKA 5GINE 4HTFB 2AZTA 3KQWA 1HMYA 2CWWA 3KQOA 5EQJB 4YMHA 1L3CA 3FUVA 2ZLBA 3OU7A 3RODA 5EHIA 1VQ1A 2O05A 3A26A 3OFKA 2H11A 4PNEA 3LPMA 4X60A 1RJFA 2UYHA 1NV9A 2G72A 3TKYA 4PYJA 3SGLA 1VE3A 2YXLA 2ZTHA 3NW9A 2OBFA 5ICCA 5FWAA 5HILA 5T6BA 5LQKA 5EOVA 3PT9A 2OYRA 1VP9A 2VDUE 4R8RA 5FULA 2A14A 3JWJA 4FSXA 4RX1A 1R8YA 3HCAA 5DX1A 4OA8A 4AZWA 3M6XA 3P9IA 5ICGA 3DTNA 2Z6UA 3T7RA 3VYWA 1YF3A 5FHRA 4JXJA 2EX4A 3BGDA 1WXXA 5CVDA 2BR4A 3G8BA 2G8NA 5EGSA 2FK7A 4NECA 2YR0A 4OA5A 2B3TA 1KR5A 3OE5A 1IXKA 1P1BA 2HMYB 4MQ4A 3SXJA 5DRYA 2BZGA 4IWNA 3FPEA 5EMMA 4BLVA 1KP9A 1XDZA 4E31A 2EFJA 2IDKA 2HTEA 3GWZA
chains in the Genus database with same CATH superfamily
1DIOB 4HGPA 1KSFX 2FPGA 3E9ZA 2ZJ3A 2I2FA 3L06A 3RBZA 1E6LA 3HWWA 1RJWA 6CHYA 2JATA 3GJ5A 4K5QA 4QULA 5HJ2A 4ZCMA 4CR6A 3SKYA 5BW8A 3B52X 1Q1GA 1E8DA 3C6BA 1GAEO 2C4TA 4DR6B 5CCEA 2CFUA 1UT6A 2AG8A 3IOMA 3P5SA 3FWNA 4KKVA 2V4ZA 1N6PA 2XGGA 5GONA 4ZI5A 4DAOA 4XIJA 4KLNA 3C39A 1OU4A 2FSGA 1SKQA 3H4IA 4IEFB 4U7WA 1PX2A 3KZXA 4DNFA 1Z28A 5JBQA 5BSWA 3FYHA 2EJWA 2Y1XA 3LZCA 4PPYA 4WNIA 3L92A 1YA8A 4DBLE 4W6ZA 3QLVA 5KYWB 2QV0A 3R0JA 3DCIA 3NT4A 4ZV7A 4QQRA 4L78A 1LDYA 2GTHA 3B36A 4UU8A 1NVWQ 1MO4A 3N0WA 3BIOA 2SCUB 4UNPA 1Q22A 4LNHA 4EG4A 2EWMA 3S2ZA 5FCDA 5JNUA 1UIMA 3AEKB 2G70A 3Q2KA 3VKUA 4L9AA 7REQA 1EP9A 3NC0C 1IJBA 2Y67A 4RACA 1ZVMA 2XUZA 3BXFA 2GM3A 3GOHA 4J7AA 4DIFA 4KO3S 1JPVA 4K9MA 5B64A 1UBTS 1ZCAA 4I9GA 4PBRA 2PD4A 4BVEA 2Z0MA 1E62A 1URPA 3PC3A 4IKEA 3KCNA 4DMMA 3BSFA 3UHPA 4EPYA 4UEQA 2QAIA 3T9BA 1XTTA 1DAGA 3CRW1 4Q3DA 2XUQA 4IGEA 1X1CA 3NTOA 3WL8A 2MSKA 3KTDA 4E32A 2B6NA 4P3YA 4FZ5A 4ES6A 1TPYA 3U3ZA 1KZHA 3P9KA 3P2JA 4PYIA 1NG1A 1TK9A 3HPRA 2DPGA 2XRFA 4S05A 2RK3A 2I03A 4O0LA 5I48A 1DE0A 5ESXA 1ILEA 4ZK6A 2CUTA 1V8PA 4I36A 3VU1A 4F12A 2CVPA 4FB5A 2F1KA 1V1JA 2OB1A 2WUDA 1QRTA 1LI4A 2VP0A 1ZJJA 3WYNA 3FCCA 3WRWA 1WLSA 3U6BA 3OE4A 3Q8MA 1IWPB 3NGLA 3SX4A 4DLLA 4A6EA 1FJHA 4FHGA 4Q7LA 2KM1A 2D3WA 4TL7A 4PG8A 3EXHB 3BAFA 1A8HA 3UUWA 3N2GB 1YL7A 4YAIA 3ENVA 2B83A 3A11A 4FMDF 3W9UA 5LKRA 1NVGA 3TQIA 5BN4B 4YAWA 4WBSA 2FPMA 2CZGA 3NHJA 1I2AA 1Q5PA 4MPTA 1ISHA 2X5KO 3WRXC 2J9FB 1DG3A 1GJRA 2ATEA 2D0OB 3HNOA 2NPOA 2YX1A 4YRTA 1WUIS 5A9TA 3VDMA 4HDOB 2QQ5A 2D1RA 3H9BA 4C2BA 2UYCA 2YVUA 1L5HB 3EXG2 4WDQA 5TQ0A 4G85A 1WQ1R 3F8TA 1PL8A 3M34A 1UXJA 2XVAA 2O4UX 2F8MA 3V4VB 1NBMD 1EFHA 1G59A 4DL9A 2QYOA 3IIJA 5J4HA 4BTEA 5DLEA 2WYUA 2AI1A 2ZRNA 3DR5A 1S7CA 1I7DA 3BJRA 3LSYA 5U4XA 3ZCVA 4O4JB 3T3EA 2POCA 2WFLB 1NNSA 2ZT5A 4X95A 4BNHA 1DUSA 1AUOA 4RM2A 2VWQA 4PX3A 1WRBA 4BV8A 1VHJA 1NXSA 1W4BA 2PPVA 1QP7A 4MZDA 2QQ0A 3IBCA 1D07A 1B26A 4IQFA 1PG5A 2H17A 3U5TA 1ZD5A 1EBFA 3PRYA 4GKVA 4JFRA 2WYVA 2XUOA 3LQRA 5CJPA 2GNOA 5IJ9A 2DQKA 2FPOA 2ORVA 3KT3A 4FUQA 1M1NA 4UE3S 5EPOA 1ZUWA 3UAOA 3HMKA 3GOQA 1KMHA 2HNAA 3OSZA 4JQSA 2UDPA 2UV8A 3N07A 4LPKA 2FSPA 2JAHA 4EMSA 2HB6A 1B3BA 1J7KA 1KNXA 4FN5A 4XIIA 1NUHA 1HNNA 1T0IA 3QKRA 4YP5A 1SQFA 5TS2A 3SM3A 3UMFA 2NNWB 3U6KA 4C4YA 3T5PA 5AJYA 1DKNA 1AKNA 3PX2A 5A3JA 3LTEA 1V9SA 5LPNA 3IQIX 3CLVA 5C4IA 2TYSB 3IHTA 4Z86A 1JDPA 3AR5A 3P0IA 4GOKA 5ERGB 4PG5A 5IKPA 1TQ4A 2IYLD 3IEUA 1EIZA 3KWLA 3RR2A 3TOXA 1SIBE 1YTUA 4QM6A 1BXKA 3AW8A 2HL6A 4MVJG 4KK4A 3AI2A 1E0JA 4URFA 1P44A 4GXRA 3IDSA 3PFHA 2OAGA 3HKBB 1M1ZA 4RSMA 1W96A 1IULA 1WOMA 3E8MA 1V35A 1II9A 4NV3A 2VDPB 1GNQA 2C94A 3GIDA 1V39A 1J24A 4N1AA 1JQAA 3ORYA 1BZYA 2V7PA 3GGGA 4BQNA 1AV7A 2ZUWA 1GADO 1K6XA 1TKCA 4LOKA 4CKWB 3CR3C 1NULA 4LXIA 4NCNA 1KIAA 2OV4A 3L4BC 3L8YA 2G9NA 3SBDA 4BGVA 2CLSA 4D9CA 2FWPA 4EGAA 5J40A 3CLUC 3OM1A 4II7A 2M6LA 3BK1A 1VDMA 3HA7A 3GG2A 1JQBA 1IG0A 4O4HA 3DF7A 4HDQB 4EO7A 1KK1A 2GXSA 2QY9A 3GJQA 1RAAA 1CP3A 3HP1A 3K0FA 3H99A 5ALLA 1O6ZA 2VHJA 2HMWA 2CC2A 1RLIA 3GCWA 3DMHA 5DHTA 2GEKA 1E96A 2YWXA 2WJIA 5DT9A 2F43B 5JS2A 1V7PC 1TUBA 4PCVA 2NG1A 4ZO7A 5FI0B 5EJEA 1KSJA 4B3MB 1XQ1A 3QBDA 1G3IA 2G7ZA 2OV6A 1K66A 3SKXA 4AW9A 1US8B 4UNRA 2M1ZA 4KB5A 1EI9A 1I51A 1OU0A 4NNJA 3TJMA 3UWDA 1OBHA 2CNDA 2QTBA 3BXEA 4M9XA 2N1MA 5EXTA 1TCCA 3O5AA 5TJ9A 3J81k 4ITUA 3IE2A 4QQ8A 4KPYA 2Z58A 3THRA 1NQAO 4HUQB 1LTQA 3G7SA 4GOMD 3NHBA 2TSYB 2HWUA 2JH9A 3KQSA 2GNAA 1MGOA 4EI7A 3RFUA 2WJ3A 3SIRA 3I73A 3EDYA 4KX3A 3P26A 4G81A 4LMAA 5LDDC 4J3JA 1CQJA 1LK7A 1N0VC 5JCOC 3HEMA 1I0IA 4MQLA 1P4GA 2FU5C 3OWXA 3KOMA 4NS4A 5F7JA 5FORA 3TIVA 3W5IA 4B83A 1EAMA 3BWVA 4UPEA 1E59A 1OD6A 4NCJA 3GPLA 1P8JA 4MH0R 2O7QA 4QVGA 5AJHA 3OPYA 4LHSA 3DEFA 3JY6A 1MH1A 2BP7B 5JQWA 3PD1A 1T8SA 3O1IC 5A62A 1IBKB 1EUQA 1HPLA 5GQSA 4MUYA 4C6HA 2XNDA 3C3AA 3PGJA 3I6ZA 4J9UE 4MUEA 5FPKA 2R79A 4RZHA 3ICWA 3Q7SA 3QPCA 4Y18A 2C04A 1J9ZA 2QL5A 3SZ3A 5A02A 3CNQS 3TIXB 2IIVA 2RCNA 4M7RA 2Z2IA 4MA0A 5KAPA 3DEHA 4BCCA 4BB0A 1DUVG 4WCFA 3KRTA 1BJTA 2QUIA 4A26A 1W94A 1KIFA 2FWBA 2V5VA 4XPIA 3C4JA 1B8OA 1XKQA 2YXEA 3PJDA 3HWX1 1HEIA 1Q7EA 2HK6A 1XEWX 3ASUA 4ER6A 1KMCA 4X00A 1U7DA 1EBUA 5TQ0B 4QA9A 2X0DA 4BWFB 4EW2A 4PICA 5AK4A 3SYNA 1MX9A 1NYRA 1ORIA 1KY4A 2G5PA 1U98A 2OBYA 1U8ZA 4NBNA 4OVKA 1P6XA 4JA2A 1NLZA 3AGPA 4V0MA 4ZA2A 1ZLXA 4M9CA 4E4YA 5B7NA 4NEGA 5CLJA 1AN9A 3HVHA 3A3KA 3QKSA 4H1TA 3NMUF 4HLNA 4BIMA 3LKDA 1WULS 3OHSX 5UKDA 2AOVA 3UAGA 3OAAA 4YJFA 1TAUA 5A6SB 5I9SA 3TRJA 3OC0A 1T4DA 2C97A 1I6WA 3GPCA 2M6KA 1TU0A 3FVQA 3TRFA 1S4QA 4OKSA 4J2OA 2BZSA 3VO9A 4QQFA 5KOJB 1X74A 2ZR9A 1KDZA 4YCSA 2C2KA 2IEYA 1HE3A 4RPKA 4M60A 4UNSA 2A59A 3WJ7A 4JCOA 4KX5A 3K1JA 5KSPA 1UMDB 4Y1EA 2PUWA 4IQ8A 4YMGA 1W4RA 3VKWA 3P8ZA 4TROA 5FOUA 3A32A 3LPDA 4M8SA 5LQCA 3CLTC 4JT2A 4MV7A 1EVZA 1GPBA 5KIAA 3LGSA 2KPOA 2AJTA 4IIHA 2OXTA 1ZS9A 3FMOB 3GLKA 4CT5A 2FN9A 3K6JA 3K4QA 1XMPA 1ZHOA 1PIWA 1FXWF 3FRIA 3MRVA 4WY8A 3IP5A 3RSQA 4K0RA 4L4XA 1NONA 1SH7A 5DCWA 5IXYA 4LK3A 4UZSA 1FTYA 1MOQA 1NVVR 2HSDA 3B7GA 1SBTA 3I2JA 1C4KA 3OMLA 2R751 3C15C 3OZUA 1Y8AA 4I55A 3A9VA 2HF7A 3A28A 3CCBA 4MIKA 1H66A 3M6FA 2AGVA 4I1OA 2J4CA 2XUFA 1IATA 4F04A 2W8BA 1L5HA 1L5ZA 4B3TB 3EA5A 2QTVB 2XMZA 1PL0A 4E12A 1LI7A 2AOUB 2QP9X 1PTJA 1M54A 3GK3A 4GLJA 4PQGA 4DAEA 4RD2A 1GUZA 3OFVA 3DL7A 1II8B 2WIBA 1W0KD 3PYXA 4RWZA 4Q03A 1PQYA 1VIMA 2WKSA 3TNYA 3DE7X 4YC7A 3GW8A 3N2GA 5IBCA 3S81A 2J3JA 3UCEA 1NOJA 1DIGA 3UK7A 1IZ9A 2ZJ1A 1CJCA 4GLLA 1GRQA 1EGMB 3EUEA 3IT0A 2CMFA 3D8SA 1C80A 1UAGA 1Z73A 3EWAA 2RC5A 3DLTA 2H59A 3HN7A 4MRMB 1VI2A 5TV2A 5EJ9A 2J45A 3GGSA 3GRUA 4X93A 3C3WA 4CLRB 2HXSA 3KQNA 1XRRA 4BDSA 5JFTA 2QJRA 5ARCA 2ZUUA 2FWRA 1YASA 3QLEA 3LKZA 2QP3A 3OEEA 2RGDA 2Z30A 1NKVA 2ETVA 1JP7A 3A6KA 5C46F 3WMEA 4OJKA 4MINA 5MN5A 5ELXA 2AV6A 5DBHX 1PJTA 3C5EA 1VXOA 1ZCFA 3VHQA 3RAEC 2PJDA 1EWQA 3L46A 3FTEA 2VAVA 3TSOA 1YAHA 4LZNA 4JJGA 2Q9UA 4P93A 5K4AA 3KDSE 1E6UA 1W30A 2JFBA 4F97A 3F4KA 3ZLBA 2FUKA 4WLFA 2CEKA 5K51A 2D0PB 3RHSA 4RVGA 1FFDA 1ND5A 4LRYA 2ST1A 3OQOA 3GLHA 1CVRA 1RVV1 3ER6A 4G01B 2O57A 5YASA 3EG9A 4A8JC 3CT6A 5JXHA 4JBLA 2ONYA 4R84A 2JDID 5CDTA 5KB3A 1TA0A 1ZNQO 3QHAA 2ZRBA 3GN2A 3T3PB 1JHYA 3B6EA 4BLOA 4LY9A 4CL2A 4HEHA 3Q6MA 2EL7A 2VJOA 2ZI3A 4P32A 5ALRA 5F78A 7MDHA 1PK8A 5IEJA 4MW0A 2YOHA 1RCUA 5G1PA 4JELA 4B0OA 1CE8B 3WDSA 4AP5A 3UJBA 4BX0A 5A5DA 1IBRA 1R1DA 3I2GA 2JIOA 2VP9A 1A9ZA 5F1OA 4F8EA 1G41A 1XAJA 2O1SA 3V8NA 4MRRA 1CDOA 4TV8B 5HQJA 2ZCJA 5JJLA 4BNKA 4FGSA 4KO4S 5GMOA 2YWEA 4FFMA 3U4IA 4MJXA 4URZR 4YREA 1Q20A 5JD4A 3JQ7B 3EVCA 4K9PA 1PBTA 1NQWA 1FDTA 1R6TA 2JIDA 1Y0BA 1JQDA 3SFVA 1SHJA 4U2GA 2ZT7A 4GG1A 4GDFA 5CLQA 3DMGA 5DM1A 5BWOA 4BLTA 1OLSA 5AHXA 5LKAA 1CDEA 3KKPA 4YPVA 4IOMA 4BV9A 4ZU3A 3H1PA 1SU7A 3K1YA 3L7AA 4EW3A 4R69A 3K1ZA 1IUOA 3O0DA 2Z4TA 3M7IA 2KSHA 1ICEA 2YRWA 3O8OA 4IDNA 2D5LA 1LTHR 1NF2A 4XJXA 3E5NA 1GAWA 3JCZA 1M3SA 1T5HX 1LPSA 3I1IA 1USKA 2IYNA 5CW2A 2EKLA 2VQ6A 4O4IB 1X7YB 3B3JA 5C18A 3ZNOA 1LBHA 3UMMA 2XPCA 4RS3A 1PZFA 2GLTA 2XUAA 2D4AA 4MR8A 4QBHA 2QPTA 4XJTA 3EBOA 3TX2A 2WWRA 3MRSA 4QEZA 2O05A 5KREA 3A10A 3OY7A 1NDQA 4QUEA 2BIFA 2ZCUA 3HY4A 2D7CA 3N39C 3STHA 1XKTA 3ZW9A 3L6DA 3AKYA 4BQIA 3IAM1 5CB0A 4P4GA 3W5CA 1RMYA 4I6GA 3VYRB 2ZSJA 4L4ZA 3HH8A 1Z74A 3VJKA 4MW7A 3WY9A 1F2TA 2Q4RA 3ZDEA 2HIHA 2VJYA 3HFJA 2BEUB 2GESA 1RQPA 3PCTA 4AMGA 4R5HA 4OA8A 2CUNA 2AJDA 2CXTA 4BO0A 2PQ6A 5ICGA 4QG7A 3R23A 5IVDA 2GYUA 2DUNA 2JDIA 2RARA 2H1FA 2D1SA 1UPFA 1QWOA 3JRXA 2GM5A 4KPGA 2X5XA 2ODPA 1HT3A 2CXSA 2DWUA 2RCYA 3AESA 3G5UA 4FMCB 4YRDA 4EPRA 1KR5A 1I1QB 3EGOA 1FS5A 1WR8A 2HMYB 1KTVA 1RYZA 2A78A 3AHEA 3HJGA 4KIJA 3SXJA 2DJIA 2ZR0A 2A2ZA 5JRZA 3IDFA 1UDAA 2OORA 2DBYA 3RS0A 3V2GA 2ENWA 3C5VA 1M6VB 4PLGA 2BMJA 1KK3A 2UUOA 2IP1A 3AFGA 1BDMA 4YRNA 4IV0A 4E88A 3AGQA 1CF9A 1NR1A 3C3KA 5CVVA 2QORA 3EA0A 3LQ1A 4IR7A 3E6AA 4JWKA 2VFAA 1RTKA 3RAPR 3RI3A 1NXOA 3UMRA 4Q9HA 3W7AA 5BR8B 5EIXA 3H8JA 4LSMA 2ZQZA 2BFOA 1T3HA 2QAJA 2CB9A 2XWJI 2ZSAA 4GYKA 4HTAA 3TINA 3ZJYA 4M38A 1N9ZA 2DUWA 4DLRA 2BM1A 3W8FA 4PIVA 3AVUA 3AUSA 1QYWA 2Z2XA 5D5PA 1E9VA 2DYKA 1KPHA 4O0MA 2WWYA 4Y6RA 5AW6A 5DTJA 3U13A 3PNQA 1BW9A 4ZI2A 1XFDA 3OCYA 2W7TA 3LH5A 2ZCVA 4P8RA 1HFKA 2DB3A 4JB0A 3VOTA 4PLFA 1B15A 3C97A 2PCJA 2I7VA 4ECEA 4EJFA 3JAMA 3NVKI 4TRMA 3NUZA 2LIPA 4HGNA 4EUHA 2C2GA 5HR5A 3JPYA 1S8AA 1DBPA 1ODIA 1CNMA 3KB8A 3ONWA 2K7FA 3E0XA 4KLAA 1L7DA 2K7ZA 3WMGA 1PT8A 2Q9BA 3GAMA 1BW9B 1WW3A 2DFLA 4RJTA 4YAEA 1C7JA 1PZEA 5BWLA 4ZKEA 4OJQA 1DDGA 5FUWA 1QQ5A 2OGUA 1PHRA 4EUNA 2ZT8A 3P4UA 1K5DA 3TB6A 2BLNA 1XKXA 3KYCA 1W2GA 1QK4A 1N77A 3FOCA 3QA3E 1EG7A 1VA4A 1WU8A 1IZYA 1Z3CA 5DI3A 4B4WA 2OCLA 3Q85A 5ISMA 1C9MA 1H2BA 1XHLA 4N76A 4HDNB 2WJ4A 1KIMA 4TYQA 4Q0MA 1TAGA 1IK6A 1QLJA 4PS1A 1NMQA 3K0AA 2R65A 2ECFA 2QD1A 3D6VA 4ARIA 1QP0A 4TKLA 5JI2E 3BL8A 2NPFA 1SCQA 4DJAA 2VP2A 4WKBA 3EX7C 4PSAA 3S8YA 3P97A 4Y8VA 4ZYVA 5CM8B 3F4LA 2CLHB 3FSGD 4ICIA 2DMRA 4N5LA 3T94A 2B21A 4IAOA 5CX1A 5HWSA 2HCRA 2HEIA 5MGBA 3GJYA 1NJ1A 2OEPA 2O8EA 2EW2A 2FZLA 2HDOA 2H51A 2MSNA 3CRZA 5AW0A 4AYTA 2LD4A 1UOPA 1N8KA 4H7JA 2K5UA 2OD2A 4OHRA 4XDZA 1EJBA 3B78A 1IHXA 3OE1A 4HHEA 4M0CA 4M7WA 5B3JA 5T57A 3VNQA 4CV1A 3TAUA 3B8HA 3K5WA 4JLOA 4AS2A 4YRLA 5AVKA 1JLKA 2ZROA 4LXYA 1JAIA 4GL4A 4IJVA 2JJ1D 1E3SA 4QHSA 1X0XA 2A1UA 4W82A 4F9GA 1AHNA 1GVHA 1E7WA 4P08A 2PSEA 5KUTA 1GKKA 3EOAI 1QG0A 5SZHB 3WISA 4RTMA 3TDMA 1YO6A 5AW8A 5IC4A 3A36A 3KPYA 5A4JA 5F5LA 5GPBA 2SHKA 1VA5A 3FNIA 3N0VA 2GD6A 4IINA 1GD1O 1MV5A 4RJKA 1PGNA 1EK0A 3PVCA 1RMTA 4DWVA 1L5VA 2C8JA 2AG6A 1PEAA 2EX1A 5DBGA 4MR8B 4N8EA 3PE6A 3U9SA 1YR1A 3WL5A 2XHEA 1UWKA 2XUIA 1F0KA 1ZUD1 3AZPA 1JTEA 3OIWA 4PC6A 2WD7B 3N05A 4QU9A 4H6VA 1ZH8A 1I4OA 1XDUA 4TZ6A 2CHQA 4HZIA 4PC7A 4EB8A 3T3HA 1N5KA 3TKLA 4DR2B 3MTIA 2V7VA 4K6MA 5CITA 1KRXA 1X0VA 1KHHA 3DULA 2MSEB 3EDQA 4MV0A 4ND7A 4QGSA 4I66A 4MS3A 3DUWA 3RC1A 2HV9A 5CXQA 4E5NA 4RK4A 2B30A 3N6RA 3SF8B 1MV8A 2NU7B 3H5WA 3R0XA 4Z9AA 1B43A 3LY7A 5AJTA 1WXQA 4CDGA 1M2KA 2FEPA 4WK2B 1F2UB 1M2GA 2P30A 3LWZA 3FB4A 3VGJA 4D9GA 3MUOA 1R6BX 3LCRA 1CVLA 1VL1A 4Y2HA 3CWZA 1UPAA 3T0GA 1YKSA 1Z0FA 3AILA 1QH8B 1B6GA 5MF6A 3ADDA 1JMKC 2VEOA 3CLSD 2C57A 4KZPA 3ZR4B 5E1BA 4DJFC 4NK5A 1I1HA 3RDPA 4JKOA 2VP3A 2AMLA 1XT6A 1R5NA 3D8NA 2GZAA 4Z4GA 4U9UA 2OLEA 3JQRA 1BE8A 4WADA 3I4FA 4INAA 2O3TA 3QMMA 1CUFA 3P9XA 2VPPA 3QFSA 1Q15A 3H5TA 4KIWA 4C20A 1SKUA 2PGJA 4RANA 2MINA 1H4QA 3I5UA 1CUWA 1DU4A 3IT3A 4F4IA 3TTSA 4IM7A 4CBVA 2HH9A 4ANFA 1QJCA 2HO5A 5E6SB 3KPWA 2APJA 1HYQA 4PZLA 1UOEA 4GWGA 3D0RA 1ANKA 3GMTA 4OXXA 2PH3A 4NP6A 2PHZA 5K3CA 2PNFA 5J2TA 5K3OA 3V7UA 4YT2A 2C84A 2VP6A 5CG1A 1E5LA 4QDZA 2VDQB 1L5QA 5EERA 4X62B 3VR4D 2ZS7A 5C2JB 4BNUA 1H6DA 5KTKA 3ZCRA 4IX1A 4BLSA 3IAM6 3M81A 3IE1A 2BSQA 2XECA 4HXFB 1KJYA 4IKPA 4Z7OB 3D0OA 4E2YA 1FLAA 1N6RA 1FS4A 3GJRA 2IODA 4LJ7A 4DLBA 2JIBA 3TTVA 4Q00A 2PZEA 3DMNA 2BCGY 2WBLC 1JIXA 4N5DA 2NOAA 4D9JA 3VZDA 2RAFA 2BDEA 1R0ZA 2XUHA 2QAGA 3OQBA 4L8GA 2A1IA 3ORRA 4R2HA 5BSEA 4HH0A 3VNVA 4EABA 4S1NA 3LFHA 1V47A 3G0BA 5LUAA 1SU8A 1WF3A 5KAMA 5CDSA 2IP4A 4RD1A 1OROA 1DDOA 1I4WA 3QPDA 4ZREA 3S70A 1QE3A 2HIMA 2NM0A 4D9HA 1STOA 4Q3NA 1BAPA 2VT7A 3OZVA 4MQFB 5DLDA 1G8KA 1YGPA 5DE3A 4MKIA 4YASA 2WA2A 1C30A 5JS7A 1Y3FE 2GFQA 4C3UA 1JH8A 1QSGA 4PZYA 1YCDA 3L79A 4JLWA 4DYVA 1R0BA 1E7SA 3U17A 1N1GA 3N2EA 4AF6A 1VECA 3CS3A 3OM8A 1XNQB 4B44A 4G4JA 1EFRD 3JRNA 1GKYA 1D0VA 3I2FA 4P84A 1G7CA 4EBBA 4XDYA 1PR9A 2N47A 3LX4A 4FMCF 4QHTA 4K03A 2H1WA 4LXUA 5TF4A 1J23A 4DJEC 1Z6AA 3VNSA 4J0JA 5JH7B 1QP4A 1Y89A 3E3OA 2NZXA 4HXEB 3DKIA 3L8GA 2ZS8A 2QN6A 4OMDA 1PQUA 1D2RA 2ZZMA 4XAQA 1U2ZA 4ZOAA 1QF7A 4ZPJA 1W93A 4JI3B 1P4JA 4H4DA 3X43A 3UPUA 3AMVA 3K53A 1SK8A 3NBUA 1GL7A 1SA0B 4L4YA 3TN7A 1QNLA 4RA6B 4LBVA 3IJPA 2ZJ2A 1LSOA 2XYGA 3HXMA 1VHTA 2WU1A 1POWA 3VA7A 5LDHA 1KJZA 4YI5A 3T4PA 5CVTA 3SQXA 2PGDA 4QBFA 3PXAA 1XZDA 4HQLA 2B25A 4KLRA 4HNAB 4C7XA 1W2WB 3AVOA 2X13A 3WAGA 1EUZA 4C22A 2H52A 2J5KA 2ZRFA 3QKIA 4DM4A 4NATA 2OK7A 1ZL2A 2HMVA 5LYJB 4HH3C 2W58A 3RCBA 1WB9A 3Q3EA 2YYYA 5ALHA 1R10A 2G1AA 5SV2A 1Q6YA 4TM8A 2VRCA 5A7FA 3SSOA 2X0EA 4FDLA 3PFNA 4FZJA 1DC4A 2WP8J 5BORA 2ONJA 2GBIA 1VLLA 1YH3A 3RV3A 1PFWA 4KRGA 5F73A 2BFAA 3O93A 1P1CA 3PDCA 3PHJA 3PQEA 3QWHA 4L7VA 4LCEA 2BEKA 1U0EA 4CLOB 5IZCC 1EVJA 1PGJA 3ESRA 3CVYA 1WD7A 3EIQA 2Q5EA 1KYTA 2JK1A 4RZ2A 2O8BB 3K0BA 3OT4A 2WWTA 4GGOA 4H1WA 4FMBB 3R9KA 4ZEOA 2IWHA 2FXVA 3CUEF 1GQSA 3H83A 1NNLA 3MYYA 3OJ0A 2QL9A 4MV4A 4HB4A 1RABA 2PH5A 1SA0A 2R6JA 4N8SA 2PWPA 1IY8A 3PFKA 2DTEA 3CSDA 1T9HA 2PZFA 3RS5A 2PLAA 1KO4A 3CTMA 1HBJA 1JQKA 4IPTA 4FOOA 1CY0A 2GBCA 3DE1X 3EF1A 5C53B 3I72A 5FF9A 4IXMA 2IDMA 2OCIA 3PWTA 2OGTA 4Q4DA 2EQ5A 3KU4A 1UPCA 3K96A 3NOOA 3QEBZ 1JN0A 1SZCA 1Y8RB 5LP6C 5LMZA 1H42A 1XD8A 3O4VA 4MMXB 1Z3IX 1AOXA 4HLCA 5AFSA 1N1MA 1B2RA 4ALLA 1A04A 4ZI7F 5B3KA 1SPXA 1R5OA 3ND7A 4ZI3A 5KJEA 1MTZA 1Q3HA 4OAQA 4GLBA 3GCXA 3NPAA 3SMVA 3VZQA 4ND8A 3W9BA 2J30A 4CUZA 3O8NA 4B9EA 3TR6A 2OGWA 1ESEA 3WL7A 4WCVA 1K5GA 4CGYA 1JE0A 3I2IA 3QTBA 1F2DA 1Y3IA 2ZTMA 4Q5IA 5B1HA 3L4KA 3CXUA 1PJ4A 2VR1A 4EG8A 2F48A 4U2EA 3EVBA 4OXNA 2OMKA 3DV2A 1V4BA 3PJFA 1GAJA 1M1XB 1FTQA 1UXOA 4IIXA 4V3BA 3EMKA 4O1HA 4IDBA 4MTLA 1F06A 1KVUA 3VO2A 4I1IA 1XCMA 1YR2A 1JTFA 1JAXA 1IQPA 1PV4A 4WOCA 1VYTA 1Y5MA 1YOVB 2QTHA 3PDJA 5DN6A 1L4GA 2ZFUA 4XKJA 1AVTA 4LFCB 4Y6GB 3RJ5A 1W29A 2RJOA 4E07A 1NC1A 4PONA 4XQCA 1YJXA 2A5GA 2GDJA 3MD9A 2QN2A 1TM5E 3NTRA 4GLOA 5C32A 1IY9A 4LE0A 3PLNA 3CPSA 3QXCA 4P7GA 5J5CA 4G0UA 4U7HA 3EXG1 3UAVA 1MB3A 4QGGA 3EVDA 2L18A 4ZD6A 4TSFD 5BWBA 9LDBA 5EXXA 3FNHA 2GJSA 1GZHB 2I2XB 4MYTA 3DLHA 2FZCA 1T5TA 2NT3A 4JENA 1WMDA 4N54A 3UJNA 4G86A 2B34A 4HVTA 2Y9PB 3MGCA 3ZZTA 3RC3A 3LLUA 1AM4D 4PTLA 1N5MA 2Y4OA 1ZYUA 3Q41A 4ALKA 4CQJA 4PZAA 4YFYA 4L5YA 4PC2A 4TKUB 2YWHA 2BH2A 2F4VB 4JT4A 1EWYA 5JVDA 1PZHA 2XYPA 5CDUA 1EWVA 3WGNA 1GQFA 2M98A 3BDQA 3TIGA 3SLKA 4Z7QB 1BH6A 1XCJA 2GCOB 1ZGCA 3KLBA 4KVFA 3DWEX 3RRZA 3UENA 1MU0A 4R9NA 2PQMA 2DY0A 2JB9A 5FUXA 5TDHA 3GXOA 2GPTA 4CKYA 4O33A 3PQFA 1NUAA 2J32A 2XB2A 3T38A 2FMFA 3O73A 2Q5LA 2WMDA 3H2BA 4XH9B 4EJMA 3WLJA 1E9BA 1JLMA 1IH8A 3TLZA 2DECA 3WFZA 2V6JA 3KJIA 3LDAA 4DSTA 1ZQ9A 3V4ZA 5C34B 3QTLA 1BD4A 1A9XA 4DUYB 5IVKA 1YFKA 1LVUA 3MS4A 3D4IA 5HF8A 1QG6A 4KIUA 3KO8A 4I3HA 4EUFA 1ULTA 3KAPA 4X64B 1DKPA 2CD7A 1U5BB 4J7UA 3EXFA 4QTZA 1PL7A 1MQ8B 1U3VA 4KIGA 2QZ4A 3ORSA 1M76A 3BFPA 4LI3X 1T0PA 4NHOA 4UVIA 4DTCA 3O2NA 1VL8A 3BZUA 5JCZA 4ZY7A 1QIHA 2RH9B 2XOKA 4XDGA 2NXWA 5AUNB 4ZT4A 3IMFA 3HJCA 4PO3X 1E1QA 1C9KA 2XF8A 1X7GA 2YMQA 3Q7IA 5ESDA 1IMJA 1TRHA 3FFTA 1NBOA 1TVKB 1GL6A 2AL7A 2CWWA 2HHAA 3F7MA 3R3UA 3WP0A 4JI7B 1YC5A 3OZGA 2GBLA 5CX4A 1CUSA 4IGAA 1U0LA 2WILA 4RA6A 1S9DA 1SCKA 2QMZA 4LHYA 5EFZA 4TYWA 4DA7A 1N9KA 4N4AA 3TOVA 3GB9A 1QQTA 1J00A 2OZPA 2I6FA 1NX9A 3QPUA 2O48X 3CIOA 4D99A 1JPJA 3D02A 1AUQA 2H2WA 2ZRPA 4O4HB 2VP5A 2XNSA 4MVJI 1K27A 2FDCA 3VPXA 4O2LA 2ZB4A 4HGRA 4FD3A 4JI2B 4IUBS 1P4SA 5AXDA 2ES4A 4E22A 1E3QA 3D8BA 3DE0X 4CI0B 3T7RA 4IIJB 3IAS1 4BNVA 1O8CA 2B20A 2FGKA 1Z34A 2ZTLA 4JGXA 2XWSA 2ZRLA 4IIFA 4IIUA 1G1AA 2HRQA 2PZAA 3OX2A 2D13A 1ZGZA 3NHFA 4EFMA 3NR2A 1IPEA 2VO1A 3IH5A 4FYVA 3OE5A 3OWHA 3WLEA 1ZIXA 4MQ4A 2YV4A 4FR2A 3RAFC 5GZ1A 4H16A 1PYGA 2O2XA 4W8HA 1U0BB 1TUBB 1B0ZA 4DBZA 1PW5A 2H92A 2OLJA 5FUYA 1AA6A 1GGJA 5TQVA 5KOYA 1KBQA 4UTNA 3RADC 1XPJA 1XTUA 1J20A 2Q0SA 2FHSA 3F6SA 4Q15A 1RLTA 2A35A 1SVKA 2I9PA 1X1AA 1QCZA 4HFRA 3E9YA 1E1MA 2RC6A 4EVQA 1Q0PA 4CODB 1EX7A 3D4LA 3OQNA 2V74B 4JQOA 3ORFA 3D2AA 1CVIA 3CNOA 2PYIA 3QVGA 4WI1A 2LDBA 5EHGA 1BOFA 3PVZA 2P40A 3EYWA 1UANA 1FL9A 1SN7A 2QZZA 1SRRA 2QXYA 3KOYA 2D1YA 2D8AA 3BMCB 1JMVA 1FLNA 3JVEA 3GJTA 1PP4A 3OKAA 1TJYA 4JR1A 4UC0A 1QZ3A 3U80A 1U2EA 4DV3B 3G2KA 3JZFA 3JQAA 4AN0A 2F9LA 5TARA 1UQTA 5K8CA 4DLTA 4DDVA 1OCEA 1UXIA 1L5FA 3A58B 5CLLA 1TYAE 2QJOA 1WD5A 3B1ZA 5K1ZA 4QOSA 4K9SA 1WY5A 3ZJTA 2G6BA 1W0CA 3HSSA 2OC4A 3KTAB 4L4RA 2YJ6A 3TD6A 1DAFA 2LTAA 3QG1A 1R5BA 1L8QA 3P2OA 2DT8A 1POXA 2RBEA 3O3NB 5EWJA 2BGTA 4HDMB 4DSNA 2RHWA 4CTOA 3B1WA 2BHRA 2PTGA 4KRYA 5DU2A 3GNLA 2E18A 1YJAA 3K9LA 5FOTA 4OL0A 1K8QA 3GJZA 5HKBA 2HQ1A 4LGCA 1UXKA 1CZOA 2ZJ4A 2B1RA 5LB4A 3VI4B 5K05A 1QRSA 4EYKA 5FUMA 4NMMA 2PUVA 2OORC 3EEOA 4TSKA 3SBXA 3Q8LA 1KEWA 2FSHA 3CJRA 3KSZO 2CNWA 5D1NA 1Y7IA 2AF4C 2HRDA 3OX1A 1IJEA 2IQIA 3HCEA 3EZYA 2PX5A 3ZVNA 4GAEA 1G8JA 1XCBA 2ZUTA 3CLHA 4C5CA 2CXXA 3IDZA 4MYHA 2A9QA 1WSBA 2VUSA 2ZVPX 4YDSA 1W75A 4FJ2A 1I1NA 2HT6A 3EQ7A 4TUYB 4CFZA 3OPYI 4E2WA 1S3SA 2WF7A 4NENB 3K8OE 3G23A 3UKJA 1CUCA 2B8WA 2IS4A 1MA0A 1B93A 3A14A 1MD9A 1N2HA 3A6DA 2ZRQA 1N2XA 3L3BA 3NTVA 3EJWA 1KY2A 4R6XA 4RPLA 3HWSA 3RS9A 4DNXA 2BD0A 1FX1A 3IESA 4IQ4A 2OA0A 4WV3A 3TSZA 1Z8NA 2H7YA 2CLLB 4JJAA 4NESA 4EFNA 2XJ4A 3STVA 1CUHA 2SKCA 5DXJA 3ZH9B 1E1YA 3OCZA 1MO6A 1PFGA 1I0ZA 1HOXA 3LS2A 5JCPA 3RS8A 2YQ5A 2P41A 3T7TA 4YUXA 5BW5A 5H9WA 5I7VA 3GRPA 3WYBA 5FL7A 4DQUA 3U5ZB 3KZKA 1L3BA 4AXHA 1OH7A 4OUDA 3IT2A 4H0NA 5DHPA 3RUFA 4XYGA 4PO1A 3WSVA 4KLCA 4A82A 1KAOA 1WHSB 1HDZA 2ODEA 2QN7A 3F0TA 3MPUA 3TQQA 1P81A 3ZZUA 4ESHA 3BCRA 5JAIA 5CIYA 1ML3A 3OSUA 1LDBA 1NQ5A 3R0IA 2JNWA 3BHNA 1JWBB 4R9RA 5LMCA 5A3SA 3W34A 4F6CA 2BZ1A 1UJ4A 1J0AA 1V4NA 4IHAA 5HFJA 3T7IA 3RLFA 3BRWA 4CG1A 2C3OA 3F6CA 5JSHA 3WL6A 4KXNA 3PUKA 4J2TA 1JU4A 2VA8A 4IEEA 2IZOA 1OH5A 2YHBA 3WLKX 3GLGE 2ZE8A 2HNKA 2VJCA 3SJAA 1ZW1A 1V7QA 4UM8B 1M1YE 4YJGB 1NW5A 2Q0XA 3GRFA 3SEAA 2XE6A 2B1GA 2I0FA 4M8LA 3CEAA 4CLEA 3DFIA 4Z54A 3QU4A 5H59A 4D8XA 1J8QA 3SXOA 4UVHA 3L6CA 1VYUA 1CYEA 1K89A 5BSKA 4Z4EA 3LNCA 1XPOA 5HRAA 4I1PA 5E7IA 4RTSA 4CDNA 1C3OA 3FPGA 5IEBA 3G49A 1LSJA 2B78A 3GHYA 3U3MA 5AVWA 1OHHD 1XTKA 3RTGA 4NS1A 3F71A 2GXUA 1C0KA 1V6AA 2BE9A 1CLEA 5EGNA 3S40A 1AU9A 3WB9A 4Y9DA 4BAZA 2MDTA 3DSRA 5HQTA 1T0BA 3BRCA 4BMPB 2QZPA 3SE0A 4E2FA 4N48A 3RYIA 5TNXA 3VNUA 1RI5A 1JAHA 2QLLA 4BE4A 4C9BA 4YCMA 3BXZA 2ZIVB 4L5CA 4ZZ2A 4JBNA 4XRGA 3NC4A 3PQ5A 2ZT6A 1T6ZA 1GPKA 3KVRA 3P2EA 4C4SA 3UM9A 1E8MA 3X1MA 1F60A 1YRWA 1X42A 1SVNA 1DBSA 3UZUA 7GPBA 1CDZA 5FTMA 1Z2AA 3HZOA 2QLBA 1YE8A 2VC2B 3F7OA 3PF8A 4U7JA 4ENWA 3IVCA 3MHTA 4Q7QA 1APBA 1AQ6A 3RREA 3GLIE 2B37A 3MT9A 4IXWA 2II6A 4GX0A 1X9IA 1N2SA 3KXIA 1UBCA 4QARA 2G06A 3QW2A 3UFBA 1RZUA 3B2NA 1TRKA 4GI1A 2PX2A 5FA6A 2V8BA 4TVOA 2ZJBA 3OHPA 3ZK7A 4EMTA 1RNLA 2JBWA 3MLBA 4IL5A 5LP6B 3ROTA 1FFEA 1FRNA 2OWDA 4US1R 3GAZA 5FBRB 4MR7A 4F5EA 1U8UA 2GF9A 5E2AA 4XWKA 3VHXB 1PUXA 2CN1A 3QHPA 2K6GA 4HO1X 4EKYA 2H4JA 1YBMA 5G3ZA 1E20A 2C83A 3SSMA 4HH1A 4CGZA 1ZH2A 1XTIA 3LSTA 2P1RA 4JUFA 3SC3A 4CM7A 2IU0A 1JDZA 3D1LA 3NAQA 3RTCA 4G3XA 4JJEA 4UXIA 1FZQA 4QHYA 1J5EB 5M7EA 1HQDA 1OLUB 5B53A 5ARDA 1N5LA 4DSOA 5IASA 1P7WA 5ABPA 1FX0B 1TAHA 1M66A 2I3DA 3GFBA 4DRXA 1WZUA 5JT1A 4S2UA 2EKBA 1VJ1A 3NTQA 1E4VA 2RK4A 1J5XA 4WZZA 1DELA 1J0EA 1T5BA 2ODBA 5PNTA 4C0WA 3DT6A 2W6OA 3KKMA 4BRZA 3Q7TA 2CBGA 1TZBA 2F1HA 1UMCB 2VHYA 1QKJA 4OU5A 1W88A 4L27A 1LS1A 1WVGA 3SCZA 3TW6A 4DCUA 3EMBA 3V5NA 3OOHA 3N70A 5K8LA 1T3LA 1W5TA 3BERA 1YRHA 4MV9A 2HF2A 2QRQA 3SJUA 1QCCA 3LDHA 3OUUA 5KZMB 4X65B 1Z68A 2CV1A 2Q5CA 2VKTA 2QF7A 4WLUA 4WZAA 3U26A 5CFMA 1KYIA 3QBTA 1Z4KA 2HLPA 4YWJA 4AUNA 1KL7A 2LCFA 1V41E 2A9VA 3BIWA 3N53A 3Q5GA 2QU7A 1B8PA 1AD2A 2GS9A 2GDZA 4TV9F 4AK9A 2X1HA 4MLDA 5CA1B 2R87A 3EGWA 4JB2A 4N49A 3NHUA 5ALWA 2Z6AA 3ZJUA 4NSSA 1W47A 1H2YA 4GPD1 1QORA 1RHRA 1XLUA 1GNRA 4M9ZA 1GVNB 3FBWA 5LYJA 3VZCA 2NU6A 1EUCA 1YQUA 2AR0A 3ZJVA 3O21A 4U8HA 1R0LA 4PZ9A 3DBIA 2AUNA 2EG5A 2EHJA 3CX7A 2ZJZA 3O4IA 5KYYA 4QPDA 2XSZD 1CUBA 5EZYB 4CQNA 4IUDS 3KJNA 3JS5A 4XCQA 1T1RA 2N1BA 4K6GA 5ALZA 4K0KB 2EFEB 4YJHB 3PXUA 1IXZA 5EMLA 2WY2D 2Q99A 3ZDXB 3KXLA 1NN5A 5KYGA 3BE5A 4RFSB 4DR1B 3CMMA 5K0ZA 4JQYA 1X2EA 1NQXA 4GD3Q 1K2WA 3V55A 3R7LA 1HQCA 5KEIA 4G5XA 2BKAA 1MB2A 3QJYA 3E5MA 4G0XA 2QVYX 3DDZX 3PQ4A 4GFDA 4MYUA 2ZWAA 3RYOA 2ZRHA 4BVKA 1QIJA 2HV8A 4MSUA 1I4DD 2JFYA 4QUKA 2W98A 4E5DA 3ICPA 1N9GB 1Q84A 2MYNA 1ZWKA 2NTEA 5HFNA 4C89A 1Y8CA 4OBWA 3MJVA 1EE9A 1AUXA 1ZKMA 2QTGA 1MBZA 3DOCA 4Q34A 4MHTA 4KACA 2ZAOA 3UFXA 5IDWA 3Q0IA 1REQB 2Q3EA 4R71A 1ESDA 1TW3A 5K3SA 2AXNA 3J7AC 1V1MA 4W5JA 4Q4CA 5FWXB 4CEIA 2IW3A 4ZCSA 1DOHA 3IP6A 4GM1A 1PLKA 1BE0A 3SJCA 3CWCA 1MC1A 4FW9A 5K0LA 5IFKA 2O2JA 4P5DA 2GZ3A 4P82A 2LV8A 3LBHA 4HTFA 2VRBA 1HFJA 3HDTA 4QC2A 4CU2A 2DHCA 3LXRA 3MXOA 1Y8RA 4Q4JB 3AF1A 5BUSA 1Q95A 4HJRA 4AP9A 3UWSA 4G41A 1UKYA 1Z2NX 2PSJA 1AV6A 3BDVA 4KI7A 2H1RA 2KSQA 3QEMA 4G1CA 4L3WA 3WGYA 5F98A 2O2DA 5FL7D 3VPHA 3OH8A 1GG5A 2I7CA 1FFGA 1C1YA 4MWDA 1MX5A 1ZD1A 3NANA 1A7UA 2XEDA 2ZYHA 4I08A 3THSA 4D3FA 1KZ1A 1Q1NA 2UUAB 1YMVA 3GCZA 3WRXA 4LYDA 4AXBA 2PT5A 2H4XA 2PAAA 2LZ0A 5C35A 1NBAA 4XA8A 1KOJA 1OX6A 3QOFA 4YRAA 3DPUA 2OWEA 3QY0A 3F98A 3N5CA 4UCXA 4RMJA 3TD2A 4E6EA 3EOZA 3OBIA 4GP6A 2A9FA 4QASA 4DDWA 3G8CA 1UBLS 2ZIEA 3E61A 2HBQA 2MIIA 2QMOA 4IZIA 1T36A 5IDVA 4W5OA 2AG1A 4KQCA 4Q7EA 4RGBA 2I1QA 3FSRA 4R8MA 4ARUA 2NZWA 3NCTA 3RBXA 4BDTA 2YVLA 3SHTA 1U7PA 1PFYA 3V80A 3F2IA 4MIYA 1JHXA 2AC4A 3KELA 4R1OA 3DXFA 2WUFA 1FSSA 3TGLA 1G291 2P3OA 3VPCA 2NU9A 4D1YA 2XTMA 5BP7A 1K7SN 4ZT5A 3QE9Y 3T1HB 1E9DA 2AOWA 1HWYA 2IHBA 1EFVB 1L7VC 1TLFA 3WQQA 3EGCA 5BT9A 1ZOLA 3DB2A 4C3VA 4D98A 3G5AA 3KWFA 2P9TA 4JC4A 3WBKA 1CB7A 5HUJA 4LZJA 2XD4A 5JV5A 1GZ3A 2ZRIA 2XBUA 3G82C 1Z7EA 3X2SA 1JVBA 3ZLTA 5BN5A 2FN3A 3AOEA 1UC5B 2JHPA 3L02A 3K0FB 2FNAA 3OHMA 1ZONA 2E1RA 1V25A 5C7IO 1NVDA 1O4WA 2GEBA 4OP2A 3PS9A 3ZD8A 4BFSA 3WDLA 5A3RA 5IJ0B 2FSVC 1JEAA 4GXTA 1EJ0A 4QOHA 3MTGA 3NWEA 2C9DA 4FT2A 4J1TA 3MOIA 4KQIA 3MW8A 4WHMA 3F90A 5DZSA 4ZCPA 3UC5A 3KQKA 3Q12A 1ZNWA 3JVVA 1BGXT 4F5DA 4PGMA 3DS8A 4DADA 4R41A 1E2PA 2FVXA 2J31A 2I1WA 5KSZA 3O9VA 4FHEA 3OT5A 1O6BA 1AGRA 3A9UA 3B13B 5FNZA 4DA6A 3WB1A 5JEDA 3P1JA 1RJEA 5MN4A 1JALA 2WZBA 1MO3A 1V9CA 4YJHA 4KWCA 5ETJA 1NBEA 1JECA 4DRYA 3L82B 4J1TC 2ZYWX 3ZY2A 4NAVA 4EQ6A 4DM7A 5BN3A 3K9HA 4KVGA 4RTKA 1CZLA 3BIXA 2WWFA 3CN9A 4OAOA 5FPTA 5EJ8A 1CDDA 3EIXA 3HXTA 1E6WA 4LNAA 3VYVA 1JKIA 1O5IA 3WKEA 4BFXA 4KR7A 1WB4A 2IZ0A 2Q6TA 3CO5A 1CR2A 3RQSA 2H6EA 1XHEA 1DG1G 2GEUA 2WU8A 2X3UA 2Y77A 4C07A 1P8AA 2PIAA 3JVDA 2QYTA 2G1UA 1KI1A 5BWCA 3AX6A 2DFKB 3F3YA 3A2NA 3QKRB 2GVZC 3KVNA 3NXSA 4LEIA 4R51A 5COBA 4A10A 4LOHA 1QMPA 1CZUA 2W2NA 3GLRA 1WA5A 5FPYA 4O02B 1JLRA 1QYIA 2BGMA 1PCXA 1HDCA 2GI4A 2X9VA 2VSNA 5HS4A 4XUDA 1J21A 5IDQA 4OSOA 3KQWA 3T3IA 3KQOA 1UUFA 2WEKA 1US8A 3FUVA 2ZSIA 1NJ8A 1C3EA 4PN7A 3HZHA 4Y6LA 2LCIA 3OFKA 5FLKA 1RJFA 4AMYA 1NV9A 1O6CA 2G72A 2Q6IA 3K09A 3NBZC 1C0LA 2J6CA 4PPNA 3NW9A 5KYYB 1EXVA 2E5FA 2I7TA 1NVEA 2UZ1A 2AEFA 2GK3A 4PBTA 5FWAA 3T5MA 3WLRA 2PUAA 5EOVA 5IC5A 2B4YA 2YIJA 5AHKA 1VP9A 3RVBA 5DTEA 3ZEAA 4TN1A 1QLHA 4FSXA 1MGPA 3IR6A 1SVOA 4RX1A 4DCTA 4ZTZB 1HT0A 2FN4A 2EKDA 2HZBA 4RPIA 1Y63A 2NUPB 3GNQA 1KZ7B 2YWCA 3R40A 1PR4A 3N8GA 5FHRA 2EX4A 1TYEB 2XMDA 3PDUA 4HJXA 5LBUA 1WO8A 4JLDA 3QMVA 1UAAA 4NYIR 3K70D 2QHXA 1P2SA 1YJCA 2VK2A 2VLBA 3R7FA 2OE2A 3OO0A 4YK7A 5BNWA 4IWNA 2ZRAA 2ZBDA 5EMMA 2XGJA 3JSAA 1G9SA 4BWVA 3A6JA 3PGMA 2WKWA 2IPXA 5KNBH 1RD4A 3A04A 3D0KA 5H81A 4H3KB 2NVWA 1TPZA 3CHYA 3E0QA 1JFRA 1I24A 3EXHA 1MB9A 3DNPA 1C5KA 3PTZA 4RXTA 1Y98A 2HMAA 2QE7A 4KQXA 1JFVA 1BCSB 1CBUA 4BO1A 5KQGA 5SY4A 5A03A 1EFPB 1R18A 1I5EA 2D3TA 2HAEA 3BIJA 2I8LA 1EQAA 2EARA 1ZWLA 3QWIA 4GICA 2PKXA 2D2XA 2O50A 2X9QA 2RAPA 3A1UA 2P9HA 3FDZB 1T5LA 3HJAA 2Q8PA 4IW3B 4FONA 5D3MB 1EDOA 3GFQA 5BV8A 1E18A 5EUCA 4G4IA 4PVCA 4FYIA 2I80A 4DOMA 4LTDA 1DIBA 3Q98A 2PL5A 4I9FA 4B6EA 1PJZA 1YDWA 2AMYA 1IVYA 3HB5X 5AW2A 3S1SA 3AKEA 3U49A 1MEJA 2B5VA 2B0CA 3QX9A 1HK7A 3ONNA 3IUPA 4XASA 1Q3TA 4V0ME 4MDEA 4BVLA 3B6KA 4RVDA 4DEXA 2NU8B 3CKLA 4M9QA 1KZ6A 3C1UA 3KDPA 1ESZA 1SVSA 3N6VA 1D2NA 4GPBA 5CFRA 5DNCA 3GLUA 1E0AA 4LIPD 4XGRA 3U4CA 2IQ5A 2X9NA 1CNFA 3C8HA 3GRAA 3WHLA 2WG0A 3UK1A 4HR7A 1FRVA 2NACA 4M22A 2RHDA 3LF1A 4KMRA 3ADPA 1HT2E 4RY2A 4P22A 2G76A 3U7QA 1HYGA 4Q3AA 7REQB 1YR8A 3O8BA 3OMWA 1CV2A 2QG6A 3WLTA 4ZYUA 2I4RA 5ENZA 2B1IA 4MRAA 1T0UA 2HYDA 2YHIA 1GPWB 2IYQA 2YJTD 4TTQA 4ZDJA 1UINA 1GQOA 1XYVA 1LQUA 1XRJA 1J7JA 1FTSA 3DOEA 3INRA 3KSUA 1G21B 3QPBA 4GI7A 4CVNA 2E49A 2D7DA 1GCGA 2ZOSA 2ZXEA 3OCJA 1JWLA 4UREA 1RQLA 2UYYA 2P11A 1RI3A 1RPNA 4JGBA 4I3GA 5I9NA 1BS2A 1M0EA 1E1DA 1OXKB 4UUAA 1CP2A 4MK4A 1Y4ZA 3D7KA 4UQPA 4D0RA 3HI6A 1IUKA 4NE2A 5H3LA 3OJEA 1FTGA 3I8SA 4JUCA 3K1AA 5ITWA 2JFQA 3O38A 4WN9B 2C5SA 3FWKA 1OE0A 4L74A 3RANA 2CXNA 3PP8A 2Q3DA 5DM4A 1J39A 3GFTA 4W4TA 3HO8A 3E84A 4IV8A 2XB6A 4O2AF 3HEBA 5KQSA 3KTAA 1WNTA 4UAJA 3V1TC 5MGNA 1I80A 3OA2A 4BNLA 4DYDA 3C41J 1EIWA 5JFOA 3PQCA 2X3FA 5AKJA 4M7OA 1Z4QA 3R3JA 3DOUA 4KAJA 2JG3A 1GDTA 2O7SA 1JFSA 3QENA 1ZR2A 1V3VA 1NIPA 3I4CA 1HL3A 1QV6A 3RFTA 3SSAA 2W71A 1N4AA 5B6JA 3X1ZA 1D6NA 2ZQYA 1AXRA 1U0RA 1K8RA 3G17A 1LPNA 3NKLA 2FAXA 3FDIA 4W5TA 1FSPA 1J22A 5JS6A 2ZP1A 3G0DA 1BS9A 2FFRA 4X1IB 4MIOA 3RVNA 1EINA 1JIKA 2QT9A 2Y68A 2WW8A 1H0KA 5A9SB 1GPMA 3E82A 3KVYA 5KJ1A 4K87A 2GN6A 1Z2PX 2UU9B 3MZ0A 1YJBA 3SFZA 4S1PA 4M99A 2R48A 4ZGBA 4KAAA 5HS6A 1OI2A 1OZGA 3ZHUA 2PBZA 4PZ0A 1DKOA 4KYTA 2OVFA 1PJ2A 1RBMA 4PINA 3WMFA 4NMXB 4ZZ3A 5KPDA 721PA 2J9ZB 3AI1A 2UZIR 2CFOA 1J8YF 1PAUA 3DBLB 2GAAA 1E7RA 1GGFA 3IQZA 3PHCA 3Q5EA 5EQTA 3X1JA 1B74A 1LF0A 4FFOA 4MXDA 4DIEA 4NJEA 2JEOA 3SICE 1TEVA 5CCBA 2PH7A 3VZRA 1E3WA 3OZSA 2BONA 3IMEA 3VBEA 3JU3A 4QRDA 1K7EB 2XMQA 5DKFA 10MHA 3U7FB 1K8XB 5LN1A 3HXPA 3GMIA 4B4VA 3WXBA 4XX0A 4A92A 1LC0A 2DXIA 5A1JA 1XROA 1YK0A 3I0NA 3VTZA 1SULA 1FSFA 2WNHA 3K72B 4JROA 1KEUA 5LLSA 4RAQA 1DI0A 2PQ0A 4A0RA 3TD9A 1HETA 3CRQA 3UVEA 2QAGC 5FWNA 4BWGA 3FUTA 9LDTA 1EX6A 3E22B 4YRKA 4YHHB 2G25A 4MS3B 1R4AA 4ENQA 3VU9A 1RCFA 3DUFA 5E38A 4JBHA 2IGBA 4ZV9A 4FILA 2IXAA 2VAMA 5C4GB 4DA4A 4DQKA 3MWJA 2ZAGA 4ER0A 5B1DA 2C4UA 5BR1A 1YHYA 1CHNA 3LDFA 2ZUDA 4RE5A 3LJKA 4RENA 3AW9A 2X19A 2C2OA 3PQ7A 3ZWNA 1L5RA 1KZ9A 1XLWA 3BTVA 4RV4A 2PZMA 1PJ3A 4QXPA 1G5TA 1MVLA 3MQFA 4D8YA 4DV7B 2A58A 2JI7A 3Q8KA 4YRSA 3O4HA 4C78A 5AUOB 3HCNA 1SB9A 5E7MA 2X7JA 3VR0A 4AWXA 2OESA 1EAYA 1I3KA 3AYXB 3OIGA 3DQPA 4KJXA 3WYDA 4MKHA 5A4FS 5JPCA 4CIBA 1BX1A 2WJ6A 2FYTA 1GT91 1QLWA 2J3EA 2WNIA 3FZEA 1LW7A 1P5HA 2XYRA 3DFKA 3I8XA 1KY3A 2VNSA 1FDOA 3D7SA 1D1SA 1M2HA 2NYRA 4TLMB 4BMCA 1SWWA 2DF8A 5H16A 1FVOA 4RIFA 3MAGA 4MWOA 2VDLB 4LBZA 1GLNA 3JQ9C 4Y1GA 2OZKA 1WDTA 2VBIA 4ME6A 1S3GA 2K2QB 4BBAA 1MJFA 5DYTA 3GLGA 1O89A 1E9EA 4EITA 5FBZA 4PSVA 1LPBB 5DFAA 3VSCA 5CD1A 4ZO9A 1V4VA 3LW8A 1EFUA 3O31A 4F7WA 3OUZA 1H65A 4LPSA 3KYJB 3AUKA 2QVXX 4QOIA 5AOVA 3IR5A 1ZBQA 2XUGA 2C99A 3RKUA 4HWGA 4LF5B 3EVZA 4L5IA 2I3AA 3OQPA 5AIAA 1U8XX 3OKPA 2WMNB 2DCUA 1Z08A 3GHHA 3IB6A 4M9RA 4NL4H 3LY5A 2O3SA 4K6KA 2Y6UA 2Z3ZA 3SC2B 2L17A 2JLCA 2WSSA 4AUEA 1RBQA 5HZHA 3EWSA 4CEJB 1SQ6A 1T5DX 2E4WA 3DO8A 2V7UA 1XZBA 3CZMA 3H16A 2ZITA 4LISA 4ZRDA 3SD7A 5K8VA 1I94B 3NKVA 5EESA 3M33A 5I7UA 1Y9ZA 4C5AA 4FU0A 4HADA 2ZRGA 3RPEA 3ER8A 2BSXA 1Z4JA 4G1EB 1UMDA 4PHHA 4I14A 4EPXA 1Q0RA 5KVQA 2FUCA 3AONB 4Q4AB 2QVLA 2ILVA 3M1LA 2C7BA 2O0KA 3M5WA 1ZD8A 3WGIA 1C8VB 4UHHA 3LC7O 1OXBB 4EB6B 1R3DA 4KFUA 3KE8A 5GY7A 4AVYA 2PX8A 2WTMA 3DFMA 3HCPA 1P2GA 4EF6A 1O7JA 4REQB 3RLIA 4KVZA 4NF2A 3SOPA 3TZKA 4C0KA 2PGXA 3KSAC 2G08A 1QIKA 3LCCA 3AXSA 4UEOA 1DCMA 2ODTX 3EEYA 2NO6A 4PZUA 1OPRA 1TIKA 1ESNA 4ILKA 5IULC 2V7QD 4YH1A 2XNKA 2RSLA 4ZOEA 5LQNA 3LFUA 4O6VA 1M8FA 4J0KA 1RYMA 2RHJA 2P9GA 3AERB 3FUWA 3NBAA 1R74A 5G3YA 2GARA 4BX8A 2FMXA 2RG7A 4TLEA 5IJZA 4G36A 4O3FA 2AJLI 4D9IA 1FY2A 3AVPA 5BY2A 4HDCA 1Z62A 1Y5NA 3IQGX 2ON6A 4CLRA 3EQ9A 4BNTA 2DEUA 4R16A 4Y30A 2YUTA 5L7YA 3ZWVA 1G6HA 5LXTB 3MHPA 1QKKA 3TRIA 4MUGA 4BB9A 4EA9A 1E2UA 5AYVA 2VUHB 1ZZGA 3N8HA 5FR2A 3MNFA 3MF4A 2COUA 2HF9A 3CNBA 1KO7A 3L8FA 1CNEA 1JFFB 2AW3A 4X5OA 1S8NA 1XMJA 2EEZA 1Z2OX 3FAZA 4JMPA 5C3UA 3W6PA 5DK4A 1CULC 2WIFA 3FSGA 4B8WA 4EEZA 1T1SA 1C44A 3GT3A 1XWIA 4BLPA 2PV0A 2QG9A 4BLWA 3DJFA 3BKWA 4OOFA 3R2JA 2FDRA 2QTNA 5EP1A 5H7XA 3B70A 1A9QA 1JXAA 5AVUA 2FW0A 4NU5A 4WX2B 4ZI7A 2B3DA 1QHXA 2P7IA 3DZBA 3EULA 3PB3A 5H5JA 5IANA 4DKJA 2JD1A 3B9RA 2IPLA 2YS7A 5JU6A 3MCZA 2DWOA 5T3UA 5BQXA 3TWOA 1UKCA 2DJ5A 2F9MA 4E1AA 4AJKA 4D0SA 1XUOA 1A77A 1P1FA 3M70A 1MOSA 1X86B 4N82A 2XCOA 2BGKA 5JLJA 5L3QB 3H87A 5JANA 4URYR 3AHFA 1XZIA 2Y93A 3S7ZA 1YFJA 3K35A 2NSFA 1P9OA 3OLXA 1NHWA 1K06A 2JASA 2X5NA 4A2WA 1MG5A 3OP1A 4HK4A 3BM5A 3I6MA 2QLFA 3I9NA 4RZSA 4DDHA 1ISPA 4K9QA 1YQEA 2M1XA 2G9RA 2H7XA 4ND1A 2Z2YA 5CMLA 3HYSA 4ACBA 3PC7A 3TRKA 1YAJA 3L5KA 1B00A 4UHJA 2KHZA 3RWOA 1XTRA 3PKZA 4KQKA 4F11A 4FYPA 1QDUA 2OBMA 3UXYA 1CUGA 3WBFA 3A7DA 3GFSA 4M0LA 5ERYA 1NG9A 1J0CA 5JLAA 4UU1A 4ZJYA 3JALB 1FFAA 4X61A 2WHPB 5HIKA 3QXSA 2R8YA 2VKQA 1U80A 3H5LA 3LL7A 4UUQA 3NONA 4QLAA 3IP9A 3BD8A 3LIIA 5DWVA 3TNDA 2ZWMA 1Y8ZA 4ZYWA 3BFXA 2BV3A 4MW5A 5LZ7A 1SUCA 2QD5A 3FHCB 4WBNB 1NPDA 3V2IA 4M89A 4Z7JA 5BVHB 4LXGA 4TWRA 4YAOA 5AVJA 2HHJA 1TXGA 2VYQA 4XI9A 5I3CA 3UAZA 3P0FA 1RIFA 2FJ0A 4GOOD 3W2FA 1JQ5A 4QXAA 4BMOB 4B32A 4E46A 4FR0A 4HI0E 2ATCA 1V5IA 1YB4A 3D3NA 1L7PA 2I8AA 5E8JA 1KXZA 2YJGA 2JLSA 3JYPA 2COKA 4XR4A 5B2EA 3F5FA 2HO4A 2H85A 1Q7RA 5CT6A 5MHTA 3AVXA 2XXBA 2Q27A 3ECSA 1D2CA 4QBTA 3OBBA 3H2GA 4M87A 3WK8A 4C6RA 2X9GA 4LHXA 2TMDA 1DS6A 1KI8A 4D9MA 1MP0A 1XVTA 1YONA 1JT9A 3IKTA 2FUEA 2H07A 1KI6B 3FJ1A 4NK4A 1UMBB 3OIVA 1GFIA 4PRZA 3DHVA 3QWFA 5IHPA 2BGNA 3JQCA 4G0YA 4CCWA 4G84A 3B48A 3C7TA 4Y9RA 5DCYA 4BFLA 1Y4SA 3DBOB 2D1FA 4R2WA 3B3FA 3AR3A 4B8YA 1E6MA 4XFKA 4HEA1 1PEDA 3QNWA 2EOAA 2V3VA 2XDQB 2CLDX 3B1FA 4PYNA 5AW7A 4G23A 1A1VA 3BIFA 4LV5B 4KQHA 3PICA 3PXGA 3BHJA 3U1VA 2O59A 2X0IA 3ME5A 3K3PA 3SDBA 1VGQA 4WZAE 1NYTA 1XAGA 5JNRA 1JVSA 4D3SA 4LF7B 1GAXA 3LZ6A 3K0HA 1DFHA 4J1QA 1P3Y1 4CLOA 4N9WA 4FNGA 2C4KA 1B16A 1K0FA 1KGSA 2R25B 2CE2X 2VHVA 1H9AA 3I42A 4BLRA 2PIDA 3HDGA 2ZQ5A 3H3XA 5KNDA 4W5RA 3P7MA 5HM6A 1MNAA 3MWEA 4X9XA 3K30A 2HU2A 3H6HA 4U0KA 4ARZB 1U7ZA 1W25A 2IEDA 1FB5A 3AHCA 1ST2A 2IH5A 4R1LA 1H6CA 2A9OA 2V58A 2FMUA 5ECWA 3HM9A 2JGFA 2ZPTX 3BCUA 1NUSA 2EGUA 1HQYE 3WOVA 3OIYA 1PR2A 1R6DA 3N2ZB 3RC7A 2PFKA 3WK6A 2P6PA 4Y2YA 1HI9A 3F6RA 5EHXA 1IBLB 3DL4A 3LWBA 1R6VA 2ZR8A 3MBKA 2H11A 2YFQA 3MT8A 2H54A 4X60A 2DBRA 1NF3A 5F23A 3KJFA 1FNMA 2HK9A 2QP4A 3RFXA 3M83A 1Z6PA 3D0QA 1OXXK 2RHLA 2VJAA 3T1OA 5J1SB 4L22A 3VR5A 4JR0A 1KVRA 2B1JA 2PO7A 3KOWA 2VHWA 3M3DA 2Q1WA 3WNZA 4KR3A 3AVYA 3RT7A 5HQ3B 4L72A 3T7KA 4ZAGA 3WKAA 4EYQA 5D3ZA 3YASA 1VJTA 4RVUA 4IF4A 4RZUA 1TYDE 4C4PA 4ZVMA 5BMOA 3AQIA 4L7QA 1MPTA 4F8YA 1NJFA 1FLDA 4EAQA 2G8NA 5HTOA 3FCUB 3CMCO 4DLZA 1D1PA 1T8YA 3DAPA 4NECA 4B3DA 4B87A 4UOQA 3T5AA 2QVCA 3KK0A 4V0OA 4C3OB 4B6OA 4CRWB 3EQ8A 5IPFA 4M9SA 1ZK0A 3Q7QA 3QX8A 1B1AA 1L2TA 1Q83A 2PZLA 4LC0A 5DASA 5BN5B 3W1VA 1LV8A 3ZU3A 1WSWA 4BLVA 3ITKA 2ZBRA 2WMOB 4RC9A 5KHOC 2BT4A 4HATA 4J29A 1RYFA 1N34B 1PKXA 3OPYB 3T7EA 3OPQA 4IG4A 2PSFA 1ADFA 5KO2A 1S7GA 2HM7A 1RQXA 4LWQA 4M36A 1SJ9A 5EWLA 3UXEA 4D81A 2PXAA 3UJ3X 1C2YA 4IEIA 4MRNA 1GIAA 5AXAA 4DXHA 4EIWA 3RHTA 3GJ0A 2NUBA 2VT2A 4OI2A 3V4FA 5ILOA 1H8ED 2O2SA 2P8JA 2KYRA 4FOSA 1RFGE 3FAKA 3GFFA 4LXTA 4QE3A 3OVMA 5EZSA 2GZSA 1GXSB 3LCMA 1XP5A 2XMBA 3BWXA 2QAGB 3ZCTA 4BNGA 1QPZA 1U3DA 1QYXA 3QWAA 4ZO8A 3SYTA 4UEIA 5FB3A 2RBKA 4ZYYA 4IX9A 2XUKA 4WFQA 1AK1A 2OQIA 1E7YA 4HAOA 1HEUA 3QPVA 3CO0S 3ISVA 4J49A 4JYPA 4J07A 1VPWA 4CTNA 3JTMA 1ZVJA 3D2BA 3KKNA 4DIOA 1NSFA 1VKHA 3OJCA 4D8TA 1WCXA 3A1SA 1LQ2A 3EGXB 4ZODA 4PM4A 2RJNA 2CSXA 3L8HA 4JEMA 5B4VA 1G7RA 5FIUA 1LDEA 1R4ZA 2CVOA 4UE6A 2CCJA 4HUTA 4NSNA 3TLBA 4ZU6X 4UFOA 2PKRA 1WXWA 5KTTA 2O7NA 1OJLA 4LOLA 4F56A 2ZUFA 2VWPA 4GI3A 5K3AA 1D6JA 1UPUA 3EQZA 4L08A 2WSYB 3FCSB 2CKMA 1R16A 1ECFA 3T15A 4W7SA 2I54A 4XUEA 2JLWA 4LFAB 5EA2A 4IDFA 3AOEC 5T5QA 1LEHA 3LP6A 1EZ4A 3EXAA 1XF1A 2RE8A 3VR5H 4EA6A 4RE6A 1OBOA 5LC1A 5JNLA 4XEUA 2H5JA 5AI9A 2HC9A 4BEVA 3G5TA 1T13A 2AX3A 2HLHA 3GGOA 1CCWA 3DNMA 4LJSA 1VPLA 4LZOA 3WWYA 3WE7A 4D4GA 1C29B 4EMBA 5BNZA 5DPMA 1N3BA 3SFTA 1K68A 1C9YA 1J70A 2NADA 3IMCA 5B2ZA 5DI9A 3VJMA 1GNVA 2QMYA 4EJ6A 1VSUA 1NLUA 2GHIA 2JF0A 5I5GA 4GUAA 3SR4A 3A27A 2QN1A 1Y6ZA 5EXEA 4EHHA 3UMYA 1JHAA 4EHJA 1G42A 4UQLA 2HYIC 2UVQA 3HNRA 1WSDA 3R6TA 5I51A 2KI5A 1D8AA 2FSUA 2O2ZA 4QBKA 1K9VF 3REFA 1UK7A 3WRYA 1YHNA 2YFKA 2WJJA 3NHZA 4EJSC 2MTBA 3EASA 2OBBA 2VDWA 1QK3A 1CZHA 4S24A 4YLGA 3WHKA 1RZRA 3H6KA 1LV7A 2G6TA 2DFPA 2FWMX 2GR9A 3UATA 3V1UA 4L9WA 2FLWA 5DTMA 5JHGB 1XPUA 2Q5HA 1YU6A 3LT1A 5AOBA 4QGBA 1SD1A 1ZY2A 5FQOA 4ENSA 1EJ6A 4EG1A 1WKCA 1Q0ZA 1BJKA 1W9MA 3FCEA 3V1KA 3O4RA 5JG7A 4EL5A 3W2TA 1DT5A 2A92A 1XZPA 3C3XA 4HQKA 2WJGA 1N6IA 2A9RA 2G4LA 2R68A 3EODA 5FWDA 4JKYA 1GLVA 4BMYA 1INLA 3T54A 3GJSA 2RGEA 3HJUA 5JAQA 4P58A 4CTJA 5D6NA 4XQEA 4MJ7A 4F4DA 4X84A 1RXVA 1YBAA 1FRQA 3ILVA 4FT4A 3ZE7A 1UPTA 2I00A 3PFBA 3DA8A 4GZMA 3JYNA 2NSYA 1IC6A 4YRFA 4RQTA 5J5AA 4UMVA 4LCJA 1TFUA 3K9BA 4TLDA 4AU1A 5G0TA 1MXHA 2G82A 5FYDA 2C7VA 5DNVA 3H1FA 4NZMA 4RHYA 5EC4A 4W5QA 1IBCA 2P77A 4L2IB 1IJFA 4M1EA 5ARBA 2MT9A 3RIHA 1Z8DA 3UA3A 4LFBB 1L7EA 4RU1A 4FGLA 4QT0A 1PSZA