3SSOA

Myce methyltransferase from the mycinamycin biosynthetic pathway in complex with mg and sah, crystal form 2
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
393
structure length
393
Chain Sequence
EFDEATVQDVVRLAGGHDSELRELTQKYDPAMISRLLVAEILSRCPPPSNDTPVLVELAIVHGSERFRHFLRVVRDSPIRPVGADEGFVGMLVEYELTELLRELFGVTHERPAGVRGTKLFPYLTDDEEAVEQIGTYLLAAQQGTEAVLAGCGSRKPDLSELSSRYFTPKFGFLHWFTPHYDRHFRDYRNQQVRVLEIGVGGYKHPEWGGGSLRMWKSFFPRGQIYGLDIMDKSHVDELRIRTIQGDQNDAEFLDRIARRYGPFDIVIDDGSHINAHVRTSFAALFPHVRPGGLYVIEDMWTAYWPGFGGQADPQECSGTSLGLLKSLIDAIQHQELPSDPNRSPGYVDRNIVGLHVYHNVAFVEKGRNDEGGIPTWIPRDFESLVQASSGGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase
publication title A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
pubmed doi rcsb
source organism Micromonospora griseorubida
molecule tags Transferase
total genus 131
structure length 393
sequence length 393
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.238: Mycinamicin VI 2''-O-methyltransferase.
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17843 MycE_N MycE methyltransferase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.30 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A Nonspecific Lipid-transfer Protein; Chain A 3ssoA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ssoA02
5T6BA 1XDSA 2JHCA 3PX3A 3BGVA 5EHIA 5IH3A 4CKCA 5DLYA 5T64A 2DPMA 3UBTA 5LQAA 4XUEA 1PRYA 1QANA 2CMGA 1NW8A 3PFGA 8MHTA 3AXSA 3PT9A 2JH8A 5HIKA 1P1BA 2EG5A 4EVIA 5KS2A 2A14A 2JH9A 3TMAA 5EQJB 5K03A 1R00A 2AOUA 3FRIA 4U7PB 2IFTA 3EVEA 5DX0A 3HCFA 4GOOD 3GJYA 3MTEA 3C0KA 3LHDA 4GC9A 1M6YA 1XTPA 3H2BA 1SQGA 1IXKA 5DSXA 3MERA 3FUTA 2N47A 1DUSA 5BP7A 2YUIA 2OPBA 4P7KA 4HRAA 5EHGA 3REOA 4PNEA 4QVKA 2UZ4A 5EMKA 2WK1A 3FPEA 2AOTA 2B9EA 4E2ZA 1M6EX 3E8SA 1KXZA 1X1CA 3KQWA 2OB1A 2YR0A 3R0QA 1YFJA 2PXXA 3A7DA 4EKGA 2ZSUA 3PB3A 5EG5A 5EOVA 1OR8A 5T67A 1IM8A 2BR4A 3E23A 3T0IA 3VC1A 3NVMB 2B78A 2FPOA 4L7VA 3DLIA 4PCAA 4BLUA 3OZSA 5E1DA 5HIIA 1YFLA 4Y30A 4BLWA 3KQVA 4YMHA 2YX1A 4C06A 2AOXA 5LQJA 2IDKA 1H1DA 3ELDA 2O06A 4QPPA 4YUVA 1BKYA 3ANXA 1M0EA 3GRUA 3BXOA 2ESRA 4IKPA 3AXTA 2UYHA 3GRRA 3DP7A 3FYDA 4MWZA 4P7FA 2PT6A 2IPXA 1FJXA 2V74B 3R24A 2FYTA 2OXTA 3SGLA 2PX4A 2GA9A 1VL5A 2GB4A 2XVAA 3FUXA 2FCAA 3JWIA 3LCCA 4Y2HA 1L3CA 4GUAA 2ZWVA 4XUDA 3T7TA 5EIFA 3HVKA 4RSRA 5K0FA 1R74A 4QPNA 3Q87B 5FADA 4RTMA 2BH2A 3BWCA 3B7PA 3C6MA 2XYQA 4R8RA 2KW5A 5LSAA 2YTZA 5FA8A 2PX2A 1VQ1A 3FUVA 3OFJA 2YXEA 4HGZA 3SXJA 5E1MA 5KVAA 1O9GA 2ZZMA 3P9NA 1JG4A 2QRVB 2AOUB 2AVNA 2OKCA 3DMGA 3I64A 1G55A 1JR4A 1FPQA 3KQQA 4PYMA 2PXAA 3JWJA 4M7RA 5BW5A 5GIOE 2O07A 5FA5A 3TQSA 4V0RA 5GIPE 10MHA 3OU2A 1HMYA 3ELWA 4FGZA 1WY7A 3EGVA 3EMDA 4OBXA 1AQJA 1V39A 3BWMA 3P9IA 5GP1A 4E70A 3OFKA 3E7PA 1L3IA 4LECA 3UFBA 2AOTB 4AZVA 2C7RA 2ZBPA 4CTKA 1R18A 5GM2A 4OA5A 1INLA 4QTUB 1NBHA 1SVUA 4G56A 5LQKA 3ER9A 1JTEA 2ZFUA 2PLWA 2AOVA 2HNKA 4RVFA 5K0NA 2PSSA 4QVGA 3SR4A 1KYWA 5CIYA 2BM8A 4BY9E 3G7UA 1VPTA 2NNWB 3BUSA 2JG3A 2B2CA 5EC8A 2QE6A 1YF3A 4MQ4A 1F3LA 4MIKA 5EGSA 5G02A 2NYUA 5LQCA 3EVDA 4DMGA 3M6UA 3X0DA 3C3YA 5D1NA 2Z6QA 2FK7A 4P7GA 2H11A 5K09A 5F2OA 2UYOA 2C7PA 1R8YA 3HCCA 3SSOA 2PX5A 3B5IA 2PJDA 3ERCA 3FTFA 3KQPA 3ME5A 4GC5A 5HIMA 4P7JA 2JHPA 4QQNA 2AN3A 3NDIA 3BGDA 3PFHA 3BZBA 3KR9A 3EVBA 5K0GA 3VYWA 2IH5A 4CXMA 3G2QA 1L3BA 3KPYA 3LGAA 1XDUA 2YVLA 4KIGA 1KP9A 1D2GA 5EMMA 1NT2A 2Y1XA 2B3TA 1BHJA 2HMYB 1AF7A 3BWYA 4BP3A 4RVHA 4RTQA 1HNNA 1X19A 4X63A 3R9XB 2P1DA 3M6VA 3HCBA 3LPMA 1EQAA 1NW7A 3HVJA 1RI5A 3LL7A 3OZTA 5LQNA 5DRTA 1WXWA 3L8DA 1G8SA 4IV0A 3FPGA 1VBFA 2PT9A 2EJUA 3E05A 3GDHA 2G72A 3NDJA 5GM1A 2ZZKA 4Z2YA 2E5WA 3SVZA 5DTMA 5MHTA 5DT2A 4XCXA 2QY6A 5LR6A 2EX4A 1VE3A 2YXLA 4KDRA 4R6WA 3T7SA 4FS8A 3TPZA 1NBIA 2BZGA 4PCLA 5CVUA 1B42A 3LECA 3IEIA 3HA7A 2VS1A 1PJZA 2AR0A 3OZRA 3QOXA 5DM1A 5DRYA 2ZBQA 3M6WA 2ZIGA 1SUIA 2IGTA 1RI2A 3DMHA 4M38A 5E8RA 2G8NA 2HR1A 2K4MA 3AWIA 2HWKA 3P9KA 2OYRA 3VC2A 4C4AA 4YV1A 5BW4A 1NE2A 4FSDA 4EMSA 3UZUA 3JWGA 5D1HA 1T43A 4AZSA 3I5UA 4RVGA 5EMJA 1JQ3A 1WZNA 1BOOA 4EQZA 4DQ0A 1ZG3A 1VP9A 4KDCA 1X1DA 2P8JA 1Q0SA 3M33A 4QDKA 5CCBA 3FTDA 1TPYA 3MAGA 3GU3A 1XJ5A 3UJ9A 3PTAA 1P39A 1AV6A 3RW9A 3KQSA 1KIAA 4O29A 3BGIA 1R6AA 3SX0A 3HA5A 2IH2A 3GRVA 3AJDA 1NW5A 5HEKA 3G88A 4RTOA 2Z6AA 3GRZA 4HTFA 4P58A 3OE5A 4CWAA 5FCDA 1R8XA 3HEMA 5E8JA 4OBWA 2GH1A 4X1OA 5ICEA 3EEOA 2IBTA 1XCJA 7MHTA 3SM3A 2ONYA 1X1BA 2HV9A 1VIDA 2Y1WA 3G2OA 4FT4A 3UA4A 1G6Q1 3GO4A 1L9KA 4FR0A 4U7TB 4AX8A 4PYNA 2F8LA 1XCLA 3A25A 4GEKA 3KR1A 5CM2Z 2GAFA 5F2KA 3UWPA 3IYLW 3NVKI 1G60A 3UJAA 4A6EA 2NP6A 3EEYA 1RJFA 5U4XA 4YV0A 2H1RA 4ER5A 1ZGJA 2G70A 5HILA 3UJCA 3PLAE 4LG1A 4RTKA 2B25A 5K05A 5KYGA 2C7QA 3KHKA 4DZRA 5GOZA 3P9CA 2HTEA 3LKZA 3D2LA 3JWHA 4QQKA 4BLVA 5K0BA 3TKAA 4PIMA 3NWBA 2EFJA 3MGGA 4ER0A 3Q7EA 1O9HA 3HVIA 3DOUA 2YXDA 4XUCA 4C07A 5CUQA 3KR0A 5KQSA 3KPWA 1SG9A 3R6TA 1SUSA 3FPFA 2PY6A 5FQOA 5K0LA 2P40A 1I9GA 2VDWA 2XYVA 2I62A 2BR3A 4YV2A 2V7EA 1SKMA 5C1IA 3T7RA 3C3PA 3KPUA 4HH4A 2PX8A 3ELUA 4R05A 4ISCA 5B1SA 3HA3A 2ZWAA 3GRYA 4RV9A 3G5TA 1WS6A 1RJEA 3FTCA 4CTJA 3FPHA 5ICGA 2PBFA 4KVZA 5GINE 1KR5A 5DSTA 1NV9A 3CJTA 2ZZNA 3RIEA 1FBNA 3HM2A 4PGGA 5C0OE 1QAQA 4HTFB 1RJGA 3OE4A 2IDJA 3HVHA 4OQDA 3UJ8A 2WA1A 4R6XA 3CGGA 1DL5A 3LSTA 4GOLD 5DTRA 3NW9A 4M36A 4DF3A 4X60A 4ZTBA 1I4WA 4YUZA 3SSNA 1P91A 5K8VA 1EJ6A 1TW3A 3BWBA 2QM3A 2NXEA 1QAOA 3HCAA 5CVVA 1FP1D 3P8ZA 1WG8A 4FP9A 1Y8CA 2XBMA 1FP2A 2JHAA 3IV6A 3CVOA 3K0BA 2JJQA 3O4FA 1EAMA 1EG2A 3CCFA 3MTIA 4KW7A 4PYLA 1ZGAA 1X1AA 2PVCA 4C05A 4ER6A 3QV2A 1YB2A 4RWZA 3DLCA 3PX2A 3V97A 5LQUA 2I9KA 3LCVB 2NXJA 4RX1A 5F2NA 4PYOA 3P2IA 3DUWA 5E9QA 1JG1A 2G71A 2GPYA 2FK8A 3G2PA 2PV0A 2OZVA 5FULA 4OX9Y 4ATNA 1QAMA 5LQRA 2AN4A 3G2MA 4PWYA 4MHTA 1G38A 1ZHFA 2AN5A 3KQYA 4YUYA 2P7IA 1EJ0A 3EVGA 1BC5A 3NWEA 3MHTA 2P41A 1KHHA 1UIRA 2AZTA 2ONZA 2ZULA 3CC8A 3FZGA 3LDFA 2PXCA 4HG2A 3M4XA 5FTWA 4A6DA 4RTLA 2PKWA 3QOWA 2ZIEA 4GOND 1DCTA 3F4KA 2LD4A 1UFKA 2OO3A 1VLMA 2I6GA 3M6XA 5E1BA 3GGDA 4BP1A 5CD1A 4RTPA 4KWCA 2P7HA 4E33A 2P3OA 5E1OA 2UYQA 5ERGB 3CJQA 5EVJA 1NW3A 3FUUA 4C03A 3B3GA 2I7CA 5DWQA 3A26A 4YMGA 3THRA 2IIPA 2XYRA 4X61A 1JQDA 1XXLA 5GWXA 4HSGA 3MQ2A 4B17A 4M37A 2R3SA 2P3LA 3A27A 3K6RA 4KIFA 1VP3A 2O0LA 5K0EA 1XVAA 1MHTA 1U2ZA 4LWOA 4PYKA 5FHRA 3I53A 3R3HA 2IP2A 4E2YA 5HOQA 5CCXA 3G89A 3OCJA 2WA2A 5E9JA 1Z3CA 1ZQ9A 5E9WA 5EMLA 5P8WA 3AY0A 3OPNA 1JSXA 4K6MA 2YQZA 3TM4A 1KPIA 4WVLA 4E2XA 3OU6A 2QRVA 3PS9A 5E2AA 3TOSA 3KKZA 5EEHA 5E2BA 4E31A 3KR2A 5K0CA 4RTJA 1AQIA 4GOMD 4YUXA 3UA3A 1N7JA 3KU1A 1NW6A 4GBED 5DX8A 4EKIA 2ADMA 5C9ZA 1Q0TA 5H02A 4F86A 2Z6UA 3EVFA 2PWPA 1JG3A 3GXOA 1NKVA 2OB2A 3GCZA 4PINA 2NP7A 3NTVA 3UJ6A 3CKKA 3TR6A 2BR5A 2O57A 3TLJA 3P71T 5K0JA 3FPJA 5EPEA 1MJFA 3KQOA 1JSZA 5CVJA 4GF5A 2OY0A 4PYQA 1YZHA 2R6ZA 3EGIA 3DULA 3HNRA 4FT2A 2OBFA 5DX1A 4E30A 2BM9A 2FHPA 5DM4A 3PVCA 5K01A 5EEGA 2ZVJA 4FSXA 5FWDA 3SSMA 3EMBA 4F85A 2AVDA 5CVEA 1D2CA 2VDUE 5FQNA 3BKXA 4PGHA 2FRXA 3DR5A 3ELYA 1I1NA 3MCTA 2IBSA 4V0QA 3B3FA 1L1EA 3U81A 5BXYA 3MB5A 5HIJA 2PGXA 3P97A 2C7OA 4DM3A 3V8VA 3CJRA 5HFJA 2PWYA 1RJDA 4AUKA 2P3QA 5KQRA 5DM0A 4RVDA 4POOA 4PIPA 1ORHA 3S68A 4DCGA 1G8AA 1RI1A 1ZKDA 4AZWA 5FHQA 1JQEA 2EJTA 3HTXA 3NJRA 3P2EA 1KPGA 1QYRA 4PYIA 4OA8A 1UWVA 2QYOA 3O31A 2AS0A 3LDUA 5CVDA 3IHTA 3G5LA 4HC4A 2GLUA 3SMQA 3DXXA 1IY9A 1EIZA 3LX6A 1RI4A 3G8AA 5JUWA 2ZIFA 3GNLA 5IKMA 4RTSA 5EZQA 1N7IA 3BKWA 3HCEA 4DKJA 2XVMA 2VP3A 5EIWA 2VZ9A 2ZBRA 3MCZA 3EVCA 4C04A 3RODA 2ZTHA 3DXZA 4PONA 4JXJA 1JTFA 3TKYA 3DH0A 2Q41A 2G1PA 1ORIA 4QDJA 5FUBA 3NMUF 4R8SA 3OU7A 3KQMA 4FZVA 4QTTB 2CWWA 3LCUA 4WXHA 5DM2A 2NXCA 4ER7A 4OQEA 1YUBA 1YZ3A 2ERCA 3KPVA 3FTEA 5DXJA 1O54A 1WXXA 3LBYA 2O05A 3I58A 3M70A 4LWPA 5DPMA 3G8BA 1XDZA 3LBFA 3GIWA 4HGYA 2ORED 3VSEA 2CL5A 4E2WA 5ICCA 4RTNA 4GQBA 1NV8A 1KPHA 1KYZA 4E32A 3TRKA 3UJDA 4UOEA 2VDVE 4NECA 3UJ7A 3TFWA 3ID6C 4YUWA 3DMFA 1TW2A 3EVAA 5EKUA 4C08A 4MTLA 4F84A 4KRGA 3FYCA 3ER8A 3BT7A 3P2KA 3DTNA 4DCMA 2ZCJA 3KQTA 1P1CA 1F38A 3B89A 3HP7A 5EKXA 3EVZA 1RI3A 3LKDA 4RYLA 5ICFA 2GS9A 2DULA 3O7WA 2CKDA 3CBGA 4AZTA 2IH4A 5EZSA 1D2HA 4CKBA 3TM5A 2H00A 3UJBA 4H0NA 4CKEA 1QZZA 2ZLBA 4X41A 5FWAA 3B3JA 3WSTA 3C6KA 3EPPA 4IWNA 1N2XA 2ZW9A 1JG2A 4IV8A 9MHTA 3EGEA 4PYJA 5DTQA 2UYCA 5HZMA 3DXYA 4ER3A 2P35A 2NXNA 4EK9A 5M5BA 3A4TA 2CMHA 3LDGA 3FUWA 4DA4A 3FRHA 3I9FA 3KPJA 5DXAA 3GWZA 4RTRA 2AOWA 1SQFA 3A7EA 5JR3A 3THSA 3ORHA 3HCDA
chains in the Genus database with same CATH superfamily
3LUFA 1HPLA 5LP6A 3Q0TA 2AFRA 2CXRA 2PZBA 4TYMA 1XWWA 3UYLA 5JH7A 4HB3A 4UHDA 1G7CA 4TV8A 3HFSA 2I6SA 1P19A 3CE9A 3KZNA 2F3SA 2I5PO 3EEQA 1HDEA 5CA1B 2COUA 3LFTA 4M0LA 4QU0A 2QTCA 1IN6A 1FQKA 5H1YA 2BGIA 4ZU6X 1J07A 2GBCA 5HW0A 2A59A 2AOUA 2DBYA 4J49A 4Q9AA 4XPIA 4XJXA 2GPJA 3EVEA 3L4BA 3L7NA 2JLBA 3H3XA 4I4TB 1WMAA 1QG0A 4KE9A 4TS4A 1G0NA 4EGAA 1GAWA 2ZJOA 2RAUA 4J0JA 1KEPA 3ZU6A 1WUTA 1U9JA 3C87A 3LT4A 4QVKA 4B8WA 2OBNA 2YW2A 1OMOA 2ZRGA 3OD1A 4DR3B 2HV8A 3H2GA 3KQWA 2I3ZA 1KAQA 3UUWA 1KI6A 1T2UA 3T9DA 4KFSA 4W9RA 3ROZA 3IVMA 4BNDB 2JLYA 2C3MA 2DH5A 4BB6A 4RKQA 3KCQA 5IF9A 1QG2A 3NHAA 5KU7A 2VZ0A 4JVNA 4Y2TA 4D6XA 3FGPA 5DGHA 1QIDA 2V59A 3NPAA 4GX1A 5COQA 3SFZA 4BVJA 4LA4A 3L8FA 1X9HA 2ESRA 2O1XA 4IXWA 4LQ4A 1BU5A 1YQ9A 3EGWA 3PGKA 3KSDO 1LI7A 3IMFA 1SEPA 2V9PA 3I52A 3NHUA 3C6QA 4FLEA 3ANYB 2BBWA 1B0ZA 1OJLA 2FYTA 4X54A 1K6MA 4AFNA 2GA9A 3THWB 4OI1A 3IUEA 3RUEA 1R9GA 2VH2A 4Q03A 1TKRA 2QUIA 1AG9A 4UCQA 4TSRA 1XD9A 1IYZA 1SG0A 2Q5OA 1VZ3A 4I1SA 5DOZA 3BF8A 2BPOA 1EK5A 5HQTA 1SA0B 1BXRB 4ZOLA 3Q2OA 2QZ4A 3FUVA 3FVVA 4DLVA 4JI1B 1OKKD 3X1JA 5KVSA 1SR8A 1U9CA 1E4EB 2QRVB 3UT5B 2ZUCA 3S70A 4DB2A 1BVHA 5LFAA 3IOMA 3L1IA 3EIEA 3FCAA 4RFSB 4NZMA 2F17A 3SLGA 4PYMA 4EQ6A 2KI5A 4Z5XA 1XZLA 2EXXA 4R2IA 2A9RA 1USIA 4BVEA 4FGZA 3O8LA 1IXSB 3ZS9A 2PO7A 1V4BA 1DRUA 1RAIA 5HCIA 3ZW8A 4E70A 3T1OA 2PLAA 4YPVA 2ZJ0A 1D6JA 4O0MA 4XJSA 1PUXA 2WSBA 2QU8A 4RZIA 5LNK1 1K2WA 1OXXK 1SBZA 1SK9A 2CJFA 2ZAIA 2ZBPA 4U2DA 4CTKA 1SCAA 1Z8DA 4D02A 4TL9A 2HD4A 4IJUA 1BCSB 2Y9PB 1GWNA 4EB6A 3A6PC 3KSUA 2W6CX 3TD6A 1BMTA 1A1SA 1ZO8A 2D0DA 3LUGA 4E12A 3G0BA 2OGSA 3F6RA 2ZRCA 3QU9A 1NQUA 4FPXA 1K2VN 2FK7A 2YN2A 5J1SB 4F06A 3JYHA 2R5WA 3TF5A 3CVYA 1L5RA 1EG7A 3B7WA 3L49A 2HRBA 1ZCJA 1WSBA 1CY8A 3KQPA 4J16A 4GC5A 3PE4A 1E2DA 4YB8A 1KP3A 2CHUA 5JG7A 5HWSA 4P5PA 1EM6A 5BV1A 5GMOA 5L7YA 4P38A 4W5RA 1IN4A 3WWYA 4GSKA 4G63A 3MUOA 4MVJF 1Z2DA 4K05A 2OGTA 2PN1A 4DQVA 5K3OA 5LD2B 3GG2A 3VU9A 5ILGA 2GO1A 4JD6A 5JPCA 2YY5A 1QV6A 2OCDA 2HK7A 4G2NA 1RS0A 3QFCA 4C22A 2P1DA 3M5WA 3RC9A 1QONA 1YS6A 1QYDA 1EQAA 1UBRS 2WSSD 4D92A 3L4EA 2P2NA 4QYMA 5CBPB 2GYWA 2RH5A 4BGUA 4OHVA 5TPZD 1DX6A 1FA9A 5H70A 3ZE0B 3AKEA 4FBLA 5IW8A 3SHTA 2QY6A 3K9CA 1NJ2A 3GFRA 4LFCB 1L5HA 3TPZA 1B4DA 4MY3A 2X0IA 3NALA 4XM0A 1HFWA 1T0HB 3LECA 2POQX 2XT9A 2WHXA 3RYCB 1M1YB 3OZRA 1Z5NA 1ZGGA 3M6WA 1ZD1A 2OZPA 4POAA 4HXGA 5AXCA 3DC2A 3D54D 3R7LA 4QUEA 1FQJA 1DKOA 3FCSB 5ITZA 5IAOA 1GQFA 3OQHA 5I8WA 3HN2A 4Z53A 3BE8A 4DJTA 3EXEA 1FNSA 3N8GA 1KMCA 1BROA 1D7OA 1KZ1A 2IW1A 2PRIA 4BIIA 1WMSA 4DQ0A 3EBOA 4RJ2A 3FVQA 1IVNA 2P8JA 3C7TA 1JB9A 2I3DA 4YI5A 1DAGA 1S2LA 3JD2A 1YJQA 3RK0A 2EFDB 3ABRB 3VR6H 4Y2YA 1FP7A 3T0GA 3R7DA 3GRVA 2AFIB 3I72A 2I03A 1XMQB 1IZ7A 2P9CA 3OZCA 2XE7A 3VYVA 4OJKA 2PH5A 3JD1A 1CQJB 3GBSA 3WGVA 4ML3A 3ED5A 4AMZA 1EP3B 4IFBA 4S1NA 5HIAA 1OJ7A 1P74A 3H5NA 4NV1A 5LLTA 3JD4A 2XWPA 5CM2Z 2XTZA 4KTVE 5KCMA 1KK0A 1SQSA 3O0DA 2CXUA 4BLPA 4JWKA 1DADA 5DGTA 4HX9A 3F98A 4JJZA 4P84A 5B1EA 2HDHA 4MYCA 4LJRA 1X77A 1UXOA 3PLRA 4AB1A 1QHYA 4FDTA 3D6JA 5KYUA 1O7JA 3A1DA 3GDOA 2AH5A 4JASB 3FE2A 4JBGA 3U9TA 4ESOA 1JHZA 5K05A 2C7BA 3CONA 4QYWA 2H1OA 2PGDA 3SBOA 1WCYA 2Z4RA 4QASA 1IMJA 3EWAA 4AJLA 3R2JA 3P9XA 5KX5F 1U0OC 2BL4A 4EHJA 1ENPA 1Z25A 2COKA 4HRVA 3HZOA 2QTWB 1NDUA 1HTBA 1M2KA 3DW1X 5TVKA 2QP3A 3FMFA 1DRKA 3W7BA 2O2EA 3FETA 2W2QA 4NU5A 3GGJA 1U2GC 1FNBA 3JATA 4YGYA 4HGQA 4LJ6A 3DM9B 3R6TA 4OFZA 3RASA 1T4BA 5JJIA 2NLOA 5I4BA 4YCCA 2NSJA 1Y3BE 3BEOA 2B1QA 2B35A 2HADA 3N2IA 3SZ3A 3N0XA 1I9GA 4PZCA 3I92A 3PCXA 3AFOA 4FNMA 4MKHA 1P8JA 3G2IA 5FT9A 4AM8A 3DZHA 1ADYA 2B37A 2QOEA 3STXA 5TXGA 1RR6A 2Q6TA 3IKMB 4P0QB 3D6TB 1EFPA 1QIKA 3I3SR 2PS3A 2VHWA 5DNCA 1GPKA 4KVFA 5CEFA 3VZSA 3IBTA 1NAIA 1V35A 5IM5A 2ODTX 4K9PA 1DV2A 3ICQB 2OUIA 1MO3A 5CMLA 3RYTC 4PGMA 5ELMA 1ZBQA 3ZNNA 3DV0B 3ZY4A 5BOSB 4MGHA 5DYWA 3AP3A 4NENB 4HVTA 5L7WA 4M1EA 4BRWA 1JFTA 1Z88A 1AQYA 1CVLA 1USKA 1CF9A 4H6VA 2K2WA 1V6CA 1X7WA 4HY3A 4E6PA 3IS3A 1FNNA 2D54A 3FOCA 1Z4KA 4PTLA 5ALSA 3HCAA 4F4JA 5LBIA 1VA4A 3DZFA 1Q57A 2BISA 3LPNA 1XXHB 2OLKA 1SOAA 3S0JA 4BV9A 1HT3A 5BORA 2VDOB 2X2PA 3U09A 1C1YA 4Y1GA 4XVCA 4TXNA 2R47A 3JZFA 3CSDA 4WECA 4FNAA 1DAMA 1FXUA 4N6OA 4LV8B 3O93A 3PEFA 3CKYA 2PKYX 5JNLA 1PS9A 3W8NA 1UPFA 2X5KO 2ZPTX 2XODA 5I5EA 4M1TA 4P22A 4WY2A 5E9AA 3IT3A 4OHRA 2QPAA 2DHRA 3WR5A 2AN4A 4QE3A 4C0BA 2V6IA 2WLTA 2V7PA 4QDUA 3WL5A 1PW5A 4YO8A 3TXXA 2GYVA 3UC5A 3PWTA 3C2QA 2ZULA 2Y1KA 3T7CA 2GGSA 4GZMA 3COYA 2QJTA 2BMJA 3LJKA 5U1PA 3WG9A 2BFBA 4XDGA 5BWMA 3PHGA 3W5CA 1B00A 1YB7A 2I54A 3M6XA 4MJXA 1Q15A 3TTTA 1OX6A 4LOIA 2CZGA 5AVTA 2P7HA 3HHPA 3O4HA 2D4AA 2HDNB 4XM1A 3I9KA 1C14A 2RGNA 3FY4A 2ZJ3A 1PG0A 2VOJA 4JL6A 4LY9A 4MUNA 5LC1A 2GCOB 1XFDA 1DSSG 4C78A 4UNRA 4YRBA 1JFVA 1PD1A 4L0CA 3KM0A 4PLWA 1U7UA 1WABA 1A97A 5K0ZA 3U56A 2CXXA 4L8LA 4WI1A 4NSSA 2JAOA 4EG6A 1U2ZA 3ECSA 1F06A 4KR0A 2EBUA 3GUYA 2XDAA 1RPZA 4MEAA 1C4KA 1NQXA 3QEJA 3RLFA 1XMIA 3A3OA 2B5WA 4W1SA 2BEUB 3FGZA 4RYDA 4PGAA 3AILA 2OM6A 4WOJA 3H65A 1PWEA 4LYEA 3RFUA 3EASA 2V54A 5J4YA 5CXQA 2YCLA 4QLOA 3IKVA 4E31A 3DBLA 1L1QA 3FX2A 3ILXA 5IXSA 1RC1A 2QNIA 4GOMD 5LWQA 1YR3A 1LX6A 4HPJB 4BVLA 4Y2PA 5C9ZA 1UWCA 4YQYA 2VOEA 3IP1A 4RKFA 1DKNA 3ADOA 2CE7A 3IERA 3MGBA 3MOSA 2QLFA 2CHQA 4BLRA 2X6QA 3SF0A 4GP6A 3ZS8A 1OAOA 1OGJA 3BE6A 2XV1A 2L0XA 3KQOA 5DHTA 3RUFA 1ZMOA 5L3QB 2I33A 4P2BA 3DB2A 1DJOA 3PUHA 4J03A 2P1ZA 4JYCA 5J59A 5I7UA 2DBVO 2EHDA 1FB5A 3QLUC 3CB2A 2OHVA 2QVGA 1U3UA 1S2MA 1KAHA 3SSMA 3GN2A 5B1YA 1V7CA 3PE6A 1ZRNA 3UAXA 1T36B 4HQKA 2HMUA 2FRXA 4DV1B 2H2IA 4QXPA 1I1NA 2ECKA 4M9QA 3PITA 4J3JA 2HEIA 2IBSA 3NV9A 1CJMA 4HN9A 4X95A 3L9XA 3B3FA 1L1EA 3P0IA 4NOMA 4C7KA 5IXYA 4Y2JA 1HQDA 3E3AA 4XGIA 1ZVKA 3ZV7A 2JFZA 4FTWA 1NKTA 3P0HA 1LW6E 1NFRA 4Y2SA 3W9BA 1ZJ6A 2HQRA 4F6CA 2DLDA 4LZWA 1U0SY 1V6AA 1W36D 4UCFA 3OIFA 3T7EA 1FE8A 2MT9A 2Q2QA 4V38A 2AS0A 3Q3EA 4P3OA 1QP8A 1WP9A 4X1KA 2D06A 3UMFA 4NCNA 2RGWA 3W3AA 1KS2A 2EKPA 4KXVA 2V7TA 3DHYA 4KRXA 5TGDA 3P27A 3DVAB 4PPFA 1EFAA 1RXUA 3T9AA 3GMSA 2UUAB 3EUAA 1N7IA 1RQPA 2VF4X 1UZUA 3AQ4A 3BMOA 1SD5A 4UHBA 5BXQC 3BS4A 2VZ9A 1XCOA 3D8UA 3RC2A 3MCZA 3M6LA 1FFEA 1NFFA 1ZM7A 1RWPA 2J9YB 3RSGA 3UHPA 3LBIA 4OHUA 4JV5B 2F67A 2G67A 2EL9A 3DH0A 3U7IA 1GSIA 1Q21A 4GZ5A 3VU0A 5G2OA 4V3CA 2WKRA 4G0MA 2IOHA 3QVUA 3ZW9A 4R2MA 4EF4A 4GX5A 3GJ3A 1NMSA 4P92A 2QAIA 2XCRB 3PV0A 4TMXA 1PFUA 1J56A 2Q3JA 5B1IA 2MCFA 1IBMB 3I8SA 2DX7A 3C3JA 3ESXA 4I4TA 4YIHA 1N6RA 4OHYA 2EGGA 3LO8A 2QM7A 4DR7B 3KG2A 1TM1E 3V2IA 1UPTA 1XRLA 2Z1DA 3TVDA 5EN4A 2JVJA 4BC1A 5LQDA 3CTPA 3VV3A 4F38A 2G83A 4BMPB 1BMFA 1G6HA 1KBZA 1NJ6A 1X42A 1D4ZA 2B4YA 2H4ZA 3ADKA 3HBJA 3UGKA 4DSUA 4NBTA 3KSBC 1KYYA 3WXBA 2J5XA 1J23A 1S3SA 3FN4A 4PLPA 4IDNA 5G3ZA 2EVWX 5BW6B 1GKIA 3WBKA 3UV3A 4BNDA 2QSUA 2WWWA 3FH0A 5CPBA 3R5SA 1ZI6A 3VNRA 4YVFA 3S7ZA 1S7CA 1KP2A 3WSTA 3VKHA 3GLGB 2F3UA 4UCWA 1RZRD 3A4IA 1YO6A 4DSTA 3WRWA 9MHTA 1GKKA 1NBMA 4NBLA 1SC1A 4LZZA 4M7WA 1KQPA 3PX7A 3L6OO 3Q40A 1M1NB 2GPAA 5AK0A 3V4FA 2A0WA 4QDOA 4EK9A 3ZNOA 5C31A 1O8CA 4DV4B 1VYTA 2Q2NA 3DR3A 2ABWA 3KPJA 3U4DA 3GWZA 5A2QA 4XVUA 4B6FA 2CLFB 2X22A 2CLHB 3FSGD 4MRAA 1KTIA 3THWA 4COOA 2CT8A 4Z3KA 5HIKA 1YZVA 3EFEA 2ZJFA 4HZUB 2D2FA 4REOA 4V0NA 3ZHTA 1XDSA 3ADCA 1NZDA 3MTJA 2VWGA 3CCBA 2E1RA 1SD1A 4OIFA 1E7SA 1PI3A 4JFRA 1R0YA 3C5HA 4JENA 1QANA 4MHSA 1BXRA 1NW8A 3X1MA 4AO7A 4ALKA 4EL5A 2EGHA 2NVWA 4RGYA 4RJIA 5JAUA 1JE0A 3LD9A 4EVIA 1GA1A 2LDBA 2C3PA 3B1XA 3OAAD 2VSNA 3MBIA 4I2NA 4OJYA 4QUJA 4R9UC 2QIPA 2R6AA 2PZKA 3RG8A 3UT5A 4C2BA 1M3SA 3OTOB 4INZA 5D3KA 3EE6A 1NR7A 3H2BA 4JOCA 5EIEA 1LVHA 5DSXA 1DQRA 1XHLA 2CLKB 3H8VA 4LYFA 2LCQA 3WFJA 5E3HA 3D0OA 4MP3A 2OPBA 3DYBA 3CRNA 3HI4A 1P4JA 4V0ME 3JPWA 3MT9A 1IJBA 1OFTA 3ZGNA 3L7JA 1ZVVA 5K2MA 1I2CA 4F1JA 2ILVA 1VRWA 3PEVA 4E08A 2QVZX 3L7LA 4B47A 3HGMA 1U3FA 1L8QA 1SCJA 1C0PA 2C5AA 3PB3A 5CDGA 1IM8A 1L6RA 4FHDA 3WO0A 1YHZA 2H2HA 4PCAA 2P11A 3DLIA 3DOFA 2W43A 4JK3A 4JU9A 2ZTMA 3WLHA 1QP7A 4II7A 4RHTA 3VR2D 1N0VC 1FS6A 2HXGA 2XB6A 2WWGA 3NAZA 4JNCA 1W5SA 2CK3A 1XRQA 4U8HA 4CDMA 3CRMA 3H1PA 1KAMA 2ZE6A 4KWTA 4QWWA 3W5UA 1A5BB 2HRCA 1EJ2A 1TJ4A 5HVNA 3OEHA 5H80A 4NZZA 2NBNA 2A2ZA 4P7FA 2PS9A 1LDGA 3WMRA 4AECA 4CV1A 3MIZA 2H92A 3MJEA 3BZUA 1R6TA 1KEVA 1U0JA 1G5FA 1UBLS 2O0JA 4HEQA 4PS1A 2GBLA 2QY9A 1L3CA 1JAZA 2HRQA 1B2LA 4XUDA 4MH0R 1FXWF 2VAXA 2XY4A 5HZKA 1FTWA 4NOJA 3CZQA 1BIFA 2FFBA 5B4UA 2XQIA 3O4GA 3JALA 4MVJG 5DTIA 1M9NA 2J3HA 2PUGA 2PX2A 3SXJA 2YXEA 4YAFA 5ADHA 2ZZMA 5KVAA 1WXQA 3AHEA 1Y3IA 4XVRA 4YJHB 5CBPA 2AVNA 1Z26A 2D1SA 5FLKA 2PCLA 3TQQA 3V7WA 3GFOA 4L8YA 1QMPA 5H3LA 3TQSA 1JW9B 2A1TR 3ZU2A 3OURA 2V6JA 1OBCA 3ZHYA 2JLCA 4CQNA 4R68A 4LTMA 3DFZA 1LPNA 1W93A 1FSPA 1AQJA 3P9IA 3OFKA 4YMWA 5IKEA 3RYCA 2XKJE 1TC2A 3FKJA 5IP5A 4UQLA 2C7RA 1TZKA 3NNNA 2JFFA 1FL9A 1JHPA 1SVUA 2GPWA 3MJHA 4G56A 4BTLA 1JTEA 2A0XA 4D46A 2XIQA 2ZYTX 3CA8A 1N0IA 1SCBA 4MGZR 3GJ8A 4Y2UA 2YXBA 3VAYA 3FOWA 4EYGA 4B6JA 1XN4A 5FPQA 3FNIA 1D6MA 1XLWA 1A5AB 1TXGA 2R5NA 3P7MA 5I4CA 2O0MA 1ZM4A 3MJSA 3PRHA 1WTCA 4L4RA 1R6UA 2G80A 1NM5C 1W87A 1VLJA 3TL6A 2H2DA 1R8YA 1M7GA 2PX5A 2AFIA 2RHWA 3G02A 3QVOA 3FTFA 1UADA 2O3TA 1JB1A 4QXOA 1QRUA 1Q17A 3WSVA 5LYJB 3DLPX 1ZIYA 3BXFA 4RABA 2ODBA 3CN9A 3PUKA 1F8FA 4KO4S 5CDHA 2R7NA 4IF4A 4JT2A 3VTAA 4EF6A 3P32A 3KKKA 5I7RA 2IH5A 2RAFA 4H7IA 4ASUD 1L3BA 2WLSA 1LTKA 4XGKA 2V55B 1BHJA 4K6CA 2RHLA 4BP3A 1F9EA 1JL3A 4EPTA 1JLSA 1U0EA 2B98A 2VTEA 3HCBA 2OGZA 4FMCF 1MOQA 1VL2A 4RH0A 4EATA 2RH9B 4M9XA 5CURA 3V4PB 5LQNA 4CMHA 3CWQA 2GN2A 3L8DA 4US0R 3V1MA 4AJ9A 2PL3A 4PFJA 5B6JA 1APBA 5MFPA 1JIQA 1SM4A 1EE2A 2PH1A 4AUEA 4BV2A 1RQXA 4QX6A 4BB5A 5EJ7A 3ET4A 2PWZA 4GZ6A 4QBGB 2WYVA 1K3FA 4AZ0B 5ABPA 1G9TA 2CXOA 2QT0A 3DE1X 1WLYA 3QOXA 2D74A 4OYLA 1ZJYA 1ZD9A 2IEDA 4OV6B 2ZR8A 5ALWA 3VDMA 4CMAA 2P27A 4DPMA 4ZYTA 3HBAA 5H9WA 1C44A 1E2MA 1RYHA 2NAPA 4MDHA 3X1KA 1E5QA 1R88A 2AUNA 4LW8A 1HNZB 2VBCA 5EMJA 2HMWA 3V4LA 5T57A 3DE2X 2Q5CA 3Q6NA 4EQZA 5BN3B 3C4QA 1G64A 3V34A 1TQ6A 5I01A 3PFNA 1MVNA 1YZFA 1NNSA 1Z8HA 1EVEA 2HA0A 1HXHA 5FI1B 3MA0A 3RUHA 3IA2A 4D9JA 1EXVA 3LTNC 1TVCA 1USGA 4B6OA 3ABQB 4O29A 2CC2A 4G4SO 4LGVA 3OT1B 1PJSA 1MNQA 4JP2A 2IEAA 3THYA 1T5IA 1QO9A 4AS1A 2PNFA 2V7XA 3DV0A 4TKZA 4L27A 1PLJA 1IL0A 4UTXA 5BOSA 1WA5A 4W7HA 3VBCA 2VJMB 4X1OA 1Z7BA 2VNHA 4NENA 1XCJA 2I6FA 3G49A 3IAXA 2IWHA 3ZJ4A 1IHPA 5EUMA 1OBFO 4E07A 2ID7A 3NJ8A 5HF5A 3ZWWA 1L9KA 1A9SA 3FLBA 3GA7A 4R7GA 4ND5A 4B7CA 4QO7A 2XTAA 4OLFA 1CJKC 3SOZA 4RD2A 3EUWA 3NRCA 4RGVA 2OQVA 1GZUA 2L17A 1H2RS 4L5JA 3FFAA 1JDUA 3D6MA 4MEBA 4QBHA 4NPCA 1YZNA 2BTOA 1ZGCA 2JIDA 2VAWA 2YC2C 4LNHA 5HILA 4AO6A 1ZISA 3PLAE 1IXRC 1C7EA 2B25A 3OLCX 5C4GB 4K6OA 4OI2A 3RRYA 5ALJA 5BWLA 4IHJF 1DE0A 1JHXA 3A2KA 1KO1A 2CDNA 4O4IB 5FTMA 2QDKA 1EZ4A 3D2LA 4BLVA 4QQKA 2KLBA 4D6YA 4HQFA 4ZP1A 6REQB 4U6SA 3TOVA 1G8YA 2H7CA 3NHJA 4ER0A 3TSYA 5F7XA 1FUIA 1MO4A 1E0KA 4LKRA 1DC4A 1IG3A 3QUTA 1D07A 5CUQA 1YKSA 1XTIA 2XB8A 3EDMA 3QIAA 5C34B 2JPDA 4E4RA 5CM8B 4E5VA 2DZDA 2Q4EA 5B37A 4JLNA 5IBRA 4C7VA 1BD4A 2H8GA 5JBQA 3DT8A 3QLJA 2ATIA 2GD2A 4IIJF 5LMNB 1YK1A 3COVA 4V03A 5K0LA 1HOXA 4GWGA 3EDOA 1WUYA 4PXAA 5TE9A 5C1IA 4Q34A 4ZRDA 3HB4X 4KR2A 3WMEA 4X6LA 3ELUA 3PNLA 5SY9A 5A04A 3AEZA 3HA3A 3ZE1B 4A8HA 3K30A 4DR6B 4YAJA 1JXAA 1EJBA 4PTZA 2GCOA 2ORWA 1JT2A 2PBFA 1XZAA 5K8UA 1OXTA 1UP6A 1XAJA 2FOXA 3LCJA 4K6KA 3KQHA 3ABZA 2Q8PA 3RIEA 2CSUA 3CM0A 2GF2A 1TOAA 3HM2A 3INRA 4GQAA 3L46A 5AVZA 2HK9A 2OYSA 3AF3A 1U1DA 3FMIA 1JMYA 4LC1A 3KSZO 3V1NA 4Z9XA 1UBCA 4IGIA 4OJTA 3L0OA 2VEOA 1LD3A 1CLUA 4ZTBA 4QWMA 2BEUA 1EJ6A 4AN0A 3LM8A 3QKTA 2ILTA 3I73A 4ROSA 1VXOA 4TTIA 3NP7A 1OFUX 1YGPA 2RGCA 4FFMA 1DZ3A 1WO8A 1FP1D 3EA0A 4X45A 5CYGA 1ZD2P 1HRDA 3HXQA 5TQ0A 1FP2A 1NPDA 3FI0A 4C4TA 1QC5B 1S2NA 2GTIA 1I5EA 3NDRA 4GLBA 3WJ1A 1ZMRA 2H07A 4W5JA 3KQLA 1T1EA 4KUHA 4KNWA 1A3CA 2JGIA 5DO9A 3RK4A 2X7XA 4V3BA 3LPAA 4YN3A 1TT7A 4JI0B 2FK8A 3IMGA 3SIXA 3RREA 4CHGA 5L3QA 3GYGA 3FFTA 2IOFA 3GROA 3C4JA 3L7KA 4NICA 3HEBA 3HMKA 4PWYA 4EKDA 5DGIA 4Z0TA 4BEJA 2BHTA 2VWPA 2PUCA 4ZCLA 5FTLA 2JAWA 5I7AA 3SJBA 3K6SB 1GG8A 2GEUA 5ER9A 1N6PA 1F7VA 1T36A 1P1KA 4RTLA 1TECE 4C7XA 4EHBA 1RAGA 4OHKA 1P33A 2LD4A 2Q7DA 3WGZA 5BQXA 3CW2A 4TL6A 5EFZA 1SCNE 3KJZA 1AKWA 1QF9A 2P3OA 1PYDA 1C7FA 4ZCMA 4XLTA 5JFGA 3WGYA 3CVXA 1EFUA 5L7TA 2PTHA 1FUYB 2J4FA 4R1PA 2A86A 3A26A 2XCSB 3QNUA 3W77A 2QVLA 4KGDA 3HJBA 2GZ3A 4DCUA 4XM2A 4CQMB 1WW8A 1TYCA 2VT3A 2IY9A 1JDTA 3NIWA 4FZJA 4WDRA 1VP3A 3KZVA 4QM6A 2PZLA 1Z5OA 1R9NA 5FL7A 3RYOA 2WM3A 4PYKA 5HPYB 2OAGA 1G21E 2I4TA 2JJMA 4QPJC 1OIWA 2Z83A 5TDHA 2E4UA 1G9SA 1KZ7B 4LX0A 1Y4UA 4P31A 5I47A 3DVAA 1B3RA 3E9ZA 1U98A 3Q10A 1YZLA 3TM4A 1L7QA 2QLJA 4WVLA 1DWOA 3ZDYB 1U3VA 3IBYA 4L75A 5E2AA 3AR9A 5L6LB 2E4YA 3KKZA 4FCWA 4D6PA 5K0CA 3IQWA 4NJEB 4RTJA 5JS6A 2WRZA 3CB4A 4RIGA 4NL4H 4B3IA 4YUXA 3NI2A 4CNQA 3HK2A 4KGVA 4ECAA 5A4IS 5JCZA 4S1TA 3ZGXA 5K6AA 3C6ZA 4JU8A 2A58A 3T3PB 3CO5A 2ZB7A 3EAGA 4UUQA 3JASB 3TW8A 3ZHRA 5T3UA 4DG8A 5I4KA 1H2HA 1RACA 3TLJA 621PA 1K7SN 4S24A 2ZR9A 4O3FA 4MVJI 1QV7A 1G4AE 2OY0A 4MQEB 4BAUA 5AQ1A 1Z4QA 4RSHA 5DX1A 4X8HA 1GY8A 1H69A 1RBZA 2BMFA 1XJQA 3HUUA 1NOIA 2ZYHA 4YRCA 3VR6D 4BO4A 3FJ1A 4QT0A 4BMVA 3EMBA 3OJFA 3T1YB 4IJWA 1FZTA 1Z4JA 2QG4A 1G7SA 3ONNA 5THXA 5C5CA 5HS6A 3C97A 2BGTA 5EJ9A 5EKTA 1AKRA 2ZKLA 4PO1A 1T1JA 2DVMA 2DBQA 1H3EA 1GTRA 3IFSA 2P79A 1O89A 1IY2A 5HIJA 4E51A 4DWJA 1W0CA 2PWYA 5J4KA 1P7ZA 1RJDA 3NCHA 4ZV9A 2CFZA 3BH7A 4YRKA 1P4HA 2DFNA 1JHAA 2YMLA 2ZBVA 4UBKA 4XD7A 3UB2A 2O8DA 3E1KA 1G8AA 1IEXA 3S2ZA 2JIBA 5K2OA 1NQWA 3OA0A 3GLGA 3LHIA 3KVVA 1AQNA 5FLXA 1ENYA 4OGWA 1QZXA 2AEMA 3VHLB 3G5LA 4HC4A 5HE9A 1OGIA 2ST1A 3KT3A 1Z83A 4WXPA 1R5JA 4ZVRA 4Q66C 1M1NA 1RTKA 1V2GA 3L1VA 4DPLA 1ZHOA 4JUCA 5ER6A 4HWRA 2ZIFA 3SKYA 1DV1A 3D43A 5EZQA 4AULA 1Y8ZA 1Z37A 4LRXA 1EX9A 2MSCB 1OI2A 1GZ5A 2AHOA 4HZUA 3O5AA 1N2OA 2X6RA 3EWIA 5IHXA 5IJWA 3GFVA 5IM4F 1QHXA 3PUZA 3G6WA 2P9QA 3O8QB 4U7WA 1XWIA 1XKTA 4E14A 3OE7A 4MULA 2KX7A 4F1KA 1DTWB 2V7QA 3WGKA 3FF1A 1N32B 3IRVA 1JAXA 2UYYA 3L3BA 5J9FA 2XQJA 1MV5A 5E95A 1YU6A 4LRSB 1LFDB 2J6BA 4H4CA 1NVFA 3B48A 4JJEA 4OKNA 1V1JA 4ABTA 4KR9A 1K7CA 4GLOA 3EF0A 3NOQA 3Q3IA 4LS3A 1T4CB 1U5CA 3HUEA 1NXPA 3RC7A 3RRFA 4LDJA 2R8XA 3FDXA 4QUAA 1MCZA 2A35A 2CL7X 2ZJZA 3QWBA 3RD5A 4ZDIA 2CXNA 1LDBA 1VE5A 1Z62A 1RYNA 2Z95A 3FIJA 4JGIA 4E32A 1IKTA 1QM5A 1ECPA 1NLZA 1UKBA 4RMJA 1QFSA 1RWWA 3JYLA 5HDBB 5BV0A 4C08A 5KNDA 2PU5A 3FYCA 3WS7A 2H1HA 2HJSA 1E2FA 4MRMB 5KSOA 1RI3A 1USUA 1ABFA 1MC4A 3JQAD 2VAVA 4NDNE 3UB3A 2F8SA 1Z7GA 3EYWA 4DDKA 3U5ZB 4MKXA 1PSDA 2P65A 3E3NA 4IL5A 5CFMA 3ACBA 3JARA 4ZT3A 4KREA 2PM8A 4IVRA 3NVAA 2FWIA 3B3JA 3ORFA 3ADBA 1C9JA 1V6SA 5BSTA 3EPPA 4CPDA 3I0MA 5TT1A 5AW6A 5I7WA 2EARA 3MJVA 1JG2A 2CZQA 3LRXA 2DEUA 5M3BA 3B36A 1CUYA 1VCNA 4DMKA 3PC2A 2PAAA 4GH5A 4ER3A 2R6HA 4MS1B 3UHOA 5KSZA 1Y1TA 2G1UA 4EUSA 3GXBA 3GLIE 1PZFA 1AF4A 4DNPA 1WL8A 3OOYA 1SQFA 2G1AA 2IT1A 2RK3A 3DWGA 4X1YB 2WFMA 4QD3A 4XAQA 5G41A 3ZWKA 4DN6A 1FNMA 4XTRA 3A6GA 1W5TA 4L8FA 1QWOA 3HKBB 7MDHA 1EGAA 2P6UA 3MMNA 4OAQA 2YVUA 5F73A 4YT5A 2Q1WA 4ZI2A 2CV1A 2HIAA 2NU7B 4NJMB 4XIFA 2BMDA 5LQAA 3UBTA 1YB4A 5BNWA 2X58A 3AXSA 3IB3A 1Z29A 4XWWA 2QSJA 2J41A 4EY4A 2FZVA 5ALOA 1C8BA 1SXIA 2JRCA 2WF8A 1EHYA 1E1LA 3D5TA 4BFCA 3T34A 1BYUA 5FOUA 5D3MB 5BSGA 1F9AA 2BGJA 5BNFA 1LK5A 2O1SA 3TTXA 3AVOA 3GLTA 4JP1A 1TJ5A 1SQ5A 4BMYA 3FLAA 2G5GX 3NPMA 1ML4A 1A7KA 2FLVA 4AJ2A 4AKIA 2B1GA 4GLFA 1GN8A 3PUVA 4GMKA 3QNWA 1CQXA 4X24A 4YI3A 3EISA 4NLLA 4D8VA 4DC1A 4OH1A 4R54A 3O9VA 4LYJA 1KBOA 5AW1A 1IXZA 3H86A 1Z7YA 4KBGA 4DUYB 2OB1A 2J9ZB 2DP4E 4KFCA 1GQRA 4C0KA 1LRJA 2VNIA 5KTPA 1NUQA 2QZ9A 3EH1A 5E6UB 3E23A 5JARA 3QX9A 4XIJA 3MJTA 1GTG1 1XRNA 3OHMA 2HJRA 5EZYF 3IBCA 3OQBA 2HN9A 1MLDA 4LZAA 5AJLA 1A71A 2YX1A 4CKBB 5KYWB 1OWNA 1KOGA 2WF5A 2GEVA 1RMYA 3LNCA 4RK5A 2IIVA 4U63A 1W8IA 2FWRA 4IKPA 2XEXA 1CEEA 2REXB 4W8HA 2OXEA 4XQ9A 1EP2B 3V33A 2JRLA 2PT5A 5G40A 3WLIA 3C8ZA 3LYLA 4RL6A 1DBWA 4RV5A 5DBOA 5LYJA 1VM6A 2H2GA 3Q9NA 5LOVB 2Y71A 4OOFA 3AEYA 4K26A 2XUHA 4G9GA 5IEJA 3R74A 1RADA 2ZJ4A 5G53C 3K94A 3GLHB 4FX2A 3QLTA 4ZK6A 4FN4A 2YS7A 1A4XA 2GD0A 4XCVA 3V8BA 4BVKA 4R1QA 3F6BX 1ZRHA 3QFHA 3DZDA 4NCIA 2EW1A 2P2LA 3F0TA 3LY9A 1Z4NA 3SD7A 1DKUA 1ULBA 2YTZA 1I2DA 3N28A 3VZPA 1UJBA 1N6KA 5ERXA 4WN3A 4BNYA 3VZCA 3PTZA 4HL6A 1F3OA 3S29A 4ZQIA 1JR4A 5B7PA 1U0NA 2WT9A 2BF4A 3EPHA 2Q50A 4KL8S 5JBNA 3RVQA 1XR3A 2YRXA 4H3VA 4ZYLA 5ITWA 3JQ9A 2BMEA 2EBHX 3K32A 3M89A 4HGNA 2O6LA 5AKXA 4AZ0A 1V39A 4HXYA 1XU9A 4X7MA 4Y2VA 2YXNA 2Z0MA 4MWGA 2HUPA 4RVCA 3GQBB 2EDCA 3E9NA 2HSGA 4LECA 4S0ZA 3X44A 1BE8A 2FWPA 2B30A 1XTBA 1G5HA 1L5WA 4G8BA 4UUPA 3RTGA 1KJZA 5JC8A 2JLWA 3ZCPA 2FB9A 5C5IA 4MAFA 3DDUA 5LQKA 2ZFUA 4R4JA 5AWFC 1CY1A 3ZU4A 3N07A 3KDSE 2RHCA 4KJZA 2JZCA 1F2VA 1M0WA 4RH1A 4F12A 2B2CA 1I0LA 1L5VA 1VDMA 2JG3A 4LFAB 4O5AA 1IZYA 1YRLA 1XRJA 4XFJA 1T9GS 2IITA 2J3LA 3TNJA 1KMHB 2F4NA 5FR2A 3S44A 1KDOA 1FRVA 2AF3C 3I9OA 3N87A 1X8LA 1QG4A 2FW8A 5TIIA 2ZWPA 1RLTA 2C31A 3A6EA 5BSRA 3STVA 1RABA 1WVMA 3OT1A 3P0JA 4WUTA 2JIMA 1SCKA 3FLEA 5AFSA 2FZLA 4GL4A 1NT4A 2ZETA 4XXHA 1CY0A 2BRUC 3L01A 2VJMA 4MTCA 4EGSA 3F73A 1ULHA 1TU0A 1Q0LA 2SCUB 2NN3C 4O8ZA 5LZ2A 2VPZA 3I6IA 3OIWA 1T6ZA 3GJ5A 4CXMA 1F12A 4IH4A 2C0CA 1CRWG 4BNGA 4YAUA 2HA2A 3VX3A 2YJTD 3K9QO 5YASA 5EJ2A 4NZ9A 3FBWA 2WP0A 3KWFA 1IHYA 3N5KA 1AF7A 2IYSA 3DEFA 1JU4A 2VBIA 2K7FA 1ZJWA 1ADGA 1VE7A 1IY8A 3H2JA 1NTOA 1RI5A 1YQDA 3L1UA 4B6EA 1GGJA 1MORA 4O4IA 1WXWA 4UFNA 5BQPA 4GOKA 3ZYZA 4MK4A 4TRJA 1OVGA 4AJEA 1QJ4A 2BEVA 2Q2VA 1N0WA 3AFHA 4GKAA 4V0LA 4E1AA 1BGVA 2W2PA 3LT1A 3KTAB 1B42A 1H9BA 3ESDA 4BTVA 3UJ3X 4FINA 1VBNA 3K9WA 3WGOA 4YV7A 4JOBA 3V1UA 1HGXA 1MP0A 2CNDA 1V16B 5KNCD 1JLKA 1RI2A 2F9MA 4US1R 3PLNA 4EJMA 4CMIA 1SXJD 1JHMA 4HNAB 5JNUA 4EMSA 3SZUA 2VF8A 2IRWA 1I30A 4WXYB 2HT6A 3BK2A 4NFHA 1A2BA 4J3FA 1AGPA 3ZQ4A 4EJSB 3QVMA 2XTJA 3GV0A 3LY7A 1VI6A 2RGUA 1X8JA 4I36A 2BFAA 3ETJA 3M6AA 1BEZA 2VCHA 2IV2X 4YYZA 4S1WA 3GU3A 4AQYB 2ZI9A 1T13A 2VAPA 3WNDA 2OUKA 1KQFA 4N3AA 1K5HA 4Z1OA 1SHZA 3R40A 1DWUA 2PMKA 4KWIA 5AK3A 2CEKA 4GMDA 3BKSA 2FH5B 4FZ3A 5HEKA 2HA6A 3PK0A 4PAMA 3QUCA 4XD2A 5CNJA 3OECA 3ROXA 1HEUA 3F6YA 3O8BA 2OWDA 4BX9A 1I7DA 4UXJA 3DHVA 4GO1A 2ZUFA 3N74A 3ZWPA 2WF6A 5EA2A 2R6DA 3SP1A 3WYBA 4H6PA 1XNGA 4J6FA 3V4VB 3AUAA 3X1ZA 1VGQA 3BL8A 5K4HA 3IMEA 1P77A 1P4GA 1W46A 5DISB 1N3BA 1TM2A 3L41A 1XZGA 5AIAA 1G60A 4LV5B 1IQPA 1V4NA 4DYVA 1KSFX 3A4VA 3K5IA 2WT4A 3SS8A 3RRBA 4UU8A 1QC5A 4MYRA 3RSHA 1W6RA 5DNYB 1E5TA 1SNYA 1Z2PX 1GPWB 3NUGA 4ACBA 1QHNA 5KYGA 4JI2B 1TO6A 1PR4A 4YJ2B 5HKAA 2JIQA 4ZAZA 2ECFA 2QW0X 5EWJB 2JFUA 4CG2A 3REQB 1ZK2A 2WG2A 3WLJA 4KHPB 3P2MA 3DV9A 4LK2A 2BTEA 4WUVA 1IPEA 3Q7EA 4OKIA 4P33A 3S2FA 1V5FA 3BM5A 2BMVA 4OYHA 2PTGA 2GXSA 3AESB 2XYHA 3A6LA 3T3HA 3PC7A 4JUIA 1N4AA 2ZU0C 4Y6LA 1H8HD 4M0DA 4NRDA 5KPDA 4YRQA 2FEMA 2IIQA 3GCWA 5SYAA 2PG3A 1T6XA 2J5KA 3PQFA 4XSGA 2BGRA 3ISTA 4AXHA 4E5PA 3OZWA 1ZVJA 1NVBA 3RYFB 3G5TA 1KDYA 2G08A 5ICGA 1B93A 5HP4A 1W34A 3K9LA 4RH3A 4HDAA 5GINE 1KR5A 1UDRA 2NWQA 1H4TA 1TKBA 2ZRNA 1FFSA 3DLTA 4HAWA 4EJFA 5A7GA 4ENPA 4IXDA 3URMA 2PGLA 2VRCA 4PZEA 1WMBA 3TX2A 3I5XA 4LF5B 3KKMA 3PWZA 1YBVA 3LC0A 1I4WA 1GKYA 2RAVA 4GP9A 3BWBA 3QVLA 1F6WA 4FOOA 3UY4A 2QM3A 4QLBA 4IDQA 3QZUA 4UUNA 1QAOA 1N8SA 3X2EA 2IYTA 3M3PA 2RIPA 3DKIA 4NI5A 3GJXC 3H16A 1OFIA 3B3QA 4EKYA 1HE4A 3BB1A 5MF6A 4OXNA 1A5ZA 5JNVA 3CG4A 3SHOA 2BFDB 2QN3A 2IQIA 1X87A 3SEFA 4UFPA 4TQAA 2H9AA 1M8KA 2CMKA 1YBFA 2GBPA 1JIKA 5HF9A 1AKTA 4TVSA 3EB9A 2CLMB 1P4RA 2QMZA 4I5GA 2FQYA 4RHUA 4QIHA 3I05A 4CR8A 4ZVMA 1ID1A 1Y7PA 2G88A 1OXBB 4XQ0A 5JU6A 3QVTA 1GITA 4X7BA 3QJ5A 4ZVUA 3QKRB 2AWOA 3NASA 4JD5A 1RXEA 2AN5A 4YUYA 5ITVA 3P9ZA 5B3AA 1EJ0A 1ND6A 2ES4A 2IZ5A 3QVKA 1Z4PX 2ANCA 1UIRA 4HG2A 3S2GA 5LP1A 4NE9A 2O6HA 1NN0A 2CVHA 2W0MA 2C4KA 4B34A 3GN1A 3QWAA 1HSOA 2VYVA 1EWKA 4L95C 2XOKA 3ORSA 1YFZA 4BJ6A 5CD1A 2CVOA 1MH9A 4KWCA 4F11A 2UUCB 1RRCA 3E35A 2CHFA 2UYQA 5ERGB 3T9EA 3WKDA 1X6VA 1H1TA 1NW3A 1E66A 1QG6A 4R98A 3B3GA 1PNOA 4EHLA 3PICA 4YMGA 5JAHA 1BHSA 4GM4A 3FZQA 5LKAA 3GFFA 3LOUA 5C5DA 2XYPA 3B9RA 2CGEA 4ZC1A 4JR1A 1EHIA 5B7GA 1KIFA 1DDGA 3NHLA 1MX1A 1Y5IA 4MP6A 1ENZA 4MRSA 4B6SA 2FLWA 5BNZA 2FJ0A 2CNWA 3VO8A 3U1TA 4ZXPA 1BS9A 3T4PA 3UUFA 5E9WA 1IN5A 1GV1A 4FS3A 4MW2A 4BQRA 4OOEA 2FVXA 3PNBA 4PY2A 4GRAA 1PJ2A 4QJBA 2YQZA 3U39A 3A3YA 2XMBA 2XT0A 2YV1A 1M74A 3AUUA 3KEMA 3L7BA 5AW9A 4ZIRB 4R2JA 2WICA 4RD0A 3R6DA 5EP3A 4GBED 4R31A 3AW8A 3SYKA 3O8QA 4MV6A 4KKXB 1EBFA 4JGBA 3FDZB 1L6IA 1BGXT 3AG5A 1VL0A 3KOYA 3IKTA 1DTWA 2BR5A 4V0OA 2JIPA 2J3QA 1RSZA 2X76A 2ZAMA 5EPEA 1GGVA 2I55A 2RHMA 4P98A 3VRHA 5LMCA 4HHEA 4EGJA 2YKGA 1U1FA 5KNDH 1XL1A 1PVVA 2ZRFA 4HLNA 3NC4A 4PGFA 2CJWA 1CERA 1EYZA 1T4CA 4NSNA 5AVJA 1H93A 2W6JA 4F85A 3T61A 5IDVA 5CVEA 4AS3A 4YJFB 1A8UA 5ALEA 3NT4A 2PSFA 3P96A 5JY1A 2QN8A 1P3DA 4O5OA 4I3GA 4QODA 5C18A 3W5SA 5AVVA 4LF8B 5I9SA 5EL0A 4YLGA 4IEEA 3HBFA 1QDUA 3EC7A 2R1VA 3G2NA 4MRMA 3SHVA 2C2KA 1JLRA 1T6YA 3R0XA 4IGFA 2P4QA 4U2CA 4MV1A 2FFQA 4PIPA 1M1XB 2JJ1A 5L3RA 2CCJA 1O03A 3C8HA 4Y7CA 5MGNA 2FEAA 3VNBA 2WIGA 4TT3D 2OXFA 3I5YA 5J4HA 1HZZC 3MJ4A 2GZMA 3OT5A 3PIIA 4YRFA 5TNXA 4FOSA 4ZARA 1RWMA 2AWNA 3C24A 3ZIUA 4BLQA 4B6PA 3IT0A 4BMDA 1NVKA 1LGYA 3M9XA 5IKMA 1EFVB 2CVZA 3DF9A 4E4YA 1M5TA 4KPUB 3ASYA 1U02A 4LCBA 4PIVA 4DZTA 2O52A 4OHZA 3HKBA 2Q2OA 2JI6A 2WM8A 1ABBA 4DY6A 2IUEA 2EBFX 4UEIA 4RJKA 4UREA 1KETA 1NI5A 2NU7A 3E2MA 1XZCA 3RGGA 2NYRA 3CF4A 1AN9A 4CMGA 1NRIA 1W76A 4C6TB 4ZMSA 2EZ4A 3KZ1E 4XX0B 3CINA 3FNRA 3EGDB 3CW9A 3QY9A 5EIBD 5JD3A 1N2HA 2NXCA 1AO0A 5D3MA 1LW7A 5JCOA 1QVAA 2A3RA 4URXR 3W2IA 2PH7A 2O05A 4B32A 1Q14A 1S8FA 2YIMA 2W93A 4O63O 4BWFB 3WWDA 5ICCA 4HOYA 1JH8A 2D5BA 1VKNA 1U8UA 2GZDA 1YI0A 2NZUG 2H0RA 3JZAA 1HDOA 3NEAA 4FFLA 4X90A 4XUGB 3AINA 3ZY2A 5L3SA 3KXIA 3F3YA 2IY7A 1QNFA 4FE3A 3W6OA 1IOVA 4HF7A 2DBRA 5AMXA 1RHRA 1LI5A 3ZCSA 1EKXA 2NV6A 2J3IA 4ZOAA 2CL6X 1IULA 1K7EB 3BRWA 5E6UA 4G5YA 3KSMA 1A27A 3KV3O 4M86A 5HUHA 1CR6A 2QLLA 5J4LA 3MNFA 1IEVA 3HXLA 1V7ZA 4H3SA 4B80A 3RJ5A 3OZVA 5EZSA 4CKBA 5KYWA 4I2VA 1ZAKA 4JQYA 3C6KA 1KORA 1U0TA 3CH6A 2ZW9A 2NZ8A 3KRTA 2OYCA 3ZNPA 4F2DA 2E4VA 2G1KA 3QK7A 3R0IA 1FDIA 2PMCA 5ALRA 2QA5A 2YQ5A 4XOIA 2VQDA 2O2DA 3F8TA 1K4KA 1TK3A 1GU1A 4HAXA 1Q2UA 1HORA 4OIMA 2FDXA 2XD4A 1KDVA 1L7BA 5HX7A 1W52X 4RGQA 2ZBFA 1GQQA 2I2AA 5FFNA 3ORHA 3WLRA 4GXRA 1GUDA 1U31A 3GLHA 3HCDA 5F76A 5NLLA 3HXOA 1ZH6A 3BXZA 4KUEA 2O50A 1JBQA 1Q1AA 1LZLA 4V02A 5DLYA 3TNDA 2IOYA 2ZUSA 1SPBS 4GNKA 4HZGA 5IN5A 1U8XX 4MLCA 4WOKA 1PT8A 3IIEA 1KO4A 3KJEA 4MICA 4Q4DA 3TMAA 4DSOA 2Q6IA 1PT6A 2GZSA 2MYTA 5CT4A 2PJRA 3U4QB 4GIBA 1RIFA 3Q3CA 2OCKA 4D8YA 4ME6A 4F4DA 5L53A 2A9QA 1DB3A 3LHDA 1E89A 2O2SA 1FFGA 2NG1A 2HJ9A 5I7FA 2AG0A 4DOMA 2FZGA 1KXJA 4RXTA 5JXHA 1B6SA 3LF2A 4P7KA 5HE8A 3HADA 4BO9A 5HKKA 4YHHB 3U61B 3DKPA 3GQBA 2UZ4A 5EMKA 3OIGA 1BW9A 3OJ0A 5J2UF 1PV4A 4QELA 1E61A 2R86A 2W2MA 2ZB4A 3OCXA 3THYB 5KTSA 2P2SA 4R1UA 1GDHA 2K87A 3F78A 1B16A 2G28A 3P4UA 4M6WB 1EBUA 1Q0UA 1LQUA 1UZLA 2ZJ6A 3LPDA 4R9NA 3VDRA 3W6UA 1J0BA 5HIIA 3WP1B 2P4UA 5L3VA 3UMMA 4AY6A 2NBMA 3R7WB 4DA7A 1BWRA 1H4VB 2MSNA 2MYUA 2QIOA 1W96A 1AD2A 2QKYA 2IA5A 5G4KB 2HPHA 3W04A 3SDBA 2JD0A 2H54A 1F2UA 5JH7F 1C7JA 3QE9Y 2ECOA 4N8SA 1YB1A 2C8KA 3CV3A 4KLAA 4P36A 2M6LA 3BHJA 5T4HA 3U7HB 7REQB 3Q1LA 4TL8A 1B14A 4HK4A 4EVQA 1PGPA 1WDWB 1Y1KE 5BYAA 1MTOA 5F9FA 4AX4A 1T2CA 1L5LA 2SCUA 1ZSVA 2X8WA 3EZXA 4I7EA 2QN9A 2UYGA 3K31A 4DWOA 5C1OA 2FUEA 4KV7A 1J8QA 1R2QA 2ZWVA 1YE3A 1E2JA 4GYWA 4O4HA 4QULA 2GM3A 4W6ZA 4D9CA 4WKOA 4AJHA 1PAUA 1R74A 4CKCB 5FADA 3VYUB 4BX3A 3TZBA 5DGCA 1E60A 2CBGA 2W2XA 5JIBA 2CFOA 2MMGA 4J0QA 1I33A 2V7WA 3M1LA 4CLEA 4BQOA 1JEYA 3AI7A 3LV8A 3OFJA 1H2WA 4HGZA 1V8DA 3UPDA 3IVAA 1DKLA 3ZU5A 4NOKA 2XAAA 4L0QA 1JG4A 4Q4AB 4RLSA 4GPTA 1HTWA 3C3MA 4MPJA 3KTOA 5F7ZA 2O9JA 4HNHA 4M7RA 5IKOA 1SXJC 1J5XA 1Q74A 221PA 10MHA 3OU2A 3ELWA 1N9GA 4TSFA 5B1HA 5BW8A 2AN1A 1LPOA 1CNFA 1K66A 1J2TA 1T9HA 1RWKA 4DTIA 1FDOA 3IQHX 3PA8A 4ZXFA 3UOGA 1UXIA 1WQ4A 3KTAA 2O19A 1XALA 1L3IA 5G0WA 3MT8A 3IC5A 2VZLA 4MWTA 1P80A 1WF6A 1K9SA 4XQCA 3V00A 1XPOA 4BO7A 4B45A 3N6RA 1PDVA 3BHNA 1HDGO 3B1VA 5LUAA 4X6XA 4HNAA 4AT1A 1QH8A 1X9IA 4DLUA 4R7TA 2LW7A 1GUZA 1Q12A 2GM5A 5EC8A 4EB0A 4EJSA 5AW2A 3IQFA 3V6LA 2DKFA 3UK6A 1GM5A 3FNQA 1UBHS 4UCXA 1R4MB 3IPCA 4Q9IA 3NGMA 5EGSA 4TZ0A 1GSAA 4FW9A 3RS9A 3SZRA 2UZ1B 3RV4A 8ABPA 3DLHA 3ZZNA 1XRPA 1B26A 2I7VA 1F2TA 1N2ZA 2F9FA 1E3LA 1KA9H 1RYFA 1XOIA 2I65A 1Y4AE 2UYOA 4UE6A 3SSOA 3N2EA 3TNFA 5J1TB 4EDFA 1EU1A 1FY2A 1PR2A 1R0ZA 3WQRA 4DIKA 2QZZA 3DC7A 4IW3B 2WTUA 2QHXA 2FN7A 2A9OA 3BZBA 1E0AA 1LPAB 3JQ7B 1N5KA 1UAGA 3U3ZA 4GI1A 1L7OA 3OP1A 4Q5IA 1KU0A 4AZ3B 1ZN2A 4KYIB 4D4HA 5DULA 2QBYB 2RGEA 2CBZA 1Y7HA 3QKWA 4TYPA 1UOPA 2DFPA 1IBKB 1GRVA 1UBOS 1Y1LA 1J97A 1JVBA 1CR4A 4ZMBA 4M1WA 2R00C 2BC9A 5I9IA 5FOSA 4DHWA 3CLSD 2QXUA 3HKCB 1NMZA 2C8JA 5T8KC 3CH4B 1JPNA 4G0UA 4OK5A 2XRYA 4C0XA 5ADVA 2BGUA 1OSNA 3REQA 3WOVA 4CM9A 4KXLA 2GDJA 3CEJA 2XNDD 1Y1PA 1QFXA 4C0HA 2X1LA 4DAOA 3I2YX 2E4XA 4HAUA 2YXLA 3C8DA 3GMDA 3UCEA 3V8RA 4BQNA 2FMKA 2PRKA 2HBZA 1T3TA 2QTAA 1U1EA 2VS1A 2I2FA 3AESA 5D51S 1YC5A 3BB4A 5DRYA 5DXFA 1GLGA 3S2UA 2WHEA 3LS2A 3Q72A 4IZ6A 1IONA 5E8RA 5G0UA 3WGLA 3ZHUA 1Q1NA 1T8TA 3FLMA 1NE2A 4Q7EA 2IZ0A 2O4CA 3I9NA 3R3JA 3R76A 2F55A 3I62A 4MKGA 4FK8A 4PZUA 4ZDWA 4CLHA 3SC4A 4U02A 3PXEA 4CRWB 4DBZA 1WZNA 5KJEA 3DQZA 4JGGA 3D7RA 4N4AA 1Z82A 1MOPA 4O2BB 5DT9A 3E27A 1KZ9A 1V1RB 3JVEA 4JJ4A 4L9WA 3RYFA 1GQOA 1XL0A 3Q2IA 5AR1A 4N48A 2D7JA 1KIAA 1RHJA 2CD9A 3NBQA 4MI6A 4ZCIA 5ENVA 2Y1GA 4FJ1A 5BV7A 1GAQA 2XUGA 1JEDA 2AZ4A 1OLUB 3JRXA 3NM4A 1OFHA 3PWSA 4P58A 1COWD 1NX6A 1TJYA 4QUGA 3WHIA 1JJVA 2UXBB 2R7KA 2KMLA 2ZRLA 1KK1A 1AQLA 1Z2CA 3G2OA 2W90A 4JODA 4NHOA 1K8QA 2VQFB 1G6Q1 3RBZA 3AOEA 2QV7A 3TIGA 1U7XA 1X1RA 4FZ5A 4F3YA 4NXNB 1YT5A 1YRBA 2JGLA 1FFDA 3HYSA 3UJAA 3VR5D 1RJFA 1H2ZA 1VKOA 3AKDA 4KFRA 2CG2A 2XQVA 2CXPA 1PQPA 3AM3A 4BZZA 1ULUA 4A2WA 3B1KA 3WBJA 3BRSA 4G84A 2FG6C 4LYDA 2BFDA 3KAJA 2M2IA 4G0QA 1LV8A 4PSDA 4U2KA 4ND6A 3TMYA 1O0SA 4E94A 4UKDA 4F5DA 2IZ7A 4X65B 1QHIA 4JWTA 3I2KA 2WF7A 3C8UA 1ESDA 3CEPB 3JAKB 4XUCA 3ZWOA 4BNZA 3BFVA 1PWYE 3V55A 4KMMA 2J0QA 3GL9A 1AUOA 2I6QA 5CX4A 3BKRA 4IF6A 4NE7A 3RF7A 4LXIA 4Z3DA 5LB2A 4LC0A 4IUYA 3IEXA 5JY6A 3ZCXA 1WCIA 2HYIC 2YYSA 2IBMA 1S4MA 2IZ6A 4QBFA 1EFHA 5B1SA 4KO3S 5BUSA 2XUKA 4ZAYA 4Z8XA 1WBBA 5BSKA 3TDNA 3GCDA 1RJEA 3ZY6A 2HHLA 4HQNA 5B4TA 4D45A 4RESA 1GL9B 5JC1A 4K86A 4KLCA 4KXQA 3VOTA 2JIRA 4DCPA 1FBNA 2OQRA 3PUIA 1W9HA 2SHKA 2OD2A 3BDVA 1PEDA 3G8YA 3MMZA 2FKNA 4OQLA 2AL7A 2R7MA 4JLOA 5A62A 1ESEA 2CLEB 1ESCA 1NNLA 2G36A 5DTRA 5DNVA 1T5OA 4Z51A 3BA1A 2P2ZA 3N2ZB 3ND7A 4TXLA 5TS3A 1S1MA 4G0ZA 2E49A 1PJ8A 4G5HA 1GR1A 2JHGA 3R8CA 2G5TA 2GT1A 1U2RA 1Z7EA 2C96A 2YN0A 1I94B 1OTHA 2FV8A 4MMYB 1YNSA 4MMXB 4ZIRA 3KU4A 2IPAB 3ZBPA 2VCEA 3H4MA 3ZJTA 2HB6A 4GI2A 5JDCA 3ONVA 2F59A 3ULKA 2NM0A 3AM5A 2WIFA 3DLCA 4N39A 3KBOA 2H59A 2O7VA 3FDZA 4H9GA 3UGQA 3CHYA 4EKNB 3DEJA 4CEIB 2DTDA 4Y2XA 1AM4D 1VHQA 4UZEA 3G2PA 3K9GA 2DUNA 2OHGA 2XHEA 3LRTA 3HI6A 4P4GA 5GAJA 2J85A 1WUKS 3EZGA 4Y6SA 2JDID 3OX1A 5HGJA 1GL6A 2I00A 4L5CA 2A9VA 4QPDA 5DK6A 1BC5A 4WFJA 4J6EA 1HT1E 1KHHA 4NDAA 4Z7OB 1KYIA 4HNSA 1ZW1A 3D3QA 1OTYA 4QFDA 4B4OA 2AT1A 1OOEA 1ODLA 2PKWA 1GRCA 2AF4C 1C2YA 1U0HC 2EW2A 1FVHA 1BE0A 1FS5A 1ZM3A 3RADC 5CNMA 2R79A 2Y1OA 1VKRA 2IL1A 1UP7A 2JZNA 1UC8A 1A2KC 2RMKA 2R25B 2HLDA 3WQQA 1R6DA 4IFTA 4IUDS 2R84A 1D7AA 3QBVA 1YRWA 4MJ3A 4EPXA 1OZGA 4NNOA 4EL0A 2DQ4A 4DR4B 2XXJA 2MINA 2QPLA 3L6EA 4H60A 1G18A 3T5CA 4EHAA 1E2EA 1SZCA 1I1HA 1QQ6A 4Q1VA 1XVAA 3WX0A 2EQAA 1NATA 4J0IA 4I5DA 1UJMA 4M0FA 5FHRA 3FVTA 3O94A 4ID3A 4RFLA 2FWBA 4IDOA 5CCXA 3D3KA 4YRSA 3O3CA 4NFYA 5FAKA 3QPAA 2WFLA 2YWRA 3GFBA 2QN1A 5LUBA 2GASA 4B73A 3FOZA 4TQGA 3OU6A 2X0EA 5EIBC 2Q29A 4KPUA 3L7YA 3H6GA 4ZVVA 4CFZA 2PR2A 1UEXC 5F7JA 2ZS9A 4D99A 1N7JA 1NW6A 2WUVA 5K3BA 1Q0TA 3PA6A 2BJVA 4QHTA 4AV7A 2DM6A 3GXOA 1NKVA 1VJ0A 3WYNA 4C6TA 4XX0A 1QQ5A 4UUBA 4M8IA 2CW5A 1IUPA 4LYYA 3FPJA 3H0KA 3OZXA 1A98A 3B12A 4CT5A 3DFIA 4IDDA 4B4VA 3ESYA 4YP9A 1EH5A 1J99A 1LC0A 2A84A 2FFHA 4HDKB 4ZMRA 1N9ZA 3OJOA 2IYOA 3SF8B 1TC1A 3PNPA 4IQ8A 3B53X 4UEQA 2J45A 2YWXA 2OG2A 3E8XA 1YIOA 3M8KA 5ALTA 4CL8A 3K0EA 1QGED 2ZXFA 1KMIY 5EUQB 3G68A 4GI3A 1SUPA 2XCIA 1OXKB 4WIAA 3OF5A 3PD0A 1ZD3A 3KYIB 1NW4A 3LOPA 2W2VA 1VFPA 2O3RA 3AJ8A 2ODAA 4LQDA 4MPPA 5DIZA 3VJMA 4H18A 3V8QA 5IU6A 4CF3A 2PGXA 4FGSA 4DR1B 4K46A 2HKIA 1TF2A 2QZJA 2YMMA 4Z4IA 1KO7A 2I71A 4JC4A 3T1TA 1CIVA 2IHTA 3E61A 2BZSA 3KXDA 1KOJA 4B79A 4TVOA 1P6UA 4XRRA 1N1EA 3TQOA 4HNQA 4PYIA 1KPGA 3ZCVA 4D3YA 4A2QA 4EG4A 5HBGA 2CEAA 2YYAA 1VG8A 1C0IA 1ZI9A 4KO1S 4O1MA 5CVDA 2VDMB 4DMLA 1CUDA 2CNKA 3EGXB 3FW1A 4Q21A 4W8OA 3MJFA 3WMXA 3N3BC 2O23A 4NYMR 1TM5E 1R4ZA 1USWA 4L28A 3U37A 1LZKA 3COPA 1NOJA 1B7GO 3HJFA 1Z28A 1YZQA 1YVDA 1PD0A 1JQ5A 2HQOA 1RM0A 1JIJA 4JLMA 4U7GA 5J4VA 1T0PA 1ZXBA 3IJRA 4MVJA 2OV8A 1PS0A 4QNMA 1CDDA 3U1VA 1JKMA 1YFKA 4HKTA 1MQ8B 5A6VA 5B30A 2G17A 2W2KB 4E1BA 1VPDA 2JEZA 3LUHA 3LQ2A 1UXHA 4MQLA 2EKDA 4NU6A 1JNXX 5B3JC 3PKZA 4ZQBA 4Q9JA 4RMGA 1KVSA 4A0QA 5IPFA 1E9EA 4J1TC 4MV5A 4DIUA 4F5WA 5DXJA 1Q1BA 4DEYA 5C8VA 3EDYA 1PQYA 3OM0A 1L5NA 3NFYA 1ZN9A 3UAGA 3BIWA 1YQTA 2ODNA 3EQ2A 1AUVA 2YN4A 2JKVA 1B3BA 3KP1A 4NX2A 4LBZA 5DGDA 1SC9A 3JAMA 3EXG1 1BH6A 1CR2A 2JVKA 1LLQA 1XBTA 3LCRA 4O2LA 1VHWA 1ZOPA 1KGSA 4Q82A 5F1YA 5JS1A 2Y99A 5CG2A 2JFWA 1SO8A 4KRGA 2IEIA 2PBRA 2EAUA 1FX0B 1SMKA 2O0KA 2O3SA 3DTNA 4M6WA 5AM1A 3U40A 5JISA 1GTSA 3PFCA 3P9RA 2JJ8A 2ZIUB 5KNBA 1U6KA 3AEUB 3MPOA 4QREA 3BULA 4N7RA 3WL7A 2XWBF 3R7WA 4D41A 2X5OA 4DGQA 5C46F 1U4OA 4IDGA 2R62A 1CUBA 1VPEA 1JHRA 3EN0A 2VHVA 2RBGA 1W94A 3WNQA 1SUWA 1XE3A 1AQ6A 4YLEA 5FR1A 4RCZA 4IV8A 1F6DA 3B6IA 3FTPA 2BVNA 4RQAA 1EWVA 4KP7A 5CA1F 3IXLA 4L16A 4JCOA 5GV7A 2WJZB 2IU3A 2CB9A 4QTXA 2VR1A 4JMPA 2IYWA 4CL0A 4D9BA 4TGLA 1KVUA 5DW3A 4AXXA 1Z45A 3GMTA 1I6LA 1UMCB 4XYMA 2Y1CA 2D0PB 3ZEIA 1H66A 1MAHA 1FDUA 4I4TF 2BM0A 2V7UA 2VT2A 4HDMA 2P9YA 1JIUA 3SHFA 5EJFA 1JSRA 1E2KA 1SU7A 1YKGA 2GSWA 1CXZA 4CKCA 3TZ6A 4BNJA 2I78A 4QYIB 1PL6A 2DPMA 1Y1SA 4GYJA 4CM5A 6LDHA 4CCSA 3OY2A 3AZQA 4J7AA 4KB5A 2ZTLA 5IAJA 5D5PA 2FN3A 2D2EA 4MVJM 1LF5A 2A14A 4Q19A 4BXOB 2BGLA 4R3WA 4Q4AA 3C70A 3AI2A 2ZSAA 3DEYX 3ND5A 4KU4A 5FBWB 4COKA 4JBHA 2OOKA 1SHTX 2I99A 3CPJB 1TVMA 3N2YA 3DFMA 4LGYA 4YQEA 2CN1A 4JEMA 1E2BA 3FUTA 2XUAA 4KDEA 2IHJA 5FTKA 5A3RA 2CJYA 1JQBA 2W42A 2K6GA 3WK7A 1FP4B 5HM8A 2GK6A 2RC5A 3A0RB 4Y9TA 3NDBB 4KO8A 3TTSA 1KXZA 1YL5A 4U9UA 3RUCA 1M5UA 4R1NA 1HA3A 1Q50A 1QFZA 3D02A 5F2EA 1Z0UA 3TSWA 3WLKX 5F12A 3BQ9A 1OR8A 5MFZA 4HAYA 2Q8NA 4R69A 2YCBA 3X1WA 3QHAA 3SNHA 4HX2A 5GZ3A 3DL0A 1CJSA 4B84A 3D5EA 4NQZA 1P4AA 3TLMA 3KQVA 1P1JA 2YC4C 2UZ1A 3G8CA 3BCUA 4WADA 2IV7A 3IH5A 1TEVA 3OO0A 1U8FO 2ZSKA 3NM5A 3PNMA 3VVCA 4B2LA 3CPSA 3OESA 4QXRA 4TS1A 1D3AA 2QVBA 3CLVA 4CW7A 1NGSA 3INYA 4B83A 3FYDA 3EFOB 2RONA 4TTJA 3MFYA 4JJGA 4LV6A 1VL1A 1E94E 3I1FA 4G25A 4DIDA 4HJXA 3CLSC 3PDIB 1SZPA 1U2GA 1KAGA 1VCIA 3JQ7A 2H3EA 4LDRA 4YJDA 2FCAA 5CTAA 3H42B 1TIPA 4MS4A 3RF6A 2CV0A 1N0UA 2C1ZA 4GE0A 5K5EA 5KB3A 2QBYA 5K0FA 4IIGA 4NXMB 1P0IA 2X41A 5KYXB 3MSCA 5FUQA 3LGXA 2NO4A 2VK4A 4INPA 4V2UA 5G1PA 1JVNA 5FOWA 4TRMA 2DGDA 1C30B 3B2QA 1MGOA 4FONA 721PA 3DCYA 3MM4A 1J49A 3I64A 2IZOA 5HUJA 4IHKA 2F00A 1Y0BA 4FNGA 1Z4MA 1DKMA 1RQRA 4FYMA 3T1HB 2EKZA 2H1IA 4P54A 1LJLA 5FA5A 2JFGA 3V1TC 4ERNA 1U3GA 4QYXA 3VDXA 4R71A 4UEOA 2GVZC 3H1AA 5T7BA 5KREA 2C5GA 4YT2A 2I0FA 3FPKA 1AA6A 2WUGA 1GJRA 1CZOA 2PDAA 3CUWA 1V11B 1KMNA 3OQPA 4P32A 3ZHVA 1AKQA 2V45A 3TIVA 3TW0A 3QKIA 1VMAA 2QQGA 5GM2A 4TMVA 1EK2A 1INLA 1UPBA 4ZREA 5JALA 3IP6A 1MB0A 1PEKE 4M1ZA 4R0MA 3TG2A 3BREA 3N70A 4B31A 2BI4A 5HRAA 1Q84A 1FRQA 2KBFA 3HHEA 3IJ5A 3R77A 4M4SA 4OJNA 5DBEX 4BY9E 1C9KA 1EEHA 4P4TA 5E6RB 3ZQ6A 1R15A 5EVCA 1ONBA 4OL0A 4PRKA 1F3LA 3QIVA 4NNPA 3EVDA 3V42A 3C3YA 2OECA 3ROTA 2Q6VA 1ZU4A 3OFSA 5K09A 4RPCA 4QRIA 1RPTA 3DEAA 1KMMA 2HHCA 3HBNA 4RQBA 1U63A 1Z6QA 3Q1KA 1ZN7A 3FJOA 3G79A 4AMBA 5I45A 4ZICA 4EOGA 1YA6A 1OLUA 2JLQA 1DAPA 2ORYA 2QD3A 4H7KA 5CU7A 2PYDA 3A3PA 4J2TA 4P7JA 4LQCA 3GEIA 1LWOA 4TRRA 2O8CB 1X7ZB 4C5BA 2XE8A 4C9BA 2JD1A 6YASA 1SVNA 4Z0NA 3TEFA 3VBEA 3WDMA 3VYWA 4N5MA 2QD5A 5KSPA 2PD4A 4YR9A 4CKWB 5DHSA 1N8NA 1SU4A 1FSZA 5H83A 2I80A 2O8BB 2DQKA 1MNAA 4MWSA 1XMSA 2HQSA 1G59A 2G63A 1Z34A 5JJCA 2IDZA 3N7ZA 3GRCA 2I3BA 5I8PA 3E3OA 5KU1A 1HNNA 3PNOA 5DZSA 5KQGA 3T95A 4IQ4A 1KAEA 4EIWA 1TJ3A 4PLTA 4Z0PA 3BICA 4XTCS 2HRRA 3CT4A 1TL7C 1M6NA 3CT6A 3GGCA 2IU6A 3TLBA 5TMBA 3UV7A 4BB0A 3E2IA 2Y0BA 4R2KA 2EX4A 1VE3A 1L4YA 3GVHA 3JAKA 2O3UA 3IAFA 4KDRA 4R7ZA 4DHEA 2PD3A 1UIMA 4YRMA 1RQ2A 5CD9A 3FROA 2EV9A 3WRVA 5EHNA 4HZIA 4BYGA 4LF7B 1IVYA 4URYR 4TZTA 2WVJA 2Z8YA 4AKSA 1I51A 1E63A 4U2BA 2NUBA 1Z6AA 1V8FA 4BP8A 4DAEA 3IR5A 1T2FA 1JU3A 1TZ2A 1P81A 4TVBA 3IP8A 3TYXA </