3SSOA

Myce methyltransferase from the mycinamycin biosynthetic pathway in complex with mg and sah, crystal form 2
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
393
structure length
393
Chain Sequence
EFDEATVQDVVRLAGGHDSELRELTQKYDPAMISRLLVAEILSRCPPPSNDTPVLVELAIVHGSERFRHFLRVVRDSPIRPVGADEGFVGMLVEYELTELLRELFGVTHERPAGVRGTKLFPYLTDDEEAVEQIGTYLLAAQQGTEAVLAGCGSRKPDLSELSSRYFTPKFGFLHWFTPHYDRHFRDYRNQQVRVLEIGVGGYKHPEWGGGSLRMWKSFFPRGQIYGLDIMDKSHVDELRIRTIQGDQNDAEFLDRIARRYGPFDIVIDDGSHINAHVRTSFAALFPHVRPGGLYVIEDMWTAYWPGFGGQADPQECSGTSLGLLKSLIDAIQHQELPSDPNRSPGYVDRNIVGLHVYHNVAFVEKGRNDEGGIPTWIPRDFESLVQASSGGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
pubmed doi rcsb
source organism Micromonospora griseorubida
molecule tags Transferase
molecule keywords Methyltransferase
total genus 131
structure length 393
sequence length 393
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.238: Mycinamicin VI 2''-O-methyltransferase.
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17843 MycE_N MycE methyltransferase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.30 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A Nonspecific Lipid-transfer Protein; Chain A 3ssoA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ssoA02
2YXLA 5LQCA 3P2IA 5FHRA 3LCVB 3TMAA 1QAOA 4LWPA 1VP3A 1VLMA 3FPFA 2P41A 1H1DA 4NECA 1R8XA 2ZFUA 1XCLA 5DX0A 5ICGA 3EVAA 4PYOA 4H0NA 2BM8A 2ZSUA 5E9QA 2YR0A 5DLYA 3TRKA 3HVHA 3A27A 3FRIA 4EVIA 2V74B 2YXEA 1TPYA 2BR4A 1WG8A 3FPJA 4PGGA 5KQSA 4FSDA 3G89A 3DXYA 3I9FA 3CJTA 2Z6QA 2NXCA 3LKDA 3E05A 3U81A 3R3HA 3KQWA 4RSRA 3BZBA 4EQZA 2B9EA 4FP9A 1YF3A 3BGDA 3EPPA 3HEMA 1Y8CA 3DMHA 5CVVA 3CKKA 2PWPA 5K0NA 2AOVA 2ZZMA 4BP3A 3OE5A 4DZRA 2B25A 2K4MA 2HTEA 4KIGA 3VC1A 4GOLD 5GP1A 2JHPA 5K8VA 2EX4A 1Q0TA 4HC4A 3DLIA 1O9GA 3EVDA 5LQJA 1HNNA 2PY6A 1O9HA 3JWIA 3OCJA 2HMYB 1JG1A 3SSNA 3T0IA 2LD4A 1ZQ9A 4GBED 5EHGA 3P9CA 1RI4A 5ICFA 4ER6A 1WZNA 5GIPE 1L3IA 5EMKA 3LECA 3EMDA 5DRTA 4DF3A 3EGIA 3QOXA 3P71T 5FQNA 5K03A 2XVAA 5HIIA 4OA5A 2P3OA 2PXCA 1DL5A 3E7PA 4OQDA 3SVZA 3GGDA 3R6TA 4P7FA 4Y30A 4YUVA 4RTKA 2N47A 3VSEA 5GIOE 4YUXA 3KKZA 1KR5A 3TKAA 2Q41A 4ER3A 4P7JA 2GLUA 2FYTA 3HCAA 1UWVA 2XYVA 1RJFA 3LCCA 3Q87B 5E9WA 1PRYA 1SVUA 2JHAA 4DA4A 3B3JA 3PX2A 1YZ3A 1NT2A 3RIEA 3JWJA 2NP6A 3ELWA 4L7VA 3OPNA 5E8RA 5HIKA 1NW7A 2B2CA 4M7RA 4CWAA 1XDUA 5BP7A 5LQNA 3CVOA 5ICEA 5KVAA 1AV6A 2EJTA 4P7KA 4R8RA 3OU6A 1RI3A 4AZSA 3HCCA 2XVMA 2PJDA 2UYHA 5DRYA 3IYLW 5FCDA 3S68A 2Y1XA 3HM2A 2PVCA 3MTEA 4YV0A 5LR6A 4E2WA 3PFGA 5K0LA 4CKBA 1X1DA 3FTCA 5M5BA 2ZZKA 4RTPA 2EFJA 1UIRA 1XDZA 3K0BA 4E2XA 3LPMA 3EVBA 5T64A 2XYQA 2FCAA 2PBFA 1EJ0A 5FTWA 3HCDA 2VZ9A 4X1OA 1G8SA 2QE6A 5CVUA 2G72A 2ONYA 3FRHA 3KR0A 5EPEA 3UJ9A 4PIMA 3DUWA 3NWBA 3E23A 4DM3A 1SQGA 5EKXA 3GO4A 4ISCA 4X61A 3M33A 2JHCA 4GUAA 4M37A 3GXOA 5DWQA 2IFTA 3EEOA 2P7HA 4E30A 2A14A 2JG3A 2PX4A 3NDIA 4U7PB 2PWYA 1B42A 2G71A 3FTEA 5LQAA 1QYRA 5FADA 3MAGA 2WA1A 1FP1D 5EIWA 3HTXA 1PJZA 3M4XA 1XDSA 3OFJA 5HILA 3FPHA 1ZHFA 1YFJA 3PS9A 1SUIA 1DUSA 1MHTA 3OU2A 3UA3A 1D2GA 5E1OA 2ZZNA 4GC9A 5DSXA 3O31A 3HNRA 3P9KA 1EAMA 3TLJA 4PCLA 3TOSA 3ORHA 1VPTA 2JH8A 2PKWA 2R3SA 3FUXA 3FYCA 2B78A 3NVMB 3P2KA 3G8AA 3KPWA 4KDCA 4U7TB 4EKGA 1Q0SA 1WY7A 3JWHA 5EZSA 3EMBA 1X19A 5EVJA 5G02A 4RTNA 3R9XB 3NJRA 5EGSA 4GF5A 2FK8A 3KHKA 5DM4A 2YQZA 3KR2A 3P97A 3FPGA 3NW9A 1ORHA 3DH0A 1BOOA 2IH4A 5D1HA 3O7WA 2EJUA 5EZQA 5D1NA 4P7GA 5EEHA 2OY0A 2EG5A 5CVDA 1RI5A 1WXXA 1AF7A 1SUSA 3B89A 3FZGA 4UOEA 5K0BA 2ZCJA 2HWKA 1UFKA 4HSGA 4RTOA 3UFBA 4PYKA 3AJDA 3T7RA 3G7UA 1ZGJA 1N2XA 3C6MA 1QAMA 3EVFA 1JSXA 1KYWA 3H2BA 1KPIA 3R0QA 1NE2A 2AZTA 1SQFA 5DT2A 5EG5A 2Y1WA 3DXXA 2ZWVA 5LQRA 5DM2A 3C0KA 3ER9A 2UYQA 3BKWA 7MHTA 4P58A 1TW2A 3CBGA 3LDFA 2OB1A 5EQJB 4IWNA 3G2MA 5DTQA 3SM3A 1M6YA 3PX3A 4IV8A 5DX8A 4AX8A 3AXSA 2ZWAA 4R6WA 4C04A 3HVKA 2IDKA 3GU3A 2AOTA 4WXHA 1R18A 3A25A 2OXTA 4DKJA 4KWCA 1VBFA 2P35A 3TPZA 2G8NA 4PCAA 4OBWA 3LSTA 1R74A 3DMGA 3EVCA 3R24A 5CCXA 4EMSA 3P9NA 4DMGA 4ER0A 1L3CA 3FUWA 3FUUA 2UZ4A 5C1IA 2I62A 4KVZA 4MWZA 2G70A 4MIKA 2BZGA 4PYNA 2H1RA 3TQSA 5F2NA 1DCTA 1JTEA 5CUQA 3UJ6A 2IH2A 3MHTA 1XVAA 3ANXA 3QOWA 5GWXA 5T6BA 1L9KA 4C07A 1YFLA 4OA8A 3KPVA 1KPHA 2NXJA 2ERCA 5H02A 5HIMA 1KPGA 3DLCA 3BKXA 5BXYA 1NW5A 4E33A 1F3LA 5DX1A 2AN4A 2NXEA 3KPUA 3MQ2A 2F8LA 5DXAA 1ZG3A 3AWIA 3EGEA 5FUBA 3I64A 1RJGA 1QAQA 1U2ZA 4QDKA 4BLVA 3MTIA 2ZVJA 5HEKA 4E32A 3SR4A 4RVFA 5K05A 3GRVA 3SSMA 3I53A 2P3QA 3MERA 2HV9A 4DCMA 5FWAA 1I1NA 5LSAA 2ONZA 3GRUA 1G55A 2ZBQA 1EIZA 4RTLA 3QV2A 4DQ0A 5LQUA 5BW4A 1NBHA 3FPEA 3OZTA 4M36A 5DTRA 5DSTA 4PWYA 4F86A 3G8BA 1V39A 1P1BA 2PLWA 4ATNA 1X1CA 5E1BA 4OX9Y 3B3GA 3M6UA 5B1SA 4X60A 3ERCA 5KS2A 3SXJA 4X41A 4R8SA 2ZIFA 3UA4A 5MHTA 1JG2A 4PYLA 1M6EX 3Q7EA 2R6ZA 3LGAA 2PX5A 2UYOA 5HZMA 3P8ZA 1KIAA 4GC5A 3GDHA 4YUZA 3PB3A 3LDGA 4OBXA 1QZZA 4AZVA 1M0EA 3GRZA 2CL5A 5ERGB 9MHTA 1ORIA 4A6EA 3MGGA 3B3FA 4PGHA 2GAFA 2NYUA 3DTNA 3ME5A 4QTTB 3TFWA 3TKYA 5EKUA 1WXWA 3KPYA 2ORED 3OZRA 1TW3A 5DM0A 3V97A 4QQNA 5E9JA 2XYRA 5IKMA 5CD1A 3RODA 5K0GA 2QY6A 5HFJA 4POOA 4IKPA 3TR6A 3HVJA 3WSTA 2IBTA 2KW5A 4AUKA 2C7PA 4GOND 1L3BA 3VC2A 5JR3A 2NNWB 4ER5A 2HR1A 3THSA 4QPPA 3OU7A 2O06A 1JQ3A 4GOMD 4RTJA 3CJQA 5CIYA 1KYZA 2BH2A 3G2PA 1VQ1A 3HA3A 2AOUA 1D2HA 1FBNA 1QANA 3GNLA 2C7RA 1VL5A 5K0JA 2ADMA 2ZLBA 4KRGA 2PV0A 2FHPA 2C7OA 2NP7A 3M70A 5ICCA 3F4KA 5JUWA 2BR3A 5K09A 3BWCA 4V0QA 3EVGA 2PT9A 1FP2A 5EOVA 4ER7A 2IPXA 3UJAA 3BWBA 3ELUA 4A6DA 1FJXA 2FK7A 4CKEA 2P8JA 1EQAA 3KQYA 1XTPA 2OZVA 3SX0A 1KHHA 5GM1A 3NWEA 1YB2A 4ZTBA 1R6AA 2XBMA 2FPOA 3CGGA 2WA2A 3PVCA 3I5UA 2YXDA 5E1DA 1AQJA 10MHA 2GB4A 1VE3A 3IEIA 3LBFA 4QTUB 5FULA 4JXJA 3KQSA 2I9KA 1IM8A 5EC8A 2PX2A 2Z6AA 2P40A 3D2LA 3C6KA 5T67A 2PSSA 3DULA 2H11A 4LG1A 2BM9A 2OO3A 2PGXA 3UJDA 1RJEA 3DP7A 1N7IA 1X1BA 2ZW9A 2OKCA 3GIWA 5U4XA 4YV1A 2PT6A 3OFKA 4HGZA 1NW8A 3A7DA 3AY0A 1JR4A 3KR1A 1NV9A 3K6RA 3KQQA 1INLA 2O05A 3FTFA 4XCXA 2V7EA 4YUWA 2ZTHA 3KQPA 4G56A 3L8DA 1G38A 2YTZA 4BLWA 3M6WA 3P9IA 4QVKA 2AS0A 4MQ4A 2GA9A 3M6XA 5DTMA 3NVKI 4R6XA 2I6GA 1RI1A 5FA5A 3THRA 1R8YA 3PLAE 2I7CA 2BR5A 4XUEA 4V0RA 4CXMA 3C3PA 3HCBA 3KU1A 5P8WA 2AN5A 2DULA 2B3TA 4XUCA 3G2QA 5DM1A 4CKCA 3BWYA 3GRYA 4RTRA 3GRRA 3REOA 2AOTB 3RW9A 4FT4A 5IH3A 3G88A 3PFHA 1IY9A 3EVZA 2Z6UA 4HH4A 3X0DA 3ID6C 4HTFA 4PYQA 5FQOA 2O0LA 4RYLA 4RTQA 3PT9A 5K0FA 3P2EA 4E2YA 4KW7A 4F85A 1WS6A 3UZUA 3CJRA 3TM5A 4C03A 4E31A 4C4AA 1KXZA 2P7IA 2OPBA 2YVLA 3E8SA 1R00A 1EG2A 1NW3A 1NBIA 3LX6A 2IDJA 1YUBA 4HGYA 4PIPA 2C7QA 5EMJA 4PYIA 1BKYA 5FHQA 3NDJA 3G5TA 2VS1A 4Y2HA 2IH5A 3CCFA 4KDRA 2VDWA 3DR5A 4WVLA 4FSXA 5KQRA 4MHTA 2WK1A 1VP9A 4MTLA 5EEGA 2UYCA 5K01A 4FGZA 4F84A 2VDUE 3KQOA 5FA8A 5C9ZA 2AVDA 5EMLA 3UJBA 4DCGA 5K0EA 3LCUA 4RTSA 1KP9A 3BXOA 3DMFA 3V8VA 3OZSA 4XUDA 2CMHA 3FTDA 4YUYA 1BHJA 4AZWA 4PONA 5E2AA 3T7SA 5LQKA 4YV2A 1RJDA 4CTJA 4RX1A 1VIDA 1D2CA 2NXNA 2CWWA 5CCBA 2IGTA 1SKMA 1XCJA 2PX8A 3CC8A 1XXLA 4K6MA 2YX1A 4LWOA 5GM2A 2ZIGA 3ELDA 3T7TA 3KQVA 2P1DA 3EGVA 3OE4A 1I9GA 4KIFA 2E5WA 1L1EA 4RVDA 3G2OA 4QDJA 1JQDA 5EHIA 3KPJA 4C08A 3BWMA 1F38A 2ZIEA 3TM4A 1XJ5A 3HCFA 4RV9A 2OYRA 4E70A 2OB2A 1O54A 3HCEA 3NTVA 4PYMA 2IBSA 3UBTA 3A4TA 4B17A 3MB5A 2ZBPA 4OQEA 3KR9A 4PYJA 5DPMA 4BP1A 4IV0A 5F2KA 1AQIA 4CTKA 3G5LA 1OR8A 4RVGA 3AXTA 3MCTA 4R05A 3A26A 5E1MA 3VYWA 3IHTA 2PXAA 2QRVB 4LECA 1NKVA 1NV8A 4X63A 4HRAA 1G60A 3KQMA 5HOQA 1SG9A 3UJCA 3SGLA 1ZKDA 2HNKA 5CVEA 4RVHA 1X1AA 3EEYA 5EMMA 1P91A 2ZULA 3FUVA 3EVEA 3JWGA 5F2OA 5E2BA 4RTMA 5K0CA 4GEKA 1IXKA 2FRXA 1YZHA 4M38A 2VP3A 3LL7A 5C0OE 4C05A 1HMYA 3SSOA 3HA5A 4FR0A 4E2ZA 3HVIA 2QYOA 2CMGA 1P1CA 3C3YA 3DXZA 1I4WA 1MJFA 3M6VA 1T43A 2QRVA 5CVJA 1G6Q1 3BT7A 1ZGAA 4PNEA 1G8AA 3NMUF 2CKDA 2GS9A 4GOOD 5HIJA 4EKIA 4YMGA 3PTAA 1P39A 4BLUA 4FT2A 3GJYA 3GCZA 2OBFA 4GQBA 2ZBRA 2AN3A 1JTFA 4EK9A 1JG4A 3ER8A 2P3LA 2AOWA 1JG3A 2PXXA 5KYGA 1N7JA 1NW6A 2AR0A 3FYDA 3BGVA 3I58A 4C06A 2G1PA 4QQKA 8MHTA 3ELYA 2AOXA 2DPMA 3LDUA 1JSZA 1JQEA 4PINA 5GINE 2ESRA 1FPQA 1BC5A 3LKZA 1Z3CA 2O57A 3UJ7A 2JJQA 3LHDA 5EIFA 4AZTA 2GH1A 3O4FA 4O29A 5E8JA 2GPYA 3UWPA 5FWDA 3MCZA 3GWZA 2JH9A 5BW5A 2AOUB 4QVGA 3LBYA 5DXJA 2QM3A 3A7EA 4Z2YA 3DOUA 3B7PA 1RI2A 2YUIA 3BUSA 2IIPA 3IV6A 3KQTA 3HP7A 5GOZA 4YMHA 2VDVE 3BGIA 3UJ8A 3B5IA 4QPNA 3FUTA 2AVNA 2O07A 4FS8A 4FZVA 3HA7A 4HTFB 4RWZA 4HG2A 1EJ6A 5CM2Z 3SMQA 4BY9E 2IP2A 2H00A
chains in the Genus database with same CATH superfamily
2IE0A 1VG1A 2WE8A 4Y0VA 4FGLA 1Y5LA 1E2UA 1V5WA 2N42A 3EZNA 4HN2A 5A05A 1YQTA 1H1DA 2VR1A 2X6TA 1UM8A 4GM1A 4H4DA 1XCLA 1T5OA 1X0XA 1YD7A 1O6BA 3N2KA 3ULKA 3E9ZA 1Q0LA 3FTQA 2LKDA 3A27A 4C1NA 2V74B 3A1CA 4U3JA 3FPJA 3CF4A 2Q8NA 4RF4A 3H17A 1X8KA 4JENA 2QDXA 2WU1A 1G2PA 3D0OA 4XFDA 5KZMB 1O6ZA 3HB5X 1KWKA 2BKAA 3LBAA 3MILA 4J0JA 4PZ0A 3T3EA 4BNDA 3EQ8A 4F8EA 2HV8A 4QPCA 3QFTA 2CXOA 3C74A 3RLFA 1LPPA 1XLUA 2WV7A 4B7AA 5I7WA 2F1KA 5IDWA 4FCCA 4YMSA 3ICVA 4NZPA 4EF6A 2V5UA 3NV7A 3IO5A 1OHHD 4HNSA 4E51A 3PC8C 3E1SA 3EGWA 2F3QA 3LGSA 3RRFA 4HC4A 1GITA 4CLRB 1D7OA 3OCJA 1JDSA 2ZI4A 1NF3A 2OCAA 3CONA 4MDFA 2UUAB 4GE0A 3R0ZA 4O4JA 1MZPA 1DKRA 3QHAA 4BJHB 1GG2A 3AR6A 1XTUA 1ZI6A 4R9SA 1DQYA 3QKTA 4DEXA 4EFMA 5C1BA 5LKAA 3WLIA 5CX4A 5HIIA 3KYBA 2YIVX 1LI7A 4RTKA 3SE7A 3AM1A 4MS4B 4GX2A 2J3QA 1XAHA 4Q7MB 4PSKA 1FMJA 1N0IA 4URYR 5GIOE 4OXRA 2B8NA 4DE5A 4BFVA 4Y2YA 3SD7A 3BN3A 1JHYA 3LCCA 4HAWA 4O8CA 2VHZA 4BO5A 1SQ5A 1VHTA 1ORVA 3BIWA 2DR0A 3PEFA 4JEHA 4BMCA 4EB6B 5EMNA 1FFSA 4J43A 2F1IA 2G1AA 1R6BX 1PZEA 4O4LB 4YTEA 3GBSA 3ASVA 2JIMA 1RZVA 5LYYA 1Q74A 2E4XA 1W87A 2PMCA 1CJUC 2WKPA 5CURA 3ZZMA 1G8YA 1A9YA 1JKIA 1YKGA 4FE3A 4JH0A 3R7WA 4F06A 4URZR 3LOQA 4TUYF 2PGOA 5BUSA 3MGKA 2B99A 1QF7A 2J7PA 1JIJA 1TXGA 1SU4A 1Q6YA 2Y1GA 2ZRJA 2ZJ8A 3LP8A 3ORYA 4L2IA 4RMHA 4N0PA 4DDMA 4YYZA 3WIDA 3IYLW 3PXBA 3VHXB 4EG1A 5K99A 5C7OO 3NHUA 5LQSA 3V80A 4D02A 2CV0A 4DA6A 1YDHA 1LSUA 1Y6RA 4JX8A 4R0MA 1DXQA 2YHAA 1J97A 3M6IA 2EFJA 2V7WA 1UIRA 1PX0A 1VM6A 3EPRA 4GPZA 2HRBA 5T64A 1SU7A 3JQGA 4K9LA 1MORA 2P6PA 2RH9B 4MPJA 4YK7A 1DKNA 3QNMA 421PA 4AO8A 5CB4B 2I2WA 1RXVA 2ZI9A 2ONYA 3UB4A 4BQOA 2QN9A 3WAJA 3IT2A 2HU8A 4FFBB 4RXMA 4ID3A 1RQNA 4EEZA 1Z7YA 4ZI7F 1M1YB 3TFOA 5EJFA 3Q8LA 4IOLA 3WIEA 4PPGA 2OV2A 3I6BA 3HB7A 4HEJA 4IRMA 5AI0A 2A2ZA 3HADA 3HU5A 4X65B 4H1VA 1NKTA 1PJZA 3DBLA 4A92A 5J23A 2LKCA 3BE4A 3GUHA 4R51A 4RV4A 1N4AA 3OF5A 4MB0A 3T1NA 3WY9A 3SHQA 3Q15C 1UXGA 5DO9A 1OI3A 3KK0A 3WHLA 4PLPA 1E8DA 2Q4EA 3U3XA 5F3WB 1XJQA 2AX3A 1O4VA 2BONA 1W4AA 4B3CA 3JTEA 3MWEA 4MP3A 2Y93A 4D96A 3BJZA 1D1SA 2YYYA 3D6VA 3G8AA 5LYJA 1Y1LA 2ECKA 3NGXA 3UK0A 5FFNA 3OCXA 1SEVA 3EMBA 4ZI7A 5EVJA 4ZGBA 2VDOB 4M1SA 1LBTA 1ZD1A 3DP9A 3HBFA 3T3GA 1EHCA 2KWIA 3ZJYA 5BNIA 5JAHA 1QG0A 5TMBA 3TOZA 4BDSA 1Y81A 5CFPA 3NTXA 2P5SA 2Q5HA 1CR1A 4HQKA 3CZQA 1JE0A 3OIGA 4DNQA 1T2FA 2CUTA 2P1ZA 2R8RA 1AK9A 5EZQA 4UASA 1BXZA 3CLVA 1QKJA 4DR5B 2ZU6A 5IVHA 1SUSA 3ZXXA 2WHRA 4CLOA 1WB4A 1B3BA 1NYLA 1AK1A 1HQYE 4RTOA 3FVQA 5JZOA 4B75A 4B6GA 2W4IA 3N0WA 1EVJA 4KEAA 1UOQA 1KYWA 2OXEA 2XB9A 4DSUA 1ZW6A 2GN0A 1XRNA 3E9MA 2IOHA 4XX0B 1KDVA 3X1ZA 5I4BA 3TS1A 3QFCA 1QO9A 4IOJA 2JIQA 3LP5A 3CBGA 4KN8A 2CZGA 5DNDA 4EATA 5L4LA 1F06A 1JPNA 4FMCB 2B2XA 5DP2A 2C20A 2QQ5A 3DMRA 4Z0HO 3ZE7A 4AROA 5K8CA 2HMAA 2YS7A 4H7PA 4ECEA 4EY8A 2R60A 4TVBA 1BFKA 4YJ2B 3DZ8A 4EJFA 1UBJS 4EX6A 1Y6FA 2HL6A 4Z8YA 4WXHA 3HBJA 5DSZA 3V1NA 4DEYA 1QRAA 3AERA 3TPZA 1NP6A 3ZJVA 2LNDA 4AX4A 4XYGA 3KVVA 1QMPA 1D0SA 2HK6A 4C7KA 1Z38A 2V7GA 3DMGA 4V2UA 3AKYA 1DAKA 4FS3A 3RNOA 4UTVA 3P9NA 2B92A 3R5XA 5G3ZA 3KOXA 2I62A 3GD5A 3V8MA 2BZGA 4W82A 4C6TA 4FN5A 4JP8A 1SOWA 3TBKA 1G6OA 1QFYA 4OM8A 3H4VA 3HR4A 2AG5A 2AHOA 4MV7A 1UBUS 3C3DA 5G1OA 4D0RA 4OKSA 2CNNA 3QPUA 1CLUA 2C3PA 1FQWA 3DW3X 4JCCA 5L4NA 4MR8A 4QFDA 4IDAA 4MQLA 4X91A 4BFTA 5DXAA 3T1YB 3DPUA 1S0UA 2FQ1A 1Z63A 1P2BA 1VLHA 3IQIX 3KKNA 2ZPTX 4IHKA 2QX4A 1BDMA 2WFAA 2I3DA 3D8HA 3EJWA 1VMAA 1WB5A 4CLRA 3SLKA 4RM2A 1J0XO 1E2EA 4OGLA 2VP0A 2WSBA 5DK6A 1MCZA 2PUJA 4N5NA 1MP0A 1SO8A 1LKZA 3MCAA 5THKA 1CJKC 2J3HA 4G4SO 1WD7A 3FPEA 5F7JA 4DXAA 4M36A 1QOZA 5DTRA 1O94C 3BGSA 3ZV3A 3BTSA 1CZKA 1B8VA 1HXHA 1X1CA 2L69A 3K4HA 3WB1A 3GLFA 1I14A 4D74A 2PGJA 4UNPA 3SXJA 3KAKA 4KJZA 3ABRB 4IH4A 2W6IA 3TW8A 2J0VA 1ESEA 4FOTA 4ND2A 2XDYA 4PVDA 2O7QA 3SC2A 3MEQA 3B78A 3I1YA 1FMLA 2CL6X 3URMA 4OUDB 2JK0A 3E0QA 5EQFA 1I0ZA 4FYJA 4A7PA 5A5VA 1XTZA 2GEDA 4JIGA 1ORIA 4ALIA 4DA9A 3HHEA 1K6XA 3SU8A 1VMKA 3B3FA 2PL9A 3F67A 1JIXA 3PDCA 4MMYB 4RZIA 3K20A 4K9KA 5TPZD 2BEKA 4XPIA 1T2VA 2O8DA 4H4EA 4MS3B 3OQJA 4N03A 1WBBA 3O73A 1HEYA 1SUDA 3BN8A 2R11A 4JGIA 2Y71A 3E48A 3ESCA 3LC2O 5HFJA 4WNYA 5F1OA 1CY4A 1BS1A 3LF2A 2KW5A 5CIWA 2Q6TA 1HDCA 2RG1A 4HNAA 1USGA 1RU3A 1DCMA 2OM6A 3ONVA 3D6TB 3LVBA 2FJ0A 1T3TA 3Q3GE 1D4AA 4RH3A 1KYZA 1C14A 3LIIA 3BIXA 1A88A 1DQRA 3A1DA 3H75A 3TOCA 4KRGA 2WZQA 4D4GA 4TV8B 3CNEA 4FNAA 3R7SA 1WV1A 4BCBA 4GXRA 2C7OA 2UDPA 3FCSB 4G89A 4IIXA 1SHTX 2MINB 1A76A 2VOJA 1IAVA 3VTAA 2YCLA 3PZBA 1SBTA 1IVNA 4RVCA 1Z3IX 2LIVA 4M7PA 1ECCA 1RYEA 3LA8A 3C97A 5AKGA 3AUYA 1KO8A 4ZQEA 3HEBA 2NVBA 3JW8A 3K9GA 4IF4A 4NOLA 3TX2A 3ZS8A 4A0SA 4BZXA 1E6LA 1XZLA 3B51X 3LHIA 1FZQA 3D8SA 1VE3A 4U7GA 2XXBA 3S81A 2WIJA 1K7EB 2E4WA 3R7WB 2PSSA 3R7BA 1DELA 4HDSA 1S8FA 3MT8A 1T0BA 3DEJA 3H99A 2PR7A 3KHTA 1PTJA 1HETA 4R1PA 3T3IA 2VP5A 1R4AA 4EHKA 4W99A 2UU9B 4NBWA 5A04A 2C1ZA 2O5CA 1JR3D 3T41A 3T35A 1N34B 1ZINA 4ZCIA 3S2FA 1ZMTA 1C81A 1SKAA 1N9GA 2EFHB 2IK8A 1U8CB 3KQPA 3LOPA 2Y0BA 4JOCA 4QSHA 3GFRA 5A71A 2GA9A 4I4TB 1BMFD 3NU1A 3GAZA 4EMBA 1SPBS 1P73A 3A3PA 4OPMA 5ICSA 2PJUA 1FNNA 2HADA 4WLNA 4AW9A 2ACVA 4UPEA 3HJCA 2RGEA 4I1YA 3VTFA 5EYPA 2JFZA 3HA2A 2CFSA 1M34B 3K6KA 1Q3TA 4J9VA 4JVOA 2IYVA 2OOKA 1II8B 4XGNA 3SK0A 4HNQA 5CJ2A 1NGSA 2ATCA 1EDDA 2KBEA 3KEOA 1RBZA 2C4HA 3B60A 5AVYA 1ZUNB 4D42A 2EXXA 3QJGA 1VKNA 2RHLA 3IR5A 1RCUA 1ISMA 4OHMA 2DHRA 2Z43A 2PUHA 1WABA 3NCTA 4U1RA 3ZY3A 4Q03A 4C03A 1OXMA 2GUGA 4JJ7A 3ZD6A 2RBKA 2BOVA 1E4EB 2Q27A 3LGXA 1N57A 4MVJI 4E14A 3A1VA 5A4JA 4TKZA 2WD8A 2YASA 1OT5A 1ZM7A 2ATEA 3DC2A 3KOWA 2DY1A 4INOA 4UU1A 1Z0UA 3E8MA 5KQRA 1TQ8A 4ZU6X 1R88A 1H0KA 3OWXA 3FYHA 5G1PA 5TF0A 2ORWA 5IBPA 5AVQA 1N5LA 3LJKA 4HQNA 3EQ9A 1MQAA 1HR0B 3CNNA 4UDOA 4Z0TA 1N7HA 2BD0A 3RIXA 4ZEVA 3OD5A 5HDBB 4BC1A 2FPGA 2I2BA 4XUDA 3WJ7A 3SZUA 2WYHA 2YW9A 3BA1A 5EVCA 1ISRA 3NBXX 3BRSA 4UEKA 1DKQA 3FN4A 3ONNA 1KMNA 3DDSA 4ZA2A 5P21A 1UBSB 4HATA 4X3CA 2I1VB 1QR6A 4ZCMA 2YBEA 5AJWA 1Z6AA 2PLRA 2EL7A 5SV2A 5FP0A 2YOFA 1MH1A 2I4TA 1I9GA 1JUDA 1BCSA 2AR9A 3SHWA 1O0CA 3T4XA 2O2GA 2N0SA 4UHEA 1NNLA 2W8BB 3MJFA 2VVTA 2ID7A 2KQUA 1Z2CA 1YQ9A 3A6EA 2HBRA 3JAKA 3L2OB 1KF0A 4ZT3A 2OYRA 2GZRA 1DBPA 5GZ1A 3RJ5A 3DDHA 3FF1A 1N2EA 1TYCA 2OAQ1 3I09A 4OQEA 1EFAA 3COYA 4Z99A 3U31A 3RAEC 5IHPA 3WHKA 4QKQA 3D6NB 1HC7A 3E5HA 3LUFA 2P1RA 4CF5A 4I5FA 4MGHA 1JB9A 4LYHA 4OJNA 3IE0A 5HOQA 4ZJYA 1DKOA 4F9TA 3DTVA 1EVQA 2JS7A 3ZE8A 1YTUA 1E2NA 3TBHA 1MC1A 4PFJA 2JLVA 3I45A 1WU8A 5GZ3A 1ORRA 2E37A 1GU1A 4QE3A 3VI4B 1YZHA 2HLPA 3C8HA 2XIJA 2EFYA 4ONEA 3SJBA 3K3PA 2WWXA 4EWLA 3FHLA 3WLAA 4KP7A 2BZSA 2GBGA 1Z29A 4F45A 3WYEA 1ZGAA 2QJRA 5C46F 1ZM3A 3AFIA 3X3HA 3BXFA 4YAIA 2BGNA 2WJAA 1X0VA 3QEBZ 2OESA 4FYKA 1EYZA 2ZBRA 6CHYA 1RMQA 3HN7A 5BQPA 2BFOA 2MSCB 1N0WA 4HEA1 1E0KA 5LZ2A 2V45A 3P9YA 3V4RA 4D92A 4QQKA 1E3IA 4ESOA 1TKAA 4JC8A 4Q9AA 5D01A 5HZHA 2ZIXA 1N78A 1CC1S 2HQOA 2O57A 1TC2A 3MWLA 4P08A 1QU2A 3GUCA 4UPDA 1E5TA 5E8JA 5KWEA 5B3KA 1RCFA 1FFDA 1JDNA 5EXSA 2G8LA 2QMYA 4TWRA 4Z2YA 3PR1A 4PR3A 4OK6A 1U9IC 4H6PA 4KX5A 2WSIA 2PA3A 4QC2A 4R3UC 3X1JA 3TUIC 3IJEB 4YV7A 2OBLA 2YFYA 1FYVA 4EHFA 4FZVA 2O07A 3SMQA 3G0OA 3SC3A 4IG9A 3U4GA 4RU1A 2QUAA 4I4LA 4OBXA 4TTTS 1EM6A 3EZ6A 3NTQA 4GMGA 3C3JA 4PAGA 5KVCA 4TL6A 1IZZA 1T0PA 5DN9A 3CF2A 4X00A 1QP7A 1R7RA 1UZMA 1WA5A 3K32A 4JLAA 4JHXA 1XD9A 3F5SA 3IUSA 4XSVA 5HK8A 4FCWA 3TRKA 5I8WA 2JLQA 5E3IA 4EVIA 4ACAA 1O8BA 3IDSA 3ZV6A 5LP6B 5LP1A 3EX7C 4OXYA 4XZ3A 4LHVA 1KJNA 2ROQA 4PHHA 2WB2A 2XIQA 1YDGA 1AKUA 2Y0CA 1LDBA 2IY8A 2BJWA 5JE8A 1L4NA 4M0UA 2BTOA 2YWEA 1UKZA 4CIVA 4CMIB 4ZQIA 2JIRA 4IHJB 4F92B 3TZ6A 3OEEA 2CXPA 5AR1A 4HN9A 2GNPA 4KNWA 4FYXA 3DOIA 3OQ6A 1XG5A 2A9RA 2ZZMA 2XZDA 1JXAA 1FXSA 1NBAA 1U11A 2HTEA 1JMYA 1NE7A 1FFHA 2HSZA 1OE0A 1K2VN 4N4AA 4AICA 3CTPA 4HAVA 1JXOA 3HDGA 5K8VA 3PSHA 2ZTUA 3MTJA 1YK1A 1TL7C 4F2DA 1PFKA 2IKSA 5K05A 2W7TA 4QHTA 2VAMA 3D6JA 4K6OA 4V0NA 3BTUA 3VZDA 4M49A 1CRLA 3ZNOA 1S3IA 4Q1CA 4QDUA 3M9WA 6LDHA 5IKPA 5AYVA 5TJHA 3MMXA 1ZZGA 5JOQA 2WVGA 5BR1A 5JRJA 3DHVA 5FR2A 3FOFC 1PR6A 2QLJA 2R7KA 5EKTA 2Q1TA 5HA5A 2N47A 4QM6A 2VJLA 1Y6GA 1I6LA 4HZGA 5CIQA 2AG1A 2N3ZA 4BYGA 2YJGA 1ECJA 3RK1A 1FFXB 3QEOA 3VVLA 2BFCA 4ER3A 3BDVA 4KQGA 4LCJA 4ETIA 3KT6A 2CVFA 4XM2A 4HDSB 4UTRA 3JSXA 2BSAA 3EIFA 1L5YA 3JZIA 2ODTX 3WLPA 2YZMA 3DCYA 3ENQA 5AW1A 5JVDA 3PX2A 1T2AA 4AMGA 2R66A 3TVTA 2O19A 4OV6B 4KNVA 1N6PA 2R5WA 3BJMA 4MV6A 3VR1A 2JNWA 1W88B 2GCOB 3Q2IA 2BISA 1AV6A 1EE2A 3LBIA 3PTLA 4WXMA 2WT8A 1W85B 5JZSA 1RI3A 2OVFA 3OQBA 1TUBB 3HCCA 3NM6B 5IN4A 2UYHA 1ICIA 4JJ6A 4KHPB 4RBNA 4YECA 1I51A 2IJGX 2I99A 3ONWA 2CNDA 1X1DA 2BMWA 5LBTA 5EWJA 1TEZA 3ZGZA 4DQXA 3LTEA 3NHZA 2VYCA 2Y3IA 2YIJA 3BDAA 4KE8A 4XWAA 5FPHA 1ONBA 1D6MA 2WFZA 1GLGA 1THGA 3P26A 1IN6A 1BEUB 3FB1A 2YC2C 3ZBQA 1RC1A 3GIDA 1X9GA 4BJ6A 2JCVA 2EFDB 1RM3A 3CN7A 2IIVA 3F9RA 2FAXA 1GTJ1 2WZCA 3WLMA 2O2XA 4X20B 4BC0A 1LRLA 4TLCA 1P7PA 2UZIR 3WKEA 3ISTA 3IAM1 1IUNA 2WA1A 3LWNA 1YQDA 1JGTA 3ZE9A 3BIJA 3OFJA 2P5TB 4Y1EA 4EI8A 1D0IA 7YASA 1YVRA 3WGMA 5CLHA 3NHPA 3VVBA 1ITZA 4B8ZA 3OOYA 2XNDD 3BD6A 2GHQA 4GLLA 1GQYA 2BIFA 3UHFA 4Z1MA 4CZ2A 3F9IA 3U16A 1T4DA 2VYNA 3BE8A 1KFCB 1Z0JA 2FPGB 3FCAA 1L5ZA 4I8XA 3TSWA 2VTDA 1CNEA 1D6SA 3QI7A 1T26A 1L8OA 2G83A 2Z2IA 3WADA 1WEHA 2E87A 1Y42X 4HS4A 3FYCA 2VJMA 2ZCUA 1DV2A 2NSYA 3O8BA 4CIAA 5IZCC 3JWHA 4GPTA 2LBPA 3UMBA 3L7CA 4RTNA 3R9XB 1GAWA 1VKJA 3ENWA 5KKCA 4AJIA 3SLRA 5FWYA 2YQZA 3CZ9A 4AZ0B 4KZKA 1YCFA 4IGFA 4D0SA 1HMPA 1IVYA 2J7KA 3E15A 1BOOA 2RAVA 3EDMA 3H19A 2M1XA 1FFEA 3U4DA 3ZUGA 4CEIA 3UATA 1PZGA 3H5NA 3UHOA 3PHLA 3TXYA 2YWRA 2GVZC 1M3SA 3MELA 3ZWKA 3SNKA 3CF6R 3LUCA 3LPDA 4LPSA 4OL9A 3GHYA 3HCOA 1UDBA 3GJ8A 2VJPA 4HF7A 4RY2A 3LUKA 4W9RA 5SZKB 5IKXA 2AI1A 2VJDA 3C6MA 1N2XA 2IYAA 5JANA 4NDNE 2WV9A 3VVMA 2FGKA 3DOHA 1XHLA 1XQXA 2QIOA 3R0QA 4LYDA 1NE2A 1S8OA 3R7AA 1WR8A 3DKVA 4K05A 4A6XA 3C1OA 3LUPA 3EG9A 2PKCA 4G5RA 5IABA 3YASA 1QPBA 3DDWA 3ND5A 2SICE 2NBNA 6ADHA 1XELA 2EZUA 2XWSA 1ADJA 3FGPA 1P29A 2WJIA 3A4LA 1SURA 2WKQA 3PR3A 4QM7A 1HKUA 4K6CA 3QU5A 3RC1A 4DSOA 4ZV4A 3G2MA 1E69A 2G36A 2QYHA 3U4HA 4L3VA 4PDXA 3NFYA 2GJ4A 3N8DA 4QDTA 4RIFA 5FBQB 3V4OA 4BKQA 3RFUA 2R84A 1I2AA 3H2GA 4KVFA 4CHGA 2C5BA 4OGFA 2EERA 3MMZA 3ZWDA 4P1ZA 4TWIA 4FFLA 1O95A 2CZQA 1VECA 3LUJA 2AK3A 3ORFA 1ONNA 2NZVG 2A3NA 4L28A 3TZLA 2B8WA 1CYDA 3GZNA 3NEJA 3QPWA 4QUJA 3FUUA 5DISB 1Q0HA 3CUKA 1G19A 2FWBA 3CR7A 5ILGA 5ADUS 5BN3A 3ZK8A 3Q0TA 3OMLA 5B55A 3D3QA 4C07A 2VLIA 1CJBA 2DYKA 3INYA 3J7TA 2NXJA 5CDFA 5F12A 3H1AA 4LPKA 4LZWA 4IM7A 2QJWA 3UGTA 5I9LA 1NW5A 2W93A 4KQWA 4AMVA 2I3BA 1IDOA 4CMEA 3MWDB 3UW3A 3M2PA 3AWIA 4AP9A 1C2YA 1E60A 4AJ9A 4BTVA 1MA3A 4IX9A 4R8MA 3DKKA 5HM6A 1DEAA 3O1IC 2MHCA 1P8AA 4ANFA 4D3SA 1IQUA 1O89A 1LF5A 3QLUA 2JGFA 3VDMA 3LYAA 1X7GA 4GIBA 1MNAA 1P77A 1K27A 1WNFA 3UK7A 4N6OA 2QM0A 3BH6A 4O63O 1EIZA 4U8HA 4R8VA 4DRZA 1CIPA 1GT6A 2NU7A 3HBMA 3NAMA 1FSPA 3VAAA 4ITVA 3T7EA 1HE8B 3E58A 1UK7A 3HU3A 2OLKA 1SCUA 2CYBA 4WKCA 1ETHA 1TA9A 4X1IA 4BN5A 1CJSA 5KS2A 2HFJA 3ROGA 4PZ9A 4QDZA 4GKJB 3T1VA 1L4KA 5CITA 3RBXA 3CUYA 3TCKA 3U9LA 1JG2A 1KGDA 3N9IA 4KGZA 4OJMX 3UMGA 3WQQA 4ETMA 1T35A 4Y18A 6GPBA 2ZRFA 4ZQHA 4GC5A 1V43A 4HGRA 4Y6OA 9LDTA 1O58A 2OHOA 5IBCA 1OXKB 2EP8A 4Y2UA 4DB2A 1Y5RA 4W8HA 3WQHA 3ZKAA 2RGBA 4DC0A 3MGGA 2YV1A 2QXYA 2VBCA 3GH3A 2VUTA 3HXPA 3LNTA 1DTWB 2HU5A 2ZCVA 4I50A 4QTTB 3WL8A 4N7RA 3TFWA 4BEVA 1IRXA 3VA7A 3KPYA 5DM0A 1C44A 1RRKA 1S96A 4QQNA 5AVJA 2XTNA 3HBLA 4X24A 3A4VA 4ZHQA 5C5CA 2P2DA 3SXUA 3ZX5A 4K28A 1SXJD 3VH1A 3SP1A 4BKRA 3QW2A 3OLQA 3GVIA 4W8GA 5B2ZA 3MYRA 4DYHA 3E61A 5LP6C 2WUVA 1ODCA 1C9YA 3PPVA 3K09C 2NPIA 4IG4A 5HKAA 3WHPA 5FLXA 2W37A 3WL6A 2D7DA 2UYYA 1P18A 2AGVA 4BB6A 1ZUNA 3ADCA 1GM5A 3GNLA 2BH2A 1P9LA 3L1UA 1VL5A 1IE3A 1WUYA 2BGIA 2YMMA 1PP4A 4BEWA 4ESVA 4IICA 4BGDA 1XU4A 3CKMA 3E35A 1UFQA 3L0IB 1OH6A 2XGJA 4U2GA 3AETB 1ZK1A 2BR3A 2O48X 2R1TA 2VKTA 2RIPA 3BWCA 3LK6A 3QBDA 4V0QA 2JB9A 1GDTA 2WUEA 3NJ8A 1CF4A 3UJAA 2OAGA 2V0NA 2DWCA 4DV6B 1LNSA 3KQYA 2FSHA 1A96A 1VFNA 3DPIA 4OAPA 5BNTA 4W9MC 1UP4A 3MXOA 4NMLA 5TC4A 3HP1A 1DZIA 1T9HA 2HLNA 2IRWA 2QLLA 4IXNA 4U0KA 4KSCA 5TS3A 3AC0A 4RZUA 3E9CA 2X1HA 3LBFA 4QTUB 4ZZ1A 4JXJA 1EFVB 4MCIA 1U90A 4R16A 4TMYA 4AKHA 3NHMA 1DBQA 1U1FA 4F2HA 1RQLA 2P40A 2R48A 2RHHA 3C6KA 3E3NA 5KSOA 2IXBA 5J63A 3HXTA 4ZXPA 3S0JA 4DLVA 4F9EA 1KHTA 1WFRA 4ARVA 4V0OA 4GW3A 1CZLA 3Q5GA 3DOOA 3R3ZA 1XUOA 2CEKA 1INLA 4HKTA 3TTSA 3FTFA 2RK6A 3MUFA 1GPNA 2Q2VA 3N2YA 4D6XA 1DQSA 4MV0A 1B43A 1XTJA 1M1UA 3GC6A 5J5VA 2BP7A 3VH2A 2Q5CA 2X9VA 2QJTA 3GLHA 4EF5A 1T5HX 4BHTA 2WMDA 1NN3A 1OFTA 2PS9A 5IUJC 1N2BA 1NJ6A 2HHAA 4XFJA 3OT4A 1FQKA 3B48A 2VHUA 2QM8A 1UDRA 3AHEA 3A6FA 5DM1A 5DFAA 5KPDA 1TADA 3CGWA 3S8YA 4ZANA 5FH9A 2GN1A 1FFCA 3OF2A 3Q3HA 2X58A 4KI7A 4MA4A 4R31A 1PDOA 4Y67A 1OKKD 2BM0A 4ARIA 2OUKA 4RTQA 1C4KA 5FYDA 4AQYB 5B4TA 3QEMA 2BGJA 4BE7B 1ZA1A 1V95A 3EB9A 1EG2A 3EXEA 2RGWA 5DNAA 1CKEA 1IHXA 2C4VA 1XU9A 2YHUA 4YJDA 2ILVA 3GYGA 3MTDA 5IRCD 1BKYA 3AFOA 3IEVA 1MABA 3K1AB 1E77A 2VS1A 1A2QA 5C4IA 1ZSVA 2Q1XA 3A6JA 1Y7TA 2JW5A 3MUEA 1ZX1A 2A67A 4KI0A 4NSNA 3U4IA 4TMZA 2IEBA 1YNSA 2ID9A 4FSHA 1QG6A 2DFKB 2YW2A 5DI9A 4MY3A 2BFMA 1DDGA 1PZNA 1II0A 1TGYA 4KXYA 4OHVA 4B4VA 2JJ2D 1B6GA 3SSAA 2G0AA 1Z4NA 2FZWA 3PYMA 3W6PA 1YRYE 2PRJA 3H1EA 2PUDA 3OZSA 4FIZA 1N0HA 4ZVUA 4CF7A 2X41A 2O3RA 3ESDA 3GH1A 4LMPA 1OX6A 1D9XA 4XH9B 3JATB 1XEFA 3U7JA 4YXWD 2HN9A 2I55A 2A3RA 3N75A 1PVDA 2B4YA 4FJ2A 3G5UA 3VRHA 3PX7A 4YAGA 3R0VA 4ZCPA 3T94A 3I2IA 1B73A 2EKPA 3E8XA 4BE9A 5JC1A 1YJCA 2VQFB 2VH1A 2ZKIA 3RUIA 4FFPA 3LLVA 4CKXA 1QRRA 2FETA 2JAQA 4XVUA 1TX4B 3NV9A 5E7MA 3MRVA 3TJZA 1ISSA 1AUPA 2ZGVA 4TKMA 2R6JA 1WMBA 4ARCA 1W85A 4BLRA 2NW6A 4TXLA 3V7FA 4A2QA 5K4HA 1ZMBA 4OG2A 2FV8A 1UXJA 1RXYA 1XX6A 2BE9A 1AG9A 4GOKA 5CEFA 4PC1A 1AQIA 2I4OA 1WMDA 4NRDA 5F52A 4ERXA 1U7UA 2VUIB 3EUWA 5E1MA 1QXSA 5TPWA 3FDXA 3H2HA 4UZSA 4J3FA 3RT9A 3ZZTA 2ZTLA 1PIWA 3EUFA 3ML1A 4AJEA 3JQAD 4F9FA 1XWIA 2BBSA 4DQLA 4FGKA 1TPZA 3PF9A 4BB9A 4J75A 1Z88A 1JLLB 1VKOA 1AK2A 2JIDA 3UJCA 5KNDH 1PZMA 2CXXA 2Y05A 3L7DA 5D2CA 3GEHA 2P78A 5AP9A 5LMZA 3BFXA 4HDOB 2FRXA 1Q6ZA 2FWJA 4F4DA 4LF9B 1PT6A 1OYWA 2PMWB 2QVZX 5KOJB 5FL7D 3PHHA 4K6HA 2JCGA 5DYYA 4DCJA 5HJ2A 4TLLB 3HH8A 2CMGA 1X87A 2M98A 2FZGA 2Q5JA 2ZIVB 3K09A 4M53A 4CEHA 4C0JA 3MFYA 1E92A 4YA6A 1PZ4A 3V4SA 5C32A 4DCPA 4BNUA 3MRSA 1G6KA 1PHPA 2C95A 2PH3A 2RHGB 4CM1A 1BX3A 5IAGA 2IHKA 2RHJA 5H9WA 2H0RA 4TS1A 4LGYA 4YRFA 2BPOA 3C4QA 3THXB 4RSHA 1XXHB 2ETVA 1IUOA 1V1MA 1NW6A 2P9FA 2AR0A 4M89A 4QU8A 2B5OA 3ELYA 2WAOA 2AQKA 1WMSA 3FVWA 3UWOA 2XRZA 5GQSA 1WJGA 3ZE6A 1M10A 2CL0X 1BS9A 3WWOA 1DAMA 4FOSA 3CEJA 1ONSA 4Z9YA 3WYGA 1FRVA 2B1RA 3MCZA 4QT4A 3KD2A 3A2KA 4IZIA 2WJWA 1E2MA 4HXYA 1HYHA 3FH0A 4EG5A 4WXEA 3OCVA 4GUDA 4XX0A 5JXGA 1K9VF 3Q12A 3UXHA 4W5OA 1TUIA 4II7A 1AKNA 4U0JA 3LYUA 3QX7A 6AT1A 5KJ1A 3GAAA 4KE6A 5EWMB 5AVSA 1DQPA 1XLTA 5KOYA 2OP0A 3PGLA 1VP3A 4E5MA 4NKRA 3VR6H 1C1XB 3JD4A 3VPGA 4ZZIA 2Q6LA 3II6X 1Q1QA 5FX2A 2A9OA 3SS9X 3CEHA 1DTWA 3LD9A 1U0FA 3OT5A 4PLWA 3COJA 4Z9FA 1W4CA 2IPNA 2V98A 3L1HA 5CB0A 4CN8A 3L0CA 5DW3A 4FSDA 2VUHB 3EVNA 3GT7A 4G4GA 4MUJA 3P9PA 2H1HA 3E05A 1M6WA 2CLLB 3N74A 5EE3A 3BZBA 3O8QA 4B6QA 5JSQA 5F23A 3UHAA 2BDUA 2Y0DA 3TQHA 1L7PA 4Q16A 2VFAA 3DMHA 1GL3A 3KZNA 1IN1A 1F6DA 1HG0A 2PWPA 2II6A 1H2EA 3ZPXA 1FP6A 1JJVA 2ZTMA 1EWVA 4BP3A 2P90A 5EJ5A 4X71A 3NX4A 3VC1A 4QBFA 5K8JB 1IONA 4UOZA 2RKWA 3KEQA 3O7MA 1GQRA 4M1QA 4FFSA 4OMDA 4UEJA 3WC4A 1QH8B 5FUQA 2QXTA 3KAPA 2GZSA 4U63A 1BJTA 5ICFA 2EKDA 1KKUA 3PA8A 2HXSA 3L8YA 1AH2A 1Z25A 4EX7A 4XTRA 1JAYA 2QORA 2CFRA 1W5TA 1REQA 5E4YA 3O84A 4ZYVA 1ESMA 2XTZA 4NBLA 4XEUA 1FFGA 3EGIA 1H2FA 2ST1A 4CBVA 2IYZA 2WYVA 1R27A 5DHPA 1RRFA 1FLNA 2BEJA 4U7HA 1USWA 5KREA 4F9GA 1FCJA 1V2GA 2O2SA 2PUWA 4EOGA 4RHFA 4EL0A 1CWUA 3FTPA 1NT4A 1WU7A 2EZ4A 1BD4A 2I54A 5DOZA 5GOTA 5KMGB 4L8VA 1YIDA 2C9CA 5FORA 2A1TR 4U2KA 4PHGA 2JHAA 4D9KA 2XGOA 3EOAI 1WQ4A 5B12A 2W6ZA 4KO8A 4XPZA 5C51B 1XPJA 1XEXA 1N2JA 2QMHA 1XCMA 2NP6A 3T9CA 5E8RA 3TRHA 2XB8A 1SCUB 5BP7A 1MIOB 3A9VA 1HL7A 1RHUA 4U9UA 4OHUA 1UZNA 3ZDBA 1A72A 3X1MA 3DBHB 1PFQA 4Z0PA 4ID9A 1N2CB 1AGPA 1UWKA 4XPIB 4C7XA 4G0VA 1HV8A 2O8DB 3JQ7B 5ITWA 1VE7A 3AP1A 1QP4A 2A9KA 1X80B 1X39A 2PVCA 2FN7A 1JYFA 3OLWA 1V4VA 1J0EA 4D56A 4RIGA 1MVLA 1K3FA 2H59A 2GYWA 1VRWA 5BQXA 1E1CB 4CM3A 3F46A 2W0SA 3DDZX 1KFEB 1TAQA 3DT8A 2C9YA 1MB2A 4FFBA 2R68A 4HN4B 2O8FB 1GKKA 3Q2OA 4UTZA 5T7BA 1OYOA 2BEWB 1Y9JA 2FZEA 2VPXA 1J5PA 1NDUA 2C5HA 2JA2A 1RZRD 4Y2SA 1T2CA 3MFQA 3VR5A 6REQA 1VTKA 3GXOA 4FN4A 4RHYA 4OM7A 3T52A 5LOVF 1OBVA 3BGOS 2PX4A 3BORA 4WY5A 4GGPA 2WJYA 5LQAA 2DJ5A 2J9GA 3W5BA 5C1OA 2B37A 4FHEA 4J29A 4YAWA 4M0PA 1JEQA 3S2UA 4JBXA 4D3YA 2ZSEA 4HDNB 5FTLA 1H4VB 1E9SA 1HH4A 1MV8A 2RGUA 3BILA 4AS3A 1Y8QA 4JT4A 2Y6UA 3GXBA 3M5WA 5KJCA 2ZAIA 3NORA 4JL5A 4H27A 1TA0A 1WIWA 3KRTA 2FR0A 3L06A 4QXMA 1G3MA 2VJAA 5C3MA 3D2BA 4B3SB 7MDHA 5LFAA 5AHXA 2JH8A 2NZYA 2B78A 3WWCA 3G0BA 2IXEA 1L4MA 3KPWA 3OFND 1C9NA 2D2IA 1DHRA 3FWPA 2PKRA 3OZVA 4IINA 2VQSA 4B3HA 3RS4A 1IBSA 3GT4A 3MNFA 1TO6A 3EYAA 3GA7A 3QVKA 3BKSA 1VBNA 2FEMA 2IIQA 4BB5A 1MZVA 1SCJA 2XUFA 1P9WA 5TMPA 4LDJA 1QGAA 1RI5A 1FLVA 3I6MA 1T2EA 2ZCJA 2HWKA 2QVCA 1V1JA 1YVEI 4RJKA 2E55A 4KIWA 1FXUA 3AVWA 4N5DA 3WK7A 1I2DA 1EXWA 3AINA 3DYVA 3NGLA 1WB9A 4D46A 5H9VA 3V1MA 5IH7A 1PJ3A 1K97A 1ICEA 1GTMA 4LXXA 4PZDA 1NF8A 4PE5B 4WUVA 4D99A 1USIA 2BMVA 5TPWB 1PGJA 1Y7PA 4J91A 5BSRA 3KSMA 1OJ7A 1I2ZA 2QTWB 3TNFA 3IMFA 1PQYA 1VGVA 4Q3DA 3IELA 4BNXA 3N7TA 1R16A 1XEWY 4GXNA 4IWNA 2B98A 4X93A 4BO3A 4AX8A 2RHWA 1YS1X 1ANKA 1HUQA 1M6NA 3JX9A 3NT2A 1TJYA 2BM1A 3L0DA 1PEAA 4L8WB 2HSEA 1PBNA 3JR7A 3QUBA 4FPXA 1O8CA 5T6MA 1TTPB 2G8NA 2R8EA 4TLDA 3PGJA 1D2EA 4BZQA 5THQA 4G5HA 4ENWA 3R24A 4W1SA 2Y1EA 3KVOA 3GUUA 4GDFA 2PGAA 5LUBA 3GLFB 5BV2P 1EFRD 3L1JA 2CHFA 1YUNA 2QEQA 4J9UE 3OUZA 3F1KA 2E1RA 3KV1A 4JJFA 4LX8A 4KPFC 5T6BA 4DLBA 3U09A 4G0NA 1I7QB 4YR7A 2ERCA 4QUKA 5E6UB 1QFMA 3BB3A 3BSYA 1GRRA 2J59A 2QUHA 4LHXA 4QD3A 2WTUA 1R0WA 3AUFA 4ADSG 2NXEA 5KWSA 3AF0A 1XRMA 2ECQA 1NVXQ 4I4TF 3TR0A 1U7PA 3FJ1A 1A9SA 1NVKA 6Q21A 1Z0AA 4BCCA 4EG8A 4BLVA 1WNTA 1J42A 1CUXA 4DV7B 1BE8A 4RV5A 2BF4A 5LNK6 1SXPA 1G41A 2Z8XA 1E8MA 2ZR0A 3UYKA 1TJ4A 3LUHA 5K3BA 1V8ZA 5DTIA 4FB5A 5B30A 3Q0IA 4H1TA 1P2UA 2COEA 2XUPA 1R1DA 3LO8A 3O91A 5D3MB 1LBHA 1NVVQ 1NL3A 2V6BA 3QEMB 3T4EA 1XTTA 1KQPA 2YV5A 3L92A 1EP2B 3OF3A 4UW9A 1MBZA 1F2VA 4ATNA 3H1TA 2XA9A 2VO1A 4A1FA 1K8QA 2CLSA 2XDQB 5AVRA 5J43A 1RWPA 5D84A 4FB4A 2WOOA 3E9RA 1XRJA 2ZIFA 5MHTA 4LI3X 1KNXA 2OG2A 2QZZA 4CIDA 5CDTA 2O8NA 3LGAA 2A86A 4UBJA 2ID8A 3OQVA 5JBIA 3PNVA 2RHCA 4EKEA 5JARA 4I9NA 4P93A 3W2GA 2R6FA 2A92A 2D7CA 2WM3A 3GGCA 4NNJA 1Z6ZA 2OCKA 3WHIA 3U7EB 4ZJUA 4LTDA 3B6EA 3Q7RA 4G85A 1NR1A 3DAFA 3CY6A 2AFHA 4X6UA 3WZMA 2D00A 4MNTA 1A8UA 3PUKA 3R5TA 3OJ0A 4PGHA 2DERA 1E6WA 1JVSA 3UMSA 4QTYA 2XBLA 2I3GA 4HYEA 3MT0A 1GZVA 5JS7A 1I5RA 1KQOA 2Z9DA 4A26A 4UHFA 3LY8A 1PQPA 1S2IA 1YKFA 2R1VA 4KMOA 1RD4A 5KNLA 2ZB3A 4U2BA 2P9CA 5EUQB 2VNAA 4B2IA 1YR9A 1GZHB 1XQVA 3OIYA 5BWBA 1NFQA 3DBRB 4ER5A 2HR1A 1FE8A 1WUJS 1RJ9A 3AKEA 1MXFA 4GOMD 5TJ9A 4KQFA 4RTJA 1SZJG 1QYXA 3C3WA 1VXOA 3RVJA 1CXZA 3DJYA 5CIYA 2PUEA 3G5MA 3GZTB 4FDLA 2C4NA 2ADMA 2ZLBA 4ZARA 3UWSA 2VNSA 3FKSA 4EA8A 1H5QA 1Z16A 2COKA 2VH2A 3N7UA 3S7TA 4F60A 1KRXA 2NTJA 1MAWA 1HI9A 1H0RA 3R23A 1C3VA 2Q3LA 4ND6A 4NE9A 1NNUA 4P5DA 4R40A 3KQHA 4R54A 3T8YA 1L7EA 3UGJA 3K72B 4ESHA 1MV5A 1JFLA 2EZTA 2HMUA 2W2KB 2OGWA 3B9RA 3MA0A 1WCV1 2NO5A 2H0AA 4AUEA 3D2AA 4QATA 1Z9BA 3C8ZA 4WEOA 3NOVA 4K86A 5K2MA 5L3QA 1N8TA 5F64A 2FEPA 4IIEA 4P92A 1G5RA 2IZOA 2HJGA 2PQ2A 2PUVA 3PRHA 4M9ZA 4O6VA 1NQUA 3DFFA 3KB8A 4R9VA 2C82A 5I6DA 1GLNA 2Y1OA 5IMSA 4Q48A 4WKNA 1F14A 1NX6A 1O5OA 1E5XA 3OQPA 3QVGA 4FBLA 3PNMA 5DYGA 5G0TA 3TZQA 1E3WB 4NYMR 4ALJA 1X1BA 2ZW9A 3GIWA 4I1OA 4JB3A 4XOIA 2PT6A 3JQ8B 1IJEA 3D3WB 5DHFA 1GRCA 1DPGA 1J39A 1JR4A 3WMWA 2FDRA 1KO4A 4PAOA 1E9EA 4ACBA 5BQFA 3DZCA 1OY1A 1IHDA 1KJWA 3DTVB 3PXAA 2BFPA 4HEQA 5A4AA 1NLYA 5K51A 1KBZA 4KVGA 3PUXA 3UUWA 3RS7A 3P9IA 2FWAA 5CLGA 5KWIA 1AJEA 2I6UA 1DI0A 2B3DA 3NH6A 3DC7A 1XNRB 1YVPA 3PLAE 5AI6A 1B8OA 4L0QA 4A3SA 5DN6D 5JDCA 5ED4A 2HGSA 4NURA 2QN3A 1VBMA 3QP9A 4PYRA 2BMEA 1MIOA 1WLYA 1RAFA 3GJQA 2H2DA 1C9EA 2CVPA 4FT4A 1EJBA 3JYLA 2VP9A 3HKEA 4ZK6A 1MAHA 1V35A 1YMUA 2AEFA 2GN2A 2O4CA 3LSYA 3RNLA 5I7FA 2BFFA 1JEDA 5TV2A 4G25A 4KH1A 3K0CC 4OQYA 3CEAA 4JYAB 2QMUA 1YUBA 1PR0A 1UPTA 4C7OA 1KMCA 3IKMB 2X8LA 2V5AA 3OZCA 4AXXA 4RS4A 3W4JA 3AESA 3TLEA 3UV3A 4BX9A 3I12A 3RTBA 2EIHA 4ILEA 2K2QB 4M1EA 4Q34A 1IQPA 5EWMA 2DLCX 3HZOA 1PFUA 3HGMA 1UPFA 3C3EA 2X7HA 5B1DA 2VZ0A 2WKRA 1NJ1A 1EDOA 1RKQA 3DWGA 3JASA 3LQRA 3SR0A 1M2VB 1X8XA 4A5OA 3RO7A 2Q46A 1TAGA 2HRQA 3E9EA 5JT1A 4WBNB 2Y77A 2R79A 4U2CA 3NEYA 1P7CA 2H1OA 1OLSB 1RWVA 1ZW1A 1Q44A 1VIDA 1UL1X 3HDTA 4FKBA 2W6ID 1ZH8A 1ZH6A 2Z4TA 4TTSA 3FNIA 3DTVD 1ADYA 2CXNA 2R47A 3KB1A 3TEJA 1OX5A 3EWSA 3IKVA 4UBLA 1KU0A 2YFKA 1C3JA 1JDZA 5L9AA 1LQTA 3SDSA 3C3AA 1AKEA 5EJ8A 3A4MA 5HKKA 4LTNA 1MTOA 1EFDN 2CNOA 4EGFA 3UBTA 1JSRA 1P4GA 2HJRA 3OLZA 4OQZA 2FVYA 4OP1A 3C5HA 4FGJA 1ISJA 2ZK7A 4BP1A 1H2AS 2ZBEA 3JXEA 4PZAA 1ISHA 1AGXA 1OR8A 4OHFA 4NCJA 3A1WA 2WNIA 2ZRNA 1DPFA 3IUEA 4EB3A 1KI6B 1ZUHA 2NZ2A 1I94B 1RPAA 1TCVA 1G5QA 2KX7A 2V7QA 3Q5EA 4I4TA 4R05A 5DBGA 1RJ9B 4G4SP 1CDEA 3I1FA 1SNYA 1A04A 3PBKA 2B6NA 1WCIB 5AJUA 1QV9A 2VSNA 3EFOB 1RYFA 1CE8A 1F0PA 2J5XA 3RUAA 5DGTA 3W9SA 4BBAA 5JFTA 1AXRA 1PE0A 2ZBVA 3H5RA 3Q7QA 3OOHA 4NS1A 4JKOA 4N47A 1CRQA 2HNBA 3CZAA 3H87A 1F1JA 4KDFA 2DH5A 2AYXA 3FZYA 1OQAA 3V2HA 2PZBA 2AKAB 2PS0A 4E2ZA 1M5UA 4KSYA 3ZE0B 1T8WA 3K70C 4NMMA 2QRVA 3DFKA 2FLKA 3U2QA 5ADHA 5FJIA 4QBKA 4YAFA 5HIJA 3JVIA 4EKIA 1J00A 4Q3KA 1AZSC 1TE2A 2ZYTX 4JP3A 2NYAA 4JYBA 2HA0A 1EB9A 2REBA 1F6WA 4NZNA 4RORA 3ZOKA 1VJRA 3I34X 1TJ5A 2ZIAA 4HWGA 5CH5A 3TGLA 4JLWA 5CDYA 1K75A 4LK2A 1JG3A 3PFFA 5KYGA 1C8KA 4DMMA 5JBNA 3U4QA 1N6IA 4DMUB 1J70A 2GBIA 3CLTC 5BV1A 4QAQA 3K05A 1QG2A 2WICA 3WKAA 1CLEA 1OFVA 2FZLA 3R41A 3TNLA 1U7XA 5IDVA 1EGMB 4HLNA 3IL2A 3UOWA 3RABA 3HMKA 2VWQA 2XMSA 3OKCA 4US1R 1H8EA 4B8WA 4G4IA 5GTDA 3P1JA 1FTGA 4U02A 3WLJA 1IOWA 1TMGE 3H5LA 3DT6A 3HRIA 2M6LA 2DWOA 5E3HA 4R7ZA 3ETJA 3IV6A 3RVBA 3WKDA 5FBZA 2FOXA 2TSYB 1ZY2A 3RTGA 4OMFG 2YJZA 4HUQA 4BAGA 4GMHA 2GAOA 5EP3A 1EJ6A 3FI9A 3EG5A 2QROA 4N49A 4EMTA 3OZBA 2ORVA 2F3SA 2NX2A 1GG8A 1VSBA 3P32A 2H1CA 4ZO9A 5DGXA 4LBVA 2IEIA 4KIJA 2C61A 4LNAA 2X13A 1GOTA 2EBWA 2L19A 4XD7A 4EYGA 3DZDA 2RONA 4S0ZA 4NZYA 2FMFA 4R9NA 1R8SA 4ZQGA 4JFRA 3RANA 4DIUA 1I3OA 4PEVA 2NV2B 2AJLI 3LKDA 1MVOA 4A0GA 4JQCA 3WNDA 1WPQA 3M4JA 3O3OB 4FP9A 4IIJA 4J4HA 5B3LA 5FNVA 4EY4A 2O8BB 2GNAA 2QD2A 2VDJA 1X42A 1OUMA 3CKKA 2H63A 4MUMA 3UFXA 4B82A 1SRRA 5LKRA 1XRSB 2JIBA 4W5RA 1DIHA 2OQVA 4R9UC 4D0NA 5BSFA 2A84A 2ET6A 1K08A 2I78A 1DRVA 5LQDA 2RKOA 4OD0A 1NOKA 2NXWA 1R50A 3OVMA 2CMDA 2E3JA 2RG7A 4Q7KA 4ZVOA 1JT9A 4NEQA 2XXJA 4IJWA 5I7HA 4EBFA 4EY5A 3S8EA 3QXSA 2MYUA 2VRWA 2VZEA 3ZS9A 4PCUA 5I8PA 4QOEA 2O52A 2ZAOA 4OY3A 4C3VA 3L4BC 3LV8A 3ZGVA 3PE4A 4C9BA 4ERNA 4GU5A 3W77A 1U7TA 4KR9A 4RK5A 3UAOA 3VHLB 1ZD5A 3D5TA 3U4CA 4CMGA 4DCVA 1EE1A 1B7GO 1FRFS 1XNGA 2GDJA 4YO7A 3X43A 3G6KA 1R0CA 2ZWMA 1UBEA 4HJXA 5CJJA 1Y3DE 1OXTA 1YZ3A 4PTZA 4XASA 1KDZA 3GP5A 3CE6A 2OGTA 4OYHA 4MWBA 1H4TA 5DNWA 5IEJA 1JHRA 3E3LA 3H05A 3OPNA 5AW0A 4HNTA 4M7RA 3IUNA 4CWAA 1R15A 1QHSA 2PCJA 2VHCA 3RRYA 1ESDA 4RDCA 4CMKA 4ZVKA 2JVKA 2WUFA 5JJLA 2BEUB 1C7EA 2JHFA 2X0IA 1JEQB 4R8RA 3W7VA 5MN4A 4DLLA 3CVXA 5CYOA 3SBXA 4NJOA 1A7JA 2ZI5A 2ZJ2A 3BWVA 4H17A 1P9NA 3MRTA 4JU8A 5CT8A 5EIOA 1Y8QB 2AI2A 2Y1XA 4KWEA 1JYSA 3ZYCA 5KNDA 4RTPA 3HSKA 4GWKA 1WTCA 3OHMA 2OHJA 2WG2A 1YKSA 4MQ6A 4AN1A 4E2XA 5IM4F 4X9XA 1H3FA 5A4IS 4FEAA 1PF7E 2VN8A 2E21A 1O08A 3B70A 8ADHA 3NRBA 4URFA 1SU8A 4WK4B 5T57A 3BF8A 1TVMA 1SQGA 3OQIA 2IYSA 2ZSBA 4MQUA 3HFJA 4R7GA 4EVRA 1HDOA 2IGBA 3M81A 3M7IA 3REFA 4IMRA 2W6JA 2P9EA 2LE0A 4HDRA 1JHVA 2V03A 3K1TA 3T06B 3TTUA 3FPHA 1RLUA 2OFPA 4Q02A 3L01A 2DETA 3UNXA 4OHXA 1DUSA 1Y37A 3M6AA 4PAQA 1J9GA 1GGKA 3K73O 3QE0A 3BMQB 4MV5A 2Q0HA 4R0VA 1LK7A 1MD9A 1QF9A 3IDFA 3SE0A 4AF7A 4YRZA 3TECE 1WF6A 3QE9Y 3IQXA 3PNSA 3RYIB 4P4GA 4V1CB 5BYJA 3BYZA 2F3UA 3K2EA 3W5DA 1XTBA 2XE8A 1OFIA 3F5QA 4EKGA 2C2WA 4KDCA 1JILA 1C8BA 1GPYA 2O59A 4OHYA 221PA 1MGPA 3GPDG 2ETXA 1XRRA 2ZBFA 3LPAA 1I5EA 4Q1EA 2PS1A 4FI3C 4B7XA 4ZOLF 4EGSA 3GEBA 5HTKA 3LT0A 3JR3A 4NMXB 1K7CA 4FEGA 3OLCX 5AI9A 1JL3A 2L42A 4GR5A 1WRBA 5AJXA 2PUBA 1G9TA 2OTCA 1I1QB 4IV5A 4G1UC 5EEHA 2J6CA 4AJ2A 3NBKA 4Z8XA 3OEHD 4V3BA 3ZD7A 1P0FA 2W4QA 3OEYA 4IFBA 3ZLVA 2IXFA 4YMVA 3K4PA 1LBQA 2AV6A 2JARA 2NSHA 4J1TC 3ZGYA 4ZMSA 4DM4A 2LTAA 2CCGA 2YDYA 4I50B 5FAXA 1Y4ZA 4JNCA 1AN9A 3L46A 3DB1A 2O8BA 5ALUA 3W6OA 1G8PA 1I0LA 1K5DA 1LDNA 1SQFA 2CK3A 2QLTA 4DIMA 3OEED 1FW6A 3ER9A 2RKBA 4WWHA 2C9OA 1K5PA 2I29A 1Q92A 5ALDA 2O2JA 2WM9B 4KWHA 1JJAA 3N0TA 3IR6A 3MJDA 3I8OA 3OOWA 1N1MA 1RJWA 1DMRA 2V65A 3L07A 1BWPA 3SBEA 2LDXA 5GPBA 3ZIDA 3VR5H 3ZK7A 4NJEB 1YCDA 4BWGA 4WBSA 4ZO4A 1WUIS 4MR8B 4ON9A 1BE1A 3SQMA 1SOVA 2YDXA 1RE1A 5FO0A 1NY6A 4MS3A 5A3VA 1ULSA 3EVCA 4LCBA 1XLWA 4PZPA 2ZEJA 2W2LA 4IY1A 5IF9A 2UZ4A 1I8TA 4DQKA 4ZAZA 5K3DA 1Y80A 1Z8HA 1A9XA 3I4FA 2JH3A 4MCJA 5F2NA 2J5KA 2PH7A 3H6HA 1XVAA 3ANXA 2MSWA 3GUVA 1P17A 4NESA 1NNI1 1YFLA 2GZDA 2XUAA 2FUKA 1F2UA 1ZC4A 3BKXA 3HWWA 1G21E 1VIAA 4JB2A 3L4BA 4M46A 1RKUA 2WDPA 1QMGA 3AERB 3WK6A 2AN4A 3KPUA 2GGSA 2V8OA 2F8LA 3MQ2A 4D45A 3ZW8A 1Z0IA 3ZE2B 1IB0A 3C39A 4X7MA 1KBOA 2P77A 4OAQA 4C14A 3SPXA 3DZIA 3AKDA 4HT3B 1JB1A 4GL2A 2D0OB 3DMYA 3MUNA 5A06A 2NOAA 5DHTA 3TAHA 2B1GA 3ZIAD 4CG3A 3AVVA 2ZJ6A 4OJQA 2P3QA 2ONZA 3DVLA 3GRUA 5L3SA 4WK2B 1G55A 5MF6A 3A3KA 2YL2A 3MPUA 5ADVA 2A5JA 3O74A 1UMBA 2W58A 1UK8A 2H9YA 5J2UB 1EP9A 4FVTA 3UKOA 3HV0A 4L0DA 3AJAA 3TJMA 5HCUA 1NF2A 3BF7A 4JUIA 4X60A 3LWBA 4FLMA 2DT8A 1IEVA 2ECFA 3I04M 3UXMA 1KEPA 2YYSA 1ZDMA 1RQGA 4IIBA 4EA7A 4H60A 1JG6A 4WZBB 4PLZA 1X9IA 5ALFA 4OXKA 5D3QA 4EYOA 1U2TA 3ZGLA 1THTA 2FP4A 5JHHB 1ACMA 5A6SB 1EWYA 2FPXA 3UN1A 5JALA 1CVRA 2W2MA 2AQHA 2VDLB 3EG9B 4DFDA 3QOYA 3SY8A 1BH6A 1EFVA 1UMKA 4KCGA 4OGKA 4BRUA 3EZ7A 1XZBA 3GT3A 4MKRA 2GPAA 5HE9A 4C0LA 5K0SA 1GG9A 2PBLA 3FLAA 2OZLB 3N28A 5C5IA 4UAVA 3IUQA 1JZSA 1X77A 4NBUA 2WKWA 1R5JA 4N7MA 3SZLA 3THYB 5IXYA 3KTAB 1QF6A 5H3CA 1X1RA 5HZGA 3KELA 4MVJH 3TR6A 2H8GA 4KWTA 3ICWA 4ND8B 5TF4A 3KUKA 2NNWB 2IELA 1MKYA 1OLUB 1T13A 3JQAA 1VGRA 2XJ4A 2R8BA 2BKUA 4OTZA 3F78A 1LEHA 4IXWA 4V38A 2NTYC 4L78A 3B8EA 3HI4A 4F6RB 3RSGA 4JDUA 4MVXA 1E0AA 4P9NA 2G5GX 4Z4GA 2PBZA 1XMPA 4CIXA 2EGHA 2Q3HA 1ENZA 1W8DA 5PNTA 4AS2A 1C4XA 2RBEA 1NR7A 3F4KA 2CBZA 1B26A 2D5AA 2HC9A 4CEJA 4RAOA 2EEPA 4J7AA 2CSUA 4AMBA 1ZM4A 2ZSHA 1GPDG 3AKCA 4L7QA 2B7CA 3HU2A 4QHYA 5DGDA 3N2GB 2XDWA 4CM7A 2SECE 1MX1A 2O3UA 3I2FA 1R6AA 2DBZA 2ZJAA 3K2IA 3PSAA 2CJPA 3PDWA 4P0PB 4FZRA 1Q7TA 3HB1A 5IJ9A 4UDNA 3GVXA 3KQSA 1BGVA 1IM8A 2XQIA 4XIJA 3D2LA 1B1AA 3J81k 4I99A 4ZREA 1TCBA 1ZK0A 4D4JA 3KDAA 4RCYA 2WYWA 1MG0A 1IZ9A 3VU9A 5IF3A 3HB0A 1QK4A 1NRIA 1RWNA 3NXSA 2RH8A 4MQBA 4RZQA 3VNRA 5KYTA 3S2EA 2AWNA 2E18A 2A33A 2OPHA 1T1IA 2V0CA 3IVCA 5LJIA 2IEDA 1MPTA 2P5UA 3K5WA 1Z0SA 2D1YA 3MGBA 5DHQA 3WNQA 4BLWA 4M2LA 4S12A 5CJPA 1EVLA 1PFWA 2J3LA 2QWXA 4HXFB 4EJMA 4HO1X 5FA5A 2HU7A 4RHTA 3N6XA 4Z7OB 5KX5A 3D3KA 5JBQA 4WY8A 1DUVG 2F43A 3JYQA 2CVHA 4HH1A 1SVNA 3L6RA 5ES4B 3IC5A 1RWQA 1YHNA 2AC4A 2AOTB 3AY3A 4UREA 3RKRA 4E13A 3IA7A 3EVZA 2V9ZA 1DADA 4PLYA 1P3Y1 4HDMB 2VSXA 2BGWA 3ZLJA 1E79A 1SB9A 4F85A 2NAPA 2P79A 4PQYA 3F3MA 1CF2O 1KXZA 3V9AA 1OZHA 2B4RO 2HLHA 1PG2A 4KQCA 1VRCA 4MRAA 2GZAA 2XW6A 3M89A 2VRCD 3IDQA 3R2JA 4UJ3A 3HB4X 4O2AF 5EMJA 3UK1A 1H69A 1V2HE 3RYCA 4XSGA 4R2WA 1XU7A 1G5PA 1Z2DA 2QP4A 5G4LA 3W3AD 3IT0A 1YI1A 2ZE8A 1ISPA 1FYXA 3F49S 4IIJF 4P86A 5BSVA 2O1SA 4MTLA 5DMHA 4L95C 3DKRA 3IP5A 5ALRA 1PYGA 1CZRA 2G9VA 2J08A 5A9SA 1XVIA 3H5AA 2I2CA 2UUCB 2ZDHA 4JLKA 3JRXA 3VO1A 1V11A 4BFCA 2J3EA 4M1WA 1H93A 1KI6A 1L7OA 1Z73A 2I7XA 4YMIA 3RVKA 1KI8A 3ECCA 3CWQA 3DV9A 4HWTA 3VO9A 4AUMA 1RJDA 2A88A 4AIIA 2PS3A 1OLOA 1D2CA 4QOJA 4RNCA 2JFUA 4EHIA 5JMWA 5CNIA 3TSCA 2FEOA 3S2YA 2YX1A 1YC2A 1JXQA 1JXMA 1PEYA 1J2TA 2RGDA 1V9SA 4R2KA 4WCDA 5A0VA 1YOBA 2GXUA 3PIRA 5KOJA 1GPUA 2Q3CA 2X77A 3RKUA 4BJ3A 1AQYA 2QTGA 1XAJA 3N05A 4QQRA 3PEYA 4PZLA 4J1SA 1FOEB 3ABSB 1MX9A 1Z4MA 4RV9A 5EJAA 1G8MA 5THXA 3REQA 5LNK1 5EINA 7REQB 3NM5A 3ZG6A 2A8YA 2EAUA 3FCEA 2GPBA 1C2TA 4B3IA 1G5TA 1XCGB 2MTBA 2ZR9A 3EXIA 1JPVA 1N8SA 1S02A 1AA6A 1XEXB 2GEBA 5FTKA 2W22A 5I9IA 4HWPA 1BHQ1 3MIIA 3OEWA 5ETJA 4EJ0A 3IHLA 4YRDA 2XCOA 4NG4A 3HGQA 4CQMA 1A4XA 4N65A 3W9UA 2NU8A 4WN3A 2NVUB 2A0FA 5FPQA 2HNKA 4N6GA 3MYYA 4MAAA 3RVOA 3HFSA 4B6FA 2XCTB 1CP2A 2O2CA 3TX6A 4AP6A 5MGNA 2XT6A 1A97A 4I36A 3KJXA 3NT5A 4YACA 1ZD3A 1DJOA 3ZHXA 1PD1A 2HWWA 4DV2B 1XCOA 2B4TO 2Q2QA 5HPYB 5BSTA 1N5MA 3WKCA 3QVSA 5JEEA 3OPMA 4DHEA 4BIIA 2TYSB 1V8FA 2VC2B 4OIFA 1G8AA 2I1LA 2OBBA 2AZXA 2Z3ZA 1Z47A 2IYLD 5KJ6A 1UKCA 3FMVA 5L95A 1E61A 2FW6A 4MDEA 5C52B 2RCYA 1YDMA 1E4OA 1MDFA 2BMAA 1N7GA 3H2ZA 3IJ5A 1B93A 1IVSA 2E1PA 4EJ6A 2P3LA 1UFRA 3ZWBA 1NRWA 2IODA 2CLHB 1XN4A 1FTYA 4R1TA 3F8TA 2FSVC 4V1CA 1C4WA 2DFTA 1A9OA 4ND8A 5LZ8A 3O1JC 5FEMA 1JQEA 4B9EA 2FPPB 4EHJA 4B74A 1JQBA 1NBOA 1OWOA 2ESRA 3ZCVA 1YQXA 5K7SA 1DEKA 4L9WA 1BDJA 1ODKA 1OOEA 2Q5OA 3DQQA 5ENVA 4D4LA 4BMZA 4C4SA 5KI6A 5FI1B 1VJCA 5H8WA 3MCUA 2DHCA 3DOUA 1Z35A 4PXAA 2VJKA 4EGAA 3CRVA 4G26A 3DB2A 4OI2A 4QU5A 3AO0B 3E2IA 5JH7F 2AUTA 1BKSB 1EJ2A 1DLIA 2FR8C 3EF0A 4KU4A 3T0IA 4HTFB 1C80A 1C9KA 1ZNYA 3D8TA 4GD3Q 4O5AA 1HA3A 4A6DA 3GAFA 5A6SA 1PNTA 1R6VA 1UJ2A 2JGIA 1AUQA 5HMMA 2HK7A 4DMCA 3G3EA 3A2LA 1SCDA 4WXYB 1VA4A 1VLMA 4RPCA 5CM8B 1NYTA 2HJHA 2HUPA 1H3NA 1I4TD 3EVAA 1H66A 1HURA 4J4TA 1BA3A 4EUEA 1Z06A 3ZEIA 1JKFA 4IGIA 3WL3A 4B48A 4ZXFA 1TIBA 2O3TA 4B3MB 3AOGA 2NXCA 1PNVA 1W73A 4PFQA 3TOXA 5KJFA 3I6ZA 2JBAA 3KLPX 1DCFA 4LSGA 3SF8A 2JC3A 4CQJA 3O3MB 3SYKA 2BUAA 5EXDA 4DRXA 2W48A 3LPNA 1O97D 5T4BA 4ALMA 2QLBA 1C4OA 2ZPAA 4HUTA 4OEHA 5IX8A 2BGMA 4D7AA 1IATA 1LI5A 2JIZD 1Q15A 1W4ZA 2WJ4A 1GJRA 4QASA 5AI5A 1V16B 3I05A 2OXIA 4DRYA 2BGKA 3KZOA 1G63A 4QJIA 4UM9B 1QIKA 1K6JA 4W1PA 4N0DA 4HV4A 5JTUA 2MMCA 2DLDA 3FNEA 3L04A 4OBEA 4UU7A 3X2SA 1PTKA 2EQAA 2JKVA 1FLDA 3EVDA 3I83A 4QIHA 3DWFA 4OQMA 1C9JA 1G5HA 4CYMA 1KDRA 1LA2A 1OD6A 2I71A 3P9CA 5EHGA 5EE9A 3SJCA 4AB1A 5GIPE 1EVZA 2AKYA 2QPTA 5JO9A 4COOA 1PFVA 5KYUA 1BOFA 4I0WB 1KYXA 1XI2A 1PWHA 3OWOA 4LZNA 1P0QA 4TT8A 4YXWA 4OLJA 5AT1A 1ILWA 2A5GA 2PKQP 2WPNA 2XF2A 2ZBUA 2D2XA 3SVZA 3R6TA 2PT7A 3WYNA 4CLXA 2VSYA 2PM8A 2Z5GA 1YK0A 3T1QA 3CV3A 1EHIA 1R9JA 3IVGA 1J23A 4HQ0A 3B38A 5IM5A 3WL4A 4A23A 4P7JA 3HCAA 5K6AA 1NJFA 2XYVA 1Z6QA 3JQ9A 2EG9A 4B6SA 3KXKA 4IXDA 2FHSA 3LM8A 1DMSA 3K9LA 3TW0A 4ALNA 4DIOA 2JK1A 3C15C 3A6HA 4XUGB 3AWDA 3CUWA 1UODA 2Q45A 2LDBA 1TU4A 4UEQA 3MN1A 3IHWA 1E1LA 3R77A 5TT0A 4RMNA 4RIEA 3R9XA 2AI3A 3RIEA 1XZCA 3B2NA 4WA7A 4L7VA 4QG7A 1GDHA 2IDMA 1DIGA 3PEEA 3ZUPA 1MOZA 2J0EA 2O2YA 3NBZC 3NBFA 3IKJA 4B73A 1M33A 4LY3A 1E4VA 1XPRA 3WR5A 4M54A 4U2DA 5JMOA 5BN4B 2AT1A 2IUUA 4EI9A 1P61B 1DX4A 1AX9A 4TRJA 5CD9A 5CLFA 3HCRA 2W11A 2X5OA 2MDTA 2AEMA 3MTEA 1VPVA 3RBAA 3MWJA 3RWMB 3QFSA 4JN6B 4ZJZA 4IJKA 3EK2A 4IZHA 4NBTA 1X7XA 1F7VA 1EJ0A 1NMQA 1XVVA 2WNHA 3EULA 3I1IA 4JIMA 1Z36A 1C7QA 2IDZA 3FRHA 3P4XA 1OH8A 5F9FA 3LS2A 2OBMA 4I55B 3GO4A 3DWIA 1LDMA 1WZEA 4GUAA 1PLKA 1JU4A 1Z2PX 4UMFA 4MICA 6YASA 2A5YB 4L02A 1GTL1 4O4IA 3NDIA 5ELXA 2BN4A 3WGJA 1PSZA 1P33A 4KPGA 3MAGA 3W9YA 2OQIA 1RHJA 2V3VA 1L5KA 3PRJA 4NCXA 3WA6A 1LJLA 4MYSA 3ZHZA 1Y8RA 1B16A 2Q1YA 3RQIA 5JXHA 1P45A 3GJ4A 1C0KA 2ZOSA 3OU2A 3OTGA 2NU9B 4KFCA 3U5ZB 1BXGA 1GKLA 2GXSA 2QAIA 2NVUA 1E3WA 5IJWA 5AW3A 1G64A 1SD1A 3NAZA 4R2LA 1EAMA 4CEJB 3ZJTA 1RAGA 2RB5A 1VE5A 4PCLA 4KBGA 4QJBA 2V7BA 1YB5A 3FUXA 2FPRA 3AM5A 1VE1A 3MHPA 4ZCRA 4S1VA 3MAAC 1C5KA 3W5IA 3BH0A 3FKSD 3IULA 3OJOA 4DLZA 1IIBA 4DSTA 5GJCA 2BFDA 4L3OA 5E7JA 2I1WA 3E6AA 1KU6A 4FNMA 4KTVE 4OHRA 5MN6A 3L0OA 4Q7QA 3JQAB 3O7WA 5C2JB 3F1LA 3FF4A 5D1NA 2WIDA 3RSFA 3I9MA 4EB8A 4P33A 3PC6A 2EG5A 2XVYA 3AF3A 3FZGA 3JVUA 3B89A 3I9JA 4UOEA 5A9RA 2IKQA 5K0ZA 1W96A 3ABIA 1A8SA 2D54A 3UFBA 3AJDA 2GHRA 1YR1A 2NU7B 5CMLA 1X13A 1KDOA 1Q7CA 4EQ6A 4ZRDA 5HUQA 1ZN7A 1QLHA 3JY6A 2WI8A 4MB2A 1Y3FE 1NN1A 3GI1A 4FQ7A 4MR7B 5E0OA 3NRCA 5LCXA 1WHTB 4B7UA 4L75A 1N6LA 2FMKA 2XV1A 1XDDA 2FQWA 2D5LA 2J48A 1F60A 4ZYXA 1QE3A 1DINA 1SCQA 2I91A 4NBVA 2XI4A 1RXSA 4JI1B 3LDFA 3NPAA 1PKEA 1U6IA 4Q4HB 5B6PA 4RY9A 1VG8A 1ZN9A 1ZU4A 3W8FA 3CCCA 3QKSA 1SCKA 2WLSA 5LDDC 4LVCA 1VYHA 3FE2A 1NDQA 3OQHA 4Y6GB 5DX8A 4B83A 3EJ6A 4MI3A 1L4HA 4MVJP 2C59A 4OQFA 3LKVA 1V37A 3WGLA 2OVBA 2ZRAA 2AJ8A 2PMDA 1NJGA 1GNVA 2RHOA 2WZDA 3WFJA 1YS2X 4IDBA 3CLKA 2HPHA 1UMBB 1U3UA 2GWHA 2IVFA 2A6PA 2X76A 3R40A 4DVJA 1ZU5A 2PSJA 4PXSA 5LZ9A 2P68A 4QEDA 2PNJA 3LUGA 5LA6A 3I2GA 5ADWA