3SSOA

Myce methyltransferase from the mycinamycin biosynthetic pathway in complex with mg and sah, crystal form 2
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
393
structure length
393
Chain Sequence
EFDEATVQDVVRLAGGHDSELRELTQKYDPAMISRLLVAEILSRCPPPSNDTPVLVELAIVHGSERFRHFLRVVRDSPIRPVGADEGFVGMLVEYELTELLRELFGVTHERPAGVRGTKLFPYLTDDEEAVEQIGTYLLAAQQGTEAVLAGCGSRKPDLSELSSRYFTPKFGFLHWFTPHYDRHFRDYRNQQVRVLEIGVGGYKHPEWGGGSLRMWKSFFPRGQIYGLDIMDKSHVDELRIRTIQGDQNDAEFLDRIARRYGPFDIVIDDGSHINAHVRTSFAALFPHVRPGGLYVIEDMWTAYWPGFGGQADPQECSGTSLGLLKSLIDAIQHQELPSDPNRSPGYVDRNIVGLHVYHNVAFVEKGRNDEGGIPTWIPRDFESLVQASSGGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
pubmed doi rcsb
source organism Micromonospora griseorubida
molecule tags Transferase
molecule keywords Methyltransferase
total genus 131
structure length 393
sequence length 393
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.238: Mycinamicin VI 2''-O-methyltransferase.
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17843 MycE_N MycE methyltransferase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.30 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A Nonspecific Lipid-transfer Protein; Chain A 3ssoA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ssoA02
2IH2A 1V39A 2FK8A 1SG9A 3EGIA 1JG2A 4MIKA 4P7GA 5ICGA 3JWJA 5F2KA 3G89A 4HG2A 4EVIA 2PXXA 2IH5A 4RX1A 3HA5A 3IYLW 5JR3A 5K0BA 4HH4A 1HMYA 3FPEA 2IGTA 1XJ5A 1EJ6A 2PXAA 4BLWA 3G88A 4V0RA 2GH1A 4QDJA 5EEGA 4KW7A 4CXMA 4RTSA 5E1OA 1X1DA 2AOXA 2H11A 2QRVA 3GO4A 3LKDA 3OPNA 4QQNA 5CM2Z 2V7EA 5FULA 3SGLA 2JG3A 3ERCA 2E5WA 1FJXA 2BR3A 1R74A 3MB5A 2YXLA 5HILA 1AV6A 2YR0A 2N47A 3HCAA 2ONZA 1G8AA 1EJ0A 3KQVA 4U7TB 9MHTA 5DX8A 5GWXA 3SSNA 5FA5A 3SXJA 3ER8A 8MHTA 3FUUA 3GWZA 5EIWA 2ZCJA 2G8NA 4E32A 3HCEA 4HTFA 2WA1A 2ONYA 3EVZA 4H0NA 4BLUA 4YUYA 3T7TA 1VPTA 1G55A 2OZVA 1D2HA 1JQEA 1AQJA 3TQSA 3GIWA 3RIEA 1UWVA 3FPJA 3MTEA 4UOEA 2OKCA 1FPQA 5GIOE 1O54A 4RTKA 1QAMA 3ANXA 3AXSA 3C6KA 5EZSA 1WS6A 3M4XA 1BOOA 1P39A 2NXJA 3M6XA 2BH2A 1SQGA 2VDVE 3A26A 4RYLA 3UJAA 1YB2A 3HM2A 4PIPA 5DSXA 2PBFA 1XDZA 4FT2A 4HC4A 4PYMA 4RTRA 3NWBA 2EJUA 1M0EA 3DH0A 3R0QA 5EIFA 5IKMA 3OU2A 4RV9A 5DM4A 3CC8A 3VSEA 1NW7A 4YMGA 5BW4A 2GLUA 3OZTA 2C7OA 2HV9A 3B7PA 3DUWA 4RVFA 5D1NA 1TW2A 2NXEA 1RI5A 2IDJA 2B2CA 2VP3A 3BGDA 3DTNA 3I9FA 4LWOA 2EJTA 5DX1A 3UJ6A 5GIPE 2FPOA 3BWCA 2I9KA 4BY9E 3OFKA 5FWAA 3EVGA 4GBED 5BW5A 1VIDA 3PB3A 2PX2A 5ERGB 1IXKA 4Y2HA 3ME5A 1MJFA 3KQWA 4CTKA 1L3BA 1IM8A 2ZFUA 2FRXA 3HEMA 5HEKA 4KWCA 1WXWA 4F84A 1PJZA 3LGAA 2XBMA 3PLAE 3T0IA 3B89A 3EVBA 3P2EA 4OBWA 3WSTA 1O9HA 3E7PA 4EMSA 3A7EA 4PINA 2UYOA 1ZQ9A 2VDUE 5FUBA 3UJ7A 5LQKA 2O0LA 4MHTA 2AOTA 2BZGA 1WY7A 3GRUA 1SVUA 1TW3A 1XVAA 3MQ2A 2QM3A 5FHQA 3X0DA 5KQSA 5EMKA 3CGGA 3LDFA 3TKYA 2C7QA 3I5UA 2BR4A 3BGVA 4LECA 4JXJA 3GRZA 5LR6A 5EMMA 2ESRA 3HTXA 4CTJA 4QQKA 2ZLBA 3KHKA 1FP2A 4O29A 3Q87B 3LSTA 1QANA 2DPMA 3P9NA 5E2AA 2NXNA 2JH9A 4E2YA 2ZIFA 2QRVB 4KIGA 4OX9Y 3SMQA 4C08A 2HR1A 1NW5A 1NV9A 3BZBA 3I64A 5HOQA 2OO3A 3PT9A 1ZGAA 3BXOA 2G72A 3B3JA 2ZBRA 4M36A 3UWPA 4PYJA 4PWYA 4RSRA 2HWKA 3LX6A 3PTAA 4OQDA 3O31A 3PFGA 4Z2YA 3H2BA 3KR1A 1ZG3A 2K4MA 3UBTA 1I1NA 3GJYA 3KQTA 2C7PA 4X60A 2PWYA 2B9EA 5DLYA 5DXJA 5DTQA 4RVHA 4HGZA 3LPMA 5GINE 5P8WA 3GNLA 3OZSA 4AZWA 4C04A 1QYRA 3L8DA 4DCGA 3Q7EA 2AZTA 2FCAA 3EVCA 3SX0A 4EK9A 3NW9A 3PFHA 2CWWA 3HCDA 4C05A 2VZ9A 3GRYA 4HGYA 1ZHFA 4XUDA 3OCJA 1WG8A 5CUQA 5EVJA 4GF5A 5ICEA 7MHTA 3FUWA 3LCUA 3G8BA 3A4TA 1G8SA 4Y30A 5HIIA 2OB1A 3G2PA 1FBNA 1RJFA 2ZULA 1DUSA 3TM5A 4PYNA 3BWBA 3C3PA 3KQQA 2Z6UA 3FYDA 5K0FA 3JWHA 1O9GA 1ORHA 3A7DA 3EPPA 5T64A 5K0LA 1JR4A 5EGSA 3B3GA 3OFJA 3C6MA 3UJ8A 2JHCA 3HVKA 4LG1A 3I58A 1XDSA 3ORHA 4DA4A 3KPYA 3CBGA 1FP1D 3BUSA 1L3IA 4A6EA 2B25A 2CKDA 4QVKA 1JG3A 2BR5A 4R05A 2B3TA 1RI1A 5EG5A 2I7CA 2HTEA 3GDHA 4DMGA 2PY6A 3FTEA 3QOWA 4DF3A 5K01A 5C0OE 3DP7A 4CKEA 4CKCA 4FT4A 1OR8A 5EOVA 1RJEA 3G8AA 3E05A 5CD1A 5CIYA 2BM8A 3IEIA 2AOUA 3SSOA 1QZZA 2F8LA 1RJDA 3DULA 4OA5A 1G38A 5FWDA 2ADMA 4WVLA 3M6VA 1G60A 2YXEA 4X63A 5LQNA 4IWNA 2QY6A 4AZVA 2LD4A 3FUTA 3QV2A 1YZ3A 3NJRA 5HIJA 2DULA 4C07A 3GGDA 4EKGA 1XDUA 2B78A 1I4WA 2P8JA 2YQZA 2AOWA 2ZZMA 4PYQA 1KYWA 4ZTBA 4G56A 3FZGA 4E33A 4GQBA 2GAFA 4HRAA 5F2OA 2HMYB 2ZZKA 2XYRA 3PVCA 3P71T 3P97A 4BP1A 5CVJA 4YV0A 3EGEA 3NWEA 5MHTA 5LSAA 4E70A 1X1BA 1VL5A 5LQJA 3KQYA 5K03A 4P7KA 2PXCA 4CWAA 3DLCA 1QAOA 3ELUA 5DX0A 2YTZA 3DMHA 4YUXA 3ELDA 4GEKA 3CJTA 3LBYA 3UZUA 1KIAA 4DCMA 5CVVA 2FHPA 5DWQA 4C06A 4RTOA 3MHTA 1RI4A 3BKXA 1QAQA 4GOMD 5DPMA 4RTLA 1NW6A 2IIPA 3K6RA 5K8VA 5JUWA 3UA4A 10MHA 2IH4A 1VBFA 3C3YA 3K0BA 5DTMA 1JTEA 5FQNA 1JSXA 1Y8CA 4AZSA 4DZRA 2ZWVA 5EZQA 1H1DA 2V74B 3DR5A 4EQZA 2Y1XA 1HNNA 2PLWA 3M70A 3NDJA 4U7PB 2NNWB 4ER7A 4YV2A 1EG2A 3FPHA 4YV1A 1KYZA 4A6DA 2ERCA 5CVUA 3O4FA 4NECA 2A14A 2YX1A 4RTPA 4QTTB 4ISCA 3DXZA 3KQPA 4M38A 5FA8A 2Y1WA 5HIMA 3UFBA 4XCXA 2EFJA 3FPGA 3BWYA 3G5TA 1NBHA 3A27A 3UJCA 4MTLA 1UIRA 3SVZA 2PT9A 2ZBPA 1R6AA 4XUCA 3TLJA 5HIKA 1KHHA 3HVHA 1YUBA 1BHJA 5K0GA 4R6XA 3RODA 2UYHA 3C0KA 4PONA 1MHTA 1RI2A 2HNKA 5E9JA 2IP2A 2P3OA 3MCTA 1B42A 3AXTA 3HVIA 4IV8A 4QPPA 4E2ZA 5CCBA 3FYCA 5F2NA 4P7JA 2O05A 4RTQA 4R8RA 3CVOA 4ER6A 3M6UA 1N7IA 4FR0A 5FADA 3E23A 1EQAA 1JQDA 3G2OA 4KDCA 1NW3A 3KPWA 3LDUA 1G6Q1 4OA8A 2CMGA 2NYUA 5EEHA 4RTMA 1TPYA 2ZIEA 3G2QA 3M33A 4R6WA 3THRA 1F3LA 2EX4A 4GOLD 3FUXA 5DRYA 4LWPA 4KRGA 4KVZA 5GOZA 5DM2A 5GM2A 3LKZA 4E2WA 2C7RA 1VE3A 2CL5A 3PX3A 4L7VA 4OQEA 1L9KA 3AJDA 5B1SA 3FTDA 4MWZA 1YF3A 3OU7A 1UFKA 1XCLA 2R6ZA 5U4XA 1P1CA 5E9WA 3HCCA 4QDKA 4B17A 3EVFA 4RVGA 2P7IA 3CJRA 2ZSUA 3GRRA 2QE6A 3P9KA 4X41A 1KPHA 1XXLA 4XUEA 1JG4A 4QVGA 2ZW9A 5LQCA 3EMBA 3VYWA 1R8YA 5KQRA 1F38A 3ID6C 2ZBQA 1EIZA 2VDWA 3NDIA 3GXOA 3OU6A 4DQ0A 2IFTA 1R00A 2IDKA 4ATNA 2WA2A 2IBTA 5DM0A 4KIFA 3B3FA 3HVJA 3OZRA 3HP7A 2NP7A 1SUIA 1KR5A 3KPJA 4X1OA 2IBSA 4BP3A 2AOUB 3S68A 1D2CA 2G70A 3MAGA 5DTRA 5EKXA 1YFJA 3AY0A 3EGVA 2O57A 5E2BA 5K0CA 3V8VA 3B5IA 3LCVB 3AWIA 4RWZA 2Q41A 2QYOA 2UYCA 2GA9A 2ORED 3EMDA 3EVDA 3FPFA 5DM1A 5C9ZA 1JSZA 2Z6QA 5CVEA 1VP3A 2PVCA 3G7UA 1SKMA 4DKJA 3VC1A 1VQ1A 4E31A 3V97A 3ER9A 3P2IA 3D2LA 4PYLA 2P40A 1I9GA 4DM3A 5EQJB 1BC5A 4AUKA 2AN3A 4RTJA 3JWGA 4KDRA 1R8XA 4X61A 5LQUA 2AR0A 2P35A 2PSSA 2PJDA 3G2MA 4F85A 2AN4A 2AVDA 5ICCA 4PIMA 3MTIA 5EHIA 3KPUA 5HFJA 3EEOA 2P3LA 2JHPA 3DXXA 3KKZA 3FRIA 1M6EX 3HA3A 1JG1A 3HCBA 1NV8A 4M37A 2XYQA 3ELYA 4IV0A 1X19A 4ER0A 4GC5A 3SR4A 4FSXA 4E30A 3NVKI 2PX8A 3FTCA 2VS1A 3TMAA 3RW9A 1WXXA 3HNRA 2JJQA 2PKWA 2OPBA 2O06A 3CKKA 1P91A 2AVNA 3VC2A 1WZNA 1RI3A 4ER5A 2CMHA 5KVAA 1JTFA 3DOUA 2G71A 5E1DA 2ZWAA 3T7RA 5K0JA 5CCXA 1N7JA 2Z6AA 2NP6A 1IY9A 2GB4A 2H00A 1NW8A 3NMUF 3BT7A 3LDGA 4PYOA 3EVEA 3LL7A 4FSDA 3T7SA 1D2GA 3PS9A 3FUVA 4ER3A 2WK1A 4BLVA 5EPEA 4WXHA 1INLA 3NTVA 3TKAA 1U2ZA 3IV6A 3O7WA 4K6MA 3GRVA 3IHTA 4V0QA 2PX5A 3DMFA 2I6GA 3G5LA 3TOSA 3R24A 5D1HA 4HSGA 1EAMA 4PGGA 1DL5A 1JQ3A 2XVAA 2PT6A 3CJQA 2XYVA 2PV0A 5EMJA 3R9XB 1Q0TA 2ZTHA 4GOOD 1L1EA 3HA7A 2EG5A 1BKYA 2IPXA 5K09A 5M5BA 1YFLA 3P9IA 3E8SA 3BGIA 3OE4A 5EHGA 3KQOA 3M6WA 3P9CA 4AX8A 3KQSA 4E2XA 2XVMA 5FTWA 2JH8A 5EMLA 3P2KA 2OY0A 1KPGA 5DXAA 3U81A 1R18A 2H1RA 5EC8A 1DCTA 2P3QA 5DRTA 3UA3A 4YUZA 1ZKDA 4C03A 5BP7A 5K05A 4FP9A 4YMHA 5ICFA 1ZGJA 3DLIA 5FCDA 5T67A 1M6YA 4IKPA 4R8SA 1NKVA 5DSTA 1KPIA 5E1MA 2P1DA 3GCZA 3TPZA 5G02A 5HZMA 5CVDA 5E9QA 3UJBA 2YUIA 1SQFA 5GP1A 5FHRA 1X1CA 3FRHA 3TFWA 5K0EA 1NBIA 2P41A 3CCFA 4QPNA 2PGXA 5IH3A 5FQOA 3UJDA 3FTFA 2P7HA 3GU3A 3PX2A 3NVMB 2GS9A 3REOA 3LBFA 4OBXA 3TM4A 5KS2A 4PYIA 2R3SA 4RTNA 4YUVA 1N2XA 4POOA 2AOTB 1XTPA 4FZVA 2OXTA 3EEYA 3R3HA 2OYRA 2YXDA 1X1AA 3P8ZA 3MGGA 5E8RA 5LQAA 3UJ9A 2O07A 4GOND 2AN5A 3DMGA 5E1BA 3MCZA 1AQIA 3KU1A 1VLMA 4PGHA 5T6BA 2OB2A 3I53A 1VP9A 4FGZA 4PCAA 4QTUB 1L3CA 3KQMA 3MERA 3TRKA 2KW5A 1RJGA 2NXCA 4GUAA 2BM9A 4FS8A 3KR0A 4P58A 2AOVA 4PCLA 1AF7A 1PRYA 5BXYA 1Q0SA 3HCFA 2JHAA 3OE5A 4GC9A 5H02A 5KYGA 2FK7A 3KR9A 3F4KA 2YVLA 3ELWA 2ZVJA 3LCCA 1P1BA 4MQ4A 1XCJA 2UZ4A 2OBFA 2PX4A 5EKUA 3QOXA 5LQRA 2FYTA 2UYQA 4EKIA 3DXYA 4M7RA 1SUSA 1YZHA 2I62A 3LHDA 3JWIA 5C1IA 1KP9A 4YUWA 3LECA 4P7FA 2ZZNA 4AZTA 1KXZA 2G1PA 3TR6A 3KPVA 3SM3A 3BKWA 3EVAA 3R6TA 3KR2A 5GM1A 5DT2A 2AS0A 5K0NA 5E8JA 4PNEA 1T43A 3SSMA 2PWPA 4F86A 3THSA 4RVDA 4PYKA 1NT2A 4CKBA 2GPYA 3A25A 4C4AA 1NE2A 1ORIA 1Z3CA 3BWMA 4HTFB 2ZIGA
chains in the Genus database with same CATH superfamily
1JDUA 2EQBA 2JW5A 1V39A 3A10A 3E9MA 4YCBA 5SY4A 1X7GA 3TBKA 3MGCA 5F76A 2MSNA 3GLRA 5KQPA 5BN5B 4IZHA 2XWSA 4NHOA 3KXLA 4DUYB 1WCYA 3CPHA 1AUOA 5CB4A 4Q3OA 1JIUA 2VTBB 2HDOA 4FVTA 4YVFA 4WOJA 2V5VA 2LBPA 3G88A 1GA4A 4F2DA 4HDNA 5IBCA 1URPA 1DRKA 3LD9A 2A9KA 3DQZA 4LZJA 2E5WA 3UCFA 1E3WA 1KH2A 3I2YX 4CMEC 4D4KA 2ZSHA 3STVA 1P9RA 1KIMA 2CYBA 3EH1A 3UK2A 5SYNA 3HCAA 1ZO8A 3KOMA 1EJ0A 1ODFA 1YS9A 4U7TB 3AWDA 4YS6A 4L8WB 4EIWA 4PZ9A 4HGNA 1QWOA 2J9FB 2CNWA 2QX9A 2XMGA 1QFJA 1XU7A 2ZEJA 2P79A 3ORRA 1FS5A 4FD2A 4OQXA 4PQRA 1RM5A 4GQIA 1CJTC 2PH7A 4D0RA 1NZJA 1LK7A 3R7FA 4FOPA 2IZ0A 1U9ZA 4H0NA 4DSOA 3G0IA 4CKEB 3LFHA 3O8LA 3TLBA 3P0EA 1LU9A 3QVUA 4YJDA 4QJBA 1JA0A 2BTQA 2WVGA 3MTQA 2BMAA 2B4KA 2C29D 5F1KA 4YBRA 5DGTA 4ZEXA 1UBLS 2Y0EA 3ZDXB 3K0FA 3O1JC 3QX3A 1NG1A 1RT9A 1XN1A 2CLEB 3A3KA 3GX1A 1B15A 1USIA 2K6GA 2P2GA 3N6VA 4G8BA 4I2NA 3GDOA 1W88A 2HEGA 4AKGA 5EZSA 1LEHA 3M4XA 2IPLA 4ZI7B 2J7KA 3M6XA 3V42A 3IE2A 1JT2A 3FCXA 1FTNA 1VL2A 3PE6A 3UHPA 5SZHB 4GGOA 2FKNA 5FPTA 1T9HA 4CHTA 3RRBA 3R0QA 3TNDA 1PU2A 4ERXA 3WWDA 3HHEA 4MULA 5IBQA 3F73A 4CF5A 5TIIA 2HQBA 3RFVA 3A0UA 3KO8A 1JDVA 3OTIA 4JGIA 4LWOA 5DX1A 3M9LA 1NYRA 1TIPA 4G0WA 1T3HA 3MWFA 2IYEA 4D41A 2VAVA 2VYND 1EBBA 4MYHA 2EJWA 3GJ4A 1ATIA 4L5YA 1U3TA 2AFHB 2XE6A 1QCZA 3VR4D 3ZZNA 1VLZA 3LGAA 4RORA 2YFHA 5JCOC 4A03A 2GN0A 5P21A 3TIFA 4E7PA 4PG8A 1JBQA 3TUIC 3VSDA 3VBCA 3EIOA 5GAJA 1FYWA 3DMTA 3VKFA 1FXWA 2GKGA 1BYIA 3K9GA 5AVWA 2AZXA 1UDXA 4KQKA 5A4KA 2BZGA 4W1SA 1C1XB 4DCCA 2VQFB 5JDIA 2P27A 3KYDA 4D9FA 2QIPA 3TKYA 1Z5UA 1JL3A 1ETUA 2Y77A 2AK3A 2V98A 3K9CA 4RKEA 5FUVA 4BGVA 4DDHA 5ITSA 5AJXA 3QP9A 3OUUA 5B1IA 4OG2A 3I9LA 2X5KO 3ZQJA 3DR3A 1Y1TA 2DHCA 1TVMA 2H1WA 1A69A 2PRKA 1W4AA 3OWHA 4UZEA 1WW3A 4B85A 1POXA 4LOKA 4L4XA 2Z3ZA 2EJBA 1N0IA 3OJXA 4M1YA 4GFDA 2CUTA 2C9CA 4J03A 4LJSA 2HRRA 2YJTD 2NUAB 2GYWA 5HRAA 1WB5A 4AV7A 2XB9A 4HUQA 1EH5A 4OQDA 3NALA 2HWWA 3QUAA 5LNK1 3FM9A 1FUIA 3OTWA 4R1PA 1Z74A 4YRGA 3GJYA 4EFDA 3D1VA 2P69A 5DXJA 1QM5A 4MS3B 5P8WA 3A6GA 3H6GA 4H6XA 4G0MA 4D44A 1JPUA 1KAHA 1L4BA 4JLNA 4II3A 4LZPA 2WZBA 1N75A 2ZVDA 4OF4A 4BHTA 4P3YA 1FU4A 1QHEA 3NW9A 4M9XA 4DDWA 4CCAA 2P6MA 5AUNB 3MQ4A 1VKZA 3LC0A 2JGFA 3EZNA 4DM4A 3RIXA 3RAGA 3Q11A 5EVJA 3URKA 2ZYUX 3AG5A 1VI6A 3B12A 1KKLA 4R2IA 2P2LA 4ZZIA 1G8SA 3BB1A 3OCZA 4IM7A 4FFNA 2X4LA 4CU2A 1NKSA 3CLVA 2JHGA 3DBRA 3JWHA 1QORA 4OGKA 2PUGA 5K0LA 5DBGA 2VKTA 1L7EA 2VNAA 1U1CA 4EYEA 3GEHA 3B52X 1Y81A 3ORFA 4KO1S 1CDDA 2ABWA 1XDSA 5CLIA 2GOYA 1IZZA 3IP7A 2LZ0A 3QWHA 4GX2A 4AS3A 2D5CA 3DM5A 2QTAA 4Y1EA 4JROA 4YDRA 1Z82A 3HFGA 1F4PA 1NUUA 1GRRA 1R1DA 2ZPUA 3DKPA 3F90A 4N8SA 4NFSA 4Q00A 2OV6A 4Z0HO 1DIHA 5B58T 3NHBA 4D8TA 2VCEA 4G4SO 3I2HA 2Q6IA 3CLSC 4PFQA 1W4CA 3M2PA 2X9QA 2WWHA 3N2GB 2NU9A 4F9TA 1KI4A 2WZDA 2BGWA 5JDIC 4ZU3A 4JBNA 2ZSFA 2BM8A 3TAUA 4XLTA 3RBVA 2OBBA 1YGYA 4NU5A 4OGGA 3M1LA 4YI3A 4EGAA 3B2EA 4M0LA 1M2NA 3PXBA 3PUYA 3L1UA 4IKEA 1K5GA 1NXSA 3PF8A 4BNYA 2O8BA 1Y5NA 1G3MA 1N6PA 3C8DA 2GN6A 3B1YA 3D31A 3B1VA 3PE4A 2V7QD 2NW6A 3MB8A 4KR0A 2PUFA 4KZKA 3L1HA 4I8XA 4RF2A 1X7HA 1MO5A 4LBWA 1GZ4A 1SOVA 2VLIA 1NDUA 4E33A 1HKHA 3CE9A 2I2BA 2GCNA 4INOA 2HMYB 1GG9A 4G0YA 2TS1A 1W2WB 1L5RA 1P44A 4R54A 3RLIA 3Q9NA 4JAVC 1OTHA 3HSYA 4UJ5A 4I66A 3WDMA 3PQ5A 1KORA 2B8JA 3PEEA 2HKIA 1XZIA 3U3MA 1FTYA 5E2IA 1HEUA 1F2UA 3TFOA 2XUOA 3HBFA 2O8CA 3DB1A 4EY3A 1G2QA 1U7HA 4V03A 1H94A 4YIKA 1V6CA 4ND8A 4X7BA 3KXPA 3LRTA 3LWBA 5TR9A 4Z4GA 1T4BA 4WDQA 1SMKA 1DPGA 1ZMXA 1C9KA 2JGEA 1NOIA 3MWGA 1JLHA 2ALJA 2YS6A 2FSPA 3E9ZA 2XEXA 5LLSA 3D3WA 2NVWA 1M67A 5TVKA 5BVHA 1VBNA 1XUOA 2OLJA 1NFFA 1WLSA 4P3KA 5EINA 3S44A 3T8YA 1JZSA 2WRZA 3I5MA 2VUTA 3IKTA 5D8DA 3E61A 2YYSA 4CDNA 1XMIA 1IKTA 2V59A 3AUUA 2I1LA 4BWFB 4MVXA 2WP0A 5KSWB 1W2GA 1DRVA 4RPGA 1BCSA 1C3OB 3I0MA 5I48A 3VNQA 2WSIA 5L40A 1DO8A 4EDFA 4Z7QB 1SD1A 2QN6A 3EOAI 1AVTA 3NHZA 1J2TA 2RAFA 2F8TA 5G4KB 1XTRA 3SZOA 2QTGA 5DHTA 3GLKA 4RAQA 3HP1A 1DCKA 2ZR7A 3OX1A 4Z3KA 1C44A 4JIMA 4LXTA 2MDTA 5F1OA 3UJ3X 5C51B 1KHHA 3C24A 3W06A 4C5BA 1SIBE 4REMA 4YRFA 4DNFA 4ALKA 1BD3A 3WNVA 5TEVA 4P6VF 5E9JA 2C20A 4JJAA 2WHPA 4PSDA 3H11B 4DIUA 4DR4B 2GFQA 5C18A 4P7JA 4RULA 3DFUA 1ISRA 3DTTA 2VNJA 1U7PA 3TL3A 1KZ7B 1IQPA 3K1YA 1SVMA 2IU0A 3NZEA 1RCFA 1IOZA 2WVAA 2O8NA 4X62B 3T4EA 2IBMA 3HJFA 4ZOEA 3UGQA 2NZVG 2BGMA 1L1RA 4WECA 3H04A 3DOOA 5J58A 1W48A 3AZOA 3I04A 2I5PO 2CLLB 1X38A 5A3QA 4HDRB 1D8AA 3RREA 3CO5A 1P2GA 2O2ZA 2R6ZA 3DCYA 1HT0A 1NI4B 1CRLA 1P1CA 2JGLA 3HB7A 3KCQA 3VR0A 4WNAA 3ZR4B 4IDFA 1L8QA 3WGKA 2BGLA 4O8CA 3T3DA 2R11A 4XUEA 5DHAA 1JG4A 2PD3A 4KXWA 1P17A 2IDZA 3QFRA 3RRXA 3VYWA 1WL8A 4DQ0A 2AFRA 4C7OB 3KHUA 1J1IA 3QVLA 4DPKA 4RY0A 1JH9A 4D25A 4M8NE 2QLJA 1OC4A 1HFEL 4UEKA 1W36C 1DX6A 2I65A 2PQ2A 1GNVA 4UREA 4DADA 1KVQA 3CCCA 2BI8A 1U02A 5ES4B 4G5HA 1Q92A 1PSZA 5K0CA 1PJ4A 2V55B 4QUAA 3EQ9A 1HR0B 5K8TA 5DM1A 5FBLB 4LV6A 4PLWA 6LDHA 2WTXA 4MLDA 4EO9A 2PUCA 1RMQA 2ZYSA 1VP3A 2PVCA 3GN2A 3L1VA 2ZI6A 4TRRA 5TJ9A 3PF9A 5B7NA 1PD1A 4B7XA 3SVTA 4PSVA 2XOEA 3B9RA 5T3UA 4B48A 1DAMA 4PYLA 3DZCA 2DOKA 1KY2A 4PRYA 5TPZD 4BGEA 4D9GA 5HZKA 1YC2A 4F97A 4B6SA 2P65A 2X6QA 1Q1ZA 4R9NA 2DWQA 1Z4NA 3H5IA 4P53A 1KK3A 3O7MA 3QF4B 1YRYE 2FWBA 4KIWA 4NZOA 4TS9A 1PQUA 2CJXA 3W4KA 4BFYA 5LQUA 1COWA 2C2YA 1H5UA 1NVGA 1JALA 3HN2A 4H6PA 3C3DA 2OT3B 2A2ZA 3KUKA 1XPJA 2ZUCA 1M6EX 1ISGA 4BQRA 1MPTA 3DV0A 1TJ3A 5DZSA 2ODNA 3ELYA 4D9CA 4AJKA 3NU1A 3BHJA 4E30A 2PX8A 5B5SA 2YQ4A 4KAXA 2NPOA 3L4BA 3T3EA 1OCEA 1PS8A 1XG5A 3IQIX 3ZHZA 2I00A 2FN3A 1RHRA 2GCOA 2CXHA 2CVQA 1KO5A 2ZYRA 3O91A 1JWBB 3RVPA 3KAQA 4QOHA 3T4PA 5IVDA 1F2VA 4XGRA 4ABTA 3LQ1A 2JFVA 3BIOA 1IY9A 2GB4A 3M6FA 3ZCTA 2XCTB 3EPHA 5TQ2A 3GA7A 1FVHA 1DTWB 4ER3A 1F2UB 1NIJA 1NKTA 1E9BA 2C61A 2R00A 4OXKA 1KJ8A 3AG6A 2W9XA 1BDMA 2H7XA 4JHXA 4F92B 2BM0A 2QJOA 3EXHB 2J0QA 1ZMTA 2JLWA 1DAIA 3FHOA 4O2BB 1YHNA 4BIMA 4GLOA 1VJTA 3KT8A 4PLVA 2H8GA 1ZEMA 2FRDA 2M1ZA 5LUAA 1TJPB 3WOHA 5ENZA 5IN5A 2ZYHA 3LY5A 3Q5GA 3JYNA 3BK2A 3EBLA 2NV6A 3GZ4A 1U04A 1DG3A 3BB4A 3ND6A 3OECA 1R18A 2H1RA 3NYQA 3AB7A 4FEEA 4QUBA 1KO1A 1NJ6A 4C03A 5BUQA 1D2RA 2BCJQ 4FP9A 3PICA 4CQLA 1M6YA 3SHTA 5B55A 3PC3A 2Q2WA 1AZSC 3AT1A 1E9CA 3HB9A 3KWFA 2PM8A 3BFXA 2G9ZA 2M6SA 4YMWA 2XB8A 3ER6A 5FHRA 5KOJB 1I3MA 1LRKA 2W2LA 4YFVA 1QH8A 1ID1A 1MX1A 1YV9A 1GRNA 1Z2NX 1E2GA 2R65A 2Y0BA 3BAZA 1BFDA 2JJMA 4GWGA 1U81A 3FJ1A 4MV9A 3U37A 4FOTA 3H3FA 1DMSA 3W5AA 2M6LA 4RTPA 4FNGA 4U3JA 2W6IA 3H18A 2WBLC 4PTYA 4ARBA 5HQ3A 5BWCA 2CEAA 5M34A 1FRNA 1K5PA 1UKEA 4NEQA 1KMHA 1OLOA 4QVIA 1JQAA 2CW5A 1X15A 3U3XA 2O2YA 3LWNA 1LBIA 2R00C 3UCEA 4OOEA 1NVVR 4NENB 5DU2A 2OZKA 2ZRBA 1KVUA 2D5BA 2OB2A 4E08A 3UAWA 1M33A 5KX5A 1RAFA 1L3CA 3PYXA 5IJ0A 1UMKA 2ONKA 2Y2UA 3EB9A 3ND5A 2HHJA 1XKXA 4LYDA 4TXLA 1RLMA 4TSFA 1SUWA 2GK7A 1W4RA 3BZWA 2F2TA 5ERXA 4DBZA 4LGYA 2IUUA 1D2MA 4HAVA 3FTNA 3QX7A 3FYUC 3EASA 3A04A 1MOSA 3FMFA 4GRIA 1ECLA 1SD2A 3FBTA 5FJIA 2RHWA 3UPUA 3JARA 4UUAA 1ZXLA 4G2NA 3QOXA 5AVXA 1D4OA 4R1NA 2AE2A 1PBNA 4LPKA 4MS3A 3CNQS 3LLUA 1H2ZA 2PA0A 4EAQA 5TPZA 5BMVF 1O6CA 5FOXA 1GFIA 2WR8A 3JATB 3LVQE 4U9HS 4HGPA 1C7RA 1PR9A 2F4NA 1EVQA 2G36A 2PKEA 3B1KA 3GHHA 4M6WB 4B34A 4E1AA 1ZL0A 2XT6A 4A16A 4RDHA 4WUVA 2HWYA 3FKQA 4MQUA 2WAXA 4JQOA 5ALPA 4QPCA 5EJ9A 3G23A 1BXRB 3N6RA 2GM3A 1P0PA 2B8NA 1AK9A 3OOJA 3USZA 4GMKA 1XP5A 1Q19A 4D0GA 4CDMA 5D6OA 3Q98A 3QE2A 1PZHA 2ODPA 4CG3A 2BPOA 4RK7A 4PZLA 2Q4EA 2PGDA 4MIKA 4OH7A 5AK6A 1P2FA 4Y67A 5F2KA 1C9NA 2NVOA 2XDQB 1REQB 3LUKA 4HG2A 2IH5A 1LSSA 4QU8A 3HA5A 4RX1A 3AVWA 4R5HA 5DK4A 1ISJA 1HMYA 2IGTA 1L5KA 3BMQA 3KL4A 2Z58A 3NBFA 3PR3A 1BZYA 2XGMA 1ARZA 2Q4OA 4XTCS 3KT3A 1E5DA 2H11A 3GO4A 3HR7A 3PC4A 2B21A 2PPLA 2RJNA 4FR5A 4G5RA 1L4NA 1DBSA 1SKAA 5FB3A 2ZSEA 1RM0A 1DAGA 1PWYE 4GR4A 1UMCB 2WV7A 3G0HA 4IRXA 1DEAA 4WXPA 2VYNA 2LW7A 3K5IA 3BXFA 3QJ5A 4WKOA 3ZG6A 3OD1A 4DZZA 1QNFA 3BL6A 5A9SA 4D0NA 3ER8A 1I24A 1NATA 1YAJA 1YFKA 2JIRA 4IJ5A 4TWJA 5KVSA 3GPLA 2FU5C 2HMSA 5EWLA 2PS3A 2WFLA 3I01A 4H1TA 4E32A 5KNCH 2NO0A 3FWZA 3MIIA 4BWVA 2C9MA 4ZI5A 4HTFA 4NY1A 2ONYA 2XGGA 1WDWB 1FDRA 3VH2A 1F8FA 3ESYA 2HYIC 1A04A 1GNQA 3HH8A 3L8MA 1GEEA 4ZY7A 2I1QA 4I1OA 1ZOSA 2DQZA 2WKWA 3H4VA 4O4JA 2AV6A 1EWTA 2EEZA 1F0KA 2DZDA 1G4HA 1GPWB 4FOSA 4MVJH 4JLAA 5GJCA 3CPEA 4Z1MD 3NDPA 3K35A 1GUZA 2P90A 3ONNA 3MRSA 5DV9A 1DAEA 4BNUA 3FMIA 2Q6OA 1MO2A 4KXFB 4PIPA 2CV1A 1TRKA 3UXHA 3IOCA 2OGUA 4JKYA 3EPKA 5IKMA 3U44A 2P4EA 3SKYA 1FYEA 1J99A 1PL8A 2B5WA 2ERXA 2X1MA 4JELA 2Y1DA 4LJRA 4P84A 1YDEA 4PQFA 2NXEA 3RC3A 4EFNA 4AKTA 5AHKA 3IAM6 5I9NA 3LDHA 4DPLA 4XWWA 4MV1A 1MX5A 2B5VA 4J3FA 3ZW9A 4DXDA 5CB4F 1EVJA 1Q22A 2B34A 2J33A 4HQRA 4QJ3A 1H2RS 2RARA 4X6UA 3QRWA 5ERGB 3MD0A 4ZU1X 3KQWA 4DSUA 4D45A 2ZRPA 2Q5FA 2X86A 4IIVA 3Q9UA 3LVRE 3P19A 3T0IA 5LOVF 3P2EA 4UXJA 1OA1A 2O1XA 4FX2A 4OU5A 5EJIA 4AWXA 5E6UB 3PV0A 1FJHA 3LUFA 1L5QA 5JSZB 1NN5A 1F0NA 2RB5A 1V3QE 5EP3A 5F7JA 2FV8A 2D0PB 4D4GA 4MRPA 3K6SB 2YZKA 1NPDA 1FUUA 2J59A 1UZAA 2VQ6A 3QE0A 3QIAA 1EFUA 2J48A 1DV1A 3I5UA 3BGVA 4DA8A 5IXJA 1A5TA 3F1KA 4W9NA 1V3TA 2H29A 2ZI5A 5IW8A 2K7FA 2ZLBA 1FP2A 5IUJC 1SZPA 2HF9A 2ZQYA 4GL2A 1G6KA 1PK8A 1ZN9A 2P6UA 2PXHA 4FB4A 1O03A 1PR6A 4XARA 1KO8A 1O0SA 3RS9A 2J6CA 3N07A 1AOXA 3LPDA 2HLDD 2HWKA 3IAM1 3HXMA 4YPVA 2QHXA 4X3CA 1OLUB 3E9YA 3QA3E 1U2PA 2V5AA 3D0QA 5FBVB 1U11A 4J4HA 1EESA 2EZ4A 1EVIA 4LRTB 4OHXA 1SD5A 1BE0A 3E1SA 3LWDA 3COWA 1SOWA 1CVIA 221PA 4MVJI 4AJ9A 2JDID 1J21A 1FDSA 2YJ6A 2AEEA 2Y66A 4NEHB 1IUOA 1QCYA 3HJUA 1AKVA 5DLDA 4RVSA 3ZXIA 4DCGA 1P4AA 1HETA 4OBBA 4CEIB 1S2NA 1K88A 1SVIA 1P4RA 1TFUA 5MFPA 3GT3A 1B4DA 2DPXA 4KXQA 5AHRA 3Q2OA 1E3DA 2VPXA 4FK8A 4TQGA 4WGFA 3V8MA 3OQOA 2P0EA 2G9NA 2LCIA 2I29A 3P9RA 1ZITA 4U0KA 4BFVA 4BLOA 2IYAA 3ZGNA 4Z7NB 4R2JA 1H1TA 3MBKA 1TA4A 1RJFA 1DUSA 2OAP1 1CQIA 4BXOB 1E9DA 3FHJA 4BKUA 4ENUA 5K0ZA 4G5GA 3PUVA 3GVCA 4JU8A 3G7SA 3QE3A 2GBLC 4GX5A 4NH4A 2OSBA 5E4TA 1TVKB 2HEIA 3I2GA 2IEZA 2F9LA 3DYBA 3DZBA 4W7IA 5A3VA 2GKSA 2NUBA 3SFVA 3T3HA 3VZCA 1ZJWA 1QSGA 3O03A 4AP9A 2F8SA 1UPAA 2HTFA 1BWPA 5AQ1A 1M6NA 4GU5A 2JGRA 3VPGA 1WXQA 4RPJA 1I1QB 1HQKA 2J5XA 2XRZA 4MYDA 1EUQA 3QTBA 3VZRA 4A2PA 3LHKA 1GQOA 4EHAA 2ZBVA 4RD4A 5IKXA 2CV2A 4DG5A 3ZV7A 4DF3A 2IOQA 5DXFA 3N8NA 5ELMA 1IQRA 1W75A 3REQA 3NI2A 4IUYA 1UUFA 3D6FA 3GGJA 3CUWA 2A88A 1CJKC 2ODWA 2OCXA 4Z7OB 2A92A 3TS1A 1OLXA 4D1YA 3K4QA 1PZFA 5E3IA 3M9WA 2LD4A 1UOQA 1U8FO 3QW2A 4UMDA 3WNQA 4KACA 1GA6A 4A1OA 4K9NA 3BILA 4EKGA 3Q9SA 2I1WA 4MR8B 1KBQA 4OLBA 3H99A 1EJBA 4PQGA 3M34A 4OUDA 3LUPA 1PGPA 2VHUA 3KDAA 3O1HB 5TDHA 1ENZA 2WD7A 2IITA 5ESXA 4CM3A 3AKCA 3G9QA 5DSZA 1PZ4A 3SFZA 1DOAA 1NIPA 1RDFA 4YV0A 1IE3A 3RTGA 1KEEB 2XRYA 4DLSA 3QNUA 3N8KA 2XYGA 5AJTA 4TMVA 3WDSA 2C4VA 2O8FB 2A0KA 3RIMA 1XDWA 2FPIA 3A05A 2I6TA 3DMHA 2FW1A 2PL3A 3ESQA 3CJTA 5K1ZA 3U4GA 1D04A 1L7MA 1XD2A 5GVSA 5KQLA 4MI9A 4LJ4A 1RAAA 1PSWA 2D2IA 2AKYA 1SU7A 1BQ4A 1J00A 2QK4A 2V58A 4E13A 1F7VA 3HMQA 5K8VA 5CDSA 3OJ0A 16PKA 1VBFA 3LZ6A 4MEJA 2CLHB 3IQEA 2HWXA 5A4JA 1FFDA 4M9CA 3WYAA 3PGA1 2FVXA 4EL5A 2X3FA 1DBVO 2L17A 4EF4A 2PAFA 4MKIA 4FYPA 3UHFA 1LVHA 4RK4A 2GD0A 2NO9A 4FFSA 13PKA 1WMAA 1JQ5A 2WU8A 4L27A 1U7XA 4QHSA 4Q4JA 4AS2A 1E77A 3DHEA 4CMIB 5FEUA 4ZTUB 5JWHA 4KV7A 5HMMA 3VDRA 2G88A 3E7WA 3AUTA 3TEFA 5LYJB 3EX7C 1USUA 1E3MA 1NBHA 2AB0A 2M32A 3KJNA 1PVOA 5EI5A 5JXGA 3NR2A 4ZOBA 2JFUA 4IMIB 3H86A 4OBEA 3DOFA 4OI2A 5FYQA 4MWCA 3R7NA 3RF6A 4DJJA 2J3IA 4EVQA 4RJTA 2CDCA 4IL5A 4LQLA 2IF0A 4R6XA 3KOZA 2UYHA 1A9YA 4M0PA 5KU7A 2FVYA 2P6NA 4RXUA 3AXTA 4N49A 3ROTA 3RE1A 2E4YA 3EHDA 4K6GA 1QZXA 1EHIA 2WG1A 3G68A 4GT1A 4WOCA 1J8YF 3KD3A 1CY8A 4U6QA 3SX4A 1N7IA 3VZSA 4CT4B 4EW6A 2H5EA 2RGBA 3CX6A 4E46A 5JNVA 1JQDA 1CIJA 4IINA 1NW3A 1R6VA 1BGWA 2PFKA 3H0EA 4HWRA 3KPWA 4MB6A 4CT0A 4ZTZB 3PCRB 4MA0A 3MUEA 2BEVB 2ODEA 2ZIEA 4KTVE 5CJ2A 5EP1A 3NFYA 4IIGA 4RPLA 4WXYB 4UATA 2A9RA 3RC7A 4LWPA 1YJCA 2CD7A 4K6FA 5GOZA 4TL9A 1CY1A 2CL5A 2Z4SA 5TMDA 1QIKA 4G97A 4C0XA 4X1YB 2WSLA 5C8YA 5U4XA 3CR7A 3THYA 3I2FA 4BZPA 1R6DA 3HCNA 4NFHA 4LWQA 3L7DA 1O95A 5JW6A 1UJMA 1UQTA 2QM8A 3Q88A 4HFJA 4UEQA 4UNIA 3E8XA 3FYUB 2GDZA 2Z2KA 1F38A 1J2UA 2Q3HA 1PO7A 2A1TR 2Q5CA 1HDEA 1QO7A 1NQ5A 1A9TA 5JRZA 1YB1A 5KWJA 2O8DB 1L4LA 1QUFA 1OKKD 1DKNA 4C78A 1D0VA 1MP0A 2FNAA 1SUFA 4KXXA 3Q6NA 2J3HA 4Z86A 2QOEA 3KOXA 1JSRA 3MWYW 2HCTA 2Z6VA 1CY2A 4MYRA 5KVCA 2ORED 5CVTA 3RYFA 1R6XA 1XA3A 4B6OA 3FOEC 1K9SA 1PG0A 3QSGA 1M2KA 4N3GA 1KVSA 3K6JA 4UM5A 5JPDA 3INTA 1OZ0A 1VQ1A 1OV4A 4BMZA 3EARA 3ZV4A 3K09A 4HGOA 4MMXB 2Q7DA 3VVBA 3S7ZA 1X7WA 4CVNA 3HJRA 2ZJ8A 3DVSX 2DUWA 4DM3A 5EQJB 1KI1A 3TEJA 3JTEA 4MIEA 2LCQA 2IEDA 2XKJE 4EW3A 2AR0A 4EG4A 4ESEA 2QPAA 1HL7A 4JB0A 3PNPA 4RMJA 5LDDC 1G8YA 1JSCA 1Z35A 4MRVA 2I8LA 4MRMA 3EEOA 5AI4A 3KKZA 1OH5A 2ECPA 3IJPA 4YJHB 4RK6A 2XTNA 3QFSA 3K71B 1V47A 2QKYA 2XYQA 1D4FA 2RKOA 1RQXA 2JI7A 1JXQA 2I4TA 2XT0A 3KTDA 3S1AB 2GXQA 3AY6A 1Z6XA 1PFUA 3CNHA 2I4MA 4LV5B 2PKWA 2Z0MA 4WQMA 1VHWA 3U3DA 1A8HA 4L73A 1CZNA 5G2OA 4ZYLA 3NX4A 4ND5A 4BYGA 2GDJA 3NCTA 1T34A 5J40A 2WWVD 1V1JA 1U0BB 5CT6A 1Z68A 3MIZA 3VU1A 5KVAA 1WV1A 4JHLA 5I7UA 1ISSA 1OFHA 1H9AA 3MJDA 1NMSA 3OKAA 4IVRA 4O2LA 1JU3A 4ZAFA 5BVGB 5C37A 3KEOA 1W9MA 2A7QA 2C3PA 4RL6A 5CLQA 4RWEA 3R5TA 4INJA 7ABPA 4W5HA 5HKKA 3WRWA 4K9OA 4OXYA 4MO2A 3S28A 4RS3A 1EVEA 2OHVA 3KKEA 2ZROA 3TPFA 3EXG1 1T0PA 1O7JA 1DQNA 4K3UA 1YBVA 4D3XA 3GMTA 3SN6A 1JA1A 5CXXA 5EMJA 3R9XB 2C5LA 2LP4Y 2DP4E 1SHLA 2CLMB 4DV4B 2IPXA 3LVBA 3P9QA 1SZCA 1U2SA 2D00A 4XIYA 1F9AA 4QGHA 3UT6A 4YALA 3BJEA 2IUEA 3KQSA 2G83A 4HWPA 1DC8A 3C41J 2EGGA 3LY7A 4U6NA 2H1IA 1ZRSA 1RQGA 3NEPX 4D97A 1BDJA 1N1EA 3B5JA 4FUQA 3FKJA 4JXZA 3EWAA 2NU7B 5HRUA 2IU3A 3PPXA 3O9VA 3FCCA 2RHDA 3RANA 4AJIA 3TG2A 4MW5A 3VPCA 5L3SB 1V9SA 2QN7A 3IP5A 3LT2A 1FJGB 4RH0A 4PS1A 3TGLA 3KSUA 2VH1A 1NP7A 1FP4A 2P41A 5IH3A 4R2HA 2ZYIA 2GD1O 3C98A 3EXG2 3B6IA 1NGSA 1EEHA 3PX2A 3BK1A 4WY2A 4NS4A 1SULA 3TJMA 1T9KA 4M1OA 3DV2A 1ZCZA 2Y8EA 2OESA 1O97C 4GVPA 4X85A 1YD7A 2OXTA 5IT5A 4Y6PA 2LV8A 2HC9A 3C6XA 3LGSA 5LQAA 3QKUA 4FZJA 4KKVA 4MQLA 2BWJA 1EP1B 3CR8A 4FFRA 3L0OA 3WXMA 1AV7A 4GR5A 2VDPB 1PG5A 1XZPA 4GRAA 3ETNA 4QUJA 3VZPA 2H2IA 3EEIA 4AJPA 2H08A 2JATA 4C14A 1VP9A 1KP2A 1GVHA 1Z06A 3SKXA 5C8YF 3TRHA 1MHPA 3MJFA 4I4CA 2C7VA 5DNYB 3A1CA 5FTKA 2RGYA 2D3WA 1L8XA 2IVZA 3SXUB 1E6WA 3EXFA 2C8VA 4J0KA 4BQIA 3TKLA 2X3UA 1ZNWA 1GGMA 2IODA 3FNFA 3K09C 3J7AC 1WXFA 4GKJB 4UPDA 1U80A 3TAHA 4BVEA 1G7TA 2FYTA 3BCUA 3GNQA 4A8JB 4N5LA 2FLKA 4JQCA 1NRXA 1T3SA 1AA6A 2VDQB 4YB8A 5BV2P 6REQB 2DTEA 4IJKA 3PXXA 1IEXA 1ESEA 1JKFA 1MD9A 1VXRA 2FR8C 3GPCA 4MS4A 1JHRA 1R6TA 4QTXA 1R27A 2WIGA 3I9JA 5HF6A 3H1EA 2AS0A 2F1RA 4O2AF 2OA0A 3E81A 1UBNA 3ZVMA 3R4CA 5BNWA 2RJ3A 4P80A 2GFHA 3RC9A 2ATXA 3H9UA 3UQZA 4BECA 1SGWA 1JAZA 2QRNA 4ZMBA 2VIIA 3OPYB 4BRZA 4PHTA 1J2RA 3M5PA 4HB2A 4Z1MA 2ZI4A 2FK8A 3EGIA 3ZDQA 1M6VA 2I7TA 3DM9B 4XI9A 5B1EA 3QXSA 3MD9A 2L2QA 3E0QA 3PJEA 5K6AC 2FQWA 2W8ZA 2OR3A 2CJFA 2HFJA 4KO2S 3EBPA 1XJ5A 1TYZA 4JOQA 3AF1A 4BLWA 1W49A 2IU6A 4QDJA 4ZVTA 1WCV1 2FMFA 3O8RA 2C7GA 5EUMA 1Z0DA 1ZGBA 1SXHA 4L4RA 4WD3A 2UUOA 1Q0HA 4GSKA 3NHUA 4PNPA 4X6LA 3NJ4A 4LEIA 1J9ZA 4KLRA 3WL5A 7GPBA 3QEAZ 2DXIA 2JASA 3JQBC 3TRDA 4CQJA 1JDJA 4ID9A 2KBFA 2PLRA 4JX9A 2EATA 2V4ZA 3E2MA 4WFJA 1M6WA 1CU1A 1TIKA 2YYAA 4QHTA 1LW6E 1OLXB 3TTWA 1U8AA 3W5JA 2XDQA 3F6PA 1QFZA 4NSSA 4V3BA 1OC2A 2DFDA 4N3CA 4ZAWA 1EDDA 3HUUA 2BEJA 1KDZA 1LQUA 2XNCA 5JNSA 4KLAA 4YUYA 1P0CA 2XXAA 1H69A 1L5ZA 1MOQA 1JU4A 6REQA 2AWOA 3EUWA 5FO1A 1QDLB 1SC4A 2RHHA 3AESA 3BMQB 2VRCD 4QU5A 4ZQGA 4YP1A 1BHO1 3FCSB 1I7PA 1CDEA 4JN6B 3BHMA 1JIIA 5BWOA 1ZICA 3FPJA 1VM6A 1UEIA 3D1LA 1RQNA 3DTYA 1SHZA 3NIGB 3NATA 3E9CA 4GNRA 4E22A 2X9VA 3ZJTA 3UMRA 2IEBA 3BD6A 2PL9A 3EFBA 3I12A 2VDVE 4TWIA 4D9EA 4DG9A 4QARA 1SC9A 1U2GA 1DC5A 2IYYA 3H9JA 4QHYA 4FT2A 3UB4A 4K0RA 1OV6A 1XAJA 4NNPA 1PDWA 2F6RA 5GV8A 3DH0A 3IHKA 3WX0A 3IR6A 2JJYA 4KNYA 2Z4TA 2NOAA 3AL3A 4Q12A 1BG6A 1IBLB 1X1QA 4G89A 3WR5A 3OJLA 4H6WA 3UJ6A 2UXDB 3RR2A 8GPBA 1Z3IX 3COSA 1GPUA 1W8IA 2BMFA 3EVGA 3JRNA 5JJBA 2FOLA 2ZAOA 3K0HA 4G01B 3N0VA 5EL0A 3VUEA 2BVNA 3DZGA 4BYMA 5ISMA 4HDMA 5BW6B 4YRLA 3A1EA 3COZA 3MTAA 3O2QB 4Y1GA 2FRXA 1K0FA 2M9MA 5F52A 3TLZA 4HMOA 3TR0A 4M1ZA 1QE3A 1TKBA 4C88A 4OSPA 4Y2QA 1KK2A 1R0ZA 2FSGA 4CR7A 4CTNA 5IJ9A 4YX9A 5SYMA 1DXQA 2GM4A 4IUDS 3O8QA 1TKRA 3NIBA 4PINA 3ZEAA 2VDUE 1NXXA 5FBZA 3RYIB 2QAGB 3T41A 4Y2RA 4MHTA 4F6RA 1SEPA 2P9GA 5DBIA 1UJNA 4ZFNA 3KEQA 3T3IA 1ANKA 3GY0A 2QXTA 1MJGM 4XUGB 4UBJA 3X0DA 2ID4A 1CYDA 1YIOA 4D9MA 3DFKA 1YHYA 4JXJA 3W6UA 1Z38A 5KJ6A 2C9YA 3F5DA 4BAGA 1IHOA 3MOSA 4C22A 3RSHA 4DR6B 3GR6A 4RZ2A 2TECE 1K8YB 1DC3A 4D8YA 1V5EA 2ZIFA 3F98A 1BMFD 2ZRQA 3FVTA 3LYLA 3QF7A 3WIUA 3WLIA 3OCVA 3ICPA 2AHRA 1P19A 3BICA 2H5IA 3BXOA 5K3EA 3AY7A 4E11A 2A84A 4KQHA 4D46A 3TB4A 2BGIA 5ALWA 2D4AA 3K6SA 4BNTA 3BL8A 4BNJA 3QVJA 1C7JA 5ECWA 1UBOS 2VPIA 4UCWA 4UHBA 1Z6PA 3A0RB 3NBAA 2C1ZA 1KGSA 1DDIA 1RLJA 3QPWA 5DTQA 1UP7A 2CZCA 1R10A 3FZQA 3GXBA 5DW3A 3L8DA 2GN2A 1PT5A 4MWBA 3HBJA 3JZFA 2XMBA 3STHA 4QBKA 1EUDA 4XCVA 3ABOB 4RESA 2QZZA 1W0JA 1LD3A 1KSGA 2C4WA 2QJTA 2CB0A 4BCBA 4GF5A 4FE4A 3W4IA 2ZTVA 3WGJA 3Q5EA 2B4AA 4E3ZA 4JOSA 3UGTA 3WLPA 3A4TA 2ZRLA 1ACJA 1UF9A 5CJPA 1U2RA 3SR3A 1HEIA 3BWBA 1F0PA 3VGPA 2I9PA 5JARA 2FSUA 1CR0A 4O1IA 4J1TA 3RROA 1FMFA 3B78A 1GWNA 1JR4A 3ROXA 3IDFA 3TSYA 3ZGVA 5IT4A 1Y1PA 1XZGA 4BV2A 3OA0A 2QRQA 3NLLA 4YRCA 5BSEA 2OFWA 4CIDA 4FNOA 4A6EA 2VAXA 2AG1A 1CNMA 4LWZA 1WFRA 1Z0FA 1MO4A 2HMTA 3RNOA 5DWDA 3QMVA 1VCHA 2I7CA 2X6RA 3T7KA 3TO5A 4ZQIA 3ORSA 1GTL1 2R86A 2D7CA 1MN6A 1SCQA 4N0MA 5HG0A 2IZZA 3R5JA 1KYQA 4YRKA 1K7SN 2JI6A 4OB8A 1QLHA 4DJTA 5A9TA 4YAKA 1RYYA 4BRUA 4QA9A 4E09A 5DNCA 2DFLA 2YRWA 2BLLA 2GRJA 3M6VA 3X3HA 3DG9A 4C7XA 2RIPA 2R5NA 2IPNA 3CINA 3OPQA 3D5TA 1VA4A 4RUKA 4FIDA 3KVVA 2PAAA 2RI0A 1RXCA 1ZJ4A 3FFWA 4IFIA 1GPH1 4P4SB 2FPWA 3Q3EA 4US0R 3DO5A 3FNBA 4O0LA 3BD8A 3EIWA 1RKQA 2IX3A 1TRHA 4GQBA 3D3WB 5FWYB 5F2EA 4PZDA 1YOVB 2X0EA 5MHTA 1QB8A 2ODTX 4TYWA 4E70A 5B3JA 2BC9A 2X40A 4WLOA 3A9UA 2G17A 3LQQA 3K0EA 3USCS 3KZCA 3AYXB 3EFHA 3PWKA 2VXCA 4G5SA 4AJ2A 4C6SA 3OEWA 2AXPA 3IC5A 3OOHA 4UFNA 3UZUA 2MSDB 4BEJA 3ZE7A 1JI0A 2I80A 2IUFA 2CYAA 2ZRFA 4AVYA 1T1IA 3IQHX 3K72B 1G42A 2QSUA 3WIDA 3TNYA 4RK0A 1CETA 1NW6A 2XLCA 4KWEA 4S1VA 3ZBQA 2BONA 2O8FA 4QTZA 1KGDA 3HJCA 3KZOA 3VPXA 4AQ7A 2DH6A 2RD2A 1NP3A 4FDTA 2EFEB 1A50B 1LBQA 4K81B 3RBXA 5KOHB 2NTEA 4AYTA 1P72A 4H6VA 5CJJA 1GM5A 2Z5FA 3CSUA 2GRUA 2PGIA 4NMHA 5EUBA 1IXSB 3NTXA 1P9OA 1BVYF 5KTMA 1H3EA 3TXAA 1CRWG 4MV6A 1PNQA 1BMFA 3ZLUA 3H6KA 4UUQA 1S2IA 3CE6A 5LA6B 3Q41A 3WFJA 1BVRA 4GWKA 1JFFB 4Q6WA 3QFCA 4ZQFA 4QGBA 2Y4NA 2I22A 2OCIA 3DXZA 5J43A 1U1EA 4DR2B 4ZEOA 3WMXA 4DBVO 2WHPB 3GQBA 1F8GA 4J0JA 4EOGA 4X9XA 3FPGA 1MO6A 2UVPA 2HSEA 2JGNA 3UJCA 4UM7A 5JNLA 2FJ0A 4CMEA 4QREA 6YASA 5HX7A 3TD2A 1EAYA 3PD0A 4F56A 3KWJA 2NADA 2V7PA 3PQ6A 4GI7A 5ADVA 5J4LA 4CIYA 2B30A 5K0GA 2ZBEA 3MZ0A 1QP8A 4MWOA 3WRYC 1KEUA 1OZAA 5GQSA 4BRWA 4GPZA 1WDLA 4KYIB 2OL4A 3QEMA 3WO1A 1LLQA 4BNMA 4DNOA 4FN5A 4KQ6A 4ZHQA 2RC6A 4KO8A 4MY0A 2XW6A 1O2DA 1T25A 4PY2A 1L5NA 1CBUA 1W5TA 5AI5A 1E89A 4RVNA 3WL4A 1C4KA 2QB5A 4C4OA 1BDIA 4ARIA 2QR5A 3EJ6A 3TRIA 2R8YA 3RYFB 3O84A 5CFRA 2QDKA 2BFEA 4K86A 2ECKA 1P73A 2WOJA 1KZHA 4HDKA 4O59O 1VLHA 2Q3MA 1C4WA 2R8EA 3OSZA 3QUSA 5FO0A 1TAQA 4DR7B 3L8EA 5AW5A 4AUEA 3P32A 3OU7A 1K0UA 4RMHA 1G20A 4I19A 2WFMA 4ZVUA 3EVFA 2ZT5A 4RJLA 2QVYX 4ND8B 3SIWA 2QD1A 2FXIA 2EKDA 4LXIA 1I2ZA 1XTBA 2PKQO 3EMBA 4MRAA 4OUDB 5J3JA 2J5QA 4I3HA 3O83A 3X1MA 3BREA 5F5XA 1VZ3A 5HVNA 1R00A 2VK8A 3ORYA 5ENDA 3ZHRA 5I8WA 2IV7A 1I30A 3OZRA 4KIFA 1Q0PA 3GEPA 2HLHA 1SUIA 4NJEA 5HF8A 3WMGA 3KWMA 4UTZA 1VKRA 2GN4A 2IY7A 3VR2D 2HXSA 3O3MB 4CN8A 1J5EB 4PHCA 3IIJA 4P93A 4DLTA 2BGJA 2G70A 3VC7A 4NCJA 1S7GA 1XZQA 2QV0A 2RHCA 2X8JA 1NFQA 5AJLA 3GJXC 1SC1A 1C8BA 1PT6A 1C3XA 1YGPA 2QYOA 5FUMA 3LIPA 3DCIA 2I2DA 3V4SA 1NVWQ 3DO6A 5AKJA 2ZR8A 3LA6A 3QLJA 2H3HA 3A3NA 3LXMA 1UBTS 4TXHA 4AXHA 4RELA 1E9SA 4CG1A 1E2BA 4LJAA 4JENA 4OKSA 5CA1B 2IELA 1SCBA 4OQFA 1CE8B 2NU9B 5JPIA 2X4DA 3M89A 3QI7A 1Z37A 3S2SA 4CGZA 4B2PA 1QIDA 1LCIA 4MVJP 1W2HA 3GLHA 3SBOA 2VJDA 2PMDA 3E18A 2CK3D 1W5AA 2DHRA 4MPDA 1LV7A 1NBMD 1YJXA 3FLAA 1PTJC 3PX7A 4F85A 2AZMA 1K92A 2JARA 2W93A 1JBEA 3LF2A 3LHSA 4J75A 4WKNA 5EHIA 4LYYA 3DBHA 3PRJA 1I9CA 1Q15A 4WFKA 4G0ZA 1VLLA 3F3SA 3T7EA 4V0SA 4YAEA 5H3HA 2C00A 5CFQA 5LZ2A 2HDWA 3A6KA 4HCJA 3X1XA 3LUCA 1O0CA 3VNAA 1QGUA 3FGOA 1XNJA 3HUFA 3BDIA 3CKKA 2BUBA 2I2XB 1XI2A 1KRXA 1HOXA 2ADOA 3GI1A 3G0BA 3NONA 4YRMA 1MV5A 1M7BA 1Q21A 2Z6AA 4AI6A 2NP6A 5DEIA 2PEZA 1QQBA 3MAAC 3BYZA 5IX8A 3W8DA 5CVCA 2DYKA 2NGRA 3AERB 2JAHA 3EVEA 3LL7A 3ENZA 4IFEA 2GEBA 4MW4A 5KYYB 3ZY3A 2QP3A 2VP2A 5FUWA 5JLJA 5KNCD 1NNEA 5EPEA 3PUIA 4AU1A 1VGRA 1U2ZA 5EXTA 1PGJA 4CUJA 2I6GA 3IKVA 3LX5A 3V2IA 1TUIA 1UFOA 5IFLA 1PLKA 3DFMA 2PT6A 2EKQA 2UYYA 3WHKA 4R1OA 3Q72A 4GKBA 5FA6A 3U0VA 1EM8A 4RHCA 1L1EA 3GN1A 2MYUA 4J7CA 4DILA 5K09A 4HOYA 5IH7A 4GKVA 2AFIE 3V55A 5F1YA 5H80A 3T5MA 4HUQB 4AX8A 3OA2A 1QMGA 1B0UA 4B2LA 4E2XA 5IXYA 4KLNA 2NUAA 4WNIA 4ZU6X 4WOKA 3FNEA 4XVUA 3IOEA 5K05A 3U44B 4ZODA 2DUMA 1EFTA 2PKXA 4FNMA 5D7BA 1DWUA 2FE1A 2XVZA 1Y9EA 3DLIA 3IR7A 4M8SA 1D8TA 1N4DA 3HRHA 4RPCA 4KR6A 2GAAA 5JH7F 1GYPA 1NKVA 2NZUG 1KPIA 5K45A 2Q5JA 5E6UA 1PV4A 4RIHA 1M2VA 1UXIA 3ONEA 2BH9A 1C3JA 3OE7A 3BCHA 3S7TA 4DYVA 1MA0A 4ND1A 2AXQA 2RH9B 3NHSA 2W2KB 3REOA 2QAIA 4OBXA 4QJIA 3WO0A 4YUVA 1Q3TA 1PWEA 1XC7A 4XPIA 1Y8RB 4MW7A 1XTPA 1A97A 4L0CA 4FZVA 4DKXA 1EE9A 1LSJA 1GA1A 3EEYA 3NNNA 2OYRA 5ITVA 2JLYA 2HW8A 1P45A 4DLNA 3G2IA 3MNFA 4I55B 2WYIA 2NVUA 4DVGA 2ZM6B 2PJUA 4AN1A 2G5CA 1XDDA 4U00A 2WMOB 1NURA 1WB9A 1OGYA 3H11A 3FDXA 3H8SA 1LNZA 4LJ7A 4OQNA 2MT9A 4ZO4A 2BUAA 4OFZA 3W2FA 1PAUA 1TCUA 1U65A 3PI7A 5A5EA 1P8JA 5F12A 5FBHA 2HIMA 4LS3A 1UKZA 2FG6C 1KAQA 3OM1A 3GVHA 2B0CA 3E4CA 3C8UA 1JJIA 4P31A 4QULA 3BXHA 4CKCB 4YAGA 2WSSD 1C0KA 1FJ2A 4EA8A 3ZE6A 4EQ6A 3A4YA 5JMOA 3AH8A 4UZSA 3C4QA 4Q18A 5CH3A 2QT9A 4H17A 2PX4A 1VOTA 4URWR 1G5IA 4D96A 2GARA 4N47A 3BMNA 2GZ2A 1WZ2A 1KDOA 3KOYA 1YZHA 2PWBA 2W5UA 4OKNA 3TIVA 3TQHA 4HQKA 4PR0A 4RDCA 1SQ0A 5C5EA 1O4WA 1JTVA 1BEUB 2JGJA 4AWAA 2XT9A 1XL1A 5HP4A 3Q8MA 2JCBA 2FMKA 1QHYA 2P9TA 3FMVA 3N2KA 4LOJA 4UEOA 2ZUEA 4N5NA 4O4JF 2WHRA 2HOQA 1B2RA 1XVTA 2CBGA 1KBZA 1IDOA 1SXJB 4ZAGA 1AMUA 1FFYA 1F3OA 4TTJA 5CYOA 4A5SA 5C32A 3PUWA 2HPZA 2RMKA 4PRLA 4UTNA 3Q7RA 1FTWA 4RC9A 4WMLA 4TLAA 3SZUA 3EA4A 2BGGA 2HJVA 3HR8A 4X1IB 3QX9A 4LYGA 4BBJA 3GWGA 4IDEA 4EJMA 1UMCA 1IG0A 2C3YA 5ICGA 4EGFA 2FEWB 4IDHA 5B1DA 3FMGA 1Z0JA 2AJDA 1S8AA 2CF6A 3AUKA 3N7ZA 4TTAA 4Z0NA 4EK9A 2DE0X 3FSGD 4TYMA 1X8JA 5EEGA 3HJNA 2BTQB 3HXLA 3QU4A 3GGSA 1A9RA 5C1PA 1E6EA 3ONDA 5AVKA 2JG3A 3IHLA 3SHVA 1RAHA 4BNDA 3W5UA 4IP0A 5CM8B 4YK7A 2XLBA 3VQTA 4H3VA 2D62A 4A7PA 5KDDA 1UXKA 3G0GA 2VPQA 5BSFA 1Y7TA 2ONZA 4GW3A 2A0FA 5FNVB 3GUCA 3RARA 2PZKA 4CFZA 2Z8XA 1GQFA 4CLOB 1Z4IA 2ZCUA 2Z09A 2CEKA 3JQ8A 4NWIA 1QR6A 4TMFA 1T6NA 5C7LO 4GMFA 4ZI7F 4NQRA 4H9GA 4MSUA 1I3LA 3TX2A 2WA1A 2ZG6A 1QHSA 5CDYA 1E3IA 1JYEA 5EE1A 3L01A 2HCBA 1SC6A 1OA0A 3EDOA 1NDHA 4TKMA 1XROA 1JQEA 4TVKA 4ROTA 4EGCB 3SQOA 3K4HA 5I7OA 2G63A 5KSZA 3U7RA 2GZ3A 3I72A 4D8WA 2QPTA 1H6AA 3UEOA 3J7TA 4WZBE 2DU8A 1WZCA 3L7YA 2JL1A 5HJEA 2OD7A 1AXGA 5EE3A 5DSXA 2DUUA 3CZPA 3H4IA 4UEWA 4DV3B 1N9GB 2EJUA 3NWBA 3KFXA 4IDAA 4XYLA 4JQZA 1CUYA 1XMVA 3RAJA 2VRBA 4JSRA 4DDUA 1V96A 4PPGA 1UZMA 2V03A 5CP8A 2HA5A 1E2IA 3GJ5A 1XSEA 4KDEA 1Q1BA 1JDNA 1TW2A 2RCNA 4OXXA 1MOZA 2CXNA 2ISSD 3ABZA 4DIOA 1P1HA 4ZO8A 1TMYA 3QPVA 3KJXA 5F78A 3MWDB 3NT2A 4PSKA 1RM3A 3WRYA 2PX2A 3FCOA 4KRFA 5JHHB 4Y2HA 3RO7A 3D5QA 1GSIA 3L0IB 2JEYA 1R88A 521PA 4D6PA 3SIPA 2FW0A 2X58A 3HEMA 4MROA 3ZWOA 2V65A 3C43A 1MCZA 4ARSA 1ISIA 4LKOA 1R4MB 2Q6KA 4CKWA 1M34A 3H83A 3CVYA 1H9CA 4EQ6B 1J4AA 3F9IA 4IYRA 1GQQA 1HDYA 2MYPA 1W0JD 3BRWD 2IC5A 5IDQA 3OHPA 2BTEA 2WSSA 1NE7A 3ZU4A 3WY9A 5IFKA 1O9HA 3TW6A 1KXJA 2UYOA 3H5WA 1YBHA 3Q1KA 3WE7A 5F98A 1NVDA 2R8XA 1L9XA 3GAZA 1GUBA 1WY7A 2J9RA 1BU5A 2W2KA 3MQ2A 2QVBA 4CTMA 4PC3A 5A05A 3WGZA 1E61A 3C3MA 2BR4A 5AKHA 4EDHA 2A1UB 2IXBA 2HHHB 5EMMA 3OSUA 2DH5A 2BDUA 1NC3A 1CD5A 1QKJA 2HU5A 3BH6A 3CTPA 3EIFA 2HGZA 4O29A 1RC0A 1XJ0A 5EXSA 1QH9A 4H2DA 4UPEA 2GK6A 1KERA 2NXNA 4WSOA 4EG6A 2QRVB 1VIAA 4R01A 4MH0R 4RNDB 3UAYA 1WM1A 5BOVA 4EKNB 1J8QA 3DWFA 3PSHA 1S4QA 1LI4A 4M36A 1G16A 1V5GA 4PYJA 5LNK6 3IUYA 5M7EA 1JJAA 2ZP1A 3G1WA 4L5JA 4PTLA 4M8LA 4Z2YA 3DONA 4Y0AA 1MJNA 2FP3A 2Q5IA 1YJQA 2EBUA 2QM7A 3KQTA 3MILA 2GYVA 1LLFA 3W1VA 1NAIA 3OZSA 4C04A 2NM0A 2AJBA 5J4KA 1L4EA 4WAUA 1NBEA 2Q21A 3SDSA 1IAVA 1KF0A 2G5TA 3BSWA 3PA8A 4GVLA 1N8TA 3SX0A 4IIYA 1TO6A 1DB3A 1HQYE 1P8AA 1PQ4A 3OMXA 1RW4A 4RE6A 2ODAA 1N1DA 3NIWA 2BE9A 1JWLA 4F4HA 3LZDA 4GDMA 4LKRA 3H42B 3INNA 4C0SA 1U1GA 3D6TB 2HAEA 4UMFA 4E03A 4ZMRA 2EV9A 5JCZA 1QIGA 5EXEA 3HY4A 4FEYA 1DEKA 3G8BA 2YFYA 5C1BA 3DD5A 5TARA 2ZUUA 3HDYA 1P4SA 2VJPA 4OAPA 3A6DA 5GGYA 5EZ6B 5KX5B 3DVAB 1ZOPA 3IESA 1X6VA 3B60A 4QO7A 4DR3B 3EPPA 3MTDA 2P4UA 3ZDBA 3DLBA 3AKZA 2I4OA 3NXKA 1QRDA 4QYXA 3HADA 3AZPA 4EF5A 5JS8A 2B6HA 4U8GA 1R3UA 2RDMA 2Z8ZA 3AMVA 1TT5B 3LF1A 4U2GA 1IOLA 1FPMA 1BW9B 3AUSA 3NGMA 5HQ3B 2D0OB 1R9NA 2B25A 4QT4A 3NS7A 4HWOA 1X74A 4HKTA 4OQLA 4PE5B 1PWZA 4Q0MA 5LZ4A 1S02A 2BHRA 2I2AA 4YMLA 2OFFA 4RIEA 1FFBA 2FZWA 3CX7A 1WTAA 4BUZA 4OMCA 1N9KA 4C6TB 4DIDA 3RIYA 5FAKA 2XUZA 4MVYA 5C0OE 1PDVA 3OLYA 4LUCA 1GRCA 1OR8A 3U39A 4YCMA 4IXMA 5ALTA 5FUXA 1JW9B 3V5NA 3IEIA 2PNJA 1BCRB 3DULA 3SF8A 4JUFA 4OA5A 3E9EA 4WPGA 2ADMA 1XZBA 2QRJA 2I6QA 4U9UA 3P9XA 4IDOA 3R5FA 3WB2A 1IM2A 2YWDA 3NJRA 4IWYA 1JEJA 2R87A 5JSKA 2WKRA 3G2LA 2FDCA 4F5YA 3IP1A 1YTUA 1ZU4A 1F2TA 4ARAA 1E7QA 1RVV1 1I51A 4MUKA 5I4KA 4KR3A 1WPQA 4EBBA 5F2OA 1GXSA 4M1TA 1QH1A 4EG7A 1P29A 3FI0A 2E85A 2DFPA 1P81A 2KS6A 2TMYA 2ZI3A 4YH1A 3KTAA 4JMLA 3T06B 1E6CA 1GPYA 3KHSA 1CJUC 1U3WA 5BR8B 4YT8A 3BHIA 1PL6A 2AF4C 2IRWA 4QJ4A 1O9BA 5DX0A 2JGDA 4YLEA 1VMDA 4PX2A 1L5LA 4B2IA 5LIRA 4YUXA 4DCMA 1U2GC 1SK9A 3I32A 4BWGA 5DWQA 5HRCA 1B1AA 2DQSA 2W2TA 3FPBA 2GN8A 3QBJA 4W1RA 4JT2A 3BSSA 2ZSKA 1CUDA 3I6IA 4JFAA 1ZU5A 5ALKA 4BTLA 4HS4A 3MWEA 3ZXUB 1TYAE 1OVMA 2R7KA 3K0BA 5FQNA 4X45A 2Q7OE 1H5NA 2ZWMA 4AJ1A 2QTZA 1LQTA 4AD8A 1U3UA 3FKSA 4TYNA 4YV2A 1GDHA 4IIJA 1N0VC 3MINA 1IN7A 2OV3A 1FX0A 4NL4H 5KOIA 4TMYA 1U8ZA 2ERCA 1HFJA 2JD2A 3IP9A 2O3RA 5KTOA 3SU8A 3T5DA 1S9DA 4A8TA 3FWPA 5JAUA 4QTTB 3KSDO 1VBMA 4WY8A 5B1HA 2EJVA 5G1PA 5JSQA 4GE0A 1BXGB 2Y1WA 3D81A 5FV7A 4EG0A 2ZKLA 4OXNA 1T13A 2EIHA 2XX3A 3X2SA 2B83A 2BP7B 5EWMA 2ZZNA 1NQUA 1TAHA 4UHHA 1NXWA 4D6YA 3DHNA 4FLFA 3TLJA 3P2YA 2GASA 2OVBA 2POCA 3VPSA 4GD3Q 3R7WA 5FTLA 2PGNA 2WICA 4MCJA 1NNUA 1WF6A 4DEVA 1JUDA 1DHTA 1RI2A 5BRAA 3FHCB 5BQOA 2G5GX 2HNKA 5AVUA 5K6TA 3NAMA 5CDGA 4YRDA 4B74A 4M1MA 2B92A 4PU0A 3C3KA 5JROA 2RGAA 1KVRA 2GR9A 5D5PA 1QRAA 4AS1A 1R9JA 2QV7A 4KFTA 5H68A 4ER6A 2GJ9A 1EP2B 3RQSA 4RK1A 3HYRA 3IOMA 3M82A 2ZAIA 4RAOA 2PH1A 3EXIB 4XQ9A 1KMNA 5FADA 4Q4CA 1OH8A 4KDCA 3GEDA 4KQEA 5BT9A 4A6PA 1YA4A 4UKDA 4JDUA 4QUGA 3VXKA 1H1LA 2GVZC 2OXIA 4NAHA 4KITB 3TDMA 3VNVA 1A5AB 4RF4A 3VU0A 3PHLA 5DRYA 1SBNE 4RPHA 1NHWA 3IVGA 4WY5A 2WILA 2XE4A 4BC1A 5I51A 3SEZA 3ZHUA 1KRWA 2IHJA 4WNAB 1KDYA 5B1SA 1XD8A 3I39X 3RYCB 3TQIA 3ICCA 2UZ1A 2Z1NA 3KUCA 3LYUA 1T0UA 2GMWA 3HYTA 2FSFA 3A2KA 1ZA1A 2HGSA 2W00A 2JAXA 3HJGA 1Z15A 2DWUA 1QBKC 2VG8A 2ZW9A 4OFWA 4OLAA 2QTBA 4FHFA 2BBSA 4MO9A 2ZE8A 1T3LA 3G5AA 5BSUA 1VPLA 2Q8QA 3NDIA 2BELA 2CG3A 1K3UB 3JQGA 2IFTA 1JMKC 3OU6A 4I4IA 1JFTA 1GCIA 3IEXA 2IBTA 5DM0A 3TW0A 3W6PA 4FS3A 1QYIA 3BCSA 3QI2A 3JD0A 4M0CA 2ZXFA 1RRFA 1X13A 3AVPA 4S0XA 1L6RA 1IWOA 1VE7A 1VPVA 5SICE 3BQ9A 3S8MA 3SS8A 1XIVA 3ZWKA 3K9LA 4FONA 4HDSB 4R3WA 4E5YA 4F5WA 4M88A 1K89A 3JD4A 3ZD9A 4EHIA 1CJVC 5BN1A 3DAGA 3A1WA 5DYNA 5TSDA 3WNBA 3QU5A 1IM5A 3CF6R 3COPA 3RF7A 1I7DA 2VSXA 4FX5A 1EXMA 1M6HA 3HP4A 1R5NA 3BS4A 3WL8A 4ND7A 3HFRA 4OFXA 5EHXA 2JBAB 1GTSA 1CYEA 1BX1A 2WQZA 4AUKA 4RTJA 3AOGA 3UKOA 4I9HA 3W8NA 2CXSA 1OXUA 3KVNA 1IY2A 5FOTA 4BN4A 4Z9AA 4I1PA 1MBZA 5JBNA 2F7SA 2OZPA 1ZM3A 4PIMA 3K70D 2VPPA 1WVIA 3AI7A 4LFAB 2NSFA 4YRSA 1WXDA 3DV9A 4NG4A 4MVJF 2Y92A 3TZEA 1KDPA 1QZUA 1DAPA 2O2CA 4IOJA 1LFAA 2QLTA 4ENSA 1CDOA 4C0AC 1XA4A 3ENKA 1AB6A 3M6MD 3P52A 2P5UA 3TMAA 3ZNPA 2DSTA 3FKSD 3WWZA 2JFZA 5HKAA 1I4LD 1ONPA 5JE8A 1YH3A 4IO1A 1YK1A 2GXSA 3ESRA 5E1DA 5B3JC 3LHIA 3EZ7A 5KX5F 3OIUA 4CEJA 1G64A 4GSLA 2X22A 1B2LA 3VU9B 3COJA 1L8OA 5IG2A 1FSFA 2WIKA 1QGZA 1S2OA 2XOXA 2VWGA 4KMOA 2COUA 3AHJA 4GP9A 3GB9A 4QUEA 2ZIXB 4NOJA 3T12A 1A1SA 4FPXA 1R6BX 1II9A 1D0IA 5H3CA 5IVPA 3IGFA 4TRNA 1PWXA 2HJGA 1R0RE 2ZUVA 1J0CA 2OO5C 3ETGA 2L42A 3T1NA 2HO4A 3GH3A 5HSGA 3CJQA 1WZUA 3T4UA 1IQ0A 2XDWA 3NXSA 3VC3A 4JK3A 3V4LA 2W8BA 4Y6RA 3C39A 3R6WA 4NBNA 4MQMA 3E5MA 3HKBA 1KFCB 5CAEB 2XWBF 4BMOB 3DBLA 4F5EA 2RHGB 2BEWA 1WHSB 2B7BA 4R1TA 4XCQA 4GLJA 1QG6A 2AMLA 4WJLA 3MJEA 3OF3A 1J2EA 5CK4A 3UKJA 4LFBB 3BIXA 3SF8B 1AMOA 2HUPA 1LDYA 1R6UA 2P1DA 4MR9A 3WBFA 3E84A 1V8ZA 1UODA 4NDNE 4WFQA 4YEDA 5A62A 1SQFA 3IXMA 1P18A 2XQJA 4GI2A 4L51A 2HU2A 4ME6A 4MQ5A 5JCJD 2FLWA 1YQEA 4DCPA 2AN1A 2O0KA 3GU3A 1S6YA 3K5PA 4HNGA 4QDOA 3LBFA 3S2UA 1DIOB 1XLTC 3L1JA 4LHEA 1X9IA 5AICA 2AFHA 1J39A 5KC8A 3DZ8A 1KMIY 3IT1A 3KV3O 1EFPB 2FPMA 4Z9YA 3RVJA 4F6RB 3I3OA 5IYZB 2YXDA 2WYVA 5E8RA 3L8CA 5HGJA 2HRQA 1KMQA 3T99A 3L0BA 2O07A 4QXRA 1Q20A 3PTLA 2IGBA 4UVIA 5KCMA 1KTVA 3FRJA 5TMPA 3F8SA 1DIGA 3RCBA 1R0BA 4CMBA 1DX9A 1PEKE 4XWAA 5JC8A 3ZS8A 1PJCA 4F86A 2AFIB 4TUYB 2IZ1A 4G4GA 3KQMA 5DGDA 2ZDHA 3HQ4O 1ZA2A 1L4HA 3RRYA 1XU9A 4R68A 4H59A 2BM9A 5FPQA 2OKGA 1PR1A 1T4MA 1DBIA 3I34X 3L07A 2CL0X 3QKSA 2HQSA 1NI3A 4I7EA 1SCKA 4X6XA 4EF6A 4BZQA 4HNVA 3ABSB 5CA0F 4GC9A 5KYGA 2VOJA 3HV0A 1X14A 1RXYA 1C2TA 1Y33E 2YVLA 2ZRDA 1IIRA 3P20A 4QBHA 4M9UA 5GMOA 3RUCA 4F04A 5FH9A 1YNSA 1ESCA 3FLBA 4FJ2A 4UHJA 1YZGA 4AN4A 4CM1A 1O0BA 4LSZA 5THKA 1A8QA 3NWJA 4PLPA 2W0MA 2V0GA 4YMSA 2OWDA 3RU9A 2PGLA 3OCUA 4QGFA 5TGZA 2HFKA 5SYAA 3TIGA 1FYDA 1CVRA 4KK4A 5EERA 3PXCX 3PYMA 4BKQA 2XXJA 3P9PA 5BWMA 1E8NA 4BO4A 2I7XA 3AR8A 5BQXA 3DEKA 3LQ4A 2JIMA 3LT5A 3N74A 2BFFA 1WULS 2G7ZA 1LPBB 2IW3A 3D8RA 3IBSA 3Q40A 1C9MA 4K05A 1TVCA 1VFNA 1AN9A 5CG2A 2H8KA 2OCAA 4K88A 4XB6B 1D9XA 1TGYA 3ZW8A 3DMRA 2GPYA 2XMPA 4U2CA 2A67A 4I50B 5IV0A 2G4LA 4IUBS 5JASA 5E6RA 3ZNNA 1T4CA 2QL6A 5A4MS 4JI8B 3MGAA 2QT0A 1ADBA 1B00A 4B8YA 1YDMA 2Q1YA 4MICA 3WBBA 2FETA 2D7DA 2Q6LA 3GDFA 3PNVA 1D2AA 2VDJA 1AE1A 1EJ6A 2OHIA 1QVZA 3LH5A 3N3BC 4WZ6A 5AI9A 5A6SB 2UUBB 1E3JA 4IG4A 1CP3A 5JADA 1US8A 1YHZA 4J0QA 5CM2Z 4Y3UA 2PYZA 3SJCA 1H3FA 2I3BA 2A86A 2Q8NA 4R0NA 4ZPJA 4B83A 5JSUA 4R41A 2FRVA 1K7FB 4GL4A 2D1QA 4YBZA 4CV3A 3I45A 1J07A 4YLGA 2OPHA 2G06A 3S0JA 2FPPA 3PQ2A 4LOHA 5AKIA 5J63A 5CEEA 4MDEA 1AXEA 2C04A 2WU3A 2X13A 2XF8A 1NUHA 4I1YA 4R0VA 1IVYA 1ECCA 4E4TA 2CE7A 4DCNA 4XD2A 4HQOA 1L4FA 3DEZA 1HORA 1DI0A 4GZLA 3VR4A 2XA2A 4EYQA 4JU9A 4QTYA 4ZCRA 2OBNA 3B9QA 4M7OA 5C5DA 3K9BA 1EE2A 2Y1EA 4NNOA 5KWIA 3BRWA 2CUZA 2FN8A 5EMNA 1GPKA 1PJ3A 2FMXA 3A4MA 4KVGA 3IAS1 2FZGA 3KNZA 3KFVA 3AW9A 3NGLA 4MB2A 4MKRA 1X8LA 1G4UR 4BLUA 3GHYA 1XA0A 3QFTA 5JOQA 3GBVA 1RWVA 3T94A 2EERA 5HFNA 5KVQA 1IWBB 1NMQA 2OKCA 1ZI6A 4N18A 2W4MA 3W0LB 3HNOA 3WYBA 1TKAA 3EGXA 3DMDA 3QLVC 4HAUA 1R0KA 4B5KA 3EYAA 2ZRGA 4N0EA 1BOOA 1AKQA 1ZJJA 4L76A 4HFNA 4N7RA 1N5IA 1WSDA 4RA6B 2PBZA 5C35A 4L8GA 5DKFA 1YB2A 3HM2A 1Z13A 3FETA 4GPBA 4CKBB 4CMKA 1T8UA 5HXAA 5IVHA 4ARCA 1X2EA 3GPIA 1QTQA 3R23A 4GPIB 1FTSA 2DHDA 1VG8A 3TUJC 5DGCA 2CYCA 3KYCA 1Y3IA 2Q29A 3H1GA 4CDGA 3ASZA 3SX2A 3VMMA 3HU2A 1LF0A 1WZIA 2C57A 2EJTA 3CHYA 4Y98A 2ODBA 2OCDA 1TQ4A 4MVJM 2EKPA 1T6BY 4MS4B 3JQBA 5BMVA 3I6BA 2ILTA 4WDRA 4PXAA 5IC6A 5AW9A 2PK3A 2GK3A 2SNIE 2PH3A 4MI3A 1SBCA 1N6HA 3D02A 1D03A 3GQVA 1MZPA 2NN3C 3PKJA 5C4MA 1OPXA 3QKIA 5KYXB 4JGGA 1ZD5A 4X44A 1XMPA 5JT1A 4F3KA 3K1AA 2APJA 1CEEA 4DV5B 1C2YA 3DBOB 4UD2A 1FU8A 4E5NA 2P0AA 3KQKA 1ND5A 3O8DA 4O4HA 1ABEA 1C30A 3E7PA 3ROKA 1DNPA 5FUBA 2ZU0C 1K4MA 3TRJA 1PX0A 3LC2O 3K9QO 4YHHB 3B13B 2W4QA 4Y9SA 3H5RA 2MR5A 2BKUA 4F7DA 1JR6A 4XVCA 2ZKIA 3DGEC 5L95A 1N32B 1UK9A 1Q1AA 1T2UA 2GESA 3DD1A 4P38A 1HC7A 2JCGA 3RUFA 2GBFA 4CIAA 5AK5A 2PMWB 1Q0RA 2HR1A 3L8YA 1M2EA 1C3LA 4ZO6A 2Q50A 3EDCA 4F7WA 3SYRA 2FWAA 2UDPA 2JLAA 2VJKA 3B3JA 1EB9A 4PG5A 3RYHB 5A1TA 1P62B 5CK5A 2AKEA 3ADOA 1V1RA 3WSVA 5JTUA 2HJWA 2OBMA 2RB4A 1D2EA 4FYKA 4CL2A 2N3ZA 5LN1A 4AP6A 1UAYA 4JC0A 1M3SA 1WMEA 5K3FB 3BFVA 1WSAA 2GXUA 1XZCA 4FCTA 1QYRA 1U31A 2HIGA 2P5YA 2I54A 1IK4A 2W98A 3L49A 2Q07A 3S1LA 3S5UA 1ZR2A 2H3EA 4DLRA 4K6CA 1L7QA 3TLAA 2CWWA 5H9WA 1GILA 4F8JA 2BM1A 1TJNA 2NZYA 3MLEA 4N0QA 1I3CA 2J5KA 2SICE 2VQDA 4G8DA 3JQ9C 4CIWA 1QIMA 1Z73A 4PG4A 4JQSA 1KHTA 2WVJA 1NJGA 3EA0A 2CKMA 3U7EB 2C9OA 5KNLA 1OYYA 4IIXA 2AUMA 4HWSA 2NO1A 3ITDA 4I6JA 4XEUA 1U2TA 3ZU3A 4E7OA 2FHSA 3SS7X 4WNYA 1V2GA 3NETA 1I32A 1QHNA 4INAA 1AKMA 3BERA 3DT8A 1P9NA 3B3GA 3ZY6A 1RPNA 2AEMA 4EKEA 4I1UA