3SSOA

Myce methyltransferase from the mycinamycin biosynthetic pathway in complex with mg and sah, crystal form 2
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
393
structure length
393
Chain Sequence
EFDEATVQDVVRLAGGHDSELRELTQKYDPAMISRLLVAEILSRCPPPSNDTPVLVELAIVHGSERFRHFLRVVRDSPIRPVGADEGFVGMLVEYELTELLRELFGVTHERPAGVRGTKLFPYLTDDEEAVEQIGTYLLAAQQGTEAVLAGCGSRKPDLSELSSRYFTPKFGFLHWFTPHYDRHFRDYRNQQVRVLEIGVGGYKHPEWGGGSLRMWKSFFPRGQIYGLDIMDKSHVDELRIRTIQGDQNDAEFLDRIARRYGPFDIVIDDGSHINAHVRTSFAALFPHVRPGGLYVIEDMWTAYWPGFGGQADPQECSGTSLGLLKSLIDAIQHQELPSDPNRSPGYVDRNIVGLHVYHNVAFVEKGRNDEGGIPTWIPRDFESLVQASSGGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
pubmed doi rcsb
source organism Micromonospora griseorubida
molecule tags Transferase
molecule keywords Methyltransferase
total genus 131
structure length 393
sequence length 393
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.238: Mycinamicin VI 2''-O-methyltransferase.
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17843 MycE_N MycE methyltransferase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.30 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A Nonspecific Lipid-transfer Protein; Chain A 3ssoA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ssoA02
5FUBA 3KQSA 2FPOA 1SUSA 2VS1A 3GCZA 4PCLA 5DX0A 5FWDA 7MHTA 1WG8A 3KR2A 3TR6A 4HTFB 1R00A 2PVCA 2ZWAA 3G8BA 3UJ6A 4C04A 3B5IA 4HTFA 3TPZA 3TOSA 5EVJA 3P97A 4GOLD 5HILA 2QYOA 4RX1A 3M6XA 5CVVA 4RSRA 2OZVA 1P39A 5E9WA 3FYCA 3AWIA 5KQRA 2CWWA 3CCFA 5LQKA 2ESRA 4KW7A 5KQSA 2P3QA 2EJTA 5DRTA 1R8YA 1AQJA 3FPFA 5F2KA 2G70A 2NXEA 3EVCA 2NNWB 3FZGA 1JG4A 1V39A 1I1NA 4ISCA 1FP2A 4IV0A 4C07A 2AOXA 3GXOA 3EEOA 4M37A 4WVLA 2G72A 4RVHA 2P8JA 2AZTA 5E1BA 2HWKA 3KQOA 4JXJA 4KDRA 2ONYA 1X1AA 2ZLBA 3CJTA 3UFBA 3H2BA 4DMGA 1KYWA 4E2YA 5KS2A 1NBIA 5LQAA 4FS8A 3MTEA 3NVKI 2O0LA 5EKXA 2C7PA 3CBGA 5ICGA 2AOTB 4RVDA 3HVIA 5EIWA 2B78A 2HMYB 3OZSA 4CKBA 1XJ5A 2AR0A 3FTCA 4CWAA 3VC1A 4PIPA 3UJCA 4GC9A 4A6DA 3SM3A 3O7WA 1XVAA 4FSXA 1XDSA 4KRGA 2GLUA 1H1DA 4RVFA 3TRKA 1KP9A 3DLIA 3SXJA 2JH9A 5HZMA 5E1MA 2CL5A 1KXZA 2PX4A 4PYKA 4PYNA 5LSAA 2OPBA 3DMGA 4PGHA 5FADA 4GQBA 3IEIA 3ME5A 3BT7A 1JQDA 2ZIFA 1KHHA 4ZTBA 3G8AA 3UJ8A 5BXYA 2JH8A 3DXYA 3ERCA 2Y1WA 2AOUA 3A4TA 3GRVA 4KVZA 2B25A 4GC5A 4AZVA 3BGVA 4HGYA 2XYVA 4IV8A 2ADMA 4PWYA 2PX8A 3HCCA 1M0EA 1VL5A 1JTFA 4YV1A 3IYLW 2ONZA 5H02A 4YV2A 1EG2A 1EJ6A 2NXNA 1NBHA 1NT2A 3BWCA 2B3TA 3G89A 3HA3A 3KKZA 3UJBA 5K0GA 1BOOA 4X61A 2OYRA 3UA3A 2GAFA 2PJDA 5GINE 1VP9A 2IBSA 2NP7A 10MHA 3P9NA 2XVMA 4GBED 1EQAA 3MCZA 5K01A 3KR0A 1G8AA 1HMYA 1R74A 1G60A 1INLA 2IGTA 3OZTA 4KIFA 5DM2A 5ICCA 4BP3A 5JUWA 3OE5A 5EIFA 5FA8A 4IKPA 4OX9Y 1DCTA 2AOWA 1OR8A 4FZVA 1FJXA 2GS9A 4G56A 2BR4A 2PT9A 2ZSUA 3B3FA 2EJUA 3GGDA 5GM2A 4QQKA 2Y1XA 3O4FA 1TPYA 5BW4A 3NDJA 5DT2A 4Z2YA 5DTMA 5CCXA 2JHPA 5FCDA 5CD1A 5ERGB 3FUXA 4UOEA 5GOZA 3DLCA 2DPMA 4DA4A 3MCTA 4OA5A 3NDIA 5C1IA 2R6ZA 2I7CA 1JG1A 4QQNA 4FR0A 5DM1A 4RV9A 5HIKA 1JSXA 3DP7A 1M6YA 2CKDA 3C3YA 1JQEA 5K09A 2Q41A 2YUIA 3LBFA 3EPPA 5DWQA 5EZQA 1X19A 2DULA 2PY6A 3FPEA 3P9CA 3TQSA 1JSZA 3D2LA 4WXHA 4CXMA 2QY6A 4E2ZA 2QM3A 1L1EA 4CTJA 1I4WA 3KQVA 3NW9A 2BM9A 3FPJA 4DKJA 2G71A 2PBFA 2OKCA 2Z6QA 3Q87B 1O54A 5DX1A 3KPWA 3EVZA 1X1DA 3FTDA 3PX2A 5F2NA 1O9HA 5FULA 3ELDA 4POOA 1SQFA 3FRIA 4E32A 4AUKA 4NECA 5EEGA 3MERA 4EKGA 2IH4A 3EGIA 2ZBRA 3B3GA 3LCVB 3NWBA 3K0BA 3ORHA 5EMJA 3SVZA 2I6GA 1L9KA 3NWEA 3C3PA 3I9FA 1UIRA 2O05A 4C08A 1AF7A 3KPVA 4PIMA 4F85A 3HTXA 4RTNA 4ER7A 3P2KA 4ER3A 5K0EA 2AN5A 3LX6A 3T0IA 3A27A 2EX4A 2KW5A 3BKWA 1D2HA 2E5WA 2ZIEA 3ELUA 3C6MA 1QAOA 3UBTA 1X1CA 5GM1A 3L8DA 4MTLA 2YXLA 4P7KA 1ZHFA 4HSGA 3UJDA 2NXJA 5GIPE 1IXKA 4LWPA 4CKCA 2YXEA 4H0NA 2K4MA 4KDCA 2OY0A 3THSA 1KPIA 3EGEA 3EMDA 3PFHA 3R3HA 4PONA 5IKMA 2ZWVA 2PGXA 4OBWA 1NW3A 3GDHA 5EMMA 5GWXA 4YUWA 4PYMA 1D2GA 3UJAA 2P35A 2I62A 1L3CA 2O57A 4X60A 5EMLA 5DM4A 1BHJA 3DOUA 3LHDA 1NV8A 2NP6A 2ZFUA 3FUTA 4R6XA 2XVAA 2WK1A 3BGDA 1XDZA 2G1PA 2IBTA 5IH3A 3BGIA 2V7EA 4XUEA 2H1RA 2JHCA 2UZ4A 3KU1A 3BWBA 3T7SA 3MGGA 3LGAA 4MQ4A 2VDWA 1KR5A 1VQ1A 1SG9A 3SSMA 4PYQA 1MHTA 3MAGA 3SMQA 3MQ2A 1F3LA 1G55A 3JWJA 2YQZA 2GB4A 4GEKA 4HRAA 3BXOA 1BKYA 2FHPA 4RTOA 2P41A 2PT6A 5FTWA 2I9KA 2PXXA 3REOA 5K0NA 4E33A 1RI5A 4GUAA 4X63A 1XDUA 4YUYA 2PSSA 1P1CA 5T64A 2FRXA 2GPYA 5EKUA 3RIEA 4ATNA 2H11A 5ICFA 5CUQA 1AV6A 1QZZA 5EHGA 4AX8A 3B89A 3EEYA 3CKKA 4E2WA 2JJQA 4QVKA 3BKXA 1R6AA 5U4XA 1XTPA 3T7RA 1XCJA 4O29A 3PTAA 1WXWA 2ZW9A 4PYOA 3OZRA 4EVIA 3CC8A 2P40A 4Y30A 5DRYA 5CVJA 2AOVA 1ZGJA 5T67A 2FK8A 3KQMA 3DTNA 1RJEA 3G2QA 3EVBA 3G2MA 3EVDA 5D1HA 5E1DA 5HIJA 4OQDA 4PNEA 1KIAA 1NW7A 2AOTA 2PLWA 4HC4A 3KQPA 1UFKA 1XCLA 3G5TA 4PCAA 1RI2A 4CTKA 4EQZA 3LPMA 3VSEA 4CKEA 2BZGA 5DSTA 2GA9A 3BZBA 3I64A 5B1SA 2P3OA 4FSDA 3HEMA 4RTJA 3CVOA 2C7QA 3LDGA 1BC5A 2G8NA 3G88A 2AN4A 3HNRA 1R8XA 3M6VA 1VBFA 3I58A 1SVUA 4R6WA 1KPGA 1SKMA 2AS0A 3THRA 5K0BA 3MB5A 3T7TA 5LQUA 5EGSA 3FYDA 3HVJA 1YFLA 3TKYA 5DTRA 3TM5A 4RTQA 3AXTA 4C4AA 2GH1A 5GIOE 4PINA 3VC2A 3CGGA 4AZTA 1QAQA 1VE3A 3M4XA 4RYLA 5EPEA 1KYZA 3DMHA 2YX1A 4QVGA 4DCGA 4QDJA 4M7RA 4QDKA 2PX5A 3Q7EA 5CVUA 3FUVA 5DM0A 3B7PA 3ER8A 4R05A 3PX3A 3DXXA 1NE2A 4RTPA 3LDUA 4C06A 5FWAA 3VYWA 5K03A 2ORED 5G02A 3FUUA 1P91A 1DUSA 1RJDA 3M6WA 5DX8A 4A6EA 2C7OA 2FYTA 1EAMA 3BUSA 3P2EA 4FT2A 5DLYA 5EOVA 4E30A 5K0JA 4P7JA 4E31A 3SR4A 3C6KA 2ZBPA 1VLMA 3ELYA 3OFJA 4YUXA 5LQRA 5CM2Z 1I9GA 2BM8A 2YVLA 1FBNA 4GOMD 5DSXA 1YZHA 4GF5A 5LQNA 3LECA 1JG2A 5P8WA 4QTUB 3V97A 3EVAA 3QOXA 4E70A 3MHTA 2O06A 1VPTA 4RVGA 5E9JA 3P8ZA 4BLVA 4MIKA 2IH5A 2ZZNA 5EHIA 2F8LA 5CVEA 5K0LA 4YMHA 2Z6UA 4RTLA 1B42A 1PRYA 5LQCA 4LWOA 2JG3A 2P3LA 2HNKA 1O9GA 2AN3A 3GRYA 2O07A 2OBFA 4R8RA 5EQJB 1WXXA 2HTEA 5F2OA 5HIIA 3HVHA 2V74B 3TKAA 8MHTA 5JR3A 3HA7A 3UWPA 3R9XB 2OXTA 3R6TA 4DM3A 3KQTA 3P9KA 4QTTB 3S68A 2P7HA 3JWHA 4RTRA 3A25A 3F4KA 3NVMB 3JWGA 2JHAA 4L7VA 4RWZA 3E23A 2UYHA 3TMAA 3PS9A 1WZNA 4GOND 4V0QA 2BR3A 2VZ9A 5LQJA 3FPHA 4DCMA 4R8SA 1D2CA 3OU2A 1RI4A 1YB2A 4BY9E 1Q0TA 3PB3A 4XCXA 3TFWA 4ER5A 3HCDA 1YFJA 1P1BA 2AVNA 2YTZA 2PWYA 5C9ZA 3HA5A 3V8VA 2PXCA 4FGZA 2ZTHA 4V0RA 5E8JA 2IDKA 1YF3A 2R3SA 3BWYA 3GNLA 1EJ0A 4ER0A 4RTSA 4OQEA 5E8RA 2IH2A 3G7UA 3FTFA 5HFJA 4C03A 1X1BA 2BR5A 3DXZA 2CMHA 3KQWA 4KWCA 2AVDA 1DL5A 2IIPA 3E7PA 3A7DA 3RODA 3OPNA 3DUWA 5FHQA 3U81A 4X41A 1PJZA 2VDUE 1YZ3A 2LD4A 3LDFA 5EMKA 4DQ0A 4YUZA 3BWMA 3LKDA 3ELWA 5E9QA 3B3JA 3MTIA 5DXAA 3PVCA 2UYCA 3P71T 1Q0SA 3G5LA 3HM2A 5FQOA 3FUWA 3KPYA 3OU7A 1RJFA 3HVKA 1G8SA 3GWZA 4PGGA 1QANA 4OA8A 1FP1D 1F38A 2ZULA 3GU3A 5BW5A 2YR0A 5K05A 4F86A 5ICEA 2ZBQA 1ZGAA 1R18A 3KQYA 1VIDA 5K0FA 3KHKA 4P7GA 3OU6A 1JR4A 3SSOA 1KPHA 5CVDA 5BP7A 3DR5A 3HCFA 3SGLA 1Z3CA 2XYQA 1JTEA 3UJ7A 2OB1A 3UJ9A 2B9EA 3WSTA 4QPNA 2PXAA 2UYQA 3EVEA 1U2ZA 2ZCJA 3LBYA 2PWPA 2QRVA 3LCCA 3E8SA 4RTMA 3KPUA 4YUVA 2QRVB 1IY9A 3NMUF 5EC8A 5DTQA 4HH4A 1MJFA 1NKVA 3RW9A 5E2AA 3P9IA 3GJYA 4KIGA 4LECA 5C0OE 5KYGA 1JQ3A 1ORHA 2EFJA 3LKZA 3I53A 3JWIA 2UYOA 3C0KA 4BLWA 1ORIA 2IDJA 3HCEA 2IP2A 4M36A 5EG5A 2FCAA 1YUBA 3A26A 3UA4A 1TW3A 2PV0A 1M6EX 4F84A 2Z6AA 1EIZA 2BH2A 5T6BA 1L3IA 1RI1A 3X0DA 1ZG3A 2NYUA 3GIWA 4HG2A 3QV2A 1XXLA 3FPGA 3CJRA 4E2XA 1Y8CA 5M5BA 3M33A 3E05A 3I5UA 1N7IA 5FQNA 1L3BA 5D1NA 4BP1A 4DF3A 3FRHA 5K8VA 3SX0A 2P1DA 4PYJA 2ERCA 4EMSA 3GRUA 3ANXA 2EG5A 1N2XA 5CCBA 3EMBA 2P7IA 5HEKA 4C05A 3HCAA 3SSNA 3AY0A 4ER6A 4MHTA 4U7PB 5DXJA 5KVAA 3GRZA 5DPMA 3LL7A 2N47A 3K6RA 1ZKDA 3GRRA 4QPPA 2ZZMA 5HIMA 3KR1A 3PFGA 4PYLA 4RTKA 3CJQA 1G6Q1 2ZZKA 5LR6A 3UZUA 3PLAE 3ER9A 2VP3A 2YXDA 3P2IA 5E1OA 4B17A 2H00A 2PX2A 4XUCA 4EK9A 2VDVE 1T43A 1NV9A 4DZRA 3OE4A 1SUIA 4FP9A 3HCBA 1NW5A 5E2BA 3R24A 3IHTA 1RI3A 2ZIGA 2A14A 4Y2HA 2OB2A 3OCJA 4YMGA 2C7RA 1SQGA 4AZWA 4FT4A 2OO3A 3GO4A 3R0QA 4BLUA 3DH0A 3IV6A 4AZSA 1G38A 2ZVJA 3TM4A 5HOQA 5EEHA 1QYRA 5K0CA 3LSTA 1RJGA 2PKWA 3TLJA 2XYRA 1UWVA 2NXCA 1VP3A 3HP7A 3M70A 2HR1A 3FTEA 2HV9A 1IM8A 1FPQA 3PT9A 9MHTA 4U7TB 1NW6A 3KPJA 4P58A 3M6UA 2FK7A 3A7EA 1QAMA 4LG1A 4YV0A 3EGVA 1AQIA 5FA5A 4HGZA 1JG3A 3KR9A 4K6MA 2WA1A 4P7FA 1WY7A 4PYIA 2IPXA 3G2OA 3AXSA 3DULA 3EVFA 3KQQA 3EVGA 1HNNA 3G2PA 3ID6C 1ZQ9A 4GOOD 3O31A 5GP1A 1N7JA 2XBMA 3LCUA 2AOUB 3NJRA 4IWNA 4OBXA 3AJDA 3OFKA 4XUDA 1NW8A 2B2CA 4EKIA 5MHTA 2CMGA 4X1OA 3NTVA 5EZSA 2IFTA 1TW2A 3QOWA 2QE6A 1WS6A 2WA2A 5CIYA 3DMFA 4M38A 5FHRA 4MWZA
chains in the Genus database with same CATH superfamily
2NZ2A 3GCZA 1XJQA 4KI7A 1AN0A 3KR2A 4QGBA 3KWJA 1R00A 4V0NA 4F3NA 4CF7A 1B8OA 1ENZA 1LPPA 1OXKB 1Z6AA 3OLQA 4PTYA 1ULAA 3KQNA 2BKLA 1SUFA 3V46A 4TTQA 3W7VA 4AP9A 3NWPA 5DM60 3LY9A 3KE8A 1DX6A 1EX7A 2C4UA 5KOIA 3TTSA 4RZSA 3PFWO 1QWOA 2NSDA 1PGOA 1SKYB 2OFPA 1E3MA 1A2QA 5DV9A 3CCFA 3I4CA 4J0KA 1DEXA 5JLAA 4E13A 1M1XB 5TQ2B 3U0VA 1IN1A 5CCEA 4LJRA 3K1ZA 2Q46A 3BJIC 2ILTA 3HUEA 3L6BA 1YQGA 2RKWA 3PRHA 2X4LA 2NNWB 3K9GA 3S29A 2X0IA 4ISCA 1TT7A 4QEDA 2DWQA 1IOVA 1MAAA 3GR6A 1ZVVA 2HA7A 2WPDA 2AOXA 3W4KA 1H6CA 4RIFA 1WVGA 2XQFA 1VM6A 1OB2A 3D7MA 2G8LA 1GNQA 1O9BA 5C7LO 1K0UA 4LYHA 4U39A 4UBMA 4EG5A 5AHRA 1ZX1A 5TQ2A 4MUJA 4B75A 4QM7A 1VMEA 1UT6A 1P4AA 2VYVA 3WLOA 1WOMA 3LL4A 5I48A 2R0QC 5K3SA 5LQAA 3R5HA 3IE0A 1MMFB 2R9VA 3PA8A 4YIKA 3NOOA 1Z7YA 3HVIA 1GKLA 4AYTA 2RC6A 1CZKA 2AG1A 3FKQA 3NIGB 4G36A 3SICE 5CFNA 2H9YA 2ID8A 3J7TA 4CU2A 5IDXA 3V4PB 1U5CA 3CG0A 4HPWA 2PAFA 3OBIA 3WYDA 3LXRA 4RH3A 5AI5A 1J0AA 1KH1A 4ZT2A 3DSRA 3LPAA 2D0DA 1Q3TA 3Q40A 2JH9A 3ZDYB 5E1MA 2DYKA 2HAEA 1V8OA 3QPAA 3UMGA 5FADA 1RZRA 3UWSA 5KQMA 5KTKA 4XVCA 2CLLB 3BT7A 4DCPA 2JDIA 1DBRA 2QGNA 2E1PA 4MQFB 4B1FA 2K2WA 3PR2B 4M9XA 4Z3OA 2HBQA 2HSZA 2XYVA 2BHRA 4JLKA 4MVCA 4BQNA 1DDIA 3ADOA 5FBQB 3V6LA 1MAHA 1ZGHA 2ZYGA 1KDZA 2C2GA 3IRVA 1IYZA 2E3JA 2QX7A 2WF7A 4DCUA 4GXRA 1FQKA 1PL8A 1RAFA 3IS3A 2B5WA 5H16A 5K0GA 1C30B 3P94A 1FVFA 1ZDMA 4ZVSA 3IKTA 2XXAB 2A5JA 3DE1X 1ZRMA 4GKBA 5LCXA 3IBFA 3A4MA 1X39A 3DB2A 3GUCA 2WHRA 1Y1KE 3BZUA 4J4HA 4QEZA 7YASA 1Z4QA 4JJ7A 1T9GR 2AH5A 1FFWA 4LGVA 1GDHA 3C8MA 3LPDA 3V9PA 4DPMA 1AHNA 2CYCA 8ATCA 2GZHA 2M1ZA 2NADA 2Q4RA 4YCDA 1WA5A 1X7ZB 3OLZA 5BW4A 3RTAA 1N75A 1WY5A 2LUOA 1ISJA 3NEYA 4C5BA 2J9FA 3MUFA 5LJLA 4D96A 3K96A 3WWPA 2AN9A 3K15A 2X19A 1I5RA 1M1YE 1DDGA 2EKBA 1ZJ6A 3NBAA 4Y1FA 1N7HA 3C5EA 1JQLB 2CXXA 3RVOA 3MCTA 2R751 1V8ZA 2P0YA 2WABA 3B38A 3IIIA 3O6VA 4LDJA 1JG1A 2WPNA 5HXAA 1E9FA 5LKRA 2VHXA 3PPIA 1A5TA 1UKYA 4X20B 4B83A 3VPBA 1JQEA 3RTCA 1V41E 3WV4A 1KAEA 5GV8A 4JOCA 3SE0A 6CHYA 1QX3A 1UKAA 3L7KA 2NPIA 3OTQA 4PO9A 5DEOA 1EFKA 1M2KA 3BHNA 1AZSC 1UBHS 1B6TA 2YWJA 3D2LA 3HYRA 3P4XA 2ZI3A 4HR7A 2G3YA 3K1TA 4P32A 4UQOA 4BQRA 4LF5B 1NJ5A 1W19A 2ZIUB 2XB4A 3AFOA 2W43A 4DA7A 4L08A 3TG2A 2AR9A 2PMFA 3NUQA 1I30A 5JV5A 1RRKA 1X1DA 4KBYA 1UPBA 1O9HA 5FULA 3N8NA 4I8IA 4G37A 3FOZA 1AF4A 3L04A 4L74A 5KYKA 2GF0A 3C5CA 3K0BA 4BQEA 1CYDA 3IXQA 2IZ5A 3NWEA 1CVRA 3OEHA 2X4DA 5JYCA 1XEXA 3PV0A 4FONA 4WK4B 3ZCQA 1H6AA 2XTJA 2ZITA 4G97A 1G41A 3PENA 4FWIB 3HTXA 3GEBA 3ZDQA 1L7AA 2OM2A 3LOQA 2QJWA 3TVDA 1QCYA 1UJ5A 3BHJA 3RAJA 1E1CA 4DGQA 2JLZA 5GM1A 4C20A 5M34A 2BOVA 3VA7A 2C5GA 1Y6FA 4KQIA 5GIPE 3UPUA 1ZOIA 3MG9A 2VKTA 3ZV5A 1ZW6A 1ILEA 2PMEA 3DEZA 1F0YA 1YCDA 4XI9A 5F9HA 1P4RA 3D4PA 3IMFA 4PPYA 3KLOA 3PVSA 4GYJA 4JC8A 1KY2A 4ZQFA 5K4HA 4G5SA 1HE1C 3H2SA 3IDAA 4H27A 1FLNA 4M0KA 2PX0A 3TLGA 1CIVA 3FCXA 1MABA 3P1JA 1MFPA 2C0CA 2CGEA 1Q7RA 2FW0A 2MSLA 3CPSA 3FUTA 3ZTYA 1DTEA 1JEQB 1WMSA 4XUEA 1U5AA 1U1DA 1U2QA 1QG4A 1XELA 4EUKA 5IX8A 1FTYA 2XDAA 3WLTA 2NO1A 3EBOA 2EP8A 1ESDA 4DJAA 2ZRFA 2FMUA 4CL0A 3QEAZ 4CM6A 1V3TA 3FR7A 1X0VA 4ZU3A 1JZSA 1O97C 5BUCA 4WY2A 1QHNA 4X1IA 2ZYTX 3ZHBA 5I8ZA 5KNLA 3MQ2A 5KAMA 4Q9HA 4DC1A 1LRLA 5EINA 5FFFA 5LYJA 4OXIA 4L27A 2H0QA 1EFAA 4QJ4A 4WECA 3BXOA 1Z6GA 2PT6A 4JUIA 4PEVA 2XX3A 4J1QA 2Z2ZA 1H6BA 4R9VA 1G3RA 3DZHA 3VZQA 5AK4A 4J90A 5LUAA 2CNOA 1IOWA 6LDHA 1BEUB 1HV8A 3HDHA 4N18A 4K0KB 3EGCA 1OTHA 3OP4A 4H7FA 3JCZA 1KMNA 3CKKA 1XD9A 4PNZA 5A4AA 3JW8A 4LXHA 1JF8A 2ATXA 3WL4A 1Y4ZA 2IPNA 5ECGC 5IAAA 1TAGA 2YWBA 1WXWA 2BFPA 1YZQA 1GCGA 2W2LA 3ZWYA 4K2AA 2I0FA 4DUGA 4KGXA 5IANA 5SYMA 2VHZA 3HKEA 4RM3A 3UTCA 1QH8B 2KLHA 3DG9A 5HCNA 3VO2A 5GPBA 5KVQA 1J25A 3G0BA 3WK9A 3AL2A 4DXHA 1JP7A 3R6DA 1XCLA 1XMXA 1XC7A 2DR2A 4PZEA 2ZRPA 1A8UA 5DK4A 1L7QA 3T94A 3A1DA 1SHUX 4Z1OA 4OJYA 1T0HB 3MLBA 1VMAA 5IM5A 3HU5A 2C9BA 2C8KA 4IJQA 4L0DA 4JI7B 2JLBA 2Q2QA 5F1KA 3PPYA 3O4HA 4Y0VA 1U28A 2B8NA 5TMBA 9LDBA 1DTWB 4H7KA 3CZRA 4BU1A 1X9HA 4DR7B 2AC4A 1YFLA 4EQ6A 4U3JA 5AXCA 3N86A 1Q11A 3VHLB 2CMDA 4XAQA 5F51A 3ZZ1A 5DTRA 4DLRA 3VC3A 4RZ3A 3VOBA 1YJBA 1ZD9A 2YVAA 4Y2TA 3LKBA 3CZAA 1ODJA 4EYEA 1SR8A 3VC2A 5CLJA 3O03A 1BA3A 2JL1A 5EPEA 4LRUA 2ON6A 3DMHA 2TYSB 4QVGA 4CLOA 1MBZA 1Z6QA 1QP0A 1Q12A 1SCUB 2E49A 2JCBA 4IZ6A 3WKCA 1A2OA 1GRCA 1NE2A 1VFPA 4G9BA 3LDUA 3BDAA 1O89A 1QQAA 1H8HA 1KYIA 4D5GA 2EJCA 2F8MA 3TLCA 2Z0MA 1YB7A 1TK9A 2FE1A 3V1NA 4W5WA 1VA4A 3BE6A 2HUPA 3KEQA 3M6WA 3SC6A 1U63A 2XTAA 1XDBA 1U1IA 1UIMA 3V80A 2XRYA 3G0DA 3ELYA 3CZCA 2JGMA 4A26A 1IAQA 2JGNA 3EY9A 2ZSBA 2CZGA 4QATA 5KCMA 2RH8A 2WMYA 2BM1A 2ZT6A 4TLAA 1ZL2A 4X85A 5C4GB 4AJLA 3JYNA 3HVRA 5AKIA 3TDKA 4R41A 2IH5A 3IBTA 1PZMA 3DWFA 1U7DA 3MIZA 2F1IA 2F8LA 4MUIA 2V8BA 2RB5A 3KJZA 4TRRA 5BWOA 5J2TA 4H4EA 1PUJA 5BR7A 2Z8ZA 3ROZA 1KEKA 1SOWA 5AJWA 4DTCA 2V7GA 4EF6A 4GAEA 2JEOA 1ZEJA 2R4TA 3GLTA 4MY0A 4HNAB 4NENA 4EECA 4HY3A 1OIVA 1NM5C 2COEA 5TPZD 1NUPA 4LTMA 2O8NA 2FEMA 5AVVA 3GL9A 3ZWBA 4MTCA 1PGJA 3ESZA 3CF4A 3IHLA 3HUTA 4FU0A 4YS6A 4O4IA 3SQOA 1WSDA 4KX5A 1NQUA 1F0PA 4LSMA 3UK6A 2PKYX 1JR6A 4JX8A 1SUAA 5C7YA 2NO6A 3NOQA 1A71A 4V3CA 2QP9X 3NH9A 2Q4BA 4EFKA 1I0LA 2ZUUA 2Q4TA 1TZMA 2DHCA 2FN7A 2C57A 2J3LA 5K3FB 5M3BA 4UXIA 5E8JA 3LRPA 1NN3A 1D6SA 2P77A 3SS7X 1ZCAA 4ER0A 3CFYA 1QP8A 3IMEA 4GQAA 4MCJA 1MAWA 3PHLA 3IAUA 5EA2A 4D4GA 1SA0B 5AVTA 3TS1A 2QMHA 4R01A 2CL0X 3PNOA 1ZU5A 1GT6A 2KE5A 2W8BA 2ZS8A 4WNAA 4X6LA 1KU6A 3U9LA 4J1TC 721PA 4IDHA 1KA9H 4YBZA 1GA6A 2XUHA 1ML3A 5JNTA 1LBEA 3KX2A 4YUZA 5IRCD 1GTL1 3HFSA 1K66A 5DXAA 4D80A 1HO3A 4P34A 1TIBA 4D45A 1VXOA 4DPLA 3CV3A 3PVCA 4CMIB 4A91A 3ASZA 1GFIA 2DMRA 3C3BA 3PSHA 3D8RA 3NVAA 1GG2A 1E2IA 4AG5A 3O90A 1FMTA 1Y4UA 1XWWA 4QC2A 2BGWA 4G8JA 1QKIA 1DEAA 3NWJA 5ALXA 5HBRA 1GTRA 1PT6A 1RTKA 5FO1A 3RYIB 4D3FA 1L8AA 1SBZA 1YQUA 3NV9A 4LF7B 1E2PA 1CR2A 1AQUA 1SC3A 1V8DA 3O8RA 4FC7A 2FPSA 5B6IA 3AB8A 2XKJE 1TFRA 4XLZA 3QVGB 4YRDA 4EY7A 3LFUA 4M1ZA 2B1RA 4MUNA 5JY6A 4FFPA 2CVZA 3WWCA 2EP7A 1UBUS 4HSEA 4CV2A 2BC9A 2HMUA 4HH4A 2Y9PB 1MQ9A 3AOEA 5IK2D 2PCJA 2RK3A 3RYOA 1VLQA 3JVIA 4IFIA 2CUZA 5FJJA 3SEQA 4GSLA 4E6PA 4U7DA 5GGXA 3H2IA 1F9EA 2Q45A 1Q19A 3IEUA 3O8BA 1JAIA 2JD1A 5D6OA 4GW3A 3HCEA 3QWHA 4M4SA 4BLWA 3X1XA 5EG5A 1V7QA 3G5AA 4TLBA 4DRYA 1ZJZA 3AUSA 4Q03A 4D4IA 2RGDA 3FDIA 3ZE0B 2Q1TA 4UKDA 1XWIA 2C5AA 1QCDA 5HA5A 3I6ZA 4REQB 4DEYA 1MZPA 4DF3A 4GRIA 1PJ8A 2B92A 3QE4A 4KRYA 4URFA 3L8CA 1T5SA 1EFTA 1CUWA 1W46A 4XYEA 2GPTA 2QVXX 4D4HA 1HR0B 3O8LA 3LNCA 1BCSA 4KACA 4EYKA 4RY9A 3LL7A 2Q5CA 1U3CA 2IVFA 3K9CA 4DIUA 1KQFA 4PRYA 2YMQA 3Q3CA 1O3YA 3CH5A 5FFMA 3LQRA 3L1VA 1U7OA 4KIJA 4LQ4A 4A73A 5EWLB 2YHIB 3PLAE 1PR5A 4BZQA 3IR5A 2QKYA 3PGA1 3RR2A 1OH5A 3FNRA 2IEGA 4O2AA 5FOTA 2I91A 4B17A 1DADA 4MI3A 4TXNA 4UASA 1LRJA 1E7WA 3N2IA 1T43A 2XBLA 4Q00A 2ZRJA 4BQQA 2OQIA 1T3TA 3T54A 3RFVA 2CVPA 3A2KA 3WGMA 3K9LA 2P6UA 4B6OA 4QUJA 1JSRA 3FETA 4AKGA 2QYHA 1CX9B 3OZDA 4LUCA 3TW0A 3FPKA 4TZTA 4RSHA 1DBQA 1IE3A 5GAJA 4HQOA 1J9EA 1FNNA 3MQFA 4B6GA 3M5CA 3G9QA 5LWQA 2W2TA 3F67A 4JVOA 4DBLE 1OHHD 2W00A 4UHDA 1G2IA 2GN6A 5HKKD 2PS1A 2Y6VA 3L6UA 3LOUA 3PGLA 5D3ZA 5TXGA 4L4SA 1DKQA 1ZITA 2C2YA 4RPKA 3A70A 4FYPA 2QPOA 2XAUA 2UZ3A 3PNYA 1NW6A 4LFCB 4C7OA 1RCUA 2UAGA 3F7OA 1JE0A 1OLSB 1QAMA 4EPYA 1JHUA 6YASA 3OQPA 1ABBA 4N0MA 2AYXA 3DM9B 4Q66C 3W4IA 3ZJYA 2QQFA 3BTSA 3JPWA 4LZAA 4CUJA 5M7EA 1EFPA 4YV7A 1ZU4A 2I6UA 5HF8A 3ZJUA 2FW9A 2QT1A 5B57C 3HDQA 4QLAA 2JFPA 3AM5A 1QGUB 4WOBA 1SXJE 3NIDB 4X3CA 2R6JA 3AK4A 3I05A 3NJRA 4TXLA 3SAJA 4CEJB 4P0PB 3OFKA 1ETHA 4YALA 1T0IA 2FE4A 5BSGA 2ZRCA 5CYOA 3ZHYA 1YASA 4OO3A 5B53A 4MQEA 4KO3S 2GPBA 4J1SA 1C1XA 3TLZA 4TL9A 1KFJB 3KHSA 4YP9A 1DE0A 1O8CA 2QUJA 2XB9A 2V7PA 1OU4A 3CRVA 4HX5A 3PUHA 5EKDA 1PGPA 3ON5A 3ZZMA 3ZZ0A 2HIGA 1YB1A 1G42A 5BWCA 2DE0X 1CD5A 4GOLD 1FK8A 1JFVA 2DBZA 3Q0IA 3LBNA 4EGAA 2OWDA 3LX8A 2QR3A 1FFDA 3KSDO 1WFRA 2P2LA 1LF0A 3P96A 3RRNA 2EJTA 2GN0A 1C9JA 4W4TA 1SEPA 1G21A 3K92A 4YXWD 3MTBA 2P78A 3MNFA 3FY4A 4F56A 1H9BA 1EXNA 5G2OA 1VIAA 1SUPA 3H9EO 3PEWA 3B36A 3EEOA 4K28A 5AVJA 5BT8A 3I9V6 2XITA 4L0MA 4RVHA 1VPVA 3C4VA 4GMDA 4TV9B 4G1BA 3O92A 3NETA 1C1DB 3ORFA 1E6UA 1D6MA 2RH4A 4Q16A 4KQ9A 1LKZA 4MYCA 1QBKC 3T5BA 3VZDA 4OU4A 1AK1A 4NZNA 1GCOA 3Q6IA 2J6HA 2W6OA 4HAOA 1JBKA 2IPAB 2VEDA 3AVVA 3AB3A 3CBGA 4GO1A 2I4OA 2ZYAA 2WDZA 2Q0XA 3IURA 4FOTA 3STHA 3QVJA 4AJHA 1RE1A 5ANRB 4DV2B 3S1LA 3NBUA 4QYIA 1QP7A 3TTYA 1RWOA 4FSXA 1W5EA 4AURA 4EG8A 2PN1A 1CTQA 4KMOA 2A4MA 1WZEA 2E5FA 2R87A 2O5RA 3KOUA 3WDMA 3IEIA 2PGOA 3RSFA 3G8AA 4EAAA 1EGMB 4AZVA 2VT6A 2HK7A 1MA0A 2PX8A 1KFCB 5I7OA 3PR3A 3BWVA 3JSAA 4JWKA 5L7TA 4BJHB 1CS0A 5CNKA 4RE6A 1CHNA 1POWA 3BWCA 4C4YA 4DLZA 3KKZA 4B2YA 1D2MA 5TB5A 2NXWA 3ZBUA 1VP9A 3L7OA 1GQOA 2IUTA 10MHA 3ZW9A 1P0QA 4KWTA 2HMAA 3E0QA 3QHPA 1LJ8A 3FTPA 2QPTA 1HMYA 2ZWMA 1J00A 1L8XA 3K05A 5CJ2A 4ENRA 2GRUA 4YPOA 1NLMA 5JUWA 2H54A 2VXOA 2HIMA 3P0IA 1F7VA 1JLMA 5JPCA 4D9JA 5J58A 4D4KA 3E7FA 3W6PA 1W36D 4ADSG 1MRSA 4BYMA 4U2BA 2C83A 4XIYA 4F9EA 3FKSA 1BX3A 4ZU6X 1FY2A 2CB0A 2EJUA 1ZMOA 3A1CA 3BTVA 4LK3A 3NBKA 4KQGA 3D4OA 4ON9A 3TQHA 1U98A 4UEQA 3KKPA 4JD5A 2G4VA 4ZQHA 5CCXA 5AIBA 4PV7A 4CIVA 4QXPA 2EBFX 3CWQA 3H2HA 4PGAA 1J39A 4RGVA 3QH4A 3FMOB 5L4NA 5JBQA 4WE3A 3KZVA 4RZUA 1PL6A 1IB0A 3EYWA 3FOWA 3ZLVA 1Q57A 1I3NA 1S02A 2AQKA 2ERXA 1Q0LA 2UV8A 1E2HA 2GI4A 2ZETA 2IIVA 4PHHA 4CV0A 1NN1A 2JCYA 2ZB8A 3RG2A 5CFQA 5LFAA 1M2GA 1NLZA 4RU1A 3NHUA 4OEHA 1TF5A 2GCGA 2FG7C 5E4JA 4CIDA 4ITRC 5HHTA 1Y8QA 5JRJA 5I4CA 4OI2A 4OY3A 5CB6A 5KYXA 1U7TA 4FX5A 4HFRA 2H4JA 4EPRA 3PFCA 4ALKA 1I4WA 1RHKA 4BFTA 2BM9A 2X77A 4ROSA 4U2GA 2Q8PA 3TLMA 3IODA 5GONA 1UH5A 3U3KA 3PWTA 2CV1A 4AYXA 1OVGA 2VTBB 4JI0B 2DFDA 1YZLA 3EIHA 4B3XA 4KUHA 2O2HA 1JR2A 2H08A 4RIIA 2J6CA 5JNUA 5DE3A 2IH4A 2OXIA 4N40A 3H2ZA 4AUKA 1JEJA 3K9NA 1DXOA 2DSNA 4UM9B 2K87A 5EHNA 4AXXA 2A6PA 1EX6A 1WZIA 1NJSA 1UQUA 1OT5A 4NAUA 1SQ5A 3A1EA 4NR0A 2JFQA 5FTKA 4K6OA 4LDAA 5H4HA 4TL8A 4BWGA 2P8SA 4XX0B 4C1NA 4FMDF 3IPAA 2G82A 4D9KA 5JS7A 2E5WA 2VQEB 5CH5A 3C6MA 3EPKA 1K63A 2FN8A 3KYCB 5T8KA 4KV7A 3QOYA 3TLXA 3V1LA 4EJ6A 4N6GA 3WQHA 4OBEA 2X3YA 3VFDA 1QZ3A 2RGNA 3THYB 1ZJJA 2E48A 1LC0A 4YLEA 2I5PO 4UXJA 5KC9A 2LXNA 1JLKA 3EZFA 3GDHA 5DNYB 3LQFA 4F71A 1RACA 3ETDA 4FHFA 4RMHA 4PO3X 5IM4F 1M75A 1ZZEA 4M9UA 4RCVA 2YVUA 1G6KA 1L3CA 2A35A 3OO1A 4UVDA 4UULA 3R5SA 2AHRA 4A0RA 1RC1A 1AHHA 3QITA 3L40A 5F3RA 3LP8A 3NC4A 3CURA 3QVSA 4G1MB 1V2GA 3C8HA 3LBIA 3TW4A 2XDYA 4CKBB 1U2TA 3GDWA 3HNOA 4J0IA 4XJVA 4O4IB 2A86A 2YWGA 2UZ4A 3WNCA 2D7JA 1A50B 1NBOA 2CHEA 4EO4A 4R1LA 1YHZA 3MWKA 4XW2A 5JCZA 2DKFA 1J06A 2B8TA 4TTPA 5IF9A 2HH9A 4NJMB 1C8KA 1TMGE 4JYZA 2VJAA 3AERB 3HRKA 4URHA 2EGHA 2BUBA 3V1MA 3ANLA 2YQZA 4MQ6A 4OUDB 3P45A 1HF3A 4DA8A 2ZTMA 3IQHX 4PLGA 2O0MA 2WJAA 4MW0A 3R0XA 5EE3A 2DOKA 3M9LA 1YJCA 5K6AA 2FDRA 1XBTA 4GRDA 1CWUA 2JFHA 4JB8A 4OG2A 5JZSA 2QTBA 4KO8A 3UW1A 2QV0A 1M74A 4MKRA 2YXPX 3ZCTA 3TGLA 3S1SA 4EB3A 3LI2A 3BKXA 1U2SA 4UNIA 3V4ZA 4TKVA 3L4SO 1BAPA 4BKPA 5FAXA 4J0EA 2Z9DA 5J1SB 4QYIB 1PZXA 4PAOA 3O1JC 1MIHA 3DV9A 1OQAA 4K9QA 3B1YA 4WUTA 4CF6A 1YA6A 4RH1A 2V7QD 4Y0NA 1NLFA 1P44A 1W85B 4B3MB 5A0VA 4WOPA 1D8TA 2ODPA 5FD8A 5LOVF 1R10A 1LPNA 3GY0A 4Q9DA 4PCAA 1MC4A 2PSEA 3KQPA 4RK4A 2BHLA 2R1TA 1RRCA 2Z83A 2D3WA 4D6XA 5JAQA 2MYTA 3O8DA 2W6IA 1PV4A 2R2GA 5TQ0B 2B36A 2BV3A 3O8OB 3LGSA 1VBFA 3FLMA 3I58A 3KC2A 3R40A 4EVQA 3ZH2A 2WJYA 4Z8XA 3H9UA 1J56A 5LQUA 1W5FA 3UMFA 2IJGX 2WYVA 4TVBA 4QHYA 1WZ2A 3F8WA 3JZFA 2P62A 1RZRD 1ZLXA 4Q4AA 2P5TB 1PG0A 2A9KA 5JMOA 1LLQA 4CG2A 3PC8C 2R66A 1CQWA 2WZQA 1DJMA 3GVPA 4PZUA 4EFNA 2F6RA 4MS1A 4JJ8A 3ZW7A 3OVMA 5ALWA 2JGEA 2OCBA 3PI7A 3Q7EA 1EXVA 3IV7A 3ESDA 3JQDA 3H13A 4RAQA 5TEVA 1Z38A 4LX8A 4X1YA 3T9BA 1V5IA 3F5FA 2ONJA 3OTOB 1GRRA 4LHXA 3F6EX 3EN0A 1JKFA 5K3DA 1W48A 4A1FA 4TZKA 3ADPA 5JMTA 2I66A 4KVFA 5JJIA 2Q8QA 3A04A 3SR4A 3UT5A 3U1TA 1E92A 2EIXA 1R8QA 3H4MA 1Q2XA 4PLHA 4TM8A 4REMA 4KK3A 4ARAA 4LYGA 5BXQC 1XD8A 4R1QA 5FB3A 1VZ3A 4L9AA 4DIEA 4EI2A 2CD9A 1AKNA 3A1UA 4R2JA 1W4ZA 2XWSA 4M53A 2DF8A 5KYUA 2Z6UA 4YMHA 2D8AA 2C00A 1PZEA 1WO8A 3RKUA 3I9MA 4WTOA 1XZKA 3Q8KA 3TMAA 4RV5A 5ENDA 2JKZA 2YL2A 1UFQA 3NIBA 3SHTA 1SVIA 2IQ5A 1KAQA 5D3MA 2W2MA 4FHZA 3KFVA 3I8XA 2IKQA 3GOHA 4QDTA 2QL5A 1C4KA 2FRVA 2QRGA 3HB5X 2NVUA 1Z45A 4FEYA 3S68A 3WRYC 4RZHA 3JYHA 4BVAA 4JBXA 1NBMD 3RABA 3HXMA 3ANNA 1N0WA 3LYHA 4TUYA 5KWJA 3PC2A 4UZEA 3V42A 3QX3A 1GYQA 4CNBA 1E1LA 4O4JB 2GK4A 1IPHA 3Q0EA 4XUGB 3U7QA 4RJ2A 4J3JA 1P7ZA 1QO0D 4DCMA 3CEJA 2BTQA 3IPLA 3GLVA 1MJ5A 1IHYA 1P1BA 2AVNA 2YTZA 3EXEB 4LOLA 3UB2A 1ZIXA 4Y6SA 1G6OA 4V0RA 3WBKA 1JILA 4JOSA 2ZT8A 3PRJA 2Y3IA 4O2BF 4YCBA 1RKUA 1WL8A 4RTSA 1F51E 2B5OA 3BBLA 1NP3A 1W9HA 2JLQA 1RYZA 2BRUC 1U7ZA 3G7UA 1ICEA 2WTEA 1Z18A 3GUZA 3L6RA 3LX5A 3K70C 2VJKA 3CZMA 4S1VA 1H6DA 2GEVA 2JJ1A 3GK3A 1L8QA 4RK5A 3WAGA 3ADBA 4FBLA 4MWDA 2D2XA 1KF0A 2ZB7A 4BDSA 5FRDA 3BEDA 3HADA 4GMGA 5AWFC 4LV6A 4Z6KA 3AR3A 4IG9A 5BYJA 1M6HA 5H5JA 4L28A 3KEFA 1OHHA 2AD5A 1O95D 3B3JA 2BLNA 4RK0A 4AROA 1FNMA 2PUWA 1KS2A 5IXSA 5JFTA 4II3A 4X5OA 1G19A 3TIFA 1GRNA 2XMBA 2Q50A 5FQOA 2C7VA 5AOBA 3JQBA 3RVKA 3KPYA 5FL7D 4C4OA 4RW0A 2VSQA 1GNVA 3EXG2 4TMFA 4XB1A 1UK9A 2HYDA 4HLQB 4P0TA 3VNBA 3JD3A 3D7KA 4ATNA 1XNRB 1ZGAA 3CZPA 1CIJA 1IK6A 1VIDA 2OXFA 3Q2IA 4KLRA 3OT1A 4MQLA 4MUXA 4HD8A 3CNBA 4PC1A 5IAEA 3W05A 3AF6A 2RGRA 1VTKA 4FTWA 4P36A 4ABYA 2JK0A 1GPAA 3T5AA 4Q1AA 5HUHA 4GT1A 2PO7A 3UJ7A 1E3LA 1QHHA 4LAFA 3CW2A 4QXOA 4TLDA 5DCWA 1KDOA 3MK31 5CVTA 3IALA 4IZOA 1V11A 3V4SA 5BMVF 2R65A 1CQJA 2HKIA 2UVDA 1XNGA 2C5LA 2IPLA 1G6HA 3PFIA 3WMRA 1HG1A 3H3JA 3ZQ6A 3NT4A 4TT8A 4RD4A 3VPXA 1K6IA 2HA3A 3PXUA 1RXCA 3ZJ4A 1E4EB 4NBRA 2DFLA 1QUFA 3QPCA 4MWTA 4TQUS 4EG1A 2R8ZA 2IDJA 4HGNA 4OHFA 4JLSA 2H1SA 3D6AA 3ZY3A 1DG1G 2ZJZA 1T0PA 1IZ0A 1OWMA 2C4WA 2RB4A 1R66A 3Q3JB 1NI5A 3CUWA 5T6BA 4AO7A 6AT1A 5M04A 3HY3A 4AQYB 3EGDA 3A6DA 1YS7A 1R1DA 1RM3A 2C04A 1BE8A 4UVGA 3OJFA 3U60B 1FLVA 3K6JA 4KNVA 1N5JA 4Q6BA 5BMVA 4PRKA 4EUFA 1RXVA 3ANXA 4KKVA 4O5OA 1WPRA 3H5LA 1RC0A 4MHTA 3ICQB 1VJGA 2ECQA 2XW6A 5BN5A 4CFYA 3UFXA 1R27A 3S55A 3L0ZA 1SZJG 2EWVA 3FVTA 5I9IA 3HU2A 3W5UA 3KOWA 1P62B 1KORA 5CFRA 1X8LA 4YQYA 1Q74A 4IV5A 2RHDA 3N3AC 3L84A 3FFBA 1GGJA 4XUCA 4C4XA 4LY3A 5ER6A 5IJAA 3I4LA 1WDKA 5K51A 5FPPA 1OASA 2IS2A 4TYYA 2AMLA 3LRTA 4OH7A 5F52A 4I81A 4LNAA 1KIMA 4FYYA 4NZOA 5FI0B 4ACBA 5DHRA 2GEDA 3BHIA 5C2JB 3QFRA 4ZI2A 5J4KA 4RM2A 1QQ7A 1TD1A 2J9YB 2WTNA 3CEPB 3MWDB 1Q2UA 3CUKA 3ZU2A 3FFWA 5KCZA 3T3OA 4RIHA 1QG2A 2W2PA 1DO8A 2WKPA 4LEIA 4Y2JA 1CP3A 2PLNA 1Q0ZA 4NURA 1KXJA 1ZSYA 4ND3A 1MX1A 2YDXA 5FH9A 3WGVA 3L0BA 2GSDA 3SZGA 3C3CA 4HDSB 1A4XA 3AUFA 4KMRA 1UEIA 2HSJA 2OV6A 3VMMA 3K71B 5DBOA 5JS2A 2P2DA 4ZJPA 2O3QA 1JKIA 1XVUA 4EI7A 5KU1A 2N1MA 1OZFA 3DKRA 3H16A 2IYVA 2RGBA 2J8ZA 4OM8A 1IN8A 1I8TA 1GKUB 2FK7A 3ED5A 4P58A 3K73O 3CO5A 1X9IA 4PICA 4UTPA 2P91A 1TJ3A 3TIXB 3N0XA 3G2OA 3IBGA 1G1MA 1MPTA 2V5VA 1E5LA 1UXOA 3PQ3A 1ONOA 3ID6C 5F7ZA 2HI0A 3FI9A 5FEMA 2WPDD 2VCHA 2WUDA 3WBFA 1C8BA 4IIJF 5JS1A 3LHFA 4FCTA 5EZYA 2JFOA 2B20A 2R25B 1N4DA 2V03A 4U5QA 4V0SA 4HQ6A 5HRAA 3UKJA 5E6SB 4XWGA 3GLHE 4OP3A 5HF9A 3FYTA 5GVSA 4TX1A 3T3GA 1M2VB 2WJJA 4HWPA 3DMFA 2JC3A 1HEYA 1C7EA 1EFVA 2JFWA 2FPOA 3TSYA 4OHYA 5KB3A 1WG8A 3DLAA 1GARA 1V5GA 3M5PA 1RFGE 4HWOA 3F1LA 4QTXA 5DHAA 5EP3A 4RCZA 4HQ0A 3VR1A 2HUNA 4U2FA 4CQMA 4IWXA 5EVJA 1SCUA 1GN8A 1XTTA 3L7YA 3N3BC 4AIRA 3IIKA 3LUAA 4EHHA 4CYMA 2B98A 2Y1DA 1ZSNA 3RSZA 3R9WA 1H4TA 4B32A 5E7JA 2QLFA 4CTOA 1D1QA 2RI0A 4IDGA 2ESRA 3OI7A 4KW7A 1NNI1 1ZC4A 2P30A 2OZLA 2X0KA 2YVQA 3FWNA 3MOIA 3OEEA 3QIAA 5DYWA 1TLLA 3LV8A 2AZDA 5F2KA 3TNFA 5CRIA 1NR5A 3E4CA 5TJHA 1CE8A 2QTCA 3GLFB 1OH7A 1V39A 1GGMA 3CX7A 4O2RA 3RU7A 2VJLA 4C07A 5AW5A 1PNOA 2Y4NA 3IHKA 4QKQA 1J8MF 2VR1A 3WJAA 1CS4C 1GQYA 1TJYA 1T9AA 2JCXA 2IZ0A 3VPDA 1DC4A 1ESCA 3SWWA 3HY6A 2AK3A 1G2PA 4M0UA 2Q9AA 1DU4A 2DFKB 3FPAA 1G20A 5LUBA 1I94B 1S9HA 2B6HA 4R3UC 2BP7A 2ONYA 1UXKA 4XH9B 2QRJA 1F1JA 3ONFA 3D6NB 3GNQA 3NVKI 4F06A 2CCGA 3A0UA 4MNTA 4YCLA 1VLLA 3ISTA 2BD0A 4WXRA 2XB6A 5LOVB 1XJ5A 2AR0A 2JBAB 4KQWA 4J43A 4PIPA 5EXXA 4YN3A 2AFIA 2BEUA 2RGYA 2YBDA 4NWIA 4QICA 2ZI9A 4W5TA 1XVAA 4DDUA 2AEEA 5G40A 5IDYA 5JJCA 2BKAA 1ZPDA 5IAOA 1GQFA 2EU8A 4Q7LA 5A2GA 3QEBZ 1RP1A 1P4JA 3ESQA 3NTLA 3U7GA 5JWHA 1MC8A 2YW2A 4EPWA 3H9GA 3IQGX 5IBQA 3CB2A 3HRHA 4PWYA 1SC9A 4WUVA 5IJ9B 2IHKA 4LYAA 4MUAA 3HZOA 3QVTA 2NT4A 1TYAE 2CVQA 2IU6A 3C4JA 3OM1A 4YBRA 4RPCA 1ZO8A 3UC5A 4EPXA 4I8DA 1GNPA 1A1SA 1O5OA 3WKDA 2ZRGA 2IBSA 3E9ZA 1KBQA 4AUEA 1QJ4A 3LUKA 2FSSA 4UTXA 2B3DA 2J45A 3E9MA 1L5FA 3SNHA 3OZTA 5DM2A 5L3QB 1NOKA 1Z7WA 1Z68A 4TTSA 1J2RA 4B81A 4B6QA 5B1DA 1NJGA 1QYWA 1DCTA 4B3TB 4M8KA 1FJ2A 3NFRA 3L79A 4G56A 4TLMB 3K8YA 1Y6QA 2ZJFA 1R2QA 3T9EA 4C4ZA 5J4LA 2G5GX 3TLGB 4DPKA 4LDPA 3G8YA 3BBPA 4NPCA 3GLGA 4JZYA 3OSZA 3T9AA 1T29A 3OE7A 3PUJA 3PZRA 4LSZA 5ILOA 2F90A 4ZREA 2AD1A 4OXKA 3C3EA 4KFCA 2I7CA 4L15A 1TQ6A 3EVNA 3GRKA 4FNOA 4ZCSA 3UGKA 1UCFA 1WULS 3A3OA 1M8PA 4IHAA 3NRCA 2R6R1 3OHMA 3INRA 4C30A 4CIYA 1JHYA 5AK6A 2C9DA 2O1XA 4Q3LA 3TPFA 5KSWB 2QBYB 5L3RA 2OCAA 3W2GA 1TYEB 3PWKA 1GLNA 1VE6A 3FPLA 3TNLA 5EFZA 2P2ZA 1P81A 4LI3X 4DAEA 3FPCA 2JLRA 3NW9A 1YRBA 2FAXA 2X58A 3BCUA 3D6MA 3DE3X 1ZIYA 4BNNA 4DKJA 4UCFA 3KPWA 1RE0A 3L82B 4G0QA 4XTCS 4XGNA 4Q93A 2Y05A 2SKDA 4FBGA 4IIGA 4QNRA 3QLTA 2YWRA 3HB4X 3RQSA 1EVIA 2ZCVA 1W44A 2GKGA 2VXCA 4YNBA 5JG7A 1CZOA 2WAMA 3GA7A 1F20A 1L9KA 5KZMB 4I3HA 3IGFA 2OP0A 1OI3A 3PQEA 1KEEB 5AKHA 1HL7A 3TTVA 4UPDA 4H3HB 4ZK2A 1EBFA 5A7HA 1RJWA 1XRNA 2CBZA 3S0JA 1LDMA 5GJCA 1GL9B 2HK8A 3QI2A 4EH1A 3ZHQA 1ADYA 2D4HA 1L7PA 3SN6A 2UXBB 4EUEA 2AFIE 3QYJA 2AXQA 1C7JA 4CCWA 2VPIA 1YQTA 2NSFA 2VZEA 2JPDA 4CDRA 1YRYE 3KBBA 3QNMA 3TVYA 2NTYC 6REQB 1E8DA 3IVRA 3OQIA 4ZV9A 1DWOA 4IIHA 1CP2A 1RCFA 4RGBA 1PR6A 2G28A 3JVDA 1X7ZA 2SCUA 3NB0A 3BB1A 3T95A 3MD0A 1P2GA 1NV8A 2CNLA 1AB6A 1CUFA 2PRZA 1WDLA 2X6TA 3S7TA 2XH8A 4C2UA 2XZLA 4P2BA 3AEUA 1JPUA 3DMTC 1A5AB 4LDZA 3NORA 4NFLA 1Y5LA 2M98A 1SBQA 4ZO9A 4L78A 2FP4A 1MT0A 1SHKA 3PHCA 3WNQA 3AW8A 5JHGB 1Q1NA 1RBYA 2DQ4A 3BXXA 3I2KA 4R5HA 3RHSA 4EB0A 4BJ1A 1KR5A 4FDLA 3HLKA 4HGQA 3AR6A 3JRXA 2XWQA 1TYZA 4WFQA 3LE8A 2ZRMA 1A7UA 5DBGA 3W5DA 5EZ5A 1EDBA 3MINA 3N74A 3GLHB 1ICIA 3P27A 4HLCA 1NYRA 2Y27A 3HKCB 4JLWA 4ENPA 1C81A 2O1EA 1GGVA 2F4NA 1XDUA 3N1UA 4P53A 1MOQA 2XOEA 2OGZA 3LWDA 1CKEA 3V4VB 1EVLA 3R0JA 2YKGA 2P75A 3ZCVA 1QZZA 1LRKA 3DD1A 1WV1A 4RF5A 3TRJA 4ZC1A 3VMFA 4DARA 2Q99A 2IYRA 2Z58A 3RJ5A 4NE7A 2ZVDA 1Z4MA 2GTPA 4CR8A 5I5EA 1RM5A 2YFKA 2C9ZA 1DBWA 5H81A 2Z8YA 3X2SA 1BNCA 1UPXA 5H80A 2VRCA 1PR3A 2L17A 3O4RA 4HDNB 2WHQA 1JAHA 1RYBA 5ADHA 5JS6A 2FPWA 1KIAA 2PLWA 3K4HA 2O6HA 2D5CA 1TUIA 2GSWA 3H04A 1GZSA 2I6SA 1ES9A 1UXGA 3L8FA 4N0EA 4QT0A 3TCNA 4YR7A 2DWOA 2I1WA 3TTUA 1R0WA 2GZ1A 2JIZA 1AGYA 4ZQCB 3I64A 3M1LA 3Q5DA 5JRDS 3G1UA 3HEMA 3MUNA 4GIBA 1N5IA 5BSWA 2VJPA 1R0KA 3CO0S 1QYXA 4IILA 1O5TA 5FLXA 3O75A 1SKMA 2HNAA 1I3LA 1JHAA 2DBVO 3DBRA 4FDUA 5CB8A 1PGQA 1FTGA 2CL6X 4M88A 2BBTA 3VNVA 2CBGA 2IRWA 1LI4A 2C2MA 1NXPA 1D4OA 3TM5A 2YWXA 1SEVA 1YCFA 3OZ7A 4IIJA 1CVLA 2J0EA 3MMSA 4HEA1 1N2BA 3A9TA 2F48A 1J4AA 1PHPA 4PLPA 3K70D 2WF8A 4D8YA 2SKCA 3CIFA 1QAQA 4YO8A 4EHIA 3S3TA 5DN9A 3QA9A 3HWSA 3FNBA 3NBXX 3K0FB 2X3FA 3E22A 3LO8A 1E3DA 2WLSA 4OLHA 5B30A 3W3AA 5AI6A 4Z3DA 4U0KA 1VCIA 3AG6A 1R16A 1G7RA 4MKXA 4S12A 4ZQEA 3PNSA 3WJ7A 5KNBH 2IYQA 3NAQA 2CDRA 3GP8A 1G5HA 1YNOA 2G4LA 3C1OA 4A6EA 1LPMA 4FT2A 4E30A 1PS0A 3AEZA 4KRXA 4HNHA 3CF0A 2GM9A 4P7JA 4UBKA 4DQXA 3CNNA 2QZTA 3KTAB 4WH0A 1K5DA 3USCS 1MO3A 3DKIA 4HQRA 2ZJ3A 1DAPA 3L5KA 1KC3A 1IXRC 1Z0FA 3EGXB 4UDNA 1E4YA 4NCNA 1M2OB 1ZCFA 4OMDA 5P8WA 3JAWA 4YMSA 1NNEA 5ITZA 2DGDA 1L5QA 1KNQA 5K1ZA 5KHOC 1EU1A 3GEHA 2FWMX 3MINB 1PFUA 4KJZA 3SFVA 1U4NA 1PZNA 2JI4A 4HNSA 4AT1A 4Z1MD 3Q3GE 1NW9B 4J7XA 5JCJA 1G59A 4PHGA 1SC1A 1SK9A 2HO5A 1OZGA 3O91A 2LKDA 4URUR 3UK2A 3UUFA 1T26A 4J0CA 4A16A 2WJ6A 1TNDA 1IL0A 3QEKA 4HN2A 4OREX 1XMIA 4K2HA 5DYNA 5EKTA 5TSDA 3UH1A 4WCFB 2BISA 4M3NA 1U2GC 1X7XB 2VP4A 4X7PA 1KJJA 3NVMB 1U1CA 1QFZA 2UZ1A 3A9VA 1FTQA 5MFPA 4KCGA 5A6SB 4YH1A 1E9RA 2HPHA 3QE3A 1MD9A 3FFTA 5LQJA 1TVKA 3BXEA 4L9SA 3WC4A 1IWPB 4X8HA 3REGA 4ENVA 4RZXA 2IS6A 3HCOA 3E9DA 4N47A 4TMKA 3KL2A 2I22A 4DWOA 5L45A 2O4CA 3ESYA 2WFLA 4ITUA 2DCUA 2CXHA 1MLDA 5HQJA 1OF1A 4EKDA 5E8RA 5HKOA 3OFVA 1AGRA 1I4DD 3H3XA 1N2ZA 1NX6A 3NJ8A 3RD5A 4PBTA 1WB9A 3RC8A 4XVUA 2PH7A 3OC6A 3EMVA 4OCZA 4QXAA 1LWNA 5AK5A 2GM3A 3GOQA 3CH4B 3QM1A 3DUWA 5L9AA 4EMBA 4YLGA 3C14C 1AK9A 2C2ZA 3FLAA 1A8HA 1CZLA 2VK8A 2WU4A 1ZM7A 2CV2A 4UHJA 2VTDA 3H8JA 4WWHA 5CEEA 1TK3A 5ALMA 2NVOA 3SXNA 5HQ3B 1UMKA 3HGQA 2Z9CA 4YP0A 2QVYX 4R8LA 1OUMA 4EGFA 4FKMA 4YRCA 3ZN2A 4CMAA 3OLVA 2RH9B 5K8IA 4Q1DA 1CR0A 1I5OA 5EVCA 4FYWA 4BLRA 4CV1A 1XQ9A 3KE9A 3ZWOA 1OV6A 2IKSA 2A0FA 2BKEA 4U9HS 4BNTA 2CG2A 3ZHSA 3U61B 4A15A 4P7GA 1SPBS 3OU6A 5BV7A 4ARIA 1WZUA 2C07A 4L3WA 4IIVA 2J0SA 3G2JA 4WBNA 1OYVA 1UC8A 1GUAA 3SGLA 2LWIA 4AULA 4M0CA 4EG0A 3WLRA 2HDHA 3NO4A 3AW9A 1YS9A 3QNUA 2VPZA 2XADA 2B4AA 4UMFA 2CNNA 2H1VA 5KNDH 3KPUA 1YHNA 5E6UB 4G5XA 4R9UC 1UC5B 3EMKA 3ZCSA 1TZCA 4YJGB 5T8KC 2B83A 2DHQA 5KTYA 1M0WA 1HG0A 3E6AA 3PWZA 1XALA 5JC8A 2YC2C 4FFBB 1VHJA 1IH8A 2OZPA 4Q3KA 3SY8A 1EHYA 2BRUA 2J4CA 1IRIA 4PC2A 3GFQA 4GPD1 4PC3A 4D3DA 2Z6AA 2AF3C 4X93A 3OPXA 4X94A 1X7DA 2LZ0A 1I1OA 3DWEX 3K5WA 1BH2A 1E2DA 2QSJA 3EQ2A 4XKJA 1ZOOA 2VKQA 4CM9A 2HF9A 5D1NA 4BUZA 2F1OA 2YCBA 4PN3A 1KR2A 1PI3A 3Q8LA 4PG4A 1KDPA 3TNYA 2PQ6A 3OPMA 1PEKE 1WRBA 2VI5A 4TV8B 5DXJA 5T4EA 5FNZA 2IEAA 4P1ZA 5D7BA 1ZXLA 3MWJA 5J9FA 1DAEA 1YOBA 2HCRA 3KXKA 4CM8A 2ZZMA 2EFDB 1DEOA 3P19A 3DT9A 5LR6A 4X71A 1FSZA 1BRMA 1S2GA 2WYUA 4ZA2A 2O1WA 1TKRA 2VP3A 2PDAA 5CT8A 1NVFA 4YACA 4QOFA 3RV4A 5JAPA 2I7TA 2WSBA 2Z56A 1CDOA 1LZKA 3P0JA 4LJ5A 2VH5R 1FTWA 3K5IA 4PBRA 1BQEA 2Z98A 2XNDA 3S44A 4QIHA 1Z7EA 1BCRA 1LX7A 3FTQA 3NAMA 4UAJA 2P6PA 4W1QA 3EQZA 2XXBA 3LOPA 4KHZA 4R81A 4CLRB 3P0RA 5ECDA 3WOHA 1EK5A 2ZRBA 5KNCD 5ER9A 1RI3A 4GRAA 4IY1A 2J48A 1K1EA 4BO4A 1SKYE 2A14A 2R4UA 3NM5A 4HGRA 2AUTA 1C5KA 3JQCA 1LD3A 3KB8A 4R2KA 1TCCA 1OPRA 5FUVA 1GTMA 2CCJA 4DM4A 3GO4A 2JFUA 2HTFA 3SDZA 4BVGA 5C4MA 4AZSA 2DQZA 4N6OA 3DL2A 1JWAB 4MSUA 4CGYA 5JI2E 1G4UR 4QULA 1D5WA 2DXIA 3CWCA 3VH2A 4O4LB 5KYWA 3R9XA 5KWVA 2GAAA 4FGKA 2Q21A 4HVTA 1LLDA 4UHFA 3MA0A 2ZYSA 4ZVMA 4OU5A 3W4JA 2QRZA 4KQ2A 4YV0A 5AW1A 2W2XA 1P3JA 1N0VC 1MAVA 3CLVA 4FDAA 5EJMA 1C3VA 1XQ1A 2BGKA 2F1RA 2HLDA 2RK6A 3AXSA 4GECA 4YO7A 5LZ7A 2VBGA 2PKQP 3EVGA 1DKLA 3A4YA 1ZXBA 1YZTA 2BY4A 1Z8HA 1RQXA 3H2GA 4E5DA 4ZP1A 5B3LA 1PDVA 2VT7A 2XBMA 2FSPA 3BL6A 1XUOA 2A9QA 4Z99A 5AVWA 4JI2B 2EBWA 4JI1B 2RGWA 3PZBA 3SG0A 1QMPA 3RFXA 3NTVA 4C1BA 5DIZA 4G5QA 1O6CA 1BQ4A 4O4IF 3VTAA 3ECCA 4PGMA 4EPVA 1GYRA 1II9A 7MHTA 2Q0SA 1FDOA 5TEWA 4W5RA 3UJ6A 4BV2A 1B16A 3NT5A 3TL3A 2FX5A 3TOSA 5AH0A 4JHLA 3B6KA 3GROA 3OC0A 1E77A 4MDHA 1ACJA 4EY3A 4UUBA 3K16A 2WJZB 1LFDB 1SN7A 1IB6A 1VYUA 3LTEA 4I1RA 1OBCA 2HU2A 1TIPA 1CR6A 1HURA 1IK4A 4NG5A 2HJSA 5M2QA 3OY2A 4AJ1A 2WTXA 3LMKA 2J7KA 2O4UX 1RHQA 2Z30A 4I9FA 4TWZA 5K3AA 1IVSA 1YR9A 3KQLA 4OFZA 3GXOA 3BJEA 4GZMA 5CP8A 5EJGA 4FFBA 3AERA 3SX4A 3AGPA 2E0IA 4Z9YA 4BMXA 3JARB 4DMRA 3HXTA 1YBFA 2R2AA 4UNQA 3X2EA 1N6HA 4BQSA 1QLHA 4H1VA 3G6KA 1W30A 2F7SA 5KS2A 1Z7GA 1VHWA 4QL3A 1T1RA 4PZAA 5BNIA 4UTNA 1JQKA 2JATA 5IU6A 3OIGA 1T1SA 4CIXA 4CKBA 1A96A 1J90A 4B2IA 2JLUA 3KWFA 1AUVA 2BYTA 4YMWA 2HBRA 3HFRA 3MWDA 4JBIA 4Q12A 3B9BA 3EE6A 2ZYDA 4BAZA 1XZ8A 3C8UA 1Z6ZA 3C7KA 1UPAA 3C39A 2PPVA 4U7GA 3O73A 2H7YA 4HAIA 4BE7B 2IELA 3JD1A 5AI4A 2CFZA 2HJHA 2ISSD 4GQBA 1MH9A 5EJ4A 5EJ6A 1OTYA 3UJ8A 2W2OA 1P5JA 3GRAA 3HACA 5KNCA 4A8JA 4F72A 3BPSA 3SKXA 1E1KA 2GEKA 3FTEA 2C95A 3B70A 1DZ3A 3KYCA 4AB1A 2QTHA 3KUXA 3OZGA 1OLUA 3PE4A 1A7JA 1YSCA 4IO1A 4N0QA 5F5LA 2RGNC 1JA1A 5DB4A 1K27A 4CW7A 2ZSKA 3NG1A 3HL0A 3MJFA 3LZ6A 4PM4A 1GTSA 3FZQA 4AY4A 2GAFA 3WE7A 4I4NA 3EH2A 3MMNA 1P80A 3STVA 3TBKA 4B2PA 1E9CA 2BEJA 4DV6B 2XVMA 3NM6B 4BQPA 1EVJA 1ID1A 1BG6A 2FWRA 4H4DA 4BP3A 1H0HA 1TECE 4J2TA 1CUXA 5FPQA 4KO4S 3IA7A 4WZAB 4DIFA 2IYEA 4UE6A 2G09A 5JQWA 2VTBA 2ZSUA 3NEJA 4PC7A 3T1QA 1ID8A 2B30A 2VWGA 2Y1XA 5CA0A 1Q0PA 2J46A 3ZIUA 1XROA 1RYYA 1FLAA 5A6VA 5ERGB 4WNCA 4A2QA 4UOEA 3L5OA 3GW8A 4PSUA 2J6BA 2XNKA 2SBTA 3RIYA 1B3BA 5DM1A 5JEEA 3ZDBA 2CLFB 1TTHA 1IBMB 1N2CE 2OCXA 4C0JA 3DGFC 3TRDA 4JB2A 2EJVA 3A0RB 3BDIA 1KDYA 2BF7A 4B6RA 3WYFA 4CKXA 5GJVC 2PY6A 4I9GA 4LHWA 4OHCA 5FOSA 1VGVA 5ERYA 4JLVA 1XRPA 1FU4A 1ISMA 4HRYA 5DDIP 1PDWA 2ZJOA 1E2MA 1LS6A 1QB8A 1VKOA 1WHTB 2W6MA 1VE5A 3MILA 3GXBA 4M0DA 4DBLC 1YMQA 1FNSA 4KODA 3EVZA 2G7MC 2P65A 1SVWA 1KK0A 5DASA 1HLFA 5B58T 2UU9B 4GG1A 5LNK6 1QVVA 1W1IA 1H05A 4QBGB 4Q9LA 4E32A 1SOMA 2ZBRA 3Q72A 4KO2S 2ZRDA 4BZZA 2VPTA 3BSSA 1ABEA 1Q1AA 4KWIA 1HTBA 3EB9A 5BN3A 1JTVA 3PRKE 3DBHB 4QOIA 3CU5A 4H35A 1DRVA 1KZGB 3P2KA 4IQ8A 1TL7C 3BD8A 3BJRA 3MWEB 5IT9A 1D2HA 2HIAA 3B6JA 4ZI3A 5JH7B 3ET4A 1G1AA 1JLHA 3AF0A 3PTLA 4P7KA 3ZHOA 3WNDA 3K53A 2BI8A 2YXEA 1JVNA 1QC5A 2OY0A 3AQIA 4IPTA 2WV7A 4G81A 4KDCA 3SC3A 4K8OA 4ENTA 4IJWA 3MJEA 2NO5A 4ZVKA 3FDZA 5LP6F 1XA0A 2PGXA 1C9EA 3DZ8A 5EMMA 1IJKA 3DDZX 1L5RA 1GXSA 3I9NA 2JGIA 4PYMA 3IC5A 3TOZA 3UJAA 4IEFB 4DLXA 3QK7A 4XM0A 2O57A 3LIIA 4WADA 1C2TA 4MQBA 4ZKDA 4J16A 3LHDA 3ZZTA 1U4OA 2ZFUA 2XNSA 2G1PA 1WCYA 1CEQA 1FUUA 1L5NA 1L5GB 3WLMA 1I7SB 3EFEA 3BFJA 4CI9A 4Z4GA 3O0TA 3R3WA 1Y82A 1I24A 5F5NA 4D82A 1OH8A 3HK2A 2H63A 2BFMA 5F73A 5HFAA 4P35A 1V25A 1MHTA 3DNFA 1X0XA 1R3UA 3SC4A 3IOBA 1BJKA 1RVDA 1Y9DA 2PMCA 2W48A 4FINA 3EEBA 1QJCA 2IUEA 4FCWA 3LC7O 1STOA 1X80B 1QSGA 3OETA 4GEKA 3O93A 4J7CA 1BKYA 1U0OC 1YUNA 4H0FA 4Z1MA 1S01A 3LLSA 4E12A 4AUMA 3OJ0A 3Q9NA 3KXDA 3GNSA 4KUGA 1BEEA 1J22A 1PO7A 1M66A 1P1HA 1U2RA 1ZD2P 1Z0DA 2MHCA 4IJKA 2RJ3A 3RI3A 1YBAA 5ABPA 4GP7A 4W8HA 1A9XB 3KL4A 1ENYA 1JV2B 2HADA 4NMXB 2FPIB 4G8BA 3FF4A 4HNGA 4WT7A 3K20A 4XB6B 2W4MA 4LRYA 4O29A 1I6WA 1P2DA 4WNIA 2ZW9A 1XQXA 3TFQA 3V32A 3WIOA 2DFTA 4ZIRA 2A9FA 2FK8A 3TOCA 3FA2A 1OXUA 4NBKA 4DC0A 3G2QA 3R3UA 4KQFA 4TMXA 3EVDA 3ZWAA 2O2IA 2QN8A 4E15A 4TXMA 1OAOA 4LOJA 2AFRA 4ESOA 1IU9A 1C0IA 3DV0A 4KPUB 1D4FA 1ZH8A 4DMFA 5F3DA 1F4PA 2HD4A 1ANKA 1FYDA 2QLTA 4RTJA 1WU7A 1UKVY 1W5AA 2AV6A 2G8NA 1KI6A 4GBGA 4YEDA 5IXJA 2R4QA 1T9KA 2ZJ0A 3H1AA 2FCRA 3CMMA 3OM0A 1CUBA 4FJ1A 4MW2A 4DLBA 1YJAA 4EA8A 3R3JA 4RZIA 4NDNE 2D3TA 1SU8A 2N75A 3IVCA 3JAKA 4U6NA 1CXZA 3VNQA 2I3GA 2EX1A 2HU7A 3QMWA 3C6XA 3CRZA 3MTGA 4BGDA 5JASA 1MJGA 1NE7A 3PQ5A 3I1IA 3O8OA 4PTLA 3E8MA 1KMIY 3M2PA 3M4XA 2WAXA 1J9GA 2FZCA 4N12A 1EUDB 2WVGA 2AQIA 4LNUA 1T25A 1W9MA 1NJ1A 1IY2A 3LBAA 3DE0X 4D9HA 2WD7B 1ZC3A 4EIWA 3BXPA 3HSYA 5AK3A 4KITB 2LDBA 5K03A 4INJA 5JXIA 5G02A 5JISA 4Z4CA 4DMKA 2E18A 2GARA 1W88A 2HHCA 2XYHA 4IQ4A 5DTEA 5DX8A 2EDAA 2PSFA 1WQ1R 3H8VA 2VF4X 4GUDA 3VISA 3OIWA 3C6KA 3KP1A 1SC6A 4LOHA 2P9ZA 2RK4A 2OAGA 3PJGA 4PR0A 2BM8A 2YCLA 2FUG6 4Y6LA 5IUJC 2POCA 5A5GA 3WYNA 5BOSA 4UU8A 4GF5A 4QWWA 1DVRA 3FNQA 1ODTC 1Y9AA 4O2AB 5LQMA 3EVAA 3AZQA 2Y2UA 4QM6A 1DKPA 3D64A 4OUDA 1KO7A 4TV8F 1ZGGA 3WICA 2DBQA 2DVMA 4KXNA 4Z4HA 4A27A 4MGYR 2C4HA 4BNZA 1O9GA 4A0SA 2X86A 3GRYA 3AI1A 4X1KA 1WXXA 2RMKA 4PHCA 5TMDA 4KSBA 5I51A 2NUAB 5AM4A 3WIDA 2VWQA 2WAAA 2HFKA 1N32B 5KO2A 3E0XA 2PK3A 1NUQA 3LVFO 4CE6A 1D2AA 1E62A 4LJSA 1F6WA 1CQPA 2DB3A 4JODA 4D44A 4DLTA 1I6MA 4PSAA 1KY5A 1WVMA 2NV2B 4BVKA 2Z3ZA 4MVJH 1VPLA 2I3AA 1GEEA 1Z26A 3GCGA 3NHAA 1ZESA 3EQ8A 1HZZA 2ZE7A 3R09A 4O1HA 1DKUA 4AS1A 3MRXA 4W5NA 2XHZA 1C2YA 1SY7A 4BMSA 2CB9A 3HDTA 2O7QA 1Y3BE 2DTDA 5JXWA 5CLQA 2DUUA 2H2WA 2IDKA 1P45A 3LPLA 4BZXA 3FH0A 5L3QA 5KDDA 2ZUWA 3PHIA 5IKEA 4NHEA 3GFGA 4R71A 3QFHA 1VJRA 1JU4A 4WA8A 3ZLTA 5CB4F 2PUVA 1HRDA 2JFVA 3BAFA 4K1LA 4XX0A 5F1PA 1AKQA 1DUVG 2B21A 4AC9A 3RTEA 3CN7A 3SHFA 2QENA 4HT3B 5BRJA 4MARA 3ZDCA 5IJ9A 3NTRA 1UC4B 1EUCA 4KQKA 1PS9A 1C9MA 3I2FA 2EZUA 4JVSB 1LCIA 4JP3A 4LA4A 4C6TB 4DR1B 1U7WA 3JD0A 4LDQA 1I9CA 4PQYA 4XDHA 3EXG1 3HM2A 3MD9A 2QGFA 4E7OA 2H7XA 3FUWA 3MJ4A 3AGQA 5DN6D 2BCEA 2NLOA 1QANA 1QV6A 3OQJA 2ZULA 1K7XB 4OJMX 4B76A 4MO2A 1SVNA 2IUUA 4EA6A 5A02A 5CDHA 4Q3AA 2CFSA 2BMAA 4NAVA 1LW7A 3E35A 3COJA 4HB4A 1JR4A 5CVDA 1PR0A 1HYHA 4QBTA 3USES 1Z3CA 2NYAA 4UM9D 3ZDXB 2NUPB 1E1RD 1JDUA 3H1TA 1Y4DE 4V0OA 3WSTA 5FUQA 2RE8A 2NNLD 3EVEA 5DYIA 4Z2AA 3IR6A 3W9BA 3DAYA 1Y8RB 2GM4A 4WV3A 2IUYA 1JJBA 3OZVA 2AW3A 3R5XA 4OQPA 3W8FA 4CJXA 4PXAA 2OL4A 2PQ0A 4H1UA 5B6PA 2C3UA 1XGKA 4ZVRA 4BIMA 3CZ5A 3QLJA 1TT5A 3X1YA 1K89A 1ORIA 4HX9A 3VOSA 4ZU1X 3O3OB 3UA4A 2GZAA 2GD2A 2H1CA 2PTHA 3AHHA 3DZDA 1HOTA 4MVJA 4F60A 1FMCA 2H92A 2YWEA 3S2UA 3BF7A 2OEPA 3HJHA 4QYWA 4PLTA 5CYGA 5TX7A 3OX3A 3I5UA 4ZCLA 1SUEA 2ZSAA 4K8RB 4BMYA 2YVKA 5GJWC 3WYBA 2Q9UA 3AP3A 5K6TA 4P84A 2WD9A 5CCBA 1JLSA 3PNQA 4QHTA 4L4YA 2VHYA 3I76A 1YR3A 1F14A 3QSGA 1O8BA 2A5FA 2IOQA 3GRZA 1J8VA 1A82A 3IUQA 1USGA 2YY6A 3B6IA 2HLHA 3JQ6A 1KOJA 3N58A 4WZBA 3PUWA 3RVBA 3W5HA 2D8MA 2Z2JA 1Q16A 3PFGA 4XA8A 1M0TA 1TA9A 1M2VA 2W6JD 3AHDA 1GU0A 1TUEA 2QXUA 1K2WA 3WGHA 1GSHA 2ORYA 2Y1CA 1PKXA 3DEFA 2OAQ1 3RAGA 4JI3B 3U4QA 4YT2A 2VTEA 3LLVA 2QJRA 3Q7TA 2JGJA 4ID3A 5AO9A 5EIOA 3W8RA 4MUMA 4MAFA 5LDHA 3PNVA 2R1VA 5EY5B 3KSAC 3R74A 5KTRA 2G17A 3HZRA 1P1FA 3ANMA 4EUSA 4YMGA 4I4TB 1O6ZA 3F47A 1DTSA 1E64A 2IY8A 2J4FA 2O48X 3CLRC 3N0WA 4Q4LA 1QHYA 1EA7A 3OCUA 2R5FA 4JY7A 2DUMA 2JBWA 2JAOA 3H6GA 2O3TA 3CX8A 4FGSA 3MT8A 1EVEA 1KGDA 2QTAA 3N8DA 4LNUB 1U8ZA 3TINA 1XZBA 1EUDA 2JF0A 3COPA 4Q1EA 3F7NA 1D3AA 3ROQA 1WXIA 3NV7A 3GLIB 1TO2E 2JAQA 3U09A 1U0FA 2JIRA 4JN6B 4CUZA 5EJ7A 4US1R 3RKSA 3A7EA 3WISA 1Y33E 2PGIA 4RS3A 2WICA 4IHJB 2OSVA 3KOXA 5FWYB 5AW6A 5JAOA 4A2CA 2P9TA 3O8NA 1H0RA 1QGYA 3TZQA 5I47A 5DSZA 4H60A 5D87A 3K2QA 3C3JA 1PEYA 4FXOA 4OBXA 1EJBA 1B0UA 4G85A 1NKSA 2EP5A 4JX9A 1FTSA 1B8NA 1SK8A 2B5VA 2ZJBA 2BTOA 1XZPA 4G0OA 4HHEA 4TYWA 1QYVA 2CHUA 4JB0A 5AUQA 5TARA 4DNOA 3CLHA 4OGWA 2BCGY 2B7BA 1U1EA 3ABQB 3R75A 2QI9C 4QYSA 2PWZA 1HQYE 3H5AA 5JHHB 3U56A 1T2EA 4UU0A 4QSHA 5BN5B 1LLFA 4QECA 1A4UA 2R7LA 1TKAA 4QYMA 2FA9A 4P3YA 1T9DA 1XZFA 2VHEA 4DMMA 1ZUNB 4LVNA 4WBSA 1AQNA 5IVKA 3ITDA 3AP1A 1C1XB 3BYZA 4JELA 4F6LA 1DX9A 2VPYA 5FWNA 5JCJD 5ED0A 5FTJA 4DV4B 3FYCA 4X97A 1Z8NA 5C4IA 1COWA 4N7RA 4RVSA 1VB5A 3C70A 4V2IA 4MB0A 2BI7A 3LHIA 4BASA 5G0TA 2F3UA 1K6MA 3O9ZA 2H1HA 4JEIA 5KVSA 1SOUA 3TZ6A 4AAYA 4IV0A 1GGFA 1FJGB 3AEXA 4NBLA 1U0JA 4BNXA 2JA1A 4NU5A 3SI7A 2DLDA 4P86A 4GVLA 1EUZA 3H1PA 1DC8A 3WLIA 4KG7A 1QTRA 4G63A 1RRMA 5IC4A 1LVUA 4LI0A 1XZCA 4QU8A 3EPLA 5IVHA 1P4HA 4L02A 3UY4A 1DHTA 5KMGB 2VN8A 3BIXA 3OQHA 5ECYA 3VGPA 1V3QE 2XLBA 4ZVUA 4EB6B 2PS3A 3N6XA 4FILA 2FMKA 1U5BA 1F3OA 1QHHB 2UZIR 2Z09A 2AOTB 3UXYA 2ACKA 1E1QA 1BKSB 1VG1A 2HMYB 4OK6A 4MB2A 4QHSA 5EIBC 4BQIA 2ZPUA 1UZLA 3WI7A 1CUVA 1RW4A 2BEWA 1Z2NX 4I5FA 2OV4A 1N77A 1UAGA 1QF7A 2OESA 4PRZA 2ZDQA 2BUAA 3EA4A 4JDUA 4XQEA 3SXJA 4IS2A 4ZHQF 2HA4A 2JRLA 1OXBB 2P1RA 2RBEA 3COVA 4YYEA 5HZMA 4OQLA 5DHTA 3V00A 3NBZC 2OCYC 2IYUA 2ZIFA 1KK3A 2QSUA 1JQBA 3L7IA 3PC7A 5EWJA 2CVOA 2IW1A 3N0VA 4ZTBA 1Z2DA 2DJ5A 2XEXA 3IP7A 3ITNA 1U9ZA 1U0SY 4LKRA 1F2UA 4N39A 1FUKA 4WLFA 4YJ2F 5T4FA 1Y9JA 4YV1A 1HDYA 4MWGA 3GDGA 3QX8A 1V1MB 4EARA 3A14A 4Z7JA 1Y6JA 1ESNA 1UBFA 2N0SA 3I39X 4J29A 2LE0A 5HWSA 5JT1A 5JBNA 2VFAA 2ENUA 2WDPA 1DPFA 3KZ1E 4JIMA 3ECAA 2MR5A 4B4VA 4B3JA 1JEEA 2JDID 5IC5A 3X1KA 4GBED 5KHAA 1KZ9A 4QO8A 1RMQA 2WU3A 1WDTA 3I01M 4LRSB 2GLTA 4KIFA 1TTTA 2ZYIA 5L3ZA 5FOWA 2ZUVA 4B3FX 3BDQA 2PZKA 4GYYA 4F5DA 2CLMB 4BFUA 5KYYB 2GS9A 3A1FA 2BR4A 1E0AA 1A72A 3P2MA 4EA9A 1Y81A 4ESVA 3AI3A 4ZOLF 2XTNA 1HTWA 3MLEA 3DD5A 3O4FA 3TBFA 4I6EA 4Z2YA 3DMDA 3IIMA 3AONB 3LH5A 4EL0A 2WWTA 4J9VA 4CFZA 4W5JA 1RYNA 3DCNA 1YJQA 2BGRA 2V5AA 2H85A 1CUSA 3GBVA 1FNCA 1A7AA 1FW8A 1UDAA 5L7YA 4DA4A 1JJFA 4YT4A 5K3BA 3QP9A 1TC1A 2WW8A 3GJXC 1J1ZA 2A0XA 3OG9A 2GXUA 1A7KA 2NAFA 3TCKA 2YY5A 5IK2A 3N0RA 4TSFA 5KYNA 3QVGA 4TKMA 4N5HX 1VCMA 4YAUA 3EEQA 4RPJA 5T4HA 5KYUB 4H2DA 1UDRA 4D8UA 5GV7A 3A05A 4L8YA 3HYLA 2Z6QA 4X54A 3CR8A 2HRCA 2OBNA 1VDMA 2VH1A 3TMKA 4DWVA 1W36B 2GOYA 4FYVA 1IQPA 2I4NA 2VAPA 4ZHSA 4JI8B 1SQFA 1TU4A 4C0KA 1PZGA 5AVKA 3AKCA 3DBIA 3OZBA 3QFCA 2VPQA 4AN4A 2OFWA 4X44A 5EMJA 4YAKA 5JLJA 4RXTA 3VRHA 4R9NA 1LDNA 4IGFA 1X7WA 4M7OA 1QDLB 2JJ2D 4ARBA 2PRKA 1VI2A 2CNDA 3FRJA 1BQ3A 4UCXA 1A4IA 4AXBA 1Y48E 2XXAA 3O2SB 3K72B 1C44A 4XARA 5EJ9A 3T9FA 2ZUBA 4KLAA 2AN5A 2IHYA 3LFTA 5J4YA 3CKYA 2OMEA 2G40A 2KW5A 3GD7A 1BXRA 3I83A 1KVSA 3M83A 5BSTA 5ADVA 1AJEA 5JVDF 5A7FA 5AVZA 1C1YA 2AG0A 3C5HA 5ESWA 2YBEA 3UJDA 4QA9A 4TXHA 4JQOA 2C9YA 4HL6A 4IF4A 3TJMA 2PBLA 1EDOA 3CW8X 1P29A 3QPBA 1JQJC 3ENZA 1H2FA 4EGCB 1N3YA 3C45A 1J0XO 1GUFA 1BS1A 2GPNA 2GNAA 1E79A 3L7BA 4L76A 2NSHA 4OQNA 3OLXA 2WUFA 4YJHA 3KYDA 5H59A 4AY5A 1RRVA 2X0RA 1EVKA 3G8DA 1E9AA 3DOUA 3PA6A 4C01A 2HRZA 3OMLA 4YAOA 4D4JA 4E08A 5IKPA 5TQ0A 4WOKA 2WK1A 3PT5A 2ZM5A 4BPBA 1IN7A 4FVTA 5TGDA 1LZLA 2C5SA 3H5OA 5LQDA 2A3RA 3UICA 4HAUA 4N1AA 4JEMA 3MGGA