3SSQA

Ccmk2 - form 1 dodecamer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
b'MPIAVGMIETRGFPAVVEAADAMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVAAGVDSAKRVNGGEVLSTHIIARPHENLEYVLPIRYTEAVEQFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A CcmK2 double layer is the dominant architectural feature of the beta-carboxysomal shell facet
rcsb
molecule keywords Carbon dioxide concentrating mechanism protein
source organism Thermosynechococcus elongatus
molecule tags Structural protein
total genus 26
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ssqA00
4OX8A 4P2SA 4QIEA 4OLPA 4RBTA 3SSSA 3DNCA 2A1BA 4QIFA 4AXIA 3PACA 5L38A 4RBVA 3I96A 4P7TA 4PPDA 2EWHA 4OX6A 2A18A 3SSRA 4DDFA 2A10A 4AXJA 3I6PA 3VCDA 3CGIA 3CIMA 3MPYA 4LIWA 3NWGA 4QIVA 3NGKA 2G13A 4QIGA 4OLOA 3IA0A 3MPWA 3N79A 3BN4A 3SSQA 4P7VA 3H8YA 4RBUA 5DJBA 4OX7A 3DN9A
chains in the Genus database with same CATH superfamily
3SXLA 1X5SA 2NYHA 2KZMA 3RTVA 2GHPA 3F0NA 4DL7A 5B0EA 4MH8A 2B0GA 1YZ7A 3NGKA 3KK1B 3K5LA 1U1RA 3KK1A 1S49A 4MKYA 2GO8A 3NS6A 1ITPA 2MZQA 3TX0A 1HW9A 2OTJS 3TQEA 2FJWA 2Y1LB 2MZTA 4MIBA 3ILLA 1S4EA 3O1LA 2IYGA 2VUGA 2BOAA 1KONA 5DGAA 3MUVP 5DDRC 3RRKA 4DX5A 3OV7A 3M2RB 1PSDA 3M7VA 1VRTA 3M2RA 1FJCA 4NE9C 3MTJA 2VA2A 3BYRA 2Y1JA 3U1NA 1UVIA 1KP6A 3L95X 2FVPA 1G3OA 4I2PB 2AP6A 4I2PA 1ZM3A 2NREA 2X1AA 2KXHA 3GFZA 4O3NA 2XCAA 3PW5A 2XYHB 2KT3A 3M2UB 1OMSA 2CFXA 4F0KA 2AEMA 2W2PP 5C7PA 4OZ0A 3EE3A 2XZDB 2YX1A 2GAHC 3TA0A 4K4XA 2PMHA 3MMAB 3MMBB 2ZH4A 1RZMA 2W8LA 3MMBA 3DXBA 2VBYA 4LRCA 1TKDA 3I4HX 5KT6A 2DNRA 2FVSA 1RWPB 4EO6A 1KC8T 3ZZTA 1IWAA 3W60A 3K5OA 1RI7A 3MECA 5KFBA 4LF4F 5CCMA 2N7YA 1XIQA 3QGHA 4IO9Q 1RP5A 3FBEA 1X4FA 3LPEA 3PO4A 1Q8KA 4CLWA 4IG0B 4C8YA 4IG0A 1APSA 2YQ0A 2XZTB 1QVGR 5J2NB 3UR0A 2YWFA 3GQCA 4ZVSB 2B9EA 4PAAA 1PC4A 3ZZZA 4ANCA 1Y7PA 5J2NA 1H73A 2IFXA 3A3NB 2E1RA 1ZTWA 2IBKA 2C3OA 3CCWA 4JV1A 3D2WA 2XS7A 2YNHB 3LP0A 2CKWA 2YNHA 1R7IA 3R6GB 1IBMJ 3QT7A 5D8HB 1F5BA 3IBWA 1SC6A 2W8KA 3I56S 4YR2A 3VTIA 5L9XA 3G6YA 2LXUA 1F2HA 1V6HA 2XQCA 4B17A 5F8MA 3AQOA 2CQPA 4Y3CA 1CULB 4I6YA 1Z4UA 2YKNB 1TFWA 4RUBA 3NGRA 4L6V3 1IWGA 4C98A 2FUG9 2R3VA 4DFJA 1N33J 1BQXA 2NR0A 5IZHA 4NASA 2E5HA 4ZP8A 3IP0A 2QSFA 1RWOB 1QLNA 2UVRA 3LWLA 4P10A 1LW2B 4ZDNA 2YNGA 3W65A 2ZOFA 3W66A 4NLOA 2UUCF 1NK4A 3CCVS 9RUBA 1R0CB 4LIWA 1Q82T 2UUBF 5D15A 4ETZA 3SQOP 5K5MA 1RT2A 1U1OA 1Q1KA 2XGPA 3LW5C 2N3OA 2PDAA 2E44A 3GJTB 5KFKA 1I3OB 1S72S 2UUAJ 1BMQB 2IPOB 2YWGA 2MZRA 2JH3A 1F0XA 2BJ8A 3R27A 1RDRA 4DSIA 1WACA 4FYWB 4USVA 4F02A 5F8GA 4DR7J 3OR2B 4B3SF 3OR2A 1NHVA 4LQ9A 4KYZA 1D1UA 5KFRA 3CCSS 2EFQA 4M8LA 2HHVA 1KS2A 3KLFB 4DL0C 4ID8A 2V2VA 4C0OC 3KLFA 1EZZB 2IBOA 2LKZA 1WC6A 3QT8A 1WC3A 3OL8A 1QM9A 2EKNA 3EX7B 4DFMA 1HNVB 3KK3B 2LFVA 3OSPA 1HNVA 4UUXA 2IC3B 3KK3A 2VQFJ 3SV3A 3IAM9 2Y1RI 1TAUA 2IC3A 2KL8A 2COLA 1NK6A 4TU9A 1X5PA 3CTRA 1FRIA 3D54A 4I67A 3CMAS 3D1QA 2CQ3A 1CS4B 4ZJOA 1P9QC 2R7OA 1SXLA 4ZPAA 2ZH8A 4HTIA 2WVCA 1YVFA 2R8GA 4LR9A 2B4VA 1HNXF 5DZ7A 5GAEI 1YBTA 2ZE2B 5HAOA 3NL0A 1U7LA 2ZE2A 4LBHA 4JI2J 3CGIA 4DSKA 2A3JA 1QY7A 3C15B 3HHLA 3ONQA 4YY3F 2UUWA 2W2NP 2JDJA 1FDDA 1S1VB 1CQNA 2HS3A 4ZCKA 1S1VA 2V67A 2AHOB 4TNOA 3AT1B 4DSEA 2EG2A 2DGVA 4JI5F 4KH1B 2V68A 4OI4A 3W8PA 4HACB 4HACA 3BO3A 4F25A 2YNFA 3R5GA 3JSMA 1HFEL 4BLGA 1PAEX 3UFCX 3MUMP 4FPRA 4B02A 4E98A 1KTQA 1QTMA 3BBCA 1LOUA 1MSWD 4FKXA 4LF5F 5HMWA 2C3YA 2XMMA 5CAAA 3LOUA 3T5JA 3K59A 5DETA 4X64J 3FSIA 2Q43A 1RISA 2ZH7A 4WTOB 3UN2A 3ZZ0A 4OYOA 1AT1B 5EWFA 1J5EJ 1NBEB 3AODA 3ZZPA 2B6AA 2GC8A 2EBEA 2BM1A 6FD1A 4WYWA 4KO0B 1MMNA 2F9JA 1YJUA 4KO0A 2G13A 1NAQA 3CCMS 4JI6J 4M5JA 3CJ5A 4BWMA 2BQRA 5M2RA 1VHIA 3M8QB 4DL4A 1Q0NA 3KLIB 1KEKA 3Q23A 4GKKF 3DC2A 1OPIA 2YPYA 2DEJA 2ZH5A 4IQXA 3P5TL 4GRSA 2O67A 2WHOA 2QA4G 1XR5A 2P8IA 3U7JA 2HG4A 4QYRA 4Z37A 5M2UA 4USTA 1WWHA 3ENAA 5EN1A 3KG1A 2E1MC 3THVA 1PO6A 5HROA 4LREA 2C22A 3H4DA 1YX2A 1NPPA 1VRQC 3TA1A 4PCQA 2GA7A 3HDSA 3OFGA 4ID5B 3KKFA 3PEJA 4RBUA 2IIHA 3HCXA 4QW9A 3OTOF 4ID5A 3PTWA 3ZZOA 1Q16B 4WCEQ 2HHTA 1ICEB 2ZJPQ 3MEGB 8RUCA 2MSSA 3GE9A 3MM5B 2W01A 3MEGA 1SUQB 5GAEU 5KFVA 4M5IA 4X4TA 1ZOTA 3OJUA 1SUQA 3H90A 1FTCA 2G1DA 3V2UC 3UDEA 3C3LA 5DRKA 4WIQA 5SUHA 3K5NA 2BW7A 4NYPA 3QATA 4X66J 2HVEA 2B5JB 2AGOA 1IVZA 2I6WA 2FY8A 3ICLA 4YR3A 2DRBA 4WYLA 4DQPA 5B0GA 1S57A 3DHXA 2OMLA 2VU5A 4YHHJ 2HQGA 1OY6A 1O6XA 1HNIB 4F4WA 3JYTA 2Y1IA 3RR7A 2XB2D 1S9FA 4ED3A 1VFJA 5KT4A 4CNYA 2J0QD 1SL0A 2VPXB 4UOFA 4F3MA 1Q7YT 2FVQA 3NS5A 2R2TA 3AXKA 2HS4A 3HPOA 4QCLA 3JSRA 5C42B 2DH9A 2BEFA 1PJ7A 4PWWA 5C42A 4WXOA 3PXGa 2B43A 1R6YA 5H9FK 1S77D 3QO9B 1H2VZ 4LJMA 3GONA 2UU9J 1VRUB 4NLPA 1LK5A 1WD6A 4QYZJ 2Q79A 3DLBA 1Y3KA 2HHHJ 2V2QA 1RT7B 2PT0A 5CA5A 4DS5A 5DGBA 2AV5A 4GO7X 2WVDA 2GIFA 4UTGA 1RT7A 1CEZA 1PBUA 2MKHA 2HBRB 4K5SA 3NCPA 2ZITA 2JC1A 2V0NA 2PMWA 3CW2C 2GMLA 1UVMA 3L09A 4OX9F 2QSWA 3CDBA 3RUBL 2HGMA 4Y2IA 2E5GA 5HMXA 1HHQA 4OJHA 4C3LA 1AA1B 1K1QA 4ZP9A 4W90B 3SYZA 4OIXA 3MPUB 4YR0A 3KG0A 4B3OA 1UEKA 2EPIA 1T9TA 3I96A 5KG0A 3T1HF 2XNQA 4H4OB 3PW4A 3OTBA 2J5AA 4H4OA 2RS2A 4H4KC 4KV8A 4DPUA 3QRPA 4M1KA 5AE2A 3IN5A 4KRWA 3TO8A 4J9LA 3EVWA 2E5IA 3K57A 2ZHBA 3OR1B 5LMUJ 2B56A 3KUEA 4U8VA 3OR1A 5HP1B 2WTFA 2XMUA 1H2TZ 3AJ2A 3AD9C 4QPTA 1AUDA 2NXNA 1Y0HA 4MIWA 2IM3A 3OPKA 1WG5A 2HLTA 4Q0BB 3S7RA 3FC9A 4BC7A 2C42A 1CC8A 4J9OA 4Q0BA 4RBTA 2MKJA 1ROFA 2VFRA 3HHLD 3PG9A 3VGTA 4DS4A 1YDLA 1YITS 1NDPA 3DYAB 4ZPCA 1V9OA 3F73A 1MROB 1BWEA 3DYAA 1PCAA 4J7CA 2WCXA 1MROA 4QIEA 3I9ZA 1M1KT 1HMVA 3DOMB 4I1TA 1VS3A 2M2BA 3DOMA 1RT6B 3IM8A 4QIGA 2Z2ZA 2YWKA 1WKKA 2DB1A 4NX9A 3RZAA 3LANA 2KFZA 3CIZA 1LNQA 2VZ9A 4ECZA 5B0CA 1UJ4A 1ELOA 4MIAA 3FSXA 5L39A 4CDIA 2DHSA 2B51A 4DV7F 1SQEA 1YRUA 2ASLA 2W2OP 3MAAA 4OYBA 1G1XA 5EWEA 1ZPVA 4FKYA 4QWDA 3MR7A 3C14B 2NPIA 3DU6A 5A6PA 5IQ6A 3GP9A 2DHAA 1FFGB 3GLJA 4FYDA 1FNOA 2J9DE 2G0CA 1ZA1B 6AT1B 4DUTA 3TZWA 2D3UA 3ZXWA 4RW6B 2OH2A 5IV4A 4HDHA 1QJHA 4B9UA 2B3TB 1I5OB 2N82B 4Y2CA 2H5IB 4KR0B 1R31A 1VR6A 2F8HA 3DDKA 5JUMA 3PZPA 3Q8RB 4Q5VA 3KLGB 4HTJA 1WNEA 2GZOA 4PABA 3KLGA 2H9ZA 1UL3A 5A0YB 1RXOB 2BJ9A 4FF2A 1XJWB 4PPZA 4KPYA 1KQSR 1K44A 3OVAA 1FE0A 1BQMB 1UFKA 3BKTA 1JNZB 1BQMA 3CJSA 3QBCA 3GFXA 3IXQA 2FGOA 2LLZA 4ES2A 3RAMA 1UA1A 1P8GA 2N4DA 2EEYA 4DDFA 4B3RJ 1SKSA 3V81B 4QW8A 5JMNA 4KBIA 4R0EA 4U8YA 1T94A 5KG6A 2CADA 3KHGA 1VBZA 4RU9A 2QGFB 4ZN1A 3HVTB 2JEIA 1RB0A 1LXNA 3HVTA 1AUSL 3SI8A 4BBYA 4OHYA 2BACA 3IG1A 1HQUA 4O4RA 1IKWB 2F9DA 2HQDA 5E3CA 1DQ9A 4K4TA 2L08A 4ZMMA 1K8AT 4TQRA 1IKWA 2LYVA 5HK4A 1QSYA 3J7Z5 4OZ5A 4ELTA 3VQSA 3T5KA 1R27B 4CLYA 4DR5F 2DJWA 2POKA 2YBVA 3PW0A 2JL9A 4M5KA 3R8YA 3T19A 5SZTA 2L41A 1HI0P 5A8RA 4I0WA 4EBCA 3SCKE 3H4BA 1R89A 5M2PA 3PX0A 3CJ0A 3JQJA 2FHJA 1S48A 3NBPA 4FYXB 4CI0B 1Y11A 1RAJA 2UXBJ 2ILYA 3Q8YA 2CG4A 3EDQB 1L3SA 2L9WA 2X3DA 3I32A 3QQCD 3HVRA 1VQ7S 4NWBA 2MEWA 1YIJS 1UVKA 2H5JB 3ZTRA 3D3CJ 4AYBD 4LF7J 3FMWA 3AOBA 2ILZA 3KOAA 1DQAA 2GO9A 2DY9A 4ED7A 3DLGB 3K5PA 2E9ZA 1RQ0A 1NJYA 2MGZB 3DLGA 1GAOA 3D1HA 1C1CB 3MDFA 2HBZB 4WIIA 2MGZA 3TWZA 3C8YA 1C1CA 2HWIA 5A8KB 1PJ5A 5IM0B 3UNGC 4KHMA 5A8KA 2UXBF 4WP3A 2VBWA 4DJBA 2LEAA 4C6AA 2R8JA 4UW2A 1VK8A 3EZOA 3N5BA 2W9AA 2E7XA 2EKYA 3NMRA 1WHXA 3BDEA 2V4RA 4F0HA 2EC2A 3PHEA 3GWCA 1FFWB 4U7CA 4C7QA 1SQFA 4AXJA 2LVWA 2MJNA 4LRFA 2ATCB 4ZCIA 3MPVA 2EC0A 3CJ4A 4DF8A 4J9NA 5CXTA 5B08A 4X62J 4RLEA 3W63A 2KG0A 2QG9B 5C24B 3RBXA 1R3NA 4QWBA 3OL6A 4DR1F 2HFZA 2BOPA 2V4QA 2LA6A 4DV0J 2FZKB 1LWCB 1S4FA 3CJKB 4OX6A 1FWPA 2GIRA 1LWCA 3ZO7A 2Y3YA 4TU7A 3CJKA 4QIVA 4QU6A 1ZH5A 1SC1B 2DITA 3H8YA 4TVAB 3MR5A 3I0RA 2NSCA 2W4DA 1N6QB 2GQQA 1WSVA 2MDAA 2XULA 2EW9A 3W2VB 4P74A 4HKQA 2E29A 1W25A 3W2VA 1Y5NB 2R8IA 4ZVGA 3UD4P 2ZFHA 5KFYA 3CDWA 2VPYB 3THPA 2HGNA 3DI6B 4NXMJ 4LSNA 2LA4A 4ED2A 1VLYA 2CJKA 1WTBA 2B4OA 4CWBA 2ZNZA 4KGZB 1U1MA 5T7LA 2W9CB 2Q6CA 1HPZB 2QMUB 2W9CA 4G1IA 2QL7B 4DLEA 3CDEA 4DR6J 1JLFA 1CBKA 4CO4A 3MMJA 3FBCA 3IWNC 2HRYA 1UTAA 4XPCA 3HHEA 4ANEA 2CZ9A 3MPYA 4EWTA 2VPZB 3ZNUA 1Q8LA 4OI0A 4CLTA 3VAGA 2MKSA 3HT0A 2QRRA 5RUBA 2YKPA 1VGYA 5LMNF 2F1FA 5DQIA 2QMWA 5MLCV 3OFEA 2HPUA 4ED1A 3EGVA 1UETA 4NMXA 1PYTA 5HVFA 2XBPA 2YWHA 5DLFA 5E41A 4DR6F 5D78A 4J9UE 4Q43A 1WSRA 1XEZA 3HP6A 1WJ9A 1H7WA 2DNZA 1Y9OA 1K0VA 3M9OB 2VICA 1RABB 3W9HA 5K20B 2XY7A 2K2PA 4U96A 1I51B 5KG3A 2HVZA 3HFZB 3N01A 3FQLA 2C3PA 2RAQA 3NNHA 3QWPA 4NXNF 2EFGA 1HD1A 3AFGA 1RKIA 2DGXA 2YNIB 4K2JA 2W9BB 5KFIA 2YNIA 2W9BA 3HX9A 1A9NB 3D1OA 4CM0A 3ZFVA 3QJPA 4NLUA 1RACB 1Q5YA 4ECVA 2AU0A 5EDWA 4IDKA 1JXLA 2UZAA 4A8QA 3W8GA 4LFBJ 1EP4A 2HHXA 2MQ8A 3FUYA 4IG3A 2WBRA 1TELA 3UCGA 1O5JA 3QGPA 3VAKA 1M5HA 4L76A 4JV0A 4ZITA 5LOQA 4ZLPA 3LP2B 1EIYB 1KFDA 3M30B 4BC9A 3D28A 1ZTTA 3M30A 1NPRA 2CPZA 1JNRB 4OHVA 2X1FA 4FBUA 2ATLA 3UO0A 5JVHQ 1T03B 1HWLA 1OYEA 3I87A 4Q7AA 4ZIWA 1F3FA 3HSZA 1T03A 2NPFA 4GVBB 1CQMA 2G0IA 4K4YA 1TK8A 4JUZA 1GT8A 4GVBA 2IJFA 4URGA 4LFBF 2VBXA 2F4VF 1FWLA 3DXSX 5L8RC 2KM8C 1NMEB 4ZVRB 4EGLA 3G82B 5ETLA 3EYZA 5AE3A 2C2EA 4M5GA 3G82A 3SDEB 2JLEA 1SL2A 3I9V9 1HR0F 1SV5B 4C3MA 4ZVPB 5LL6d 1HWUA 2K06A 3X3UA 5FIIA 2ZBIA 4DSFA 3Q8UA 3QIPB 3G87A 4K2XA 3E3XA 3H2LA 3J80Y 3QIPA 1KLMB 3P45B 1HNZJ 4JI1J 1KLMA 4DL3A 3BZQA 3FVYA 2JVRA 5KFQA 3VGSA 2MZSA 3HHKA 3UCUP 4OJ1A 4W98A 4K7QA 2IY5B 1H6KX 4QR0A 4P6QA 2H54B 1U2CA 1JLEB 1NHUA 4FF1A 2DNPA 4RNMA 4J9MA 3G6XA 3TANA 1JLEA 3CCES 4DG1B 1X9SA 4CIOA 4U95A 3QT5A 2J7KA 2CNOB 2WB1D 3KTQA 3ZNJ1 1XBWA 3RBEA 1RWMB 3H2VE 3TARA 3J81j 3K5MA 1NJXA 3IWXA 1RAOA 3VR1A 1FNXH 4J9QA 2ABYA 3IO1A 4HHUA 5J1NA 5IOLA 1FJ7A 4C11B 3RB0A 4GO5X 2AJQA 4C11A 4M5MA 1S97A 2MQMA 2HZVA 1B4SA 2HRTA 3FCWA 1RAFB 4WP9A 2MQOA 1O51A 1E6VB 3UE2A 3H98A 1NB2A 1E6VA 3HT3A 1Z1ZA 4RW8B 3BSCA 4W4MA 3EGWB 5E2QA 1SH0A 4RW8A 4DX6A 1FVSA 3NKYA 3HZGA 2MB0B 2HFSA 1TKXB 4MKAA 3OD2A 1GTEA 2E1PA 4HHHA 4JI4F 2C2OB 1QSSA 5K9FA 4KHPJ 2BANB 3EGNA 2BANA 5D0HA 3U02A 4ED4A 2IDLA 2ZM6F 2AYMA 3GYXB 1XC9A 1RWVB 3PRVA 3HJVA 2AT1B 3TZZA 1CJTB 3BH7B 3Q0AA 2FC8A 2EFNA 4F04B 3SV4A 5DJBA 1EAYC 1JIHA 2H4WB 3S6EA 2E1AA 2ZH3A 1JKHB 3BQ1A 1S1TB 3OXGA 4A8XA 3IMQJ 4PRFA 2GVDB 5LSRA 2XEXA 1S1TA 3E2EA 3TVKA 1TUWA 1AFIA 3PRDA 1LWEB 4DFKA 5HJYA 1LWEA 3G8QA 3R7SB 3N6LA 2Z57B 4P72A 3EPGA 5IWAJ 2AMCB 1U09A 4Q2MA 3CJ8A 4ZLNA 4F67A 5ADZA 2WVFA 3M8YA 4DL5A 3PVXA 3DFEA 3QLHB 1N56A 4X4RA 1R8HA 3QLHA 3VGVA 2ZVSA 2GW8A 1SQGA 4WU3A 3GIJA 2H5EA 4B3MF 1IR0A 5HQLA 2DTJA 3CJTA 5AT1B 1FESA 3CDAA 4LF1A 4NA3A 4Z2XA 4CTAB 3I6PA 2KHCA 3RGIA 3CCZA 4FNIA 2CQHA 4CTAA 1URRA 2VG5A 2XTJP 2BJEA 1S9GB 3ZTQA 2DNGA 1OJ4A 3J80U 4EZ9A 4J90A 3KXDA 2WZ1A 1SJ3P 2EK1A 2NXCA 2CRLA 5F0WA 4C0HA 3OUYB 2FDNA 1TKZB 4TN2A 1TKZA 3TEGA 3OSNA 4N8NA 2V8GA 3NCQA 5F41A 2H3EB 4USIA 4DU8A 1SJ1A 3KK2B 1NK5A 3GV8B 2V94A 3KK2A 1VQ8S 1FXRA 5GMDA 2RHQB 4PXEA 1FKOB 1MN7A 1FEHA 5D3GB 4PG4A 1FKOA 3WIVA 2A2DA 1KOOA 3HHDA 3OLAA 4IFYA 1U1LA 1GNKA 1VBXA 3SCJE 3R5AA 5KFNA 2GHVC 3P96A 2I5JB 4USKA 4L3NA 4PWUA 2HW3A 1OWXA 2HNYB 2WW4A 2XWXA 2QYGA 2LXFA 4GKJJ 3H40A 4QIFA 5J2QA 1SKUB 2NZCA 5KFEA 2AZ3A 3M32B 4MFBA 1IQTA 3M32A 4F3QA 1M1GA 5L46A 3DMJB 4RW4B 1JXVA 2BZ2A 2KM8B 1HARA 1IBCB 4RL1A 4DV3J 1RBLA 2EVZA 2HBYB 5B7WA 1NKEA 2JFKA 4FXWA 1VHFA 1RHJB 3E8OA 3DLKA 1U4BA 3X1LB 1OIAA 4GMKA 3MR6A 3I5BA 4GKJF 2V2ZA 3CWJA 3UVJB 3EICA 1B0PA 2VV5A 2AYGA 4CO5A 1HBUB 4P2FA 3N4WA 2LQBA 3U27A 3PKYA 4JI3J 4R25A 2GCFA 3VGUA 1TUGB 4LRAA 1WDDA 1KR4A 1NSQA 4NLSA 2GNKA 2PO4A 3BJYA 3AXMA 4ZVHA 4EUVA 1PJ6A 2JJ4D 3MFIA 1U2RA 1RHMB 2KDOA 1VLOA 2RUSA 3WC0A 5I3QA 4LSLA 1UWAA 3BM7A 2W7AA 5LXYA 3FNNA 1VIOA 3H0PA 2L48A 1SVDA 1RCOB 1RTDB 5HMZA 2BW2A 4ZK7M 1S6PB 3ZC4A 3EUNA 1H0HB 1U48A 4LFAF 1CJKB 5CCLA 4GC7A 2ALYB 2F65A 1OYDA 3JB9k 5LM7E 2BXJA 4DEZA 3CEDA 2LQ8A 3W5YA 4JI3F 3JQKA 3MTKA 3EXCX 4A8SA 2AZ1A 4LR7A 2YH1A 3M2VB 4A48A 1WEYA 2C2KB 4ILRA 2ZBQA 5HQMA 1F1BB 4DV5F 2OKQA 2RIJA 2Y8YA 4OI3A 3P4UB 1C0TA 3PYDA 1EHWA 3PACA 2ZDOA 4JP8A 2MKIA 2M7SA 3BSOA 4ED6A 4WFXA 1HNWF 1W2BR 1T02A 4N56A 3TAMA 1B99A 4LRBA 4P2SA 5KFOA 2K8GA 1P6TA 2HWHA 2X7IA 2L9DA 3GZ7A 5HATA 1N32J 4WKRA 2KFYA 1U1PA 3SFGA 5G4DA 4ED5A 2DR9A 3TUZC 3C6UB 3NGUA 1GMWA 2IVMA 3C6UA 4DBQA 4RW9B 1FJGF 1S9EB 1V3ZA 4OZ1A 4RW9A 4MYUA 1Y00A 2NLWA 1S9EA 3LP1A 3PW2A 4RBVA 2QZ8A 1RAHB 4PWDB 3V4IB 4JOUA 5AJ3J 3KWMA 1JLQB 1WOSA 4A8OA 4PWDA 3V4IA 1NJIT 1UEVA 2LP4A 2Q1LA 1JLQA 2OHDA 3V6HA 4NLXA 3LO3A 4OZ2A 3D6FB 2JEJA 3KLHB 3GG0A 4PQUB 3TZXA 3MM9A 3KLHA 4PQUA 1TL1B 4MMOA 4LF6F 1N32F 3O8WA 5IFMA 3P8BB 3OFHA 4DV2F 4CT8A 1VCTA 4EI2A 1TQLA 1X0PA 2RQKA 4N47A 4MJKA 4C8LA 1UWBA 5G0RA 4OX7A 3KJQB 1MW7A 3DRSB 3F44A 1HBNB 2K3KA 1NDLA 3DRSA 1HBNA 1Q78A 1N0UA 3TW0A 1NDKA 2LQ5A 2DIUA 3BKUA 1RWNB 4TYBA 2OFHX 3SSQA 3R9LA 4DPXA 4J9RA 4X4QA 2ACMA 3H5SA 2HZCA 1BHNA 2O01C 5AXMA 1T0TV 4B08A 2JRSA 3K17A 5KFDA 2WSEC 4WWSA 4ILLA 2F3JA 2UP1A 1PAUB 1U8SA 2GVZB 4HVZA 1KVKA 2GVZA 3MWBA 2J0SD 2OO4A 2QA2A 4CP5A 3M8WA 1N5YA 4PZVA 5KFTA 2GJFA 2ASYA 4FS2A 2QO3A 1CC7A 2RF2B 5CZXA 1F6TA 5IT9Y 4DPYA 2CQGA 2WAQD 4IFVB 4DV1F 2R2UA 4TY8B 1EB0A 4IFVA 1JQGA 1DJ0A 1S1UA 4RNNA 1MU2A 3C16A 3VAMA 3TUPA 3FEYB 5BYRA 2J6SA 3ITHB 3D67A 4Y6IA 3FBBA 3BN4A 3ITHA 4N77A 5FLXY 1T9XA 2HFOA 3Q83A 2JNJA 2KI2A 2OSQA 4QPXA 5GMKa 4K4VA 4WFBQ 3T41A 3MPDA 4TKTA 3LGNA 1KQFB 1TP7A 4M5NA 4WK1A 4DCPB 1BWVA 4OJ3A 2X1BA 3LGHA 2OPRB 3JSBA 3I4PA 4DSLA 2OPRA 3IS9B 4RWWA 1RA6A 2XMAA 2P6SA 4ECWA 3IS9A 1Y4ZB 4B9LA 5GMEA 5KG4A 2O66A 2JC0A 1B7YB 3GJSB 5CQGA 2QLJB 3W1YC 3B4DA 1DFDA 4JYAJ 4PPDA 4I68A 4F26A 4PG5A 1EETB 3P49B 2M0GB 1T9YA 4FPIA 4I69A 2UUTA 3M8RA 3VAIA 3C19A 1N36J 3D0IE 4A8YA 1IR1A 1YRXA 2LQJA 1FK9A 3LUYA 4F4YA 1LKZA 4FF4A 2VA3A 2HQ3A 1RT3B 2OPPB 1RT3A 4R5PB 3C6TB 2RKIB 2KHDA 3G6VA 1VQMS 2CVEA 2XSJB 3C6TA 2RKIA 1QAIA 2Z2YB 2NUHA 2XSJA 2B4PA 2HFUA 5BXIA 3DOKB 1JLGB 4C8NA 3DOKA 1Q8IA 1SIZA 2B9WA 5ETQA 1JLGA 4HI1A 4Y28C 3G6ES 2MMYA 2XZWA 3DU5A 3W61A 4UZBA 2FLOA 4K5RA 5KOWA 5BR8F 3BGLA 2DKOB 4NEZA 1RT1B 3PEHA 2FJDB 2Q6BA 1RT1A 3WDOA 3MM6B 3AOCA 4NYOA 4NLDA 1RT4B 3NCRA 5D0RA 4RNOA 2GGPB 3HVWA 3MM6A 3GIRA 1RT4A 4K0KF 4E8UA 4IH5A 3MAHA 4OLPA 4CO0A 1M5PC 4DV4F 3SFUA 3PFOA 5HSPA 3V5RA 1BE4A 1FJEB 1LWFB 3KHLA 1FRLA 3HSJA 3HZEA 1D3WA 2HBQB 1LWFA 4YQWA 4Y2AA 2FYXA 5H9FJ 2JZ5A 3E01B 3QSIA 3KDOA 4QOTA 4MK8A 2B7CB 2E9RX 2LECA 3CD6S 1B64A 1UW4A 3Q24A 5KFMA 4OX8A 1TZ0A 4N8OA 4LF4J 1DHMA 5F8LA 3DM2B 1R8PA 1H98A 5H9EJ 2YKAA 3BB5A 1RUSA 3M2UA 3E51A 1RAGB 4KFBB 3WX4A 1UAWA 2OEKA 1TUVA 4KFBA 3MMAA 5IT9U 1CSJA 4TY9A 4PQAA 1NM2A 3M8ZA 4WFYA 4C48A 2RT3A 3SIPB 1F3VA 4CH7A 1NK8A 2YKQA 2KRBA 2VFSA 5FLXU 3TNVA 3CUNA 2LU2A 2D3ZA 4USWA 4IOAQ 3T3FA 5LJ5Y 2LDIA 3ZZYA 4N5SA 5KT5A 4LF9F 3HFKA 1MLAA 1SH2A 4USUA 1UJ5A 1LXJA 3K2YA 2FHOB 4H4MB 1VQLS 4TYAA 4H4MA 2HQIA 4HH0A 2J8SA 3FZBA 2BRLA 2W25A 1RE1B 3FKBA 3RRHA 4V19X 2N3LA 1SCJB 3KJNB 2LEPA 3M8SA 4NYZA 3N0VA 1DLOB 2BABA 2OELA 2AF6A 3H5YA 4QJVA 2M5YA 4Z7YA 2VFVA 1XMQF 2UUCJ 1K9MT 3H25A 1JLCB 3B82A 2R7UA 4NA1A 1WF2A 1JLCA 1RWUA 3BV8A 3CJ3A 2UUBJ 3DNCA 4AQYJ 2JEFA 3PKMA 1G6BA 3UD3P 2W1BA 1RTIB 2E9TA 3NXZA 3R5CA 3FJ2A 4MAKA 1RTIA 1CULA 2V5HG 5T14A 2YKNA 4RW7B 1GX5A 2BA9A 3VF0B 1JXEA 4RW7A 4ECRA 2BV3A 3PYFA 1JJCB 3VCDA 4ZPVR 2WONB 3UDLA 1ZZFA 2IA6A 3MM7B 3BBBA 2WONA 3MM7A 5EWGA 3CCQS 1VQ5S 3LGMA 2BRKA 1LW2A 3M4XA 1VQOS 4B3SJ 2CNLB 2HLUA 2NYIA 1R8AA 2CJYB 3MXHP 2HQCA 4KGKA 2IM0A 5LT5A 2R7VA 2IMWP 4AQYF 1TFYA 3GV7B 4OI2A 2O1PA 4K4UA 4Q45A 2FLLA 1IKYB 3KMSA 2I2YA 4NZ7A 1IKYA 3W7BA 1CVJA 2V8VA 4KY3A 3QZ8A 2KJVA 2KJWA 2BMBA 1XNRF 3OVSA 1IBKJ 3BF4A 3UI3A 9ATCB 1RWWB 2JLFA 3GCWP 2PGCA 2D41A 4TU8A 2KO1A 4WF9Q 1RHQB 4AL7A 4OQJA 3AA9A 1X9MA 2C2MB 1NO8A 1OO0B 3P6YC 1Q8BA 4P52A 4K59A 1IUJA 1S7HA 3WQPA 1RHKB 2OSRA 1H3DA 4Y00A 3W62A 5I42B 3TA2A 5KFCA 1HNXJ 2HAIA 5I42A 1IKXB 1NZAA 2VODA 1T7PA 2HVIA 1VISA 2AX0A 4I4BA 1IKXA 2ZUGA 4NLGA 1X9WA 2OPSB 3UDCA 1IBKF 2OPSA 4ZCLA 1K1SA 4WZMA 4YY3J 5GVQA 2V34A 2YWEA 5J2PB 2ZOMA 1X31C 4QWEA 4JI7F 2YKMB 2AD9A 2CPFA 3G96A 5J2PA 2KKHA 1FXDA 3R1HA 2YKMA 4JV2A 4FYYB 2CQBA 3N79A 4JI5J 3R2DJ 3HD2A 2HIQA 4KSEB 4RNHA 2ZEJA 4AD6A 1CS4A 2EWHA 2J7UA 3TAQA 4MKVA 1VYAA 4RWXA 3R97A 2CPJA 2NXJA 3A3OB 3CC7S 5E33A 2ZKTA 4U7UD 2R7XA 2AW0A 2LCWA 4FS1A 2GX8A 1FD8A 1HYSB 1IBLJ 4LF5J 1JJ2R 1ZAVA 1F9EB 3PYGA 2VIHA 4P75A 3IFEA 2ZBCA 5AXLA 1N5TA 1X5OA 2V8HA 3C15A 3UQSA 1K47A 1NLKL 2HK3A 2QN6B 4YB6A 2WSCC 3LH2S 1F9HA 3O2IA 3K8VA 2H51B 2PEHA 2AWZA 4L3KA 2Z8QA 3CB4A 4XPEA 2D69A 4QWCA 1RWKB 2RRNA 1G4CA 3EVMA 3NNAA 3HSDA 2AX1A 2R7WA 2KG1A 1VOMA 5GADU 2H48B 3H5UA 1YZ6A 2ZVIA 4CLSA 3GILA 1Q53A 1OSDA 4ZLJA 3I5CA 1IBLF 4CO1A 4GKKJ 3US5A 2EFPA 1TVRB 5J2MB 2XMKA 1LFWA 4OV6A 5KFWA 3KNGA 3H7HB 5CHCB 1TVRA 5J2MA 2K7KA 1VBKA 4NLVA 2ZZMA 2AYEA 3MMCB 5HJXA 3MMCA 1VQNS 1LEOA 1F5AA 4ATNA 3DRXA 3S1TA 3P5BP 1VC5A 4DFPA 2MLYA 5DG9A 3IRWP 2DR8A 4I7FB 3NAHA 4DR3F 2K7JA 4I7FA 5CD4H 5D4LA 3OTOJ 1VQSA 3R5BA 3VALA 3VV2B 3RG6A 1QVFR 3M8QA 3WHIA 2DNYA 3KLIA 1RA7A 5J1EB 4DU7A 3RJMB 4W92B 2PFDA 1WI6A 4D3HA 4MK9A 2HNZB 3I5AA 8ATCB 1Y10A 1KSPA 4OYPA 2HNZA 3EDRB 3PCOB 2PI4A 3F41A 1XNQF 1HBOB 1XMBA 5DLGA 4URSA 5THWA 4FYVB 2W2MP 4NCGB 1IJFB 3CT9A 3MEDB 1M5OC 4NCGA 2GS8A 1SI9A 1MWZA 2GQCA 4OYIA 3EXYA 3IRXB 4E0DA 2FQQB 3CO9A 1VMBA 3IRXA 4YMEA 1NSKL 4DSJA 2CDQA 2MQQA 2OJ3A 3TAPA 4YUDA 3PIOQ 4NI2B 3LPYA 3M9MB 2HYIB 2KYZA 2WRMA 3MM5A 1SJFA 2IA0A 1EQMA 2I0XA 2VC0A 1TL7B 1TL3B 2ZH9A 1U26A 4RUAA 1TL3A 4CT9A 4ZHRB 5J1PA 4MT1A 2RQ4A 3DRPB 4ZHRA 2JX2A 5KFAA 3DLLQ 4ZLLA 3DRPA 2B5JA 2MZJA 2V4JB 2V4JA 4FF3A 3LALA 3L7PA 3MCOA 2JSXA 1S12A 4F4AA 4DLGA 2MTLA 4DWIA 2DNNA 4ITSA 2W4PA 3R7BB 2O3DA 3VQTA 4DV6J 5HI7A 5ETRA 2PN6A 5CYQB 3M8PB 1HNIA 2P2CB 2NS1B 5KG7A 1D09B 3M8PA 2CQ4A 2R7SA 2BBEA 3MR3A 3CCTA 2FZCB 1FXLA 1IM6A 2M9KA 2V69A 4UQGA 4P2XA 4DXLA 4PYDA 5D6GA 3EZUA 3W64A 5D4PA 2UVVA 4EU0A 3NGTA 3HF5A 4ZOSA 1LFPA 4OX9J 1IN0A 3DKDA 1RBOB 3TJ8A 2IRXA 4IO1A 1BY9A 4TQSA 3QO9A 2BM0A 1BD6A 2B8PA 3ULHA 5K8NA 4NL5A 2ZC3A 4HEA9 3CF5Q 4DL6A 3CCLS 1GX6A 2FB0A 2DHHA 4DV6F 1VRUA 3CMES 1DARA 4CYUB 4ZJLA 1HD0A 3GSIA 4DF4A 2BUNA 2RDDA 4LFCF 3QYYA 2APOA 2UVUA 3QJLA 1REVB 3T1HJ 4DHVA 3Q89A 4RPFA 2E5LF 2NUUG 1RJJA 5H9EK 1REVA 3MOZA 2CZVC 3MUTP 3SZ2A 1GMUA 4AL6A 4AXIA 4J5OA 3GB0A 1WOPA 2V2KA 4P7VA 3AJDA 2XI3A 1RHUB 4OMFG 1UZDA 3A12A 2C2RA 3G9CA 2P5VA 2J9CA 1C0UB 1IM4A 1C0UA 1W26A 2F4FA 2BKPA 1RYSA 1SJRA 3FBFA 2IRYA 3I0SB 1REGX 5C5JA 3I0SA 4WTYA 1CJVB 1MG7A 5IXUA 1CJVA 5IC4B 4B9NA 3G8TA 4I2QB 4NLQA 3NGDA 3B4MA 3KUGA 4I2QA 1XERA 3FCVA 2QC3A 1DAXA 2XWYA 1S76D 2CNNB 4DUYF 1C4CA 2FLNA 4MKBA 2XI2A 5A6WA 2HHSA 5LSLA 2EI5A 3N6NA 4X65J 4HR2A 5DM6Q 3RW7A 4DZ6A 1L3TA 5HP1A 2YPZA 4KAIA 5FJ4A 2DGWA 5E0OA 4J37A 4KIAA 1UA0A 1BQNB 3CCRS 3CXCR 2DPJA 1VIXA 4DQIA 1BQNA 1U24A 3AD7C 2MKYA 4JI0F 4BCAA 4YOEA 3MF5A 4DV7J 1TAQA 4M5DB 4OL8A 3FQKA 4JI8J 2RRAA 1YHQS 2P6TA 2XHCA 4M5DA 2CWKA 1SH3A 1AW0A 4J9VA 1NDCA 1SJ4P 2DEIA 1T9VA 2J9EA 2Q3PA 4FDFA 1X4EA 2YY3A 3Q2SC 2XMVA 2XGQA 2FZGB 2RH3A 4J91A 2IVFB 4M94A 5F9NA 4P71A 5AE1A 4X65F 2XLJA 1RT6A 4KKOB 1KWMA 2OMOA 3A4TA 4ZPWR 2IAJB 1U47A 3HKWA 1KFSA 4DCOB 1YLXA 1NK7A 4HL9A 1T05B 2W4CA 2VQEF 1VJWA 1T05A 2DXDA 4BHQA 3H5XA 1NSPA 3PM9A 1X4DA 4ER8A 4JI8F 4GVLA 2WVBA 2NSBA 4MYTA 2KN4A 1EKRA 2MJUA 4OV1A 3MFHA 4URQU 2MY8A 2PA8D 1NB7A 2CPYA 3HHLC 4MTPA 2XNRA 3C14A 3DOLB 2GQ2A 2AJ1A 2R42A 3DOLA 4DQQA 1BLUA 1FERA 1KRPA 3B54A 4XO0A 4P2MA 4RW6A 5E5NA 3U1LA 4DPTA 3PYEA 2PSZA 1L3VA 1YJ7A 2HEKA 2V50A 4CQ1A 4F36A 1I6JA 1YJWS 5IT4A 3D0GE 2C2ZB 2IMOA 1ZPWX 3DRYA 2SXLA 1FKAF 2J6UA 3A8IA 1N4LA 2DGUA 2VKRA 5B0BA 3OLBA 4OHWA 1VRTB 2H65B 4ZS6A 5A0YA 4A4JA 2FJXA 2QA4S 2VOPA 4IRDA 5KT3A 1NCLA 3D0HE 1MWYA 2I8EA 2AGQA 4YS2A 4CH0S 2VFTA 2B8QA 1EKSA 2DNQA 4OZJA 5GAHU 4DR5J 3QWUA 4HH1A 3BGOP 3K8WA 3O44A 1K0TA 2V8PA 3OXFA 3N9UC 3V81A 4NZ6A 1WG4A 2G1HA 2HFNA 3GYGA 1S0NA 2HVDA 3W3SA 4J9PA 3UD5A 3OQ2A 2XO7A 5IS2A 3R7NB 2LEBA 3OT9A 1S0OA 2DPIA 1F2GA 3CJQA 2P9EA 4EZ6A 3J7ZT 1EJ7L 2MHNA 1V5IB 2J0WA 2CA9A 4RNFA 3GIIA 3MECB 2YTCA 4X4OA 3KUHA 1AYEA 3D6TB 5HLFB 4QBUA 2Q66A 2RNEA 3T9NA 5HLFA 4ZPBA 3PO5A 4ECTA 2M8DB 1BGXT 2YXLA 5KTQA 2AYBA 3SMZA 4ZVUB 1HIYA 3TUJC 1QAXA 2ZH2A 2XLIA 4ZPTR 3PHTA 3UDVA 5DDPC 2XCPA 3IR7B 1XQIA 3DGVA 1URNA 1FE4A 1U25A 1P1TA 4LQ3A 2CJBA 3Q8SB 3TQ1A 4ENOA 3AB4B 1BC6A 3KHHA 1RU2A 2FGCA 3OHBA 3NY0A 2M3DA 3MCMA 3HXMA 4X4NA 2R8KA 3LP0B 2G0JA 4WJBA 1OY8A 3FEZA 4UF4A 1X7VA 4PG6A 3EVOA 1NZ8A 1VI7A 4PXBA 4WE1B 5T41A 2VG7B 3UW1A 4WE1A 5E7OB 2VG7A 2VJVA 3LQVA 2ZD1B 2V9KA 4BDPA 2ZBRA 3ENQA 2ZD1A 4XAKA 1HQEB 3CNQP 2BQUA 3QZ7A 5IM0A 1SJQA 1HQEA 2C3MA 1NXIA 3GTYX 3MI7X 2PIIA 4L74A 1HKAA 4A8FA 4B9MA 4DR1J 2KH9A 3TUIC 2I38A 7AT1B 2YQ1A 4PXCA 1OQ3A 3LAKA 1OY9A 3UN3A 4G3IA 4NZ0A 5E3AA 1ZM4A 2E7VA 3NEKA 3IWLA 2B9YA 1IBMF 2YNGB 1O0PA 1UEUA 2AJ4A 2QFIA 2AGPA 3NNCA 4ES1A 4U7UK 4IOBA 4CO3A 1B0VA 3UCZP 3SCLE 3ENVA 3Q22A 1RT2B 3FK4A 4U67Q 2RS8A 3BQ0A 1B3TA 3A8EA 2QEXS 4CLZA 4OYXA 4DN9A 3OJSA 4H4KA 4LBPA 1YG0A 3CDUA 2GJIA 2I9SA 1QDUB 1WTFA 5C24A 1N33F 2RD5C 5E3QA 1C4AA 1YRTA 4UY8T 5KT2A 4IR9A 4CLUA 1RK8A 1KD1T 2KVQE 1A0OB 3MEEB 1Q81T 4O3SA 3UWTA 4UY85 2J76E 1YKWA 3MEEA 2HVHA 3GSDA 4FXVA 1Q79A 1FVQA 1ZM2A 3Q8QB 1N6QA 5IV3A 5DS7A 5B0FA 2MPUA 2HK2A 4X4UA 1KTVA 3UPFA 2BDPA 5CZVA 2RHSB 2QIFA 3SBMA 5KG2A 4PR6A 4IRKA 3JAMY 1YJRA 3IBCB 2DR7A 4DQSA 2VPWB 1YQHA 5LMNJ 3TOQA 3DI6A 2UUAF 5D4NA 3A1YG 2D1CA 5B0AA 5KFUA 2CWXA 5H1SV 4CLKA 3AJ1A 4DUZJ 3EGZA 2HHPA 2ZDPA 1CG2A 3QNWB 1M5VC 2HIYA 1AROP 1RHRB 1HPZA 3WX8A 3CSKA 1FI4A 1N52B 3DLHA 1BUXA 4DR7F 3SEOA 1U6FA 2RSQA 3HHNB 4IYQA 4OYMA 2HNDB 3MCSA 1FTRA 2WK4A 3POTB 1U8WA 2HNDA 3POTA 5KFZA 1HW8A 3AH6A 3DDIA 1VK3A 1TU0B 1A6LA 3M6WA 3QSYB 3K7RA 4LVOP 3AD8C 4NXNJ 4PEOA 2CQDA 2G2ZA 2XO6A 3HHLB 2Z58B 3H42A 1UVJA 1N5VA 4DUZF 1S99A 3V6JA 1P9YA 2CNKB 2EFVA 2VQFF 2EBGA 1OS5A 3KMQA 3GIMA 1F9FA 1RAEB 3DHWC 1PKUA 3MD3A 3OTCA 4F3OA 3OXLA 3M6XA 2YNFB 2CQ1A 3NOGA 1X4HA 3JSMB 1HHTP 4AT1B 4ZVEA 1OPZA 1U2FA 1ZAXA 1YBAA 5E3RA 4JI2F 2ROPA 4USJC 3GCXP 3RAQA 1FA0A 2DXEA 4NLWA 1QAJA 2B6AB 2BQ3A 1CJUB 3D7SB 3JTNA 4ERDA 2E7WA 1CJUA 1YJ9S 4KHRA 4I56A 2F40A 3TR5A 3BYPA 4EYIB 4LMZA 2F8EX 5HL7Q 2F4VJ 3KLEB 2VOOA 2ZH6A 5F0UA 5EUHA 3KLEA 2CJAA 3PDNA 2QTWA 1VC0A 1RLDA 4NOHA 3R2CJ 3CO0P 1N8RT 2FD2A 1K73T 1JJHA 4I64A 2HWTA 2Z56B 1FHTA 2EFOA 1NH7A 3LP2A 1HR0J 4X64F 4IUFA 2PFFB 4ZCMA 5ETNA 1J5EF 3FSYA 5KFHA 1FX4A 4F50A 4WKYA 5JJBA 4O44B 5HROB 4O44A 2OP5A 3W5XA 1HWIA 1VBYA 3CD0A 4PKDB 4AL5A 1U0HB 1VDHA 2AEFA 2MSTA 2AEJA 4JI6F 3CC4S 1U0HA 4LR8A 4AE5A 1QUPA 5ITHA 3R5DA 1M5KC 3NOCA 5L1JA 1NK0A 3J7AN 2FHJD 5DQHA 4OHXA 4CCHA 3IR6B 2DNHA 3SDEA 4NMLA 3JAMU 1A7GE 4NPOA 3T6JA 2CIMA 1YJVA 3N28A 2DGSA 1SV5A 4BWJA 1UZHA 2GJ2A 4OYAA 2G9OA 1X4BA 4K4ZA 1TMMA 2G2OA 4WXWA 1ULRA 1QUVA 3EM1A 2KU7A 5DG7A 2JVOA 1UFWA 2B9XA 4CLLA 2V8DA 2YWWA 4XIUA 3A3PB 1N5QA 4L73A 1E6YB 5KFXA 4A8KA 3D9BA 2RB7A 1WG1A 3O3LA 3SSRA 1E6YA 1WORA 4CH1A 1JMTA 3PJXA 3GV5B 4C8MA 3MOJB 3AB2B 5C2GA 3JYTB 4KTQA 1S6QB 4DG1A 2RQMA 3BGRB 5F9LA 1S6QA 2WVEA 4EMDA 4O3PA 3JTOA 1NH8A 3BGRA 4DPWA 4F2RA 1RAIB 4JI4J 1B7FA 3D3BJ 2OTLS 3S8SA 4O3RA 1VQ9S 3AY0A 2RVJA 4X66F 3BO4A 2CPEA 2FJAB 1RKJA 2ZM6J 1UCNA 2FLPA 5K8OA 2L9NA 5BYQA 3ILIA 2FIUA 2QX0A 3CD5A 2QJ3A 1U0SA 4G65A 3IR5B 4YHHF 5KFPA 1DQ8A 1JX4A 4X84A 2KRRA 5ETOA 1S79A 3WC2A 1AZSB 4YFUA 2BYCA 2ZZTA 1AZSA 1GQEA 1TKXA 1N88A 3N6MA 2BE2B 1UPPA 2FVRA 4M95A 1FDBA 5KT7A 2BE2A 5MAOA 4UUWA 2A1BA 2RE1A 3TVYA 2JOQA 4IQMA 4CM2A 1RTJB 1ZM9A 5KFJA 1NUEA 3KFWX 3TRGA 5HN0A 4F4ZA 1RTJA 3T1AA 5HVGA 2C3UA 3TP2A 4Q2LA 2CQIA 2UU9F 2HSEB 2DK2A 1DY3A 3QRRA 2YKOA 1S59A 4RZRA 1CJTA 2QE5A 1TTHB 2HHHF 4B3OB 4F7VA 5LSOA 2DGQA 4B3MJ 1U6ZA 4M5HA 1R8CA 3CJ2A 3FRZA 2QFJA 1JKHA 4ZP6A 4HI2A 1X0FA 3VVUA 1FRMA 2GVDA 4KV8B 1UKUA 1KBRA 1WC0A 4S0MA 3M6UA 3D4JA 1FNMA 1D8YA 2VDHA 2PE8A 3ZZRA 1D9AA 1SB6A 1FRJA 3CCUS 3HSGA 2QL5B 1WC4A 4HT7A 2XY5A 1HBMB 2O5DA 1WDTA 3CVKA 1FO1A 1HBMA 1GXTA 1T95A 3I55S 3OBIA 2HFVA 2XMJA 2ZOGA 1U02A 2KYXA 1FEEA 5JXSA 4G1PA 2ADBA 4NLRA 3FGVA 4QR2A 2KB2A 6FDRA 3P3DA 3HKZD 2DVIA 2Z30B 2J0XA 1KOHA 1KHVA 1C2PA 1T3OA 3T5LA 2IM1A 2RMLA 3EWGA 3K89A 1HMVB 5EX3A 1S9GA 3MGJA 2MZ1A 5EX0A 3G71S 2IRUA 4P7TA 2B4UA 1T9WA 5LMUF 2LU1A 5K14B 3D68A 3J81Y 3OUYA 4J9SA 5K14A 2J9DA 5B0DA 3T9ZA 4YB5A 1XR7A 4PYAA 1DTQB 2N4CA 2U1AA 5L38A 1TL5A 2WB4A 2DH8A 4A8WA 4YB1P 4R0JA 1DTQA 1PGZA 2KXNB 5DO2A 2OAUA 2FPHX 3MAAB 4FN5A 1LW0B 2MKCA 2DIVA 1S1XB 3NS7B 3I82A 4OHZA 3T5HA 1LW0A 1S1XA 2R7QA 4LVNP 1KVIA 1ZAWA 2UV8A 2MXYA 5D3GA 3T6BA 1DZ5A 2DGOA 4A8MP 2C2NA 3GJRB 1Y3JA 1IXKA 2NQPA 1X60A 3PJ9A 2OFGX 2DNLA 3MM8B 2CJ9A 3FFIB 3MM8A 1KKHA 2I5JA 3FFIA 2C28A 2KZZA 5KFSA 3HM9A 3BREA 5HQ8A 2KTQA 2HNYA 4ES3A 3BR9A 4RU2A 1FF2A 1X5TA 1RLCL 2JWNA 3RAXA 1FX2A 2DRDA 1RSCA 1WF0A 3JQMA 3R5JB 4ZPDA 3FZ2A 3QMQA 1YTYA 4JV5J 2VJUA 1D9DA 1MMLA 1X4CA 1T3NA 3W5ZA 2KT5A 1V5VA 2A18A 2C2DA 4C9DA 1VQPS 3BSNA 3ZTPA 4OJGA 4IKAA 3D6HB 3DMJA 4RW4A 1S6OA 1L3UA 4QQBA 3PR4A 4ZA1A 1YBUA 2W7OA 4ZIVA 4KE5A 4LFAJ 3PX4A 5ETMA 3GFYA 5JVGQ 2HHWA 2DRAA 4OI6A 2HZAA 3HD1A 3UVJA 1J5OB 4C8KA 1HWJA 2OEMA 1HBUA 3KHRA 2KXFA 1J5OA 4RKUC 3OFFA 1Q4RA 4ELVA 3D6MB 4JV5F 5F8HA 4HYKA 2EG1A 2VC1A 4N7TA 1GXUA 4YN3B 4XTTA 3BKFA 4DV5J 1EARA 3IGNA 4DR4J 1XR6A 3IG1B 1HQUB 2XY6A 5CYJA 3AHPA 3ZTSA 4FP9A 1S5ZA 3NAIA 1AXQA 4ED8A 1XMOJ 2F63A 1YK9A 3OHAA 3QJJA 5ETSA 4C2MA 2RU3A 3V6KA 1HNWJ 4CLPA 2DD8S 2OD6A 2AJ0A 1P1LA 4DL2A 4DX8H 1RTDA 2FJBB 3KDNA 2MKKA 4B3RF 1S6PA 1C1BB 5A8RB 2Y9HA 1CJKA 1M1HA 1C1BA 1HWKA 2F7VA 1NSAA 1U1KA 2XC9A 2ASDA 3TJ9A 5IT0A 2LMIA 2XG8A 3NBPB 2HHQA 1JLBB 4ZJQA 1FJGJ 2HQFA 1JLBA 4DPOA 5AXKA 4YDDB 2OI2A 5F8IA 3M2VA 2R4FA 4DR4F 1WUUA 1T9UA 4Z7CA 2DBBA 2R2RA 3JXOA 4XDCA 4PUOB 1L5UA 1Y5LB 1XMOF 1RYRA 4PUOA 5D0EA 2DXFA 2D3O1 1GMVA 2QYCA 4P9SA 3DN9A 3TJAA 2ZJQQ 4P73A 3IAS9 4ZVQB 4B9SA 2NCKL 4LF6J 4DV2J 4KJIA 1RWXB 1Z2LA 3J81U 4UT4A 3PX6A 2IYIA 2Z2MA 3ADAC 3IGVA 3NG8A 1AFJA 2XYPB 3QIDA 4DQRA 1YJNS 4FZVA 2ZHOA 4ZP7A 5KG1A 5IQQA 3MR2A 1N0VC 3A13A 4ED0A 3D5MA 4PXDA 2QL9B 2ROGA 1RT5B 3ELHA 3PNIA 2PC6A 1RT5A 3VAHA 2QMXA 3HI9A 4LF7F 4KQZA 4X4PA 2ZZNA 2XSFA 1H72C 3DRRB 4CNZA 3DRRA 1TL1A 4UZCA 2YX4A 3RBDA 3EPIA 1VQYA 2JLGA 3O6QA 4MK7A 4LF2A 2B7BB 1KQKA 2ADCA 1XTZA 2UV8G 4ICLB 4ICLA 3RB4A 3NMAA 3QAEA 1X4AA 3AOAA 2Y8WA 2VDIA 3W9IA 4DV1J 5A8WB 2IDEA 4JBCA 2A10A 5A8WA 2NZ4A 3I0RB 2IVYA 2R7RA 2ZJRQ 4ELUA 4KGMA 1U1QA 4WFAQ 2OIHA 3BGUA 1MNEA 1VQ4S 3BS9A 5E3PA 2M8HA 3GU0A 4X62F 4LSNB 1KN6A 2RU9A 2V6AA 2VL1A 4K4WA 3KLVA 2WOMB 2K1RB 2RF2A 2WOMA 1R0AB 3PRBA 1TV6B 4G1QB 5T7LB 4DV0F 2K1RA 2CQ0A 1T11A 2VB6A 1R0AA 1TV6A 4G1QA 1ACMB 4TY8A 1H74A 2F8MA 2Z2LA 1WC5A 4CZCA 1GH8A 3OVBA 1JLFB 1H7XA 3GG1A 2QLFB 4LRDA 4Y2KA 7FD1A 1I1GA 2WBMA 4HLBA 2BE7D 1J2VA 4M5LA 4WFNQ 2RILA 1DTTB 3G8SA 4F2SA 4Y0FA 1DTTA 1Y5IB 4IRCA 1ZA2B 2DCLA 5DQGA 1GFWB 1WELA 2GFFA 3L9ZA 3QFHA 3ILOA 2DNMA 1NU4A 2ZH1A 1W7WA 3UN5A 3VZHA 2D7SA 1YGYA 4NXMF 4LSZB 3OTDA 5C25B 1KLNA 1L3KA 1G2EA 5C25A 5HVHA 4QWAA 1HL6A 2VD3A 4QYZK 2BJ1A 1PYSB 3CD7A 3RYLA 3V4MA 4F0MA 1VC6A 1NRKA 2VASA 1EETA 5I3PA 1TL4A 5IC6B 4KGVB 1QE1B 3IBFB 1UFLA 4ECXA 1QE1A 2F5GA 5ETVA 2DGTA 5BR8J 3J7A1 3RB6A 3ZTOA 5DDOC 3TX8A 2DO0A 4OI1A 2XS2A 1CPZA 1FRXA 3KYLA 3PIPQ 1DURA 1U1NA 2MY7A 2CPHA 1J27A 2VH7A 4K0KJ 1S0VA 1LV5A 1O8BA 2OPPA 3QFWA 1S6UA 4R5PA 4DV4J 3BBFA 1G7CB 3MPWA 4KT0C 4LIRA 5KFLA 4YB7A 2PMZD 4QU7A 4B9VA 2IJNA 1FKPB 3THTA 2RQCA 1FKPA 2W7PA 3BEGB 2CPIA 4QIWD 4IDKB 3V6DB 2OD4A 2XYGB 3V6DA 1IR2A 1EP4B 1RTZA 3VZIA 1GXLA 4IG3B 1V3RA 2BR0A 3MD1A 2IM2A 5CD4A 4B3TJ 4EK2A 4NLYA 2L3MA 2MLXA 5EHHA 1NNDA 1I94J 3PJWA 4I6AA 1H38A 2GGPA 3B8HA 3NLCA 3SSSA 2W2QP 2CAJA 2WW8A 1PIEA 4K4SA 4IR1A 1SKWA 1BXNA 3ILJA 5A76A 1PG5B 1QAYA 3F56A 2Y0BB 3R3TA 3JTPA 3GYNA 2VHGA 1JK9B 2ACYA 4Y2MA 3NRBA 1IQZA 4X2BA 3E01A 2N7CA 3EMTA 1FCAA 1UVLA 4BS2A 3PW7A 2DR6A 2ASJA 1DRZA 2OEJA 8AT1B 2WSFC 5KFFA 1GTHA 1VQ6S 1HA1A 3KG4A 1FT8A 4RUHA 3RU0A 4QZVB 4I6WA 4B3TF 3TZYA 1CLFA 4F4KA 4ETXA 3DM2A 4C8OA 4DI6A 4B9TA 1I94F 3QGGA 3BPDA 5ETKA 1WHWA 4O0NA 5D0GA 4DR2J 4RO0A 2GMHA 3BR8A 4O23A 4ZKAA 2HS0A 3KJVB 4LF9J 3ET6B 4WZQA 2PEBA 3CULA 3KJVA 3ET6A 3L4BC 1NKBA 2M4MA 1WKJA 1N34J 4UQTA 1OSCA 5BJRA 1WF1A 3DCAA 4AFFA 1RADB 1M0SA 3LAMA 4XK8C 1FD2A 2X3GA 4E2FB 4NCAA 4KGXB 2QLWA 3N5FA 4OZNA 3ENWA 4ALZA 1WI8A 3AAWB 3SCIE 2D9PA 3LTOA 2NXEA 3FCHA 1PILA 3DGPB 1XMQJ 1GMWD 3PFEA 3DGPA 1TMJA 5F3ZA 1V3SA 3UNYA 2YQ3A 1Z2ZA 2BKNA 1S1WB 3BGFA 2QLBB 4NRUA 1S1WA 4DR2F 1NHKL 1FWKA 2ZKUA 2FC9A 2CJXB 3TYTA 4NA2A 1WHYA 3GR0A 3MURP 2CPDA 1N34F 3NGSA 5ETPA 2PD1A 1HNZF 4X4VA 2R8HA 3D66A 1WEZA 1ZYQA 4JI1F 3CC2S 1RCXB 1OQ6A 3ETOA 2J8AA 1WOOA 1S7IA 3VAJA 1F5CA 2XMWA 4NCBA 1DLOA 1RAAB 3CE8A 2R9LA 1QD1A 4F8RA 4OLOA 2M88A 3G4SS 1GK8A 1PYOB 1VQKS 4CO2A 2CDRB 3PV8A 4J9KA 4ZVFA 2HURA 2LQ9A 2EXUA 3K58A 2BKOA 2U2FA 3NWGA 2RJZA 2GV1A 2HMIB 3ZZUA 3M6VA 3R6LB 2HMIA 3GPAA 1DBDA 1HI1A 3M1VB 1XNRJ 5LJ3Y 2A2CA 3BPSP 2XMTA 3M1VA 2BVZA 1WHVA 3R1LA 1UJ6A 4O4GB 2EK6A 2OGUA 4O4GA 2DYAA 3CPWR 4V1Ak 4HHJA 4DOZA 4OFZA 2E66A 1U45A 2CJQA 3H20A 4O0IA 3BO2A 4LUBA 4RJVA 3LWMA 3EZ5A 3WZ0A 4DZDA 2MLZA 3AA8A 4TLRA 3Q8VA 2JFDA 5GADI 5CABA 2AQ4A 2QT7A 3VWSA 5FD1A 3Q2TC 1FRHA 2HAFA 2DT9A 3LF0A 4TXSA 4KHPF 3ETMA 1FDNA 2XM3A 3VHQA 1QTNB 3QT6A 4JI7J 4WFZA 2VBZA 3IA0A 2HGLA 3C66A 1UP1A 4EEYA 2W24A 2FVCA 1WC1A 3BN7A 1SC3B 2BX6A 2YX7A 1YJTA 3OL9A 4L72B 4DMZA 4U9RA 2ZUAA 5F3TA 3U1MA 5KOXA 1WKLA 3HFVA 4C0BA 3RRGA 2CQCA 2IHR1 5DG8A 2VFUA 3K0JA 1MMDA 3B6BA 4LBIA 4RR5A 3EJMA 4RX6A 2VG5B 1KQGB 3PR5B 5D4OA 1P27B 4FBTA 3TVZA 4U6PA 2AJFE 4CLFA 2A6OA 3UR3C 5IWAF 2GHWA 2HHUA 1KNZA 3GIKA 5GAGI 4QR1A 2FTRA 2A0FB 2OLWA 4C97A 3BSAA 4Q44A 2DH7A 2YH0A 3J7YI 2FJEB 4FVMA 1SKRA 4LT6A 1NPKA 2D74B 5L1IA 5B09A 3FDSA 4ECYA 2AKWB 2DY1A 2M52A 3GFHA 4NLTA 3DDNA 1HLWA 5DM7Q 3M05A 3PY8A 4K50A 1U6BA 1AB8A 3MZIA 4YEAA 3HK2A 2ZBPA 4WBFA 4CRJA 3SQGB 2VKZG 1HYSA 3SQGA 5HANA 3QGIA 2LXIA 5BYSA 2OUGA 4USMA 1U49A 4IFYB 4N41A 1RBAA 1SPBP 1JB0C 3TEHB 4FXDA 1KDNA 4KH0B 4AUKA 4YP3A 1LK7A 4C8ZA 3ISND 4DR3J 1ZBTA 2DCUB 1JLAB 2V63A 3HO1A 2QA1A 1JLAA 3Q86A 3HMJG 3H2UB 5J2QB 2KT2A 3ISZA 3BH6B 3KNAA 1TK0A 2R7TA 4EO8A 2VG6B 2ZC4A 1KHWA 2HRUA 1D9FA 2PA3A 2VG6A 2A6MA 2NXUA 4MFBB 4PG7A 4KB7A 5F8NA 4D3GA 1M90T 1D8ZA 3W9JA 1XNQJ 3L7UA 2DNOA 2DNKA 4N76A 1RGVA 4LF8J 5LXRA 3FEXB 3DLKB 5K8MA 2FY1A 1T8EA 3TI0A 1NJWA 4IH6A 1WEXA 3CMQA 5HO4A 2CZ4A 3DLJA 1HI8A 3RR8A 3T1YJ 3HLUA 2JEGA 3Q8PB 2VONA 4ZN3A 5A2QY 4ZVOB 1N54B 1N48A 3ISNC 2E1CA 4M63A 3BDPA 1SC4B 1D0EA 4ECUA 1R8BA 1TKTB 5J1EA 1R43A 1TKTA 4ILMA 5U47A 4LSLB 2DHGA 2K3IA 1PBAA 4DV3F 1HBOA 3C46A 3JS9A 3FMBA 4FNHA 4LF8F 2RDJA 3WIUA 5GAGU 2DISA 3J7YU 4HDGA 3MEDA 5KG5A 1S0MA 3QPIA 3T1YF 1NK9A 2FHMA 3H59A 5AXNA 2FHKA 1B0TA 4NI2A 3CCJS 3KJFB 2OPQB 2KFNA 2MYFA 2OPQA 3OW2R 2YVSA 2RDIA 2G4BA 4Q8EA 1LQ9A 1TL7A 4TLQA 3GR1A 1C0TB 1FRKA 1W2IA 3NP5A 4OZLA 1XWLA 4R8UB 2PI5A 2P9CA 2M70A 2UXCJ 4JB8B 4R8UA 2BJDA 2CQ2A 1FDAA 3TAMB 5L1KA 5CYMB 3A8KA 1JWWA 1MN9A 4A47A 1R6VA 4Y65A 5CYMA 3FRYA 1Q7LB 1XN9A 4RUCA 4G6VB 4L75A 1KVJA 4OYZA 4YDXA 2ZHAA 3L7OA 4ECSA 3L3CA 4EBEA 2GMJA 2I1RA 4IOCQ 1JJ4A 2CXEA 3RB3A 5L1LA 4UOGA 3LP1B 5CH7B 5CYQA 2Y0SD 2LDYA 3MCNA 1IKVB 1ZS6A 4LFCJ 1IKVA 2XLKA 1FFSB 4Q8FA 3GMGA 3G86A 2J6TA 2H4YB 3NWRA 2E5LJ 1QSLA 2MQPA 1S10A 2E5JA 4Y34A 2UXCF 4EBDA 1ZZNA 2CPXA 2ZWOA 2AIRB 3QRQA 2DR5A 3MM9B 2HKEA 2GIQA 4HT5A 4K8RA 4XDDA 1HQ2A 3WBZA 3BQ2A 2GAGC 1H2UX 2FJVA 4DN0A 2C1EB 1UWBB 2X1GA 2V9WA 3CIMA 5G0RB 2IJRA 4WP8A 4CYUA 5DDQC 3DLEB 1YI2S 3DLEA 5KAKA 5AJ3F 3LA0A 4FVCA 1LWXA 2JHEA 4KPCA 2MQLA 2CVIA 5HMYA 1Q95G 4ECQA 4ANDA 1HHSA 2Z4PA 3CJRA 1B70B 5L9NA 2CUYA 4DUYJ 4NRTA 4EYHB 2DO4A 4A46A 4X4SA 4C3KA 1YSJA 4KC5A 3OTEA 3G2XA 1RU1A 5I3UB 3O5TB 1GEHA 3MHYA 5I3UA 1N5YB 1M5SA 1EX8A 4OZ3A 2Z0GA 1X4GA 4JI0J 1NEEA 5A2QU 3JSYA 1S1UB 1EQ0A 1MU2B 3C16B 1PC5A 4IH7A 2KVIA 1TK5A 5F8JA 4DCJB 3IC1A 3VAFA 4V19J 5C2CA 3OL7A 1Q5VA 7FDRA 2AJ2A 4C4WA 3HVAA 3RW6A 3W2WB 1SIWB 3W2WA 2BJ3A 4ZVTB 4H54A 5EGYA 2CG8A 2ERRA 2UVWA 5FDLB 1UVNA 1XK8A 2MQNA 4NEYA 5GAHI 5FDLA 5ETTA 4O3QA 1NJZA 2RUGA 4OYWA 2ZNYA 2R2SA 4O3OA 1X8DA 3HULA 2VQEJ 2BJ7A 2DHXA 4USHA 2VF3A 4WU2A 5K8PA 2D3OR 3IM9A 1N5SA 4UOCA 1F60B 3S01A 2X51A 3QAUA 1TR0A 4PG8A 3I31A 2ALZA 3A8JA 1UPMB 3B78A 2UXDJ 1IJEB 4WK3A 5I4MA 1R0BG 4DX7A 5D77A 1FK9B 1NKCA 1MWQA 2MHEA 2RRBA 4GC6A 2XS5A 2BE9B 3MEKA 1YWXA 2CYYA 5KFGA 2J7WA 2QV6A 3HJFA 2H1YA 2D9OA 4KKOA 3C2PA 4UOHA 3VVTA 2IAJA 3MAQA 4F4XA 2QLXA 1SL1A 1ZETA 1UMJA 1Q86T 5DZ6A 2ZWPA 1VJQA 1RTHB 4JYAF 4WPAA 3GJQB 2ROEA 2G2YA 1RTHA 3M9NB 1UW9A 2UXDF 2P9GA 4EFAC 3RBZA 3AQPA 1SBRA 5HBMB 2XHWA 1N36F 5HBMA
chains in the Genus database with same CATH topology
1A9NB 3D1OA 3I5CA 1IBLF 2HNYA 3SXLA 4CO1A 4ES3A 3BR9A 3ZFVA 4RU2A 1FF2A 1X5TA 2JWNA 1X5SA 3QJPA 3RAXA 2KZMA 3US5A 2EFPA 3RTVA 1TVRB 4NLUA 2GHPA 5J2MB 2XMKA 1LFWA 5KFWA 3KNGA 5CHCB 1TVRA 1WF0A 5B0EA 4DL7A 5J2MA 4MH8A 4ZPDA 4ECVA 2B0GA 2K7KA 3FZ2A 3QMQA 4NLVA 2AU0A 1YTYA 2AYEA 2ZZMA 3MMCB 3NGKA 5EDWA 3KK1B 3K5LA 4IDKA 1JXLA 2UZAA 1U1RA 3MMCA 3KK1A 1VQNS 1S49A 4A8QA 1D9DA 4MKYA 1F5AA 1MMLA 2GO8A 3NS6A 4ATNA 1EP4A 3DRXA 2HHXA 3S1TA 2MZQA 1VC5A 4IG3A 1HW9A 2WBRA 1X4CA 4DFPA 1T3NA 3UCGA 2OTJS 2KT5A 1O5JA 3QGPA 2A18A 2C2DA 2FJWA 4C9DA 5DG9A 3VAKA 1M5HA 2MZTA 4MIBA 1VQPS 3IRWP 2DR8A 4JV0A 4I7FB 3NAHA 3O1LA 2IYGA 3BSNA 4DR3F 2K7JA 2VUGA 4OJGA 4ZLPA 4IKAA 4I7FA 3DMJA 4RW4A 1KONA 1S6OA 5CD4H 5DGAA 1L3UA 3MUVP 3LP2B 5DDRC 3RRKA 5D4LA 4QQBA 3OV7A 3M2RB 1KFDA 3PR4A 3M30B 1VQSA 4ZA1A 3R5BA 1PSDA 4BC9A 3VALA 2W7OA 3D28A 1VRTA 3M2RA 1ZTTA 1FJCA 3M30A 1QVFR 3M8QA 4KE5A 3MTJA 2VA2A 2Y1JA 2CPZA 3PX4A 3U1NA 1JNRB 4OHVA 3GFYA 5JVGQ 1UVIA 2DNYA 2DRAA 4OI6A 2HHWA 3KLIA 3L95X 4FBUA 2X1FA 2ATLA 1RA7A 2FVPA 5JVHQ 1G3OA 5J1EB 1T03B 4W92B 1HWLA 4I2PB 3I87A 4Q7AA 2AP6A 1J5OB 4C8KA 1WI6A 4D3HA 1T03A 2NPFA 1CQMA 1HWJA 4I2PA 1HBUA 4MK9A 3KHRA 4K4YA 1TK8A 2KXFA 1ZM3A 2HNZB 1J5OA 4RKUC 3I5AA 3OFFA 4JUZA 1Q4RA 1GT8A 2NREA 2X1AA 4ELVA 2KXHA 3GFZA 4O3NA 1KSPA 2HNZA 2PI4A 2XCAA 3F41A 3PW5A 1XNQF 1HBOB 1XMBA 5F8HA 4JV5F 4HYKA 2EG1A 2IJFA 2VC1A 4URGA 4LFBF 2KT3A 2VBXA 2F4VF 5DLGA 1GXUA 3DXSX 3M2UB 4URSA 5L8RC 5THWA 2KM8C 2CFXA 3IGNA 4NCGB 1XR6A 3IG1B 1HQUB 1IJFB 2XY6A 4EGLA 3CT9A 5CYJA 3MEDB 1M5OC 4NCGA 4OZ0A 1SI9A 2YX1A 3AHPA 3EYZA 4FP9A 1MWZA 3TA0A 2GQCA 5AE3A 3EXYA 2PMHA 4K4XA 3IRXB 4E0DA 2C2EA 3NAIA 1AXQA 3MMAB 3CO9A 4ED8A 3SDEB 3MMBB 3OHAA 3QJJA 2JLEA 2ZH4A 1VMBA 3IRXA 4C2MA 2RU3A 4YMEA 3V6KA 1SL2A 2W8LA 3I9V9 3MMBA 3DXBA 2DD8S 2OD6A 2VBYA 4DSJA 2CDQA 2MQQA 1HR0F 1TKDA 2OJ3A 1SV5B 4C3MA 2AJ0A 3I4HX 5KT6A 2DNRA 1P1LA 5LL6d 1HWUA 3TAPA 3X3UA 2FVSA 4YUDA 3PIOQ 5FIIA 4DL2A 4DX8H 1RTDA 2FJBB 2ZBIA 3LPYA 3M9MB 2MKKA 2HYIB 4DSFA 2KYZA 4B3RF 2WRMA 1S6PA 3QIPB 4EO6A 1C1BB 3MM5A 1SJFA 1KC8T 5A8RB 4K2XA 3E3XA 3H2LA 3ZZTA 2IA0A 3J80Y 3QIPA 1C1BA 1KLMB 1HWKA 2F7VA 1U1KA 2I0XA 2XC9A 2ASDA 3K5OA 2VC0A 5IT0A 2LMIA 1RI7A 3MECA 1KLMA 2XG8A 5KFBA 3NBPB 1TL3B 3BZQA 3FVYA 4DL3A 4LF4F 2HHQA 2ZH9A 5CCMA 1JLBB 2N7YA 1U26A 3QGHA 2JVRA 4RUAA 4IO9Q 1TL3A 4CT9A 1RP5A 1JLBA 1X4FA 5KFQA 4ZHRB 2MZSA 5J1PA 3PO4A 4DPOA 3HHKA 3UCUP 4OJ1A 2RQ4A 5AXKA 4YDDB 5F8IA 1H6KX 3DRPB 3M2VA 2R4FA 4QR0A 2JX2A 4ZHRA 4P6QA 4IG0B 4C8YA 5KFAA 3DLLQ 3DRPA 4DR4F 2B5JA 2DBBA 2MZJA 2V4JB 4IG0A 1APSA 2R2RA 1JLEB 1NHUA 2V4JA 4FF1A 2DNPA 4XDCA 4PUOB 4RNMA 1L5UA 4J9MA 5J2NB 1QVGR 3UR0A 3G6XA 2YWFA 3GQCA 1Y5LB 3TANA 1XMOF 1JLEA 1RYRA 4FF3A 3LALA 1PC4A 3L7PA 3ZZZA 4PUOA 3CCES 1Y7PA 4DG1B 5J2NA 1X9SA 2JSXA 2IFXA 4CIOA 2E1RA 4DLGA 1ZTWA 4DWIA 2IBKA 2DNNA 4ITSA 2C3OA 2QYCA 3CCWA 4JV1A 2W4PA 3D2WA 2XS7A 2J7KA 2O3DA 3DN9A 3VQTA 5HI7A 2ZJQQ 2YNHB 2WB1D 2PN6A 3IAS9 5CYQB 3KTQA 4B9SA 1XBWA 3M8PB 3LP0A 1HNIA 3RBEA 2CKWA 2NS1B 2YNHA 5KG7A 1R7IA 3H2VE 3TARA 3M8PA 5D8HB 4KJIA 1F5BA 3K5MA 1Z2LA 1NJXA 3IBWA 1SC6A 3IWXA 2CQ4A 2R7SA 3VR1A 3PX6A 1FNXH 2IYIA 4J9QA 2BBEA 2Z2MA 2W8KA 3I56S 3IGVA 4YR2A 3CCTA 3MR3A 3VTIA 5L9XA 3G6YA 3NG8A 1AFJA 3QIDA 2ABYA 2LXUA 3IO1A 4DQRA 1YJNS 5J1NA 2M9KA 1FXLA 4FZVA 1V6HA 1FJ7A 4UQGA 4C11B 3RB0A 2ZHOA 4ZP7A 5KG1A 5IQQA 4GO5X 3MR2A 2AJQA 4B17A 5F8MA 4C11A 1S97A 3AQOA 2CQPA 2MQMA 4Y3CA 5D6GA 1N0VC 3EZUA 4ED0A 3D5MA 4PXDA 4I6YA 5D4PA 2MQOA 2UVVA 1O51A 1Z4UA 2YKNB 4EU0A 1E6VB 3HF5A 2ROGA 3UE2A 1TFWA 4ZOSA 1LFPA 1RT5B 3PNIA 3H98A 2PC6A 1IN0A 1E6VA 3HT3A 1RT5A 1Z1ZA 3VAHA 4RW8B 3BSCA 4L6V3 3EGWB 2QMXA 3HI9A 2IRXA 4IO1A 5E2QA 4C98A 2FUG9 4LF7F 1SH0A 4RW8A 4DFJA 1FVSA 3NKYA 1BY9A 1BQXA 3HZGA 2MB0B 1TKXB 4MKAA 4KQZA 4X4PA 4TQSA 3QO9A 2BM0A 1BD6A 3ULHA 1GTEA 5K8NA 4NL5A 2NR0A 2ZC3A 4HEA9 3CF5Q 4DL6A 2ZZNA 5IZHA 3CCLS 1GX6A 2XSFA 3DRRB 2FB0A 2E5HA 4ZP8A 4DV6F 1VRUA 4CNZA 4JI4F 2QSFA 1QLNA 3CMES 1DARA 3DRRA 2UVRA 3LWLA 1QSSA 5K9FA 1TL1A 2YX4A 3RBDA 2BANB 1LW2B 3EPIA 1HD0A 1VQYA 4ZDNA 4DF4A 2BUNA 3EGNA 2YNGA 2BANA 2JLGA 3O6QA 2ZOFA 4MK7A 4LFCF 3QYYA 4NLOA 3U02A 2B7BB 2UUCF 2APOA 1KQKA 1NK4A 3CCVS 2ZM6F 2UVUA 2AYMA 3QJLA 2ADCA 1REVB 1XTZA 4DHVA 4LIWA 3GYXB 2E5LF 2NUUG 2UV8G 1XC9A 4ICLB 1RJJA 1Q82T 1REVA 3MOZA 2CZVC 2UUBF 4ICLA 3MUTP 3SZ2A 3RB4A 3NMAA 3QAEA 4AL6A 1X4AA 4ETZA 4AXIA 5K5MA 1RT2A 4J5OA 1U1OA 1Q1KA 2XGPA 3GB0A 5A8WB 4JBCA 2A10A 2V2KA 3LW5C 5A8WA 2N3OA 2PDAA 3Q0AA 2FC8A 2EFNA 2E44A 5KFKA 2NZ4A 3I0RB 3SV4A 2IVYA 4P7VA 2R7RA 5DJBA 1S72S 2XI3A 1JIHA 4OMFG 3S6EA 2C2RA 2ZJRQ 3G9CA 2P5VA 4ELUA 2E1AA 2YWGA 2J9CA 2ZH3A 1JKHB 1C0UB 3BQ1A 2MZRA 1S1TB 2JH3A 3OXGA 4A8XA 1F0XA 1IM4A 4PRFA 1C0UA 5LSRA 4KGMA 3R27A 2XEXA 1S1TA 3E2EA 3TVKA 1U1QA 4WFAQ 1RDRA 4DSIA 1WACA 1RYSA 5HQ8A 1AFIA 3PRDA 2OIHA 1LWEB 1SJRA 4DFKA 2IRYA 3I0SB 4F02A 5F8GA 1LWEA 3BGUA 3G8QA 3OR2B 3I0SA 1MNEA 4WTYA 5C5JA 1VQ4S 4B3SF 3BS9A 3N6LA 5E3PA 2M8HA 4X62F 4LSNB 3OR2A 2RU9A 1KN6A 3EPGA 1NHVA 4LQ9A 5IXUA 4B9NA 3G8TA 4I2QB 2VL1A 4NLQA 4K4WA 1U09A 3NGDA 4Q2MA 3B4MA 3KLVA 2WOMB 4I2QA 4F67A 5ADZA 2K1RB 2RF2A 1D1UA 2WOMA 5KFRA 3CCSS 2EFQA 1R0AB 3PRBA 1TV6B 4G1QB 4M8LA 5T7LB 1XERA 2K1RA 4DV0F 2CQ0A 4DL5A 2VB6A 2HHVA 3PVXA 1KS2A 1R0AA 1TV6A 4G1QA 1DAXA 3DFEA 2XWYA 1S76D 3KLFB 3QLHB 4TY8A 4DL0C 1C4CA 4DUYF 1N56A 2FLNA 4ID8A 4MKBA 2XI2A 2F8MA 4X4RA 1R8HA 2Z2LA 5A6WA 4C0OC 3KLFA 3QLHA 2IBOA 4CZCA 2HHSA 1GH8A 2LKZA 3OVBA 2ZVSA 2GW8A 1JLFB 1H7XA 3GG1A 4WU3A 4Y2KA 3OL8A 1QM9A 3GIJA 7FD1A 2H5EA 5LSLA 3EX7B 2EI5A 3N6NA 4DFMA 1HNVB 1I1GA 4B3MF 2WBMA 1L3TA 5DM6Q 3RW7A 4HLBA 5HP1A 4KAIA 1IR0A 3KK3B 5FJ4A 2DTJA 2DGWA 1HNVA 3OSPA 4UUXA 1J2VA 4WFNQ 5E0OA 4J37A 2RILA 2IC3B 4KIAA 3KK3A 1UA0A 3SV3A 1BQNB 3IAM9 1DTTB 3G8SA 2Y1RI 1FESA 3CCRS 3CXCR 1TAUA 2IC3A 3CDAA 2DPJA 4NA3A 4Z2XA 1VIXA 4CTAB 3I6PA 4DQIA 4F2SA 2COLA 1BQNA 1U24A 1DTTA 2KHCA 3CCZA 1Y5IB 4Y0FA 4IRCA 4FNIA 1NK6A 2DCLA 5DQGA 2CQHA 4TU9A 1WELA 1X5PA 4JI0F 4CTAA 4BCAA 4YOEA 2GFFA 1URRA 3CTRA 2VG5A 3MF5A 2BJEA 1FRIA 3D54A 4I67A 1S9GB 3CMAS 3D1QA 2DNMA 1NU4A 1TAQA 2CQ3A 4M5DB 2ZH1A 4OL8A 3FQKA 2DNGA 3VZHA 2RRAA 1YHQS 2D7SA 1YGYA 2P6TA 1P9QC 2R7OA 4EZ9A 4M5DA 4NXMF 1SXLA 4ZPAA 1SH3A 1SJ3P 3OTDA 5C25B 2ZH8A 1AW0A 2EK1A 1KLNA 2CRLA 4HTIA 1SJ4P 1L3KA 5F0WA 2J9EA 4C0HA 3OUYB 1G2EA 5C25A 2Q3PA 2FDNA 1YVFA 4QWAA 1TKZB 2R8GA 1HL6A 2VD3A 1X4EA 4TN2A 2B4VA 1TKZA 2YY3A 3Q2SC 3CD7A 1HNXF 2XMVA 3RYLA 3V4MA 5GAEI 2ZE2B 1VC6A 3OSNA 2XGQA 4N8NA 1NRKA 2V8GA 3NL0A 3NCQA 5F41A 1U7LA 2VASA 2ZE2A 2RH3A 4USIA 1SJ1A 2IVFB 3CGIA 5F9NA 3KK2B 1NK5A 1EETA 4DSKA 4M94A 3GV8B 5I3PA 5AE1A 4X65F 1TL4A 2XLJA 2A3JA 1RT6A 2V94A 1QY7A 4KKOB 3KK2A 3HHLA 2OMOA 1VQ8S 3ONQA 4ZPWR 4YY3F 2UUWA 2JDJA 1FDDA 2IAJB 1FXRA 1QE1B 1U47A 1S1VB 3HKWA 1CQNA 1KFSA 1UFLA 2HS3A 4ECXA 4PXEA 4ZCKA 1FKOB 1QE1A 1NK7A 1S1VA 2DGTA 4HL9A 4TNOA 1T05B 3J7A1 1FEHA 2W4CA 5D3GB 3RB6A 4PG4A 2VQEF 1FKOA 1VJWA 5DDOC 4DSEA 3TX8A 2EG2A 2DO0A 2A2DA 4OI1A 1T05A 2XS2A 4BHQA 1KOOA 2DGVA 1CPZA 4JI5F 3H5XA 1FRXA 3PM9A 1X4DA 3HHDA 3OLAA 4IFYA 4OI4A 3PIPQ 4JI8F 3KYLA 1DURA 1U1NA 1U1LA 2MY7A 2CPHA 1GNKA 2VH7A 2NSBA 3SCJE 4MYTA 1VBXA 1S0VA 3R5AA 5KFNA 1LV5A 1O8BA 2KN4A 2GHVC 3P96A 2I5JB 2OPPA 2MJUA 4L3NA 1S6UA 4OV1A 4R5PA 4URQU 3MFHA 3BO3A 4F25A 2YNFA 4PWUA 2MY8A 3JSMA 1HFEL 3UFCX 2PA8D 3MUMP 4FPRA 1G7CB 2HW3A 4B02A 1OWXA 1NB7A 4E98A 1KTQA 3MPWA 4KT0C 4LIRA 5KFLA 4YB7A 1QTMA 2PMZD 2HNYB 2CPYA 3HHLC 2XWXA 4MTPA 2XNRA 1LOUA 1MSWD 4LF5F 4QU7A 5HMWA 2LXFA 4B9VA 2C3YA 3H40A 3DOLB 2XMMA 4QIFA 2IJNA 2GQ2A 1FKPB 2AJ1A 3THTA 3LOUA 3T5JA 3K59A 5DETA 3DOLA 2RQCA 3FSIA 4DQQA 1FKPA 2Q43A 1RISA 2W7PA 2ZH7A 3BEGB 1BLUA 1FERA 2CPIA 5J2QA 4QIWD 4IDKB 3ZZ0A 3V6DB 1KRPA 2OD4A 5KFEA 5EWFA 4XO0A 3V6DA 4RW6A 5E5NA 3U1LA 1EP4B 3ZZPA 3VZIA 2B6AA 1GXLA 4IG3B 2PSZA 2GC8A 2EBEA 1L3VA 1V3RA 2BM1A 6FD1A 4WYWA 4CQ1A 2BR0A 3MD1A 3M32B 1I6JA 1YJWS 2IM2A 4KO0B 4MFBA 5IT4A 1MMNA 1IQTA 2F9JA 1YJUA 3D0GE 2IMOA 3M32A 4KO0A 1ZPWX 4NLYA 2L3MA 4F3QA 3DRYA 3DMJB 4RW4B 2G13A 2BZ2A 1NAQA 5EHHA 1NNDA 2KM8B 2SXLA 1HARA 3CCMS 3PJWA 1FKAF 4I6AA 3CJ5A 2J6UA 4BWMA 2BQRA 2GGPA 3B8HA 1H38A 3NLCA 2DGUA 1N4LA 2EVZA 2VKRA 5B0BA 5B7WA 1NKEA 3OLBA 3SSSA 2JFKA 4FXWA 1VHFA 4OHWA 1VRTB 4ZS6A 5M2RA 5A0YA 2WW8A 3M8QB 4A4JA 4K4SA 4IR1A 4DL4A 2FJXA 1SKWA 3E8OA 3DLKA 1QAYA 2QA4S 1U4BA 4IRDA 3KLIB 2VOPA 3F56A 5KT3A 3X1LB 1KEKA 1OIAA 3R3TA 3D0HE 4GMKA 3MR6A 1MWYA 3I5BA