3SSQA

Ccmk2 - form 1 dodecamer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
MPIAVGMIETRGFPAVVEAADAMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVAAGVDSAKRVNGGEVLSTHIIARPHENLEYVLPIRYTEAVEQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A CcmK2 double layer is the dominant architectural feature of the beta-carboxysomal shell facet
rcsb
source organism Thermosynechococcus elongatus
molecule tags Structural protein
molecule keywords Carbon dioxide concentrating mechanism protein
total genus 26
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ssqA00
4OX6A 4RBVA 3I6PA 2A10A 3DNCA 3SSSA 4RBUA 2G13A 4QIGA 4QIEA 3DN9A 4P7VA 3CGIA 3IA0A 3I96A 2EWHA 3N79A 4P7TA 5L38A 3SSRA 3H8YA 5DJBA 4AXJA 3NWGA 3PACA 4QIFA 3CIMA 2A1BA 4OLOA 3MPYA 3VCDA 4AXIA 4RBTA 3NGKA 4DDFA 3MPWA 4LIWA 4OX8A 4OX7A 4P2SA 2A18A 4QIVA 3SSQA 4PPDA 4OLPA 3BN4A
chains in the Genus database with same CATH superfamily
3N6NA 1ZM9A 1TFYA 1SL0A 3CDBA 2Y1IA 4DF8A 1UVIA 1DY3A 4C8MA 2B0GA 2VFRA 5L46A 4FVCA 3EXYA 3L9ZA 3OFGA 1UW4A 4FXWA 3H2UB 2C2ZB 3N4WA 3FSYA 3S7RA 3T9ZA 5DJBA 1NSKL 4C2MA 4DX5A 1URRA 3NCPA 3NS6A 5M2PA 2ZJRQ 4A8YA 4ID5B 1EETB 1YGYA 1FFSB 2PC6A 2ZH8A 3M05A 4DL5A 3HHNB 4P75A 4URSA 4HACB 5AXKA 3Q2TC 4C8YA 1DURA 1ZZNA 3R7NB 1SKSA 4FBUA 1VS3A 3DOLB 4KBIA 3HFZB 2DD8S 1NPRA 1U48A 1W25A 2Q79A 1RT4A 5EWGA 2XMAA 2B4PA 3IGNA 2C22A 2KYZA 2PA8D 4DJBA 5AXNA 5F8MA 5KFEA 1UTAA 1O51A 3M8YA 3THVA 5CZVA 2DR7A 3HHLD 2ZWPA 5F41A 1R89A 3SMZA 4E2FB 3CUNA 2AGOA 5AJ3F 1IR2A 4NCBA 3TJAA 2DYAA 3PRDA 2P9GA 2UUCJ 1UJ5A 1FKPB 5T41A 1FDBA 3EX7B 3AJDA 1WEXA 4OV1A 1QTNB 4ZITA 4ED6A 5FLXY 3OR2A 3QGPA 3PYGA 1WOPA 1YVFA 5E3PA 2VFSA 4DU8A 3HT3A 5KG7A 1T3NA 1X9MA 5KG1A 1HD1A 2CG8A 4IQXA 2XCAA 2XYPB 2AJQA 1CJKB 2DH8A 5I42A 2LQ5A 1HBUB 3R8YA 3HHLC 4GVLA 1FFWB 1TUGB 3CJKA 5E3AA 2XLJA 2G0CA 4URGA 1S0MA 3TI0A 2XGQA 4YOEA 3TVYA 2KU7A 4TU7A 3FSIA 4WWSA 4CH0S 3NKYA 3Q24A 2MQNA 1H0HB 3ZZRA 3CCSS 3MXHP 2E7WA 4J9VA 5IC4B 3CIZA 1SQGA 5D4NA 4LFBF 3SXLA 2ZWOA 3T1HF 2MZQA 2ZBQA 3I0SA 3SQOP 2VKZG 3ONQA 4CH7A 2RKIA 5E3QA 4GMKA 2ZFHA 2VUGA 1SJ3P 4I2PB 8ATCB 1RKJA 1BC6A 2Z30B 3DDKA 3MPYA 2CDRB 2C2OB 2LQJA 1JB0C 4QWAA 1YIJS 1VQOS 5KG6A 4NLRA 5J1PA 4DQRA 3Q83A 3TJ9A 2OPPA 1JLQA 1RTIA 2HNYB 2VD3A 2XTJP 3OXGA 4IKAA 1VBXA 1IWAA 4GKJJ 1HWKA 3MEGB 5D8HB 1CC7A 1KFDA 1PAEX 1UMJA 2OFHX 1Y3JA 3DYAA 4JI0F 4HI1A 3HPOA 2BJ1A 4C0HA 3VGVA 3W62A 3KLIA 3R5CA 3N6MA 2JL9A 3B78A 2WVCA 4OHWA 2FY1A 1TQLA 2E5LF 2XMWA 4PABA 1NO8A 1TAQA 2MHNA 1UW9A 1S1VB 2MKKA 4DWIA 3OTDA 5E41A 2FJBB 2ASLA 3M2UB 3QLHA 4ENOA 4K5RA 1BMQB 3B4MA 4RW8B 5LJ3Y 2JC1A 3OHAA 5L9NA 2V4RA 2XEXA 4CO1A 2M52A 5LXRA 4YN3B 1WI6A 4JI2J 2QA4G 2KXNB 3CJ2A 4Y34A 2P8IA 5KFWA 1KS2A 1GMWD 3VAGA 5KT4A 3A8IA 1RHMB 5HLFA 3T9NA 4B9VA 1X7VA 2QN6B 2V67A 2VODA 3C8YA 1LKZA 4C4WA 2DH7A 2FJEB 1J2VA 3T1YJ 1TV6A 1K1QA 3MOJB 3CPWR 2QYGA 2MSSA 4DPXA 2K3KA 1N4LA 1E6YA 2RMLA 1U25A 5GAEI 3KLFB 2QLBB 5LMNJ 1B0PA 4N41A 4FXDA 1NH7A 3NWGA 1T11A 4USVA 2Z2MA 2R7TA 1G2EA 1NDPA 3ICLA 1TVRB 4RW9A 1LWEB 5HVFA 4DCOB 4JI8F 3OR1B 2VBZA 3NP5A 1RADB 1HNIB 3OTEA 3QIDA 2VBYA 2M4MA 2HURA 3OUYB 2KFYA 3CMES 2EKYA 3LOUA 2AEJA 3RBDA 4HI2A 1U2FA 2ASYA 4IFVA 3FUYA 1XJWB 3LPYA 3Q8QB 1BWVA 4OYOA 1V3SA 1RCXB 3AB4B 4B3RJ 4A8KA 2IHR1 3ZC4A 1XMQJ 4LF8F 1EB0A 2DXFA 4P72A 4A8QA 1S1UB 2XLKA 1RHKB 1LWXA 1NDLA 2HBRB 4CDIA 4USWA 2FC8A 3D0IE 5A8KB 1ZM4A 4Y2KA 3I5AA 2GO9A 2ZDPA 4U95A 4DR1J 2BJ8A 1WACA 2CQPA 2FLOA 3L3CA 2ZH1A 5C42A 3E51A 1EP4A 3DI6B 3R9LA 2V8DA 2E5LJ 2LU1A 2O66A 4X4RA 1ZPWX 3UPFA 4C8OA 4ZCKA 4U67Q 3PJWA 1FRKA 1YZ7A 4J91A 5HBMB 5I3UA 3BSOA 4F36A 1FRHA 3JXOA 4CT8A 4X65J 4N5SA 3CC7S 1FHTA 2RF2A 4LF7F 3QPIA 3M1VB 4Y2IA 1NKBA 2VQEJ 4LF5F 4N76A 1FE0A 2AZ3A 2BA9A 1NJYA 4Y28C 3SDEB 4IG0B 1JXVA 3P8BB 5F3TA 3CMQA 1WSVA 1K73T 3PO5A 4LF2A 2FY8A 4NXMJ 3GILA 4PQUA 3HSJA 5AXLA 2FLPA 5L39A 3AQOA 4W98A 4O3OA 3HSGA 1TZ0A 1PYOB 3R97A 5KFBA 3P5TL 3ZZYA 2HIQA 1Q79A 2F4FA 1X4EA 2HGNA 2NXJA 3RUBL 1F60B 1EX8A 3M8PB 4IDKB 1AFJA 2OTLS 4Y65A 1FJGJ 2N4DA 1L3KA 2CNOB 2KI2A 3GB0A 3D6MB 4USMA 1VHIA 3LP1A 1RT7A 1MROA 2F8EX 3B54A 1CG2A 4B3OB 4XDCA 2FTRA 3W9IA 4J9PA 5D3GB 2VIHA 4DUYJ 1WTBA 1RT2B 4KH1B 1RAAB 2KB2A 4L3KA 4UOFA 2E1CA 2XS7A 4R0JA 1G3OA 4M5GA 5KOXA 1U8SA 3F0NA 3GIRA 5KAKA 5K14B 3AHPA 1RDRA 2BVZA 2Z58B 4NLWA 5G0RA 1M5HA 2CPDA 2HLTA 3HKWA 4LFAJ 3J7Z5 4IFVB 2XY6A 2WSEC 4QWBA 4ED1A 1AA1B 1NDCA 2KJWA 4ZVPB 1O0PA 3HKZD 1SIWB 1Q8LA 4I64A 4ZVGA 5MAOA 3AXKA 4MKBA 2ASDA 2QV6A 4ANCA 5DG9A 2BKOA 2ZUAA 4Q0BB 3NG8A 2QFIA 4O4GB 1N32F 4I1TA 1LNQA 4F2RA 4YMEA 5M2RA 1SI9A 3U02A 1B7FA 1TL7A 1K0VA 4IOAQ 1XK8A 3QT7A 3QT6A 2H1YA 3K89A 5HBMA 4DQPA 3MM8B 3H2LA 2JJ4D 2VB6A 4MK8A 1NSQA 3GV8B 1CEZA 1GMVA 2DIVA 1LEOA 1UA1A 3CSKA 4KKOA 2OGUA 4LFBJ 2H9ZA 3I0SB 2D74B 1GT8A 4RNNA 4GO7X 3HD2A 5KFYA 2CQ3A 3CCWA 4TN2A 1XMOF 1GMUA 4X65F 4ECXA 3OVBA 1R0AB 1HQEB 2CG4A 2CPFA 5F8HA 4W92B 1N5SA 1SCJB 4LVNP 3HVAA 2D3UA 4KGMA 1I94J 4PUOB 4NCAA 4IR1A 2XO7A 2CQ2A 2IIHA 1UZHA 5CYQA 1FI4A 2QIFA 5K8OA 4RNMA 2HVHA 3H7HB 4R8UA 4X64F 2E9ZA 4GVBB 4DN9A 4U7CA 3MMCA 2MZ1A 2GGPA 3CCVS 4DR4F 1RAIB 1S1XB 2HHPA 2J5AA 1MU2B 1ZOTA 4NLQA 2R2SA 3Q8UA 1NU4A 2GVDB 1A7GE 2ZBPA 3BO2A 3QIPA 4M5KA 2ALYB 2P6TA 4J9QA 2OELA 3W5YA 2MY7A 1IBMJ 5T7LB 3C16A 1S7IA 3D6HB 4I7FA 1FD8A 3RJMB 5A6PA 1U7LA 3D66A 4XIUA 1MG7A 4NLTA 4Q5VA 3QMQA 1VRTA 3TYTA 2A0FB 4X4UA 4ZJLA 2BV3A 2W2OP 3KLVA 4MH8A 4G1IA 3SQGB 2CJBA 4X64J 3MZIA 2FGOA 2B9XA 2ZVSA 1VLYA 2V34A 1NK4A 1N88A 2IAJB 5L38A 3UDCA 1TL3A 2BOAA 3GE9A 3OJSA 2CDQA 3PY8A 4DQIA 3HK2A 2UXBF 2YKPA 2LXFA 3CEDA 1E6YB 2VQFJ 1FK9A 4RNHA 1VQNS 2XZTB 2CZVC 3CJ4A 1UFLA 4M5NA 5FDLB 1RTZA 3J81U 5ETLA 2Q3PA 2N3OA 2XNQA 2HZVA 3H42A 1IR1A 4KHMA 1E6VB 5E2QA 4OYXA 1JJHA 3WX4A 5L1IA 3IR6B 3T6JA 1X0PA 2DXDA 3BGUA 5GMEA 4IFYB 2Y0SD 2J0SD 4W4MA 2QYCA 1LV5A 1F6TA 2H4YB 2HKEA 2YNGB 3BZQA 4DMZA 5HMXA 2WONB 3R1HA 4X2BA 4ZCIA 2BE7D 3O44A 4LF4F 1U24A 1UVLA 3IWNC 2BOPA 3RW6A 3MMBB 3DHXA 2RH3A 2EVZA 4DPOA 3DGPA 1NMEB 1F9FA 2QA4S 3I96A 4NLVA 1R6VA 3BGRB 3US5A 3VALA 2JOQA 3PX0A 4DSKA 4ETZA 3MOZA 2WVEA 4DUTA 2AGPA 1VBYA 3PR5B 1U6ZA 2DK2A 2AT1B 3K8VA 2IM0A 4KGKA 3WIUA 3GP9A 4DV2F 2D3O1 4E0DA 5GADI 2V2KA 3GYGA 4X4SA 2CJYB 4NEZA 3KLHA 1T03B 2V8PA 3DFEA 3RB3A 2FVPA 3CULA 3LGNA 3D68A 4EFAC 1GQEA 2QL7B 1RXOB 2LXIA 4JI6J 5F8NA 1XERA 3ZZ0A 2I6WA 2C2KB 1VJWA 1SJQA 4PWUA 3W1YC 1SJRA 5J2NB 4CLSA 3K59A 2MJNA 4AL7A 5HMWA 1TK5A 5B0DA 1FNMA 5CCMA 4OX9J 4F0MA 3Q22A 3BN7A 1RWWB 4FP9A 1SIZA 1LWCA 1VDHA 4PCQA 1B0TA 4TY8A 3MMCB 2FHOB 3WBZA 3VHQA 3KUEA 1HNWJ 4MKYA 4P73A 1K0TA 2YWKA 2YXLA 4YY3F 1CJUA 4K4WA 3FCWA 5A8WA 1HQ2A 1WC3A 2R7VA 1QVGR 1UA0A 2DRAA 3TW0A 3EWGA 3GSIA 3BKUA 3MECB 2Q6CA 1F1BB 1M5VC 3Q8PB 2UVVA 1KVKA 3MM6B 5DM6Q 1TVRA 4K50A 1S6OA 3GJQB 2CQBA 1C4CA 4NXNF 2XO6A 2IFXA 2Z4PA 4QJVA 4FDFA 3D7SB 4DR7F 1HHTP 1U0HA 2YQ1A 2VA2A 4FF4A 2DR6A 4FYWB 2MKYA 3OW2R 3PJ9A 1PJ5A 2KXFA 4CLYA 2Z8QA 2R2RA 4N8OA 1Q81T 2GC8A 3DRYA 3G8SA 4NLUA 3JSBA 3IMQJ 2AZ1A 3PEHA 2MTLA 2AP6A 2JVRA 2F63A 1OY8A 1T05A 2FJXA 4UY8T 1RWMB 1VK8A 1JLCB 2IVFB 3M6UA 5K14A 4AUKA 1IR0A 3BPDA 4C98A 1Q7YT 2OFGX 4QWEA 2YKNA 1S6PB 2W4CA 3MM9A 1X9SA 4ZP6A 5IV3A 4IH7A 4QWDA 2WAQD 1T9YA 1LW0A 2X1BA 3OTBA 1M1HA 1V5VA 2QLFB 3BDPA 3I5BA 2OUGA 1OPZA 1P6TA 2RRBA 5IQ6A 4NLPA 4DQSA 1KONA 4FNHA 4ZVEA 2V8VA 2V5HG 4K2XA 4QR1A 4DG1A 2NZ4A 3JSYA 3VAMA 5L9XA 4U6PA 2EFPA 1TELA 2JFKA 3WC2A 3HSZA 2N7YA 1QAJA 2QMXA 4IDKA 3DLEA 1IXKA 5KFMA 2VJVA 3KXDA 4LR8A 3CCMS 4LQ3A 1XIQA 4LRFA 4RUAA 1JNZB 2B56A 4C7QA 1M5OC 1RTHA 4NX9A 5GAHI 1V5IB 2DISA 5C2CA 1RGVA 3I5CA 3LAMA 1U26A 3M8ZA 3PM9A 5ETNA 4YR2A 3M8PA 4CO4A 4DV1F 4TYBA 5CHCB 2R9LA 3PW0A 4NE9C 3VCDA 2KG1A 4YB5A 3ISNC 4O23A 3AFGA 2XC9A 1VQYA 2CUYA 4LF1A 1UVKA 4OZ2A 3LA0A 2ZOFA 1WEYA 2FPHX 1UEUA 2BZ2A 5HP1B 4CQ1A 3M2RA 2RB7A 3VGTA 2JHEA 5J2MB 4R5PA 2RILA 5HMZA 1I94F 4WBFA 2BJ7A 4F50A 2ZZTA 1VOMA 2Y9HA 4FKXA 3C14A 3I4PA 4WFAQ 1SH0A 4F0HA 3JYTB 1Q8IA 1W2IA 1NHVA 3FFIB 2MEWA 3MEEB 3N79A 3NY0A 3DOMB 4FVMA 4Y2AA 2PMZD 5GAHU 3KK2B 4HYKA 5FLXU 3Q8YA 5IXUA 1S79A 2CQGA 3TOQA 3J7A1 2QT7A 2PSZA 2AQ4A 1ZH5A 2HQIA 2LDYA 5CZXA 1CS4B 3DM2B 1F5CA 1ZA1B 1H6KX 2GV1A 2A1BA 2V4JB 4Y2CA 5EHHA 1CJKA 2VG5B 2IA6A 1VLOA 2ZD1B 2JEJA 3JTPA 3WHIA 3MM5B 2JWNA 2MKSA 3IG1A 3RRKA 1DLOA 5ADZA 1TL1B 5B0BA 3J7ZT 2ZH5A 1KQSR 2UUBJ 1F0XA 1Y00A 2AV5A 1FJEB 4LVOP 2GQ2A 4IFYA 3V2UC 2BE2A 1S1UA 3OUYA 2FJWA 3PKMA 2UXBJ 4LRBA 2RAQA 4M94A 4GC7A 4E8UA 1WDTA 2PI4A 2OPRB 3KG1A 3IM8A 2AJFE 4H4OB 4H4KA 4U9RA 4O3QA 1EHWA 3KHRA 1TAUA 4L6V3 1IKXA 4FYDA 4GVBA 1U0SA 1K44A 1ZM3A 4C11B 4GC6A 2FVQA 1N34J 4ES2A 3M8QA 2WVDA 5F8LA 4LR7A 4ZVOB 5HANA 3KTQA 1ICEB 1RTHB 4HVZA 4PUOA 4DR4J 2W2MP 2OD6A 1KQFB 1DJ0A 3K7RA 2F8HA 1LWFB 2AWZA 3GSDA 1OMSA 2NXUA 3PACA 3BREA 4PEOA 2A6MA 4WP8A 1RT3B 3W66A 4Z7CA 3J81j 1T03A 4B9UA 2HG4A 4IYQA 4UZCA 1HBOB 2WBMA 3I9V9 1JLAB 2ROGA 2RUSA 4ID5A 4IO1A 5HAOA 4DG1B 2X7IA 4WFZA 2ZHBA 3BEGB 5ETKA 2FHJD 2J7WA 2OMLA 4OYPA 5LSLA 2J6SA 2CIMA 2DO4A 3FQLA 1BQMB 3FEXB 4USIA 3EUNA 1NH8A 1CULB 2AYEA 4B9TA 5B0AA 4YY3J 1DZ5A 1N0VC 2HHUA 5RUBA 1VC0A 1R6YA 1RLDA 1KNZA 1VRUB 1JKHA 2ZBRA 4WIQA 1BQNA 1F9HA 4USTA 4F7VA 3T5KA 2KRRA 3JB9k 3QJPA 4I4BA 4DV3F 1FRLA 1S77D 1IQTA 3T5LA 4K4YA 3WC0A 3DOKB 4O44B 2WB1D 2EFGA 3MPVA 3RB6A 4DV0J 1RUSA 1FK9B 1UWBA 2F4VF 4KT0C 1HWUA 1R43A 4J9LA 3TX0A 1X9WA 3H2VE 1HBMB 2BACA 2VPXB 3TAPA 4RU2A 4ZOSA 2V2ZA 2RS8A 1NKEA 3UD5A 1D8YA 1U0HB 2DEIA 4KGZB 1LQ9A 2BJ9A 2ALZA 4F4WA 2V94A 3BB5A 4DPTA 3PW4A 2NPIA 2HQDA 3ADAC 3GWCA 2F9JA 3R2CJ 2W7OA 5BR8F 2LEBA 2F40A 5LMNF 2ZC4A 2HGMA 1YBUA 2EFOA 2QLXA 5GAGI 4DV3J 2OTJS 1F2GA 2IM1A 4DCJB 1JLQB 5EWFA 1KRPA 4KHRA 3MMAB 4F4ZA 3BV8A 1A0OB 4B3SF 2GHPA 4JI2F 1NRKA 2W4PA 3BO4A 1X5SA 4HR2A 3TAQA 1N5QA 2UVWA 2KJVA 1VQ4S 1FXRA 1PAUB 1HI8A 4JI5J 1U4BA 4UW2A 2MZSA 3PFEA 4DN0A 1FESA 2EFVA 3UE2A 3KMSA 2HQCA 3H25A 4ICLB 3SCIE 5MLCV 1WUUA 1RAOA 5HVGA 3HZGA 2FQQB 5CYJA 1U1QA 1KFSA 4JI3F 4M95A 2M70A 4DX6A 1W2BR 3PZPA 3E3XA 3P96A 3ZTQA 4ELVA 2B6AB 4F04B 5A8WB 1OQ3A 2HBZB 1I6JA 3MAQA 4B3TF 3UD3P 5IM0B 5T14A 1JJ4A 1RAEB 2PI5A 2CVEA 4MYTA 4M5DA 4XO0A 1QTMA 1H3DA 1PBAA 4L74A 1L3TA 5F8JA 4ECSA 3T19A 1SVDA 4V1Ak 4MIBA 1WF0A 2RRNA 3WIVA 5KFRA 4JV2A 2V50A 2XHWA 2NUHA 3AODA 1TL4A 2LP4A 2GQQA 1U1NA 1R3NA 2C2NA 5CYMB 3MR7A 1HNWF 1F5AA 4DX7A 4I69A 1HNVA 4WPAA 4U96A 4GRSA 2VQEF 2Y1RI 4X84A 4EUVA 5D6GA 2PT0A 1N56A 3EPGA 3DRRA 2BRLA 3SCLE 5KT5A 4CO2A 3VAHA 2Y8WA 4HKQA 1SC1B 1U02A 3TAMA 3KHHA 4ZN1A 1OS5A 1XN9A 3VQSA 1HBNA 1V3ZA 1IKVA 1NBEB 1S5ZA 2IAJA 2JRSA 3CTRA 4ZVUB 4C6AA 1R8AA 1A9NB 1N0UA 2G2ZA 2GA7A 3MGJA 5M2UA 3GJSB 3ULHA 3M9MB 4UOHA 2G13A 4I6WA 1TL5A 2H54B 3UVJB 5HQMA 3TUZC 3CGIA 4J9NA 1RZMA 3FBEA 2ZH6A 2JNJA 5THWA 1B99A 2CPEA 4DV6J 1HFEL 1TL3B 3R6LB 2BEFA 4NI2A 4WTOB 3TZXA 2C2RA 5B7WA 5BYSA 1LW0B 3G8TA 3QRRA 2HFVA 2DGXA 3IXQA 1OY9A 3P4UB 4ZVRB 4C8KA 4NA1A 3BKFA 4JI1F 2XS2A 3W64A 2ZZNA 5I4MA 4DFKA 2F7VA 1YX2A 3D1HA 2QLWA 2YKMA 4HEA9 4CYUA 3H5UA 1NPPA 1SJ4P 4ILMA 4URQU 5HN0A 3NLCA 1CJTA 4R25A 5A0YB 1HPZB 1HQUB 1FRIA 4RPFA 3MUTP 1RCOB 1SKUB 4KR0B 1S6UA 3OVSA 3PNIA 4B17A 1KR4A 2YNIA 2AW0A 1NZAA 4BWJA 6FDRA 1S0VA 1IBCB 4OZJA 5CA5A 1C0UA 2MQQA 3KUHA 3SCJE 1LW2B 4LF7J 1EKRA 2BANB 3ENAA 3DLJA 4N47A 2I38A 2VFVA 3F56A 3PW7A 2I9SA 2EBGA 2ROPA 1IJFB 1KTVA 3G6VA 3HZEA 1N52B 4JI6F 4QIFA 6FD1A 5I3UB 1XNQJ 1XR7A 1S7HA 3HLUA 5C42B 2A3JA 2HNYA 2NZCA 4LF9J 1TL7B 4DCPB 4DV7F 2ACYA 3MEGA 1HWLA 2ABYA 3M6VA 4R5PB 4YR3A 2V9WA 1JLGA 4KTQA 4OX7A 4BWMA 3TANA 3BPSP 1H38A 3BN4A 3I32A 1Y0HA 2B51A 2OPSB 3TEGA 1DBDA 2DHHA 2FDNA 1RT1A 1U6BA 2LCWA 2WTFA 1U8WA 1Y5LB 2IYIA 5D4LA 3NNHA 1B70B 5ETTA 1N48A 5LMUF 1GX5A 1YJVA 4N7TA 2RHSB 1M5PC 4CO0A 1UP1A 3CW2C 4LF9F 3K5NA 1FERA 4DR3F 3MM5A 4B3MJ 1EARA 1T9UA 2NXEA 3BQ0A 5EN1A 2YNHA 3BSAA 3AXMA 5G0RB 1Q1KA 2HBYB 3MCNA 1MMNA 3GU0A 3BYRA 2FJAB 2QSFA 3DLGA 2HLUA 4ZVTB 4EBEA 4RW4B 3JTNA 3OL8A 3GMGA 3MM8A 5HL7Q 4ED2A 3GYXB 4ZLNA 1WSRA 3G82A 4RL1A 3CJ8A 4WKYA 3Q8VA 1WHWA 2V68A 1OYDA 3D1OA 1Q4RA 1XWLA 4LSZB 1DFDA 3UR3C 5IS2A 1A6LA 2B9YA 2BYCA 2HYIB 2YWEA 1WTFA 4WP9A 2JZ5A 1JIHA 1ZS6A 3GV7B 2W9AA 1VQMS 2ZKTA 2JEFA 2HVZA 2B7CB 2FGCA 1YQHA 2OP5A 4PRFA 5BYQA 3QYYA 3FNNA 2ATLA 4H4MB 4RW4A 3O6QA 1Q82T 1B0VA 1H7WA 2JEIA 3OL7A 4IG3B 3NBPB 5GAGU 1T9TA 2WBRA 3M8RA 3LQVA 2CQIA 4PXEA 3W8PA 1VQKS 3CC4S 3PTWA 3W5ZA 1DTQA 2MQMA 4NA2A 3EDRB 4P6QA 3RU0A 4B9SA 3R2DJ 1S1WB 3GJRB 4LSNA 2XZWA 3A3PB 4ZVQB 4ALZA 1JK9B 5KFNA 1RT3A 1FXLA 2ADBA 2DR9A 2P9CA 2MJUA 1WEZA 3CDWA 3D3BJ 3UFCX 2HHWA 4P74A 1D1UA 3GR0A 3DOLA 5C2GA 4ZPWR 3PO4A 4PYDA 4PXDA 1OSDA 3DLEB 1SJFA 4HT7A 4UTGA 2OIHA 2COLA 1P9YA 2CADA 4HH1A 2LQ8A 4CTAB 3DLKB 3C2PA 2Z2ZA 2R42A 2ZUGA 3N0VA 3M30A 4WF9Q 1S97A 5DDQC 3FKBA 3V5RA 4DV1J 2FB0A 2HHSA 2WZ1A 3MCMA 2BRKA 3IR7B 5L1KA 3F41A 4ZP9A 2CFXA 2YX4A 1K47A 3KFWX 5A8KA 3OFHA 3T6BA 3KLEB 1UJ6A 2MKIA 4X4NA 3C3LA 1CQMA 2RF2B 3VVUA 3JAMU 4NYOA 1MMLA 2VG6B 3GJTB 1LWEA 1MWZA 4FS2A 1VQ8S 1RWNB 3Q8SB 3NOCA 1WKLA 2HAFA 1FTRA 1Y5IB 6AT1B 1DRZA 3X1LB 1YRXA 4CLKA 4P2SA 5A2QU 4OMFG 3GFXA 4WP3A 2DCUB 3D3CJ 2KVQE 2XNRA 2DGWA 4PPZA 2ZE2A 1XNRJ 1GXTA 1FA0A 1O6XA 1TMMA 2IMOA 4MKAA 4OZ3A 2JVOA 1SL2A 4PWDA 4F4KA 5KFPA 2K7KA 5FJ4A 2DNHA 2CVIA 1VK3A 2E29A 2LQBA 3CJRA 3KJNB 4QR0A 3UCUP 1T0TV 4DR2J 3VR1A 2AMCB 1HBNB 2Q43A 2Q1LA 1XMBA 1KN6A 4ZPDA 2MKJA 4LF4J 1YK9A 1Q5VA 5KFJA 3MCSA 3MEDB 1KVJA 4JYAF 2MPUA 2C2MB 4K59A 2J7KA 5D4OA 4KFBB 2G1DA 4NLXA 3RR8A 4L72B 2RQ4A 4A47A 5L1LA 1U6FA 1RHJB 2J8SA 3U1NA 3IN5A 1VC5A 2AD9A 1X4BA 2R7RA 2JLFA 3FC9A 4WIIA 3VZIA 1O8BA 2J8AA 4BC7A 4ZCMA 4YHHF 3LUYA 3QQCD 4J37A 3GIIA 2CAJA 2J6TA 1RT5B 1L3VA 1EKSA 3IGVA 4FPRA 1ZYQA 3GCXP 2EBEA 1ULRA 1CVJA 2VG7A 5LSRA 2XI3A 3K2YA 4LRAA 5JVGQ 2PEBA 4OI1A 1SC6A 2E1RA 5H1SV 1G6BA 2DH9A 1YJ9S 1YJRA 3M8QB 1S1VA 2MLXA 2QO3A 3RB0A 4OI0A 4ZVFA 1H98A 3AOCA 4I2QA 5IQQA 2WRMA 3JAMY 2KKHA 1S6PA 2HHQA 1CC8A 3G4SS 2MQ8A 2VG6A 2H48B 4K7QA 3UNYA 4ZIVA 4G1QA 2YNFA 4AXIA 4A8FA 1FD2A 5T7LA 4AYBD 2UZAA 2VKRA 2CQHA 1KD1T 2W9CA 1JNRB 4QW8A 1S9GB 4Q8EA 2GVDA 2M8DB 4BC9A 1HR0F 2IC3A 4DV5F 4ZHRA 4R8UB 5A8RA 3ET6A 3M9NB 4P7VA 3KK3A 4C3LA 4YDDB 3C46A 2DO0A 3CO0P 2HSEB 1RAFB 2M9KA 2P6SA 3BYPA 3M7VA 2MQPA 3RBEA 4PYAA 3MEDA 5I3QA 1I5OB 1YJ7A 1GXUA 2HS3A 4ZIWA 2MB0B 2DNKA 2CYYA 2M7SA 1NLKL 1BLUA 4FZVA 4UOCA 2R7OA 4UT4A 5IT4A 3W9HA 2Y1JA 1BGXT 3LP2B 3C6UB 3VVTA 4YS2A 2ILYA 1T3OA 4UOGA 2U1AA 4KB7A 4O3SA 2WSCC 2RRAA 4JB8B 2NUUG 1UWBB 2J9DA 3QWUA 4Y3CA 3NMAA 1S6QA 3PXGa 4AT1B 4PWDB 3VAIA 4RWWA 3AT1B 4P10A 4DLGA 4TYAA 5K5MA 1RHQB 2XSFA 3PX6A 3T5JA 3QAEA 4EZ9A 1QM9A 2R8HA 1H74A 4Z7YA 3M6WA 4XTTA 1PG5B 2IVMA 2QJ3A 2H65B 1HBUA 3Q8RB 3I6PA 5KFDA 3OL6A 1NJWA 2UVRA 2VDIA 1JXLA 4M1KA 2GO8A 2UUWA 2XMVA 4WE1B 4ZJOA 1Q78A 5DDPC 3V4IB 3V6DA 3UD4P 2KT5A 3O2IA 3UCZP 3W61A 3I55S 3IWLA 3LP0B 3RRGA 3LALA 3MMAA 4K0KF 3IAS9 2GW8A 1M1KT 3E01A 2PMWA 2KRBA 2ZBCA 3EGWB 3S6EA 2KO1A 3G82B 1RKIA 2EI5A 3HVWA 2C42A 3EMTA 4QOTA 2ZM6F 4DR2F 4OZ0A 2DKOB 1BD6A 4FYYB 8AT1B 2GGPB 3KLHB 3NWRA 4NRTA 1D8ZA 5B0FA 1S72S 4LF5J 1HL6A 2JX2A 5BYRA 3LWLA 2DNMA 1EAYC 4O3NA 1L3UA 2ZOMA 4XPCA 2VQFF 1RBLA 3HHDA 4DL6A 4EZ6A 1JX4A 1NXIA 4ZP7A 4PXCA 3U27A 4RNFA 3HMJG 3D6FB 4IRCA 5CD4H 2Y0BB 2JFDA 2HHHF 2UUAJ 3HP6A 4IH6A 3TUIC 3SI8A 3BSCA 1UZDA 2CPIA 5KT3A 4DFMA 5H9FJ 4B9LA 3QJLA 2AX0A 3TX8A 4CT9A 4ZLPA 4OYWA 1HNXJ 2EWHA 3MD3A 2KL8A 4DFJA 3CD6S 3CCLS 4IO9Q 2Y8YA 3M2VB 1VBKA 4M5LA 1RBAA 5EDWA 4AXJA 2RDIA 4ZMMA 3G96A 4DV5J 1RT6A 1XMQF 3PDNA 4LF8J 4QR2A 4USKA 2E66A 2EC2A 1SC3B 2BXJA 2GIRA 2GAGC 4YUDA 3GPAA 3ZZZA 4NYPA 2AU0A 1T8EA 4C8LA 3IP0A 4L3NA 4RWXA 5DS7A 3CD0A 1K8AT 1HI0P 4C97A 2YY3A 4RW8A 5B0EA 1DTTA 4U8YA 2OSQA 5K9FA 3TZZA 2FLLA 5GADU 4DX8H 3GFZA 3DDIA 4KQZA 1IKYB 4OZ5A 3SSQA 3FFIA 3MEEA 1FNOA 2DHGA 1U1KA 4OX6A 3ISZA 4TLQA 1AUDA 1FWPA 2FJDB 2L9DA 2RU9A 2W7PA 2LXUA 2N82B 1NSAA 1SQFA 2YBVA 1TKTA 1PYTA 1I1GA 7AT1B 3AY0A 1H73A 4LFCJ 2ZE2B 1PO6A 3EGZA 5F0UA 3IM9A 1R8PA 4CNYA 1F9EB 3CCQS 4U7UD 2BKPA 3BO3A 2F8MA 2ADCA 3KDOA 5CH7B 1HQUA 1HPZA 1P1LA 3NGSA 3UW1A 5D4PA 3UO0A 4OHZA 4ECZA 2KZMA 1WC4A 3UDVA 1S10A 4Y6IA 4USHA 2YKMB 1KKHA 2E5GA 4YEAA 1WF1A 1FWLA 1NPKA 2PD1A 1RAHB 2D9PA 2XMUA 4Y00A 1T9XA 5JUMA 4BLGA 5KFCA 3NGKA 2FHKA 2KH9A 4ECUA 1DLOB 1OY6A 5LOQA 3V6DB 2GJFA 2ATCB 1JJ2R 2EC0A 4DL0C 5J1NA 4KFBA 2LMIA 3JSMB 3P49B 4LFCF 1GFWB 1TKZA 3M32B 1WNEA 3RAMA 4HACA 1NK9A 2XMTA 3DMJA 1J5EJ 4F4XA 2NS1B 3WDOA 5HJXA 2XSJA 5DGBA 3IA0A 2C3UA 2B4OA 1R31A 1HA1A 2L48A 3EICA 3B4DA 4P7TA 4CLWA 3DLHA 2H5IB 2HFOA 4K4SA 3FDSA 5ETMA 3BQ1A 3EVWA 2V2VA 3I9ZA 1WHYA 3MECA 4NLDA 3EZOA 2JLGA 2Z2LA 2X3DA 2YKNB 2CJKA 2G4BA 3M2VA 2BBEA 1BWEA 1IBKF 1WOOA 3LW5C 1CULA 2DNOA 1Y10A 4CLTA 3T3FA 2YH1A 1Q0NA 1HR0J 5FIIA 4QBUA 5HI7A 1S9EA 1Y7PA 2DNRA 1JKHB 1WHVA 1FKPA 5K8NA 4ECTA 5J2QA 4DS4A 5KG3A 1JWWA 2XZDB 3N9UC 1U09A 5IOLA 3CCUS 4M5MA 3HD1A 4ILLA 3LGHA 4I2QB 1QAYA 5D15A 2G2OA 2IM3A 1NEEA 2DNNA 2JLEA 2XI2A 3K17A 4NLSA 2W9BB 1Q86T 1PYSB 2HHHJ 2UU9J 5EUHA 2UP1A 1QLNA 2E9RX 3DRSB 1VJQA 5DGAA 2F65A 3PHTA 4DS5A 3OR1A 1FDNA 4PWWA 1YSJA 5C5JA 1U1LA 2UV8A 4OYZA 2I5JA 4LQ9A 3G6ES 4JI3J 1IKYA 4KC5A 3AJ2A 5K20B 5KT6A 1KLMA 2B5JA 1D9AA 3PG9A 1MROB 1RWKB 4RBTA 4DDFA 4B3OA 2HNDB 4YQWA 4A8SA 3G9CA 3C15B 4UQGA 4JI5F 4WU3A 2HHXA 3JSMA 5CQGA 2F4VJ 3AB2B 1NJZA 4J9UE 3VF0B 4K0KJ 3HVRA 2IJFA 1RT5A 5EX3A 5AXMA 5JVHQ 3QZ7A 4DPWA 3L09A 4WE1A 1N8RT 4LF6F 4LRCA 3QNWB 1KTQA 5DDOC 3FCHA 5DLGA 4J9MA 3GTYX 3MHYA 4JI1J 2D9OA 3NBPA 2DVIA 3TA2A 3BGLA 1RQ0A 2OHDA 3ISND 3V4MA 5BR8J 1RAJA 4QU6A 2C3YA 1S0OA 2AYGA 1FKOB 5LM7E 1X60A 2E44A 3VAFA 4EBDA 5KG0A 2FZCB 4OHVA 4C8NA 1EP4B 4NL5A 2HQFA 2V4JA 1YHQS 3VGUA 1REVB 5HMYA 4YFUA 2C3PA 1R8BA 2HWTA 4U7UK 5EWEA 2HVDA 2K3IA 4CTAA 4CIOA 3Q0AA 4DEZA 2H51B 3SFUA 1T02A 1KBRA 1PC5A 4W90B 1OIAA 1N36F 3NGDA 1YG0A 1QUPA 1APSA 4WFXA 1S9GA 1L3SA 2OMOA 2PE8A 4S0MA 4B9NA 2ZM6J 4F0KA 1N6QA 4CM0A 5HROB 2DGQA 4B3RF 1QE1B 2QMWA 4LR9A 4KAIA 4V19X 3SSRA 1CSJA 3HX9A 3ITHA 3UDLA 3FJ2A 5ETSA 1S1XA 4I0WA 2NPFA 1SH2A 4OYAA 3CIMA 1RB0A 5DQIA 1Z2LA 4QZVB 3KLEA 3GIKA 4ER8A 4JV1A 2B4UA 4G6VB 1RT2A 4KHPJ 4ZA1A 4DL7A 3NCQA 1U2CA 3VZHA 1JLGB 1HHQA 4EEYA 2AX1A 1XMOJ 5LJ5Y 1JLBA 3POTA 4IUFA 3UVJA 1YITS 1IKWB 3FEYB 2VASA 2UXDF 4RW9B 2E1MC 1ZAXA 3MR6A 1SUQA 1U47A 1HKAA 1HBMA 1R8CA 4ITSA 4L76A 1IKVB 3W63A 4B9MA 1FJCA 3SQGA 4ECYA 1TV6B 3DDNA 2AIRB 2ZNYA 3A3NB 3M6XA 3NGTA 4UUWA 3OHBA 3I87A 1RWPB 5KT7A 4DR1F 4O44A 4EU0A 1VQ9S 1KSPA 5KOWA 2ZJQQ 5H9FK 5KFHA 1GAOA 3AD9C 3KLFA 2XWYA 4K2JA 5HK4A 1UPMB 1UETA 1IBLJ 2YWWA 2WCXA 5AT1B 2AGQA 3CB4A 2BQ3A 3N6LA 2P2CB 2NR0A 3MM9B 3PEJA 3ZTSA 2QTWA 4Q0BA 1TKXA 1AW0A 1YWXA 3THTA 1AYEA 2NSBA 4TU9A 2H5EA 1X4GA 3UDEA 2IJRA 2DBBA 4MK7A 3CJ3A 4RR5A 1CJTB 4OFZA 1YRTA 4WYLA 3P45B 5A0YA 1UFKA 2XM3A 3QO9A 4ZP8A 3UN2A 5LXYA 4ECVA 4X4PA 1Y11A 2ILZA 4OLPA 2C1EB 3EM1A 2M3DA 2QRRA 3T1HJ 3HCXA 4RBVA 2ZC3A 4NZ0A 2IPOB 1IWGA 2OO4A 1GTHA 2HS4A 3DI6A 1TU0B 1O5JA 1VGYA 3IO1A 3HI9A 1G1XA 4RW6A 1RP5A 2LEAA 2ZBIA 2LU2A 2DCLA 4G1PA 9RUBA 2K8GA 4DL4A 4CWBA 5K8MA 4BBYA 2DITA 1SV5B 4KGXB 2UUCF 4C0OC 1C1BA 2MQLA 4O4RA 2NQPA 1ZA2B 3OVAA 4F25A 4RUBA 2MGZB 2Q66A 5B09A 4EO8A 2AJ1A 3QIPB 3MPDA 3N5BA 3MAAA 5J2NA 3DLBA 1UFWA 2X1FA 3C16B 4B3TJ 2QGFB 2DGSA 2AJ4A 1VRQC 3H40A 1ZETA 4OI6A 2LQ9A 4ZDNA 1BY9A 1NDKA 2Z57B 3RGIA 2E1AA 3FMWA 2DNPA 2WOMB 4K4ZA 2GVZA 1FVSA 4RUHA 2RVJA 1JLEA 1AB8A 2XYHB 3KK2A 3PYDA 2CWXA 3TUPA 1EZZB 3EZ5A 1VCTA 5ETQA 4CCHA 2OD4A 4PZVA 3JQKA 2F5GA 2FYXA 4HL9A 1FEEA 1H2TZ 3K5OA 4NCGA 3DGPB 3QJJA 3J7YU 2BJDA 4EMDA 2EFQA 2PMHA 4PG5A 5LL6d 4UY85 5SUHA 3TZYA 1VI7A 4K4VA 1DTQB 3NGRA 2RQKA 4O0IA 3KJVA 3H5YA 4OZLA 4KIAA 3N28A 4RX6A 3U7JA 2JEGA 2YQ3A 4ANEA 3SZ2A 3TAMB 4LFAF 2GAHC 1DQ9A 4JUZA 4ED4A 2AEFA 2D3ZA 3PIPQ 2DY1A 5K8PA 3BJYA 3PW5A 4CYUB 2EK6A 3OBIA 4UF4A 3UWTA 1YTYA 2XY7A 4WYWA 2HRYA 3CDEA 4KJIA 2QC3A 1FXDA 4HTIA 1N33J 5EGYA 4MKVA 4DR7J 4F26A 3BH7B 4HTJA 4QYZJ 2CZ4A 1KP6A 1WG5A 2B43A 1HNZJ 4MJKA 3AJ1A 3D6TB 4OIXA 3ELHA 1TUVA 1T9VA 3U1LA 3E8OA 3MR5A 2XB2D 1R8HA 1CQNA 4CH1A 3B8HA 4DV4F 1EETA 1UAWA 1OPIA 3BM7A 5HATA 1I3OB 2DY9A 1FKAF 2ZH2A 1MSWD 3KJFB 2WW4A 2K2PA 5J2QB 3BKTA 4CO5A 3MTJA 3B6BA 1CJVA 2DRBA 4QYRA 1B3TA 5J2PA 2IY5B 1F3VA 3OTOJ 3ZZOA 2OPQB 1VRUA 1XTZA 2DNZA 2R3VA 2DPIA 4DPYA 1S76D 3ITHB 2DGVA 4LF6J 4LJMA 3CC2S 4LUBA 4KYZA 3OV7A 3LGMA 3D67A 4HHJA 4ED7A 1GX6A 3C15A 3CJQA 1QE1A 4DV4J 3D1QA 1PJ6A 1YZ6A 3LH2S 2GIFA 2XBPA 3FBFA 3ILIA 3LO3A 3PYEA 5ETRA 2WOMA 4GKKJ 1Q95G 3ENVA 4FPIA 5GMKa 4ERDA 3T5HA 3G6YA 3OXLA 2V8HA 4KE5A 5ETPA 2MKHA 4WXWA 4PKDB 5A8RB 2N4CA 3KK3B 2P9EA 3AAWB 1C0UB 1JLBB 1FKOA 3DCAA 1RLCL 4OI4A 4WK3A 2CKWA 4WTYA 4QW9A 4K4TA 1NB7A 1RTDA 3FVYA 4X4VA 1YJUA 4G65A 2XHCA 1PIEA 1JJCB 1FRJA 4ZPCA 4BCAA 3GZ7A 2CNNB 3J7AN 1JQGA 1P27B 1KHWA 1NHKL 1DARA 2QLJB 4UQTA 2DHXA 3QZ8A 1E6VA 1HWIA 3H98A 3IBCB 4MK9A 3L95X 4ZK7M 2CZ9A 2HFSA 4RLEA 1SQEA 2VJUA 2W4DA 2Z56B 2ACMA 4G1QB 5B08A 1FDDA 1N5VA 3OTCA 5KG4A 5BXIA 1RT4B 2W8KA 4DSFA 4RW7B 3OLAA 4DR5J 1EJ7L 4OQJA 2RKIB 3D54A 1NK6A 3DLLQ 2MY8A 3H20A 1ZPVA 2WVFA 3QSIA 2DIUA 3VTIA 4ED3A 4OX8A 3EGVA 3PCOB 4NA3A 2KZZA 2POKA 3GQCA 1NK0A 1FDAA 4DL3A 2VG5A 4DQQA 2CJXB 4ILRA 2R2UA 3MDFA 3H5SA 3NL0A 3KLIB 2GZOA 1Y4ZB 3PHEA 3QFHA 5AE2A 4IOCQ 3QO9B 1GH8A 1C0TB 3EE3A 2NYHA 2KG0A 5C25A 1T94A 2B9EA 2ZHAA 1Y3KA 2QZ8A 1RABB 4O0NA 3BGRA 1RTJA 1KC8T 4ZKAA 3CE8A 5CYMA 3SIPB 2X3GA 4WU2A 2X1AA 4PQUB 2J9EA 2HFUA 3MUMP 5HP1A 4AL6A 4WZQA 2R7QA 2LEPA 2NXNA 1PCAA 1OSCA 2RJZA 2C3MA 4OX9F 5BJRA 3MPWA 2B7BB 2ERRA 4FF1A 1CJVB 3T1AA 2OEJA 1HD0A 2V6AA 3EDQB 5EX0A 2VPZB 2WVBA 2XMJA 4M5IA 2VICA 2D1CA 1TMJA 4ZCLA 1TL1A 4KO0B 4L73A 4MAKA 3ZO7A 2JC0A 3QFWA 1N5TA 4EGLA 3NNCA 1U1MA 3KMQA 3AQPA 4ZVHA 5AE1A 1X31C 5KFTA 3KLGB 5F9LA 2HIYA 1IKXB 2YX7A 4YR0A 2CJ9A 2M2BA 3Q2SC 1B7YB 1HW8A 5B0CA 3TJ8A 5DETA 5CABA 5D0RA 5A76A 2V4QA 1BUXA 3ENWA 3M4XA 3T1YF 1Z4UA 3I4HX 5IT9Y 3MI7X 1SL1A 5U47A 4X4OA 1NCLA 1DQAA 1V3RA 3V4IA 3TO8A 3JQJA 4QIVA 5D0EA 4K4XA 1LXJA 4RU9A 3RAQA 4Q7AA 1KQKA 4XPEA 4DR5F 4RW7A 2J0WA 4X66F 4JV5J 3DNCA 4M5JA 3CXCR 4DL2A 3RG6A 2HMIA 1AT1B 1T05B 1UVMA 2VH7A 2OKQA 2RUGA 4H4KC 2XQCA 4ELTA 2YTCA 4F2SA 3CD5A 3SCKE 1UEVA 3UI3A 2ROEA 2DT9A 3R7BB 4DV7J 2ASJA 1FNXH 1SJ1A 1R0AA 1XC9A 2UU9F 3ETMA 2GX8A 1VYAA 3J80Y 3KDNA 3ZTRA 3EPIA 1HYSB 1XQIA 3HT0A 1X0FA 2QFJA 1N36J 3CO9A 1T95A 1KVIA 3BSNA 1FEHA 3A8JA 2IRUA 3SBMA 3DRPA 1C1CB 1FX4A 1H2UX 2ZEJA 2W8LA 2RT3A 1WKKA 1WF2A 3NRBA 1FWKA 1H7XA 1K9MT 1BQMA 2DXEA 1VIXA 2HZCA 1CLFA 2YKQA 3RR7A 4Z37A 2YWHA 4CO3A 1S4EA 2PN6A 1TK8A 4Y0FA 3CCTA 4ZPTR 3ZTOA 2J0QD 2VFTA 4I56A 2CPJA 2XULA 2YNFB 3W60A 1VC6A 1AZSB 4JI4J 3D0GE 1IBKJ 3HFVA 3W3SA 1AXQA 1KDNA 1UCNA 3CJSA 4HDGA 3A8KA 2CA9A 2IDEA 4M5DB 1M5SA 1S6QB 3DLGB 1V6HA 3NXZA 4NCGB 3W2WA 1SUQB 2E9TA 4DSIA 2RQCA 2E5IA 1NSPA 2E7VA 2P5VA 1UPPA 4DHVA 3C6UA 5KT2A 1WDDA 2BKNA 2MLZA 1FO1A 2Z0GA 3TUJC 2K06A 2HWHA 1IKWA 2GHVC 2Q6BA 3DU5A 4PPDA 4RUCA 3LWMA 1N34F 1HNZF 1G4CA 2HMIB 3FMBA 4ZPBA 3TP2A 2QG9B 4Q45A 1YKWA 4ATNA 4YHHJ 3C6TA 3EYZA 3PW2A 4ZHRB 3LP0A 5E3RA 1LK5A 1F5BA 2DGUA 2YWFA 3E01B 3M32A 3R5JB 1FJGF 3Q89A 2HW3A 1I51B 4OJHA 3RTVA 1RE1B 3KG0A 2SXLA 2O3DA 4FN5A 2CQ1A 4EWTA 3K5MA 2B8QA 4F67A 2ZJPQ 3HDSA 3CVKA 3HULA 5KFGA 2UXCJ 1S12A 1PGZA 1HMVB 2HZAA 3DRXA 5AE3A 2LFVA 4KGVB 2DGTA 3RB4A 1OQ6A 4P2MA 1F2HA 8RUCA 3DRPB 1J5EF 1X8DA 2DHSA 4QPXA 2A18A 4Q43A 3K0JA 1UEKA 4DBQA 4ECQA 1ZTWA 4QU7A 2DJWA 5JJBA 5IT9U 1GTEA 4NLYA 3CNQP 1JXEA 2FHJA 1TKZB 2HK3A 4ETXA 4WFBQ 3OXFA 2KTQA 2HQ3A 2B6AA 2W01A 4LSLA 5KFVA 4NZ6A 3BGFA 2AKWB 4F8RA 4TQSA 2XY5A 1SKWA 3TNVA 4QPTA 1JLFB 2BW2A 2D7SA 1AZSA 1WC0A 2PGCA 2L3MA 3HHLB 1LWCB 2KT2A 2ZNZA 3CT9A 2PFDA 3PYFA 1D0EA 4ID8A 5C24A 1BHNA 3EVOA 4N56A 3L7OA 1NUEA 1BXNA 2Y1LB 2AEMA 3IBWA 2HNDA 1RBOB 3WZ0A 2UUAF 1KHVA 4DF4A 3MPUB 1Y5NB 3MAAB 3R27A 1LK7A 1WWHA 2EEYA 2N3LA 3EGNA 4I6YA 4OJ3A 4MYUA 4TY8B 2R4FA 5KG5A 4XAKA 3PKYA 3P5BP 2KVIA 4AFFA 1KLMB 1QJHA 3JSRA 1MWYA 2GQCA 4I68A 2GNKA 1U2RA 3D5MA 2CNLB 3C6TB 3GLJA 3RRHA 2HHTA 1NAQA 1X5PA 4K5SA 1T7PA 1DAXA 5H9EK 2BDPA 1VMBA 4KV8B 3W2VA 4C8ZA 3IAM9 1X4DA 1UVJA 4TKTA 1QAIA 1X4HA 3QRQA 1TR0A 4LRDA 3CMAS 4F02A 1SXLA 2W2PP 4OYMA 3I82A 2G0IA 2RDDA 4NEYA 2CWKA 5KFOA 3J81Y 2KM8B 4JI4F 4UUXA 3A8EA 2O01C 5ITHA 2PFFB 4ZN3A 4DXLA 2OJ3A 3HM9A 3DXSX 2I1RA 3MFHA 4ED8A 3SFGA 2UXCF 2CXEA 2CPZA 2ZH4A 5LMUJ 3CJ5A 5FDLA 3ZTPA 2YNGA 3GIJA 2VBWA 4QCLA 3R7SB 1MWQA 3BBCA 4CLZA 3KYLA 4B3SJ 3R3TA 4A46A 3LANA 1RTJB 2WB4A 2FD2A 2GJ2A 2MLYA 2BABA 1GEHA 2J9CA 4KSEB 3G71S 4IRKA 2ZOGA 2AYBA 2DRDA 5KFFA 4MTPA 2XMMA 2FC9A 3BBBA 2E5JA 3HHLA 4ES3A 4OI2A 1RISA 1BQXA 3I31A 4QQBA 3N5FA 3DMJB 4ZLLA 3KK1A 3VAJA 1SC4B 2UUTA 1ZAWA 4ICLA 5CYQB 3IWXA 2XSJB 3TRGA 2R8KA 1HYSA 2H3EB 3KOAA 2M5YA 2MDAA 2CRLA 3GG1A 1WC5A 1PC4A 1H2VZ 3AOAA 1GK8A 4DR3J 3R5DA 2R8IA 4B3MF 4D3HA 4O3RA 1JMTA 1TFWA 1MW7A 2AF6A 2HWIA 1Q8BA 2GHWA 3POTB 1RTIB 3S01A 2GS8A 5L1JA 4JI0J 3THPA 1MLAA 3HF5A 1SB6A 4C3MA 3PVXA 1HHSA 2QA1A 3O3LA 4NLOA 1QDUB 1VRTB 2PO4A 3UN3A 7FD1A 4MMOA 1TK0A 4OL8A 3DKDA 2XCPA 1RT1B 1W26A 2IC3B 1ROFA 3IS9B 2UV8G 1HLWA 1C4AA 4RW6B 3TEHB 2HEKA 3X3UA 4AQYJ 2RHQB 3DLKA 1CS4A 1Q8KA 2CQDA 2NXCA 3DM2A 4IOBA 1C2PA 2I0XA 4MIAA 5KFAA 3W2VB 3LP2A 1H72C 3Q86A 2J6UA 3PFOA 3PRVA 1IN0A 1U45A 5DG7A 4DUYF 2YX1A 2ZVIA 1OO0B 1WOSA 4ECWA 4FYXB 3DU6A 2F9DA 2DNYA 1GNKA 1IUJA 2FHMA 4AE5A 3C14B 4TNOA 3D0HE 3MMBA 3DRRB 1G7CB 3BH6B 3CJ0A 5F9NA 2W9BA 5F8IA 3TARA 5E0OA 2VHGA 2KN4A 1S57A 2HPUA 1PJ7A 2HRUA 4XK8C 3R1LA 4KPYA 1AFIA 5HQLA 2A10A 1Z2ZA 2FZKB 2FZGB 4FNIA 3LPEA 2LA4A 3ZZUA 2UUBF 1WELA 3WX8A 4X62F 3GONA 4YP3A 3HHEA 3NGUA 3PRBA 5E3CA 5DQHA 4H4MA 1N32J 5D0HA 3A4TA 3Q23A 1ELOA 2DNQA 3ILOA 1SKRA 2KT3A 1M90T 3SYZA 4JI8J 4QYZK 4O4GA 4FBTA 3C66A 3QAUA 4X4TA 3S8SA 3OTOF 4NASA 1SH3A 2V69A 3NNAA 3OT9A 3KNAA 2M8HA 4EI2A 1XR6A 4J9KA 1P8GA 2QA2A 3IC1A 1X4FA 2AJ2A 4ZS6A 1QSYA 2J76E 2LYVA 1LWFA 5ETOA 4MT1A 3M30B 1FTCA 3K8WA 1C0TA 2BQUA 1CBKA 3LAKA 3U1MA 1HBOA 5KFKA 2R7SA 1CPZA 4F4YA 1IM4A 2DTJA 1NK8A 1EIYB 4CLLA 2QX0A 4AQYF 3KJQB 3KHGA 4KPCA 4P9SA 2VV5A 3WQPA 3M9OB 5CXTA 4WZMA 4NRUA 5SZTA 2V63A 2U2FA 3R5AA 1HWJA 2NLWA 5I3PA 3HFKA 3P6YC 3H0PA 4DFPA 4RZRA 2CPXA 4WKRA 4PG8A 3ZFVA 2QL9B 4F4AA 2A2CA 3J80U 1RT6B 3G2XA 1HNXF 4KH0B 2HHVA 3NEKA 1EQMA 1SV5A 1U1RA 2BM1A 4JI7F 5DM7Q 3NAHA 2I2YA 2KFZA 3KJVB 3OPKA 1NM2A 4JYAJ 2HNZB 3RW7A 4ECRA 3EVMA 1QSLA 3R5BA 4ZJQA 4M8LA 4YDXA 1S1TB 2OEKA 3FCVA 2IYGA 4J5OA 1JLFA 4PG7A 3OSPA 3CDUA 3BR8A 2ZH3A 4NWBA 1PILA 1HNIA 4KY3A 1QVFR 5L8RC 1TKTB 1NK7A 4I6AA 4P71A 2O1PA 4MFBA 3BF4A 3HJVA 1YJTA 3QGGA 3M2RB 4BHQA 3D2WA 4DSJA 1FF2A 4A48A 2IM2A 4PG4A 3KLGA 3VAKA 3TVKA 3FZ2A 3FZBA 4TLRA 5C7PA 5I42B 1ZTTA 1RYSA 1TP7A 3AA8A 2LLZA 3TQEA 2MYFA 2QL5B 4FS1A 2FJVA 3AD8C 2YNHB 1TKXB 1URNA 2VOPA 2R7XA 2GJIA 3JS9A 1RHUB 1TKDA 4TVAB 4WJBA 1KOHA 1HMVA 2L08A 2YKOA 4NPOA 2WONA 2V2QA 1D09B 1NZ8A 4MIWA 4KHPF 4DZDA 3HVTB 4OHXA 2XMKA 2N7CA 2BUNA 1ZAVA 3UQSA 4O3PA 2HFZA 4IG3A 2E7XA 2KHDA 5IV4A 4A8WA 1NKCA 4CZCA 4N77A 4DV6F 1VHFA 2B3TB 2EPIA 5IM0A 1LOUA 2FLNA 5D77A 3KNGA 1HARA 4KRWA 1TTHB 2VPWB 7FDRA 2BJEA 1S99A 4CLPA 4CLUA 2L41A 3MR3A 1RU1A 1XR5A 1YLXA 2VDHA 2LA6A 2XG8A 3CWJA 4ES1A 3V81B 3LTOA 3K5LA 4C0BA 2MHEA 5GMDA 1VQLS 1LXNA 5DZ7A 3MWBA 5JMNA 4FXVA 1WD6A 4GKJF 1WC1A 1P9QC 2GCFA 4Q44A 2Z2YB 5JXSA 3DYAB 5DLFA 3GFHA 4Z2XA 3G87A 2VPYB 3N01A 3ET6B 4LBHA 5KFZA 4RO0A 4IQMA 1OWXA 2OPPB 5E7OB 2W2NP 1QUVA 3DHWC 2EG2A 3MR2A 2IMWP 3CD7A 1UJ4A 3MEKA 2MGZA 3D4JA 2MQOA 2C2DA 3HXMA 3FQKA 3M2UA 3QLHB 4IG0A 3W65A 1XNQF 4ZPAA 1D3WA 2KFNA 2O5DA 3QT8A 4H54A 3PR4A 1IQZA 2ZKUA 9ATCB 1YBAA 3MAHA 2PEHA 1UVNA 3OFEA 1VBZA 1QAXA 1YI2S 2FVCA 4MFBB 4PAAA 5KFQA 3MM6A 2HVIA 1SBRA 1ZZFA 1IVZA 3CDAA 2F3JA 5J1EB 4NI2B 3M8WA 5GAEU 5KFUA 1QSSA 4ANDA 5CAAA 2CPYA 3AA9A 3PIOQ 1L5UA 4Q2LA 2KDOA 2OEMA 3I0RB 4RKUC 3LP1B 4UZBA 3DOKA 2FUG9 4K4UA 3DXBA 1F3FA 2GVZB 4KKOB 1IM6A 1NJXA 3GV5B 3HSDA 3JQMA 4OZNA 3EXCX 5A6WA 2BJ3A 2JH3A 2CQ0A 3A3OB 2OI2A 3CF5Q 1Q5YA 4EO6A 1KOOA 2KXHA 1RTDB 1DQ8A 3NOGA 2HVEA 3UN5A 2CQCA 2RSQA 4P2XA 5KTQA 1UKUA 3CCRS 1DHMA 3MFIA 1NJIT 2W7AA 2B9WA 3TWZA 3QATA 4WXOA 1S59A 1MU2A 1NNDA 2FVSA 2WK4A 4JP8A 1Z1ZA 2YH0A 3I56S 1KLNA 2F1FA 3W5XA 3QWPA 1Q7LB 4F3QA 3R6GB 4NOHA 1Y9OA 2HQGA 2XS5A 3NMRA 4PG6A 1VQSA 1WG1A 2R8GA 4J9SA 1HQEA 1LW2A 3J7YI 3FBCA 4TU8A 2MKCA 4D3GA 3IRWP 1BE4A 1REVA 1V9OA 2K1RA 1WI8A 3O1LA 3QGHA 3RZAA 1HW9A 4KO0A 3BBFA 3TQ1A 1NK5A 3H5XA 4X4QA 2PA3A 2VG7B 2MZTA 2OPQA 2HFNA 2W1BA 3A13A 4A8MP 4J9RA 2WHOA 4CLFA 2AYMA 4NYZA 3OJUA 1ZBTA 2BMBA 3PX4A 1U1PA 4NMLA 2G9OA 4PR6A 1FCAA 2VZ9A 1RSCA 2XLIA 1YRUA 2KM8C 3OR2B 5HROA 1KEKA 1MMDA 1EQ0A 4Q8FA 3MD1A 4ED0A 3IRXB 4RJVA 1PKUA 2IRXA 3NCRA 2H5JB 5F8GA 2MZRA 3OLBA 2FVRA 2ZDOA 4K8RA 4KV8A 3RYLA 2HK2A 3QSYB 2IVYA 5HVHA 3K5PA 3DOMA 1WG4A 3AOBA 3BQ2A 2RNEA 3V6HA 1D9FA 2C28A 2X1GA 2G0JA 1RWVB 4QIGA 3D28A 3DN9A 1FRXA 2UXDJ 4RNOA 4EYHB 3LF0A 4J7CA 4QIWD 4NLGA 1T9WA 1VQ7S 3DGVA 3K57A 1U1OA 3H8YA 3C19A 3L7UA 4WFYA 1RT7B 1P1TA 2VL1A 2HNZA 1S1WA 2EW9A 4LSNB 2XYGB 5IC6B 3CCJS 2DR5A 2E5HA 3JTOA 4BS2A 3QRPA 4I2PA 1VQPS 2DPJA 2ZZMA 3KWMA 1GXLA 2A6OA 1IBLF 1YDLA 3ZZTA 1RWUA 3FGVA 4DUZF 5F3ZA 2RDJA 4Q2MA 2H4WB 3TZWA 2HAIA 4EK2A 3IG1B 2EFNA 4JOUA 3HVTA 3D9BA 1XBWA 1NHUA 1UWAA 2BE2B 5HQ8A 4B02A 1GMWA 1WJ9A 2CPHA 2DNLA 4M63A 5D78A 3H90A 4HLBA 3FRZA 3IBFB 1RAGB 4RBUA 1B4SA 3SDEA 5LSOA 3VQTA 5KG2A 1J5OB 3TA1A 1AUSL 1RA7A 3ZNUA 4NZ7A 3MM7B 2DHAA 4ZLJA 2VC0A 1X5OA 2W24A 3FBBA 5IZHA 3OSNA 3KK1B 2IA0A 4DV0F 2VC1A 1REGX 2RIJA 3MTKA 3VWSA 5IFMA 5G4DA 1OYEA 2GMLA 1X4CA 2M0GB 4B08A 4J90A 2BANA 1SPBP 1S1TA 2OLWA 2IJNA 2UVUA 2VONA 1XNRF 1CJUB 1HNVB 2VFUA 4TY9A 2O67A 1HIYA 3P3DA 4EBCA 1MN9A 3B82A 2W2QP 3BDEA 5HLFB 3E2EA 2RS2A 3BR9A 4HT5A 1C1BB 1S9EB 2J0XA 2G1HA 2NSCA 5KFLA 5LT5A 2A2DA 4F3OA 3ZZPA 2L9NA 1KWMA 2IDLA 3GYNA 1W7WA 4ZVSB 1VQ5S 4ED5A 2VBXA 4LREA 1S4FA 1B64A 1RYRA 2G2YA 2R8JA 5DRKA 1RI7A 2B4VA 1UL3A 1LFPA 3VV2B 3F44A 5HJYA 1JLEB 2EXUA 2I5JB 1YBTA 3BGOP 3UR0A 1HI1A 2AHOB 3W8GA 3H4DA 4AL5A 4DLEA 1VISA 3QBCA 3V6KA 1WORA 3GR1A 4DZ6A 4X66J 3PV8A 4LIWA 1S9FA 4WK1A 1WC6A 1M1GA 3OQ2A 4HHHA 4CRJA 1ACMB 3O5TB 5J2MA 3PJXA 4A8OA 4OHYA 1QY7A 2GMJA 4PXBA 3V6JA 5CD4A 3SSSA 1J5OA 4DPUA 2MSTA 1N5YB 1JLCA 2LDIA 4OJ1A 3W7BA 1PSDA 3S1TA 2CQ4A 4DSLA 3EZUA 1OJ4A 1S49A 4OI3A 1PBUA 2YWGA 3K58A 1RU2A 1RJJA 2PIIA 3OFFA 3R5GA 1FVQA 1VIOA 4OZ1A 3I0RA 4IH5A 5AJ3J 2OH2A 1FFGB 5DO2A 1N6QB 3A12A 5HO4A 4FKYA 2EK1A 3ILLA 5IWAF 4GKKF 2EKNA 2V9KA 5KFSA 3H59A 2BM0A 2BR0A 2W25A 4OYBA 2LKZA 1RA6A 2X51A 5E5NA 1Q16B 1X5TA 1FJ7A 2IRYA 2GIQA 3MM7A 1WKJA 2I8EA 3ENQA 5FD1A 5ETVA 1R7IA 3OD2A 4H4OA 2J9DE 3TVZA 2L9WA 1NB2A 3OL9A 3GIMA 2RD5C 2V8GA 3AD7C 2HGLA 4GO5X 4CNZA 2W9CB 3L7PA 2BE9B 2J7UA 3FRYA 4HHUA 3G86A 1TUWA 1VR6A 4LIRA 4JV5F 3MCOA 2KYXA 2WW8A 4FF2A 4JI7J 4C9DA 3W9JA 3O8WA 4USJC 4USUA 3F73A 2R2TA 1FX2A 3RBZA 1S0NA 5J2PB 2E1PA 5B0GA 2VOOA 1MNEA 4OV6A 4WFNQ 2Y3YA 2DGOA 4Y2MA 3RBXA 1MN7A 2JSXA 1VFJA 2DB1A 3H4BA 2VA3A 5HSPA 3SV3A 1K1SA 3UNGC 4DR6J 1RACB 1RHRB 4P2FA 2D3OR 5D3GA 2APOA 4ELUA 4TXSA 4YB6A 1X4AA 3IFEA 2VF3A 5DG8A 2JDJA 2GMHA 5KFIA 3FK4A 3UCGA 3W2WB 2NCKL 4YB1P 1N54B 1RK8A 3AH6A 3DRSA 2B5JB 2NYIA 3NAIA 3QT5A 3ILJA 4DSEA 2PDAA 3FSXA 5CCLA 2CJAA 1BQNB 2YPYA 4LT6A 4JV0A 2MMYA 4DI6A 4E98A 2BQRA 5DDRC 2DR8A 5IWAJ 2QMUB 4PQAA 2RQMA 4AD6A 3IRXA 1J27A 4DUZJ 1Q53A 2XWXA 3ZNJ1 2LVWA 1AROP 3KUGA 5KFXA 4NXMF 3ZXWA 3QGIA 1U49A 4XDDA 4NMXA 4ZPVR 2D41A 1WHXA 2DEJA 2YNIB 5H9EJ 4DU7A 2ZD1A 2GFFA 5DZ6A 3CJTA 3ETOA 5F0WA 2IBKA 3KG4A 3MF5A 4IRDA 3HO1A 1M0SA 3BS9A 2MZJA 4HH0A 4BDPA 3TA0A 2ZHOA 2EG1A 2C2EA 1N5YA 3SV4A 2ZITA 2M88A 4DOZA 1C1CA 2KHCA 2RE1A 4L75A 5A2QY 1JLAA 3MURP 4NXNJ 1FT8A 4A4JA 4FF3A 4G3IA 2K1RB 2MXYA 4EYIB 4LSLB 3CCZA 2R7UA 2FIUA 1VQ6S 2HRTA 3V81A 2K7JA 2ZH7A 3HJFA 4WCEQ 1D9DA 3L4BC 4N8NA 4CM2A 2QEXS 4I67A 4FYVB 4C11A 4C48A 5C25B 2IBOA 3HHKA 4LBPA 4R0EA 4CI0B 3VGSA 2ZH9A 2RU3A 3A1YG 2YKAA 3DC2A 4CP5A 4J9OA 4DR6F 4YB7A 3IS9A 2BX6A 4HDHA 1IBMF 5E33A 3FEZA 3G6XA 3TR5A 1M5KC 1KQGB 2QSWA 4OYIA 1S48A 2R7WA 4I7FB 4P52A 1YJWS 5GVQA 1ITPA 1R0CB 3RAXA 2YPZA 5C24B 2V0NA 4LMZA 1ZM2A 2B8PA 3KKFA 3MMJA 5DQGA 1RWOB 3SEOA 2LECA 2DNGA 2OPSA 4TQRA 2WSFC 1QD1A 2D69A 3GFYA 2OSRA 3NS7B 4QIEA 1IJEB 4U8VA 2HS0A 5IT0A 4DV2J 2BW7A 3M1VA 3T41A 3KHLA 4M5HA 1RWXB 5D0GA 2QE5A 2YVSA 2NREA 3GCWP 1R0BG 4QWCA 2HBQB 4V19J 1FRMA 2CJQA 3NS5A 4JBCA 4X62J 1YJNS 4C3KA 3MUVP 2C3OA 1LFWA 1DTTB 2XGPA 3JYTA 4IR9A 3M8SA 5J1EA 1XEZA 3GG0A 4OLOA 4OJGA 4F3MA 2AJ0A 4A8XA 3CCES 3IR5B 4LBIA 1N33F 1R27B 2VU5A 3EJMA 2CNKB 3CJKB 2YQ0A 2OAUA 3G8QA 1FE4A 2OPRA
chains in the Genus database with same CATH topology
3N6NA 1ZM9A 1TFYA 1SL0A 3CDBA 2Y1IA 4DF8A 1UVIA 4C8MA 2B0GA 2VFRA 4FVCA 3EXYA 4FXWA 3OFGA 1UW4A 3H2UB 3N4WA 3FSYA 3S7RA 3T9ZA 5DJBA 4C2MA 1URRA 3NCPA 3NS6A 5M2PA 2ZJRQ 4A8YA 4ID5B 1EETB 1YGYA 2ZH8A 2PC6A 4DL5A 3M05A 3HHNB 4URSA 5AXKA 3Q2TC 4C8YA 1DURA 1ZZNA 1SKSA 4FBUA 1VS3A 3DOLB 4KBIA 2DD8S 1U48A 1W25A 2Q79A 1RT4A 5EWGA 2B4PA 3IGNA 2C22A 2KYZA 2PA8D 4DJBA 5AXNA 5F8MA 5KFEA 1O51A 3THVA 2UVUA 5CZVA 2DR7A 3HHLD 5F41A 3SMZA 1R89A 3CUNA 4NCBA 2AGOA 3X1LB 5AJ3F 3PRDA 2P9GA 1UJ5A 1FKPB 5T41A 1FDBA 3EX7B 1WEXA 4OV1A 4ED6A 5FLXY 3OR2A 3QGPA 5E3PA 3HT3A 1YVFA 1T3NA 2VFSA 1HD1A 5KG7A 1X9MA 5KG1A 4IQXA 2XCAA 2AJQA 2DH8A 5I42A 2LQ5A 1HBUB 3HHLC 3CJKA 5E3AA 2XLJA 2G0CA 4URGA 1S0MA 3TI0A 2XGQA 4YOEA 3TVYA 2KU7A 4TU7A 3FSIA 4CH0S 3NKYA 3Q24A 2MQNA 1H0HB 3ZZRA 3CCSS 3MXHP 2E7WA 3CIZA 5D4NA 4LFBF 3SXLA 3T1HF 2MZQA 3I0SA 2VKZG 3ONQA 4CH7A 2RKIA 5E3QA 4GMKA 2ZFHA 2VUGA 1SJ3P 4I2PB 1RKJA 1BC6A 3DDKA 3MPYA 2LQJA 1JB0C 4QWAA 1YIJS 1VQOS 5KG6A 4NLRA 5J1PA 4DQRA 2OPPA 1JLQA 1RTIA 2HNYB 2VD3A 4IKAA 3OXGA 1VBXA 5D8HB 1HWKA 3MEGB 1CC7A 1KFDA 1UMJA 2OFHX 1Y3JA 3DYAA 4JI0F 4HI1A 4C0HA 3KLIA 3R5CA 3N6MA 2JL9A 3B78A 4OHWA 2FY1A 1TQLA 2E5LF 2XMWA 1NO8A 1TAQA 2MHNA 2MKKA 1S1VB 4DWIA 3OTDA 5E41A 2FJBB 2ASLA 3M2UB 3QLHA 4K5RA 4RW8B 3B4MA 5LJ3Y 3OHAA 2JC1A 5L9NA 2V4RA 2XEXA 4CO1A 2M52A 5LXRA 1WI6A 2QA4G 2KXNB 3CJ2A 4Y34A 5KFWA 1KS2A 3VAGA 5KT4A 5HLFA 3T9NA 4B9VA 1X7VA 2VODA 4C4WA 3C8YA 1LKZA 2DH7A 2FJEB 1J2VA 1TV6A 1K1QA 3MOJB 3CPWR 2MSSA 2K3KA 1N4LA 1E6YA 2RMLA 1U25A 5GAEI 3KLFB 1B0PA 4N41A 4FXDA 1NH7A 3NWGA 2Z2MA 2R7TA 1G2EA 3ICLA 1TVRB 4RW9A 1LWEB 4JI8F 3OR1B 2VBZA 3NP5A 1HNIB 3OTEA 3QIDA 2VBYA 2M4MA 3OUYB 2KFYA 3CMES 2EKYA 3LOUA 3RBDA 4HI2A 1U2FA 2ASYA 4IFVA 3LPYA 3Q8QB 1V3SA 3AB4B 4A8KA 2IHR1 3ZC4A 4LF8F 2XLKA 4A8QA 1S1UB 5A8KB 2FC8A 3D0IE 1ZM4A 4Y2KA 3I5AA 2GO9A 2ZDPA 2FLOA 1WACA 2CQPA 3L3CA 2ZH1A 5C42A 3E51A 1EP4A 3DI6B 2V8DA 2LU1A 2O66A 4X4RA 1ZPWX 3UPFA 4C8OA 4ZCKA 4U67Q 3PJWA 1FRKA 5HBMB 5I3UA 3BSOA 1FRHA 4CT8A 4N5SA 3CC7S 1FHTA 2RF2A 4LF7F 3QPIA 3M1VB 4Y2IA 1NKBA 4LF5F 4N76A 1FE0A 2BA9A 1NJYA 4Y28C 3SDEB 4IG0B 5F3TA 1K73T 3PO5A 3GILA 4PQUA 5AXLA 2FLPA 5L39A 3AQOA 4O3OA 1TZ0A 5KFBA 3P5TL 3ZZYA 2HIQA 1Q79A 2HGNA 1X4EA 1F60B 4IDKB 3M8PB 1AFJA 2OTLS 4Y65A 2N4DA 1L3KA 2KI2A 3GB0A 3LP1A 1RT7A 1MROA 2F8EX 4B3OB 1CG2A 4XDCA 2FTRA 4J9PA 5D3GB 1WTBA 1RT2B 2XS7A 2KB2A 2E1CA 4R0JA 1G3OA 5KOXA 1U8SA 5KAKA 3NL0A 5K14B 3AHPA 1RDRA 2BVZA 5G0RA 4NLWA 1M5HA 2CPDA 2HLTA 3HKWA 3J7Z5 4IFVB 2XY6A 2WSEC 4QWBA 4ED1A 2KJWA 4B3RF 1O0PA 3HKZD 1SIWB 1Q8LA 4I64A 4ZVGA 5MAOA 4MKBA 2ASDA 2QV6A 5DG9A 4Q0BB 3NG8A 4O4GB 1N32F 4I1TA 4F2RA 4YMEA 5M2RA 1SI9A 3U02A 1B7FA 1K0VA 4IOAQ 1XK8A 5HBMA 4DQPA 3MM8B 3H2LA 2JJ4D 2VB6A 4MK8A 3GV8B 1CEZA 2DIVA 1UA1A 3CSKA 4KKOA 2H9ZA 3I0SB 2D74B 1GT8A 4RNNA 4GO7X 5KFYA 2CQ3A 3CCWA 4TN2A 1XMOF 4ECXA 4X65F 3OVBA 1R0AB 1HQEB 2CG4A 2CPFA 5F8HA 4W92B 1N5SA 4LVNP 3HVAA 2D3UA 4KGMA 4PUOB 4NCAA 4IR1A 2XO7A 2CQ2A 5CYQA 4RNMA 5K8OA 2QIFA 2HVHA 4X64F 4R8UA 2E9ZA 4DN9A 4U7CA 3MMCA 2MZ1A 2GGPA 4DR4F 1S1XB 2HHPA 2J5AA 1MU2B 1ZOTA 4NLQA 2R2SA 1NU4A 3BO2A 1A7GE 4J9QA 3QIPA 2P6TA 2MY7A 5T7LB 4XIUA 3CCVS 4I7FA 1FD8A 5A6PA 1U7LA 4NLTA 4Q5VA 3QMQA 1VRTA 3TYTA 4X4UA 2BV3A 4MH8A 4G1IA 3SQGB 2CJBA 3MZIA 2FGOA 2B9XA 2ZVSA 1VLYA 1N88A 2IAJB 5L38A 3UDCA 1TL3A 3GE9A 3OJSA 3PY8A 2CDQA 4DQIA 3HK2A 2YKPA 2LXFA 3CEDA 1E6YB 1FK9A 4RNHA 1VQNS 2CZVC 3CJ4A 1UFLA 5FDLB 2Q3PA 2N3OA 2XNQA 5E2QA 4KHMA 1E6VB 3WX4A 1JJHA 5L1IA 3IR6B 3T6JA 1X0PA 3BGUA 2J0SD 4IFYB 2Y0SD 2QYCA 1LV5A 4DMZA 2YNGB 3BZQA 5HMXA 3R1HA 2WONB 4X2BA 4ZCIA 4LF4F 3O44A 1UVLA 1U24A 3IWNC 2BOPA 3RW6A 3MMBB 3DHXA 2RH3A 2EVZA 4DPOA 3DGPA 1F9FA 2QA4S 3I96A 4NLVA 3BGRB 3US5A 3VALA 2JOQA 3PX0A 4DSKA 4ETZA 3MOZA 2AGPA 1VBYA 3PR5B 1U6ZA 2DK2A 3K8VA 4DV2F 2IM0A 4KGKA 4E0DA 5GADI 2V2KA 4X4SA 1T03B 3KLHA 2FVPA 4LQ3A 3CULA 3DFEA 3RB3A 3LGNA 4EFAC 1GQEA 2LXIA 5F8NA 1XERA 3ZZ0A 1VJWA 1SJQA 4PWUA 1SJRA 5J2NB 3K59A 2MJNA 4AL7A 5HMWA 1TK5A 5B0DA 1FNMA 5CCMA 3Q22A 3BN7A 4FP9A 1SIZA 1LWCA 4PCQA 1B0TA 4TY8A 3MMCB 2FHOB 3WBZA 4MKYA 1K0TA 2YWKA 4YY3F 4K4WA 5A8WA 2R7VA 1QVGR 1UA0A 2DRAA 3TW0A 3MECB 1M5VC 2UVVA 2Q6CA 3Q8PB 3MM6B 5DM6Q 1TVRA 4K50A 1S6OA 2CQBA 1C4CA 4NXNF 2IFXA 2Z4PA 4QJVA 4DR7F 1HHTP 2VA2A 4FF4A 3OW2R 2KXFA 2R2RA 2Z8QA 4N8OA 1Q81T 2GC8A 3DRYA 3G8SA 4NLUA 3JSBA 3PEHA 2AP6A 2JVRA 2FJXA 1T05A 4UY8T 2IVFB 1VK8A 1JLCB 3M6UA 5K14A 4AUKA 1IR0A 4C98A 1Q7YT 2OFGX 4QWEA 2YKNA 1S6PB 2W4CA 3MM9A 1X9SA 4ZP6A 4IH7A 4QWDA 2WAQD 1LW0A 2X1BA 3OTBA 3BDPA 3I5BA 2RRBA 1OPZA 1P6TA 5IQ6A 4DQSA 4NLPA 1KONA 4FNHA 4ZVEA 2V8VA 2V5HG 4K2XA 4QR1A 4DG1A 2NZ4A 3JSYA 3VAMA 5L9XA 4U6PA 2EFPA 2JFKA 3WC2A 2N7YA 1QAJA 2QMXA 4IDKA 3DLEA 1IXKA 5KFMA 3CCMS 4RUAA 1JNZB 2B56A 4C7QA 1M5OC 1RTHA 4NX9A 2DISA 1RGVA 3I5CA 3LAMA 1U26A 4DV1F 3PM9A 4YR2A 3M8PA 4CO4A 4TYBA 5CHCB 2R9LA 3PW0A 3VCDA 2KG1A 4YB5A 3ISNC 4O23A 2XC9A 1VQYA 1UVKA 2ZOFA 1WEYA 2FPHX 1UEUA 2BZ2A 5HP1B 4CQ1A 3M2RA 2RB7A 4R5PA 2JHEA 5J2MB 1I94F 2RILA 5HMZA 4F50A 1VOMA 3I4PA 4WFAQ 1SH0A 3JYTB 1Q8IA 1W2IA 1NHVA 3FFIB 3MEEB 3N79A 4FVMA 5GAHU 4DL3A 4Y2AA 3KK2B 2PMZD 4HYKA 5IXUA 1S79A 2CQGA 3TOQA 3J7A1 2QT7A 2PSZA 2AQ4A 1ZH5A 2HQIA 2LDYA 5CZXA 3DM2B 1F5CA 2GV1A 1H6KX 2V4JB 2A1BA 4Y2CA 5EHHA 2VG5B 2IA6A 2ZD1B 2JEJA 3JTPA 3MM5B 2JWNA 2MKSA 3IG1A 3RRKA 1DLOA 5ADZA 1TL1B 5B0BA 3J7ZT 2ZH5A 1KQSR 1F0XA 1Y00A 2AV5A 1FJEB 4LVOP 2GQ2A 4IFYA 3V2UC 2BE2A 1S1UA 3OUYA 2FJWA 3PKMA 4M94A 4GC7A 4E8UA 2PI4A 2OPRB 3KG1A 4U9RA 2AJFE 4H4OB 4H4KA 4O3QA 3KHRA 1L3UA 1TAUA 4L6V3 1IKXA 4FYDA 1ZM3A 4C11B 4GC6A 2FVQA 4ES2A 3M8QA 5F8LA 3KTQA 1RTHB 4HVZA 4PUOA 2OD6A 1KQFB 1DJ0A 3K7RA 2F8HA 1LWFB 2AWZA 3GSDA 2NXUA 3PACA 3BREA 1T03A 1RT3B 4B9UA 2HG4A 4IYQA 1HBOB 2WBMA 3I9V9 1JLAB 2ROGA 4ID5A 4IO1A 4DG1B 1AFIA 2ZHBA 4WFZA 3BEGB 5LSLA 2FHJD 2J7WA 2OMLA 2J6SA 2CIMA 2DO4A 3FQLA 1BQMB 3FEXB 4USIA 3EUNA 1NH8A 2AYEA 4B9TA 5B0AA 1DZ5A 1N0VC 2HHUA 1VC0A 1R6YA 1KNZA 1VRUB 1JKHA 3T5KA 1BQNA 2KRRA 3JB9k 3QJPA 4I4BA 4DV3F 1FRLA 1S77D 1IQTA 3T5LA 3WC0A 3DOKB 4O44B 2WB1D 2EFGA 3MPVA 3RB6A 1FK9B 1UWBA 2F4VF 4KT0C 1HWUA 1R43A 4J9LA 1X9WA 4RU2A 3H2VE 1HBMB 2BACA 2VPXB 3TAPA 4ZOSA 2RS8A 1NKEA 1D8YA 1LQ9A 2ALZA 4F4WA 2V94A 3BB5A 3PW4A 2NPIA 3GWCA 2F9JA 2W7OA 5BR8F 2LEBA 2F40A 5LMNF 2ZC4A 2HGMA 2EFOA 2QLXA 5GAGI 2OTJS 1F2GA 2IM1A 1JLQB 5EWFA 1KRPA 4KHRA 3MMAB 4F4ZA 4B3SF 2GHPA 4JI2F 1NRKA 2W4PA 3BO4A 1X5SA 3TAQA 2UVWA 1N5QA 2KJVA 1VQ4S 1FXRA 1HI8A 1U4BA 4UW2A 2MZSA 3PFEA 4DN0A 1FESA 2EFVA 3UE2A 3KMSA 4ICLB 3SCIE 5MLCV 1KFSA 4JI3F 3HZGA 5CYJA 1U1QA 4M95A 2M70A 1W2BR 3PZPA 3E3XA 3P96A 4ELVA 2B6AB 5A8WB 1OQ3A 1I6JA 3MAQA 4B3TF 3UD3P 5IM0B 5T14A 1JJ4A 2PI5A 2CVEA 4MYTA 4M5DA 4XO0A 1QTMA 1H3DA 1L3TA 5F8JA 4ECSA 3T19A 4MIBA 1WF0A 2RRNA 5KFRA 4JV2A 2XHWA 2NUHA 1TL4A 1U1NA 2GQQA 1HNWF 1R3NA 5CYMB 1F5AA 4I69A 1HNVA 2VQEF 2Y1RI 4X84A 4EUVA 5D6GA 2PT0A 1N56A 3EPGA 3DRRA 2BRLA 3SCLE 5KT5A 4CO2A 3VAHA 4HKQA 3KHHA 3TAMA 1OS5A 1XN9A 3VQSA 1HBNA 1V3ZA 1IKVA 2IAJA 3CTRA 1A9NB 2JRSA 1R8AA 1N0UA 5M2UA 2GA7A 3MGJA 3M9MB 3ULHA 2G13A 4I6WA 1TL5A 3TUZC 3CGIA 4J9NA 2ZH6A 5THWA 2CPEA 1NK4A 1HFEL 1TL3B 2C2RA 1U1OA 5B7WA 5BYSA 1LW0B 2DGXA 3IXQA 4C8KA 4JI1F 4NA1A 2ZZNA 2XS2A 5I4MA 4DFKA 2F7VA 3D1HA 4HEA9 2QLWA 2YKMA 1SJ4P 3H5UA 4ILMA 4URQU 5HN0A 3NLCA 4R25A 5A0YB 1HPZB 1HQUB 1FRIA 3MUTP 4KR0B 1S6UA 3OVSA 3PNIA 4B17A 1KR4A 2YNIA 2AW0A 1NZAA 4BWJA 6FDRA 1S0VA 4OZJA 5CA5A 1C0UA 2MQQA 3SCJE 1LW2B 2BANB 3DLJA 4N47A 2I38A 2VFVA 3F56A 3PW7A 2I9SA 2EBGA 2ROPA 1IJFB 1KTVA 3G6VA 3HZEA 1N52B 4JI6F 4QIFA 6FD1A 5I3UB 1XR7A 1S7HA 3HLUA 5C42B 2A3JA 2HNYA 4DV7F 2ACYA 3MEGA 1HWLA 2ABYA 3M6VA 4R5PB 4YR3A 2V9WA 1JLGA 4KTQA 4OX7A 4BWMA 3TANA 1H38A 3BN4A 3I32A 1Y0HA 2B51A 2OPSB 1U6BA 1DBDA 2FDNA 1RT1A 2LCWA 2WTFA 1Y5LB 2IYIA 5D4LA 3NNHA 1N48A 5LMUF 1GX5A 1YJVA 1M5PC 4CO0A 1UP1A 4LF9F 3K5NA 1FERA 4DR3F 3MM5A 5EN1A 3BQ0A 2YNHA 3BSAA 5G0RB 1Q1KA 4K4YA 4C8LA 1MMNA 4EBEA 2FJAB 2QSFA 3DLGA 2HLUA 4RW4B 3JTNA 3OL8A 3GMGA 3MM8A 5HL7Q 4ED2A 3GYXB 4WKYA 1WHWA 3D1OA 1Q4RA 1XWLA 1DFDA 3UR3C 5IS2A 1A6LA 2B9YA 2BYCA 2HYIB 2YWEA 1WTFA 1VQMS 2JZ5A 1JIHA 3GV7B 2W9AA 2JEFA 2ZKTA 2HVZA 2B7CB 2FGCA 1YQHA 2OP5A 4PRFA 5BYQA 3QYYA 3FNNA 2ATLA 4H4MB 4RW4A 3O6QA 1Q82T 1B0VA 1H7WA 2JEIA 3OL7A 4IG3B 3NBPB 5GAGU 3M8RA 2WBRA 3LQVA 2CQIA 4PXEA 1VQKS 3CC4S 1DTQA 2MQMA 4NA2A 4P6QA 3RU0A 4B9SA 1S1WB 4LSNA 4ALZA 2XZWA 5KFNA 1JK9B 1RT3A 2ADBA 2DR9A 2P9