3SSVA

Engineered low-affinity halide-binding protein derived from yfp: fluoride complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
229
structure length
228
Chain Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMRQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Determination of engineered chloride-binding site structures in fluorescent proteins reveals principles of halide recognition
rcsb
source organism Aequorea victoria
molecule tags Halide binding protein
total genus 56
structure length 228
sequence length 229
ec nomenclature
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ssvA00
4W6SA 3BXCA 4UTSA 3ZUFA 4KW4A 2QLHA 2A54B 5DPHA 4KGFA 1OXEA 4L13A 4W6FA 1JBYA 2V4EB 4L1IA 4ZIOA 2DUHA 2FZUA 4W6RA 2WSNA 4TZGA 3VICA 4Z4KA 1G7KA 4W7FA 2WHTA 3DQ1A 3EVUA 4HQ8A 2DUFA 3ZUJA 3U0MA 5HZUA 4XVPA 5T3IA 4W6PA 2ARLA 4LJDC 2ZO6A 1YHHA 2H5RA 4J89A 1Q73A 1B9CA 3CD9A 3EK8A 4PPLA 4RYWA 4W6HA 3SVNA 3TMRA 1ZUXA 1F0BA 5DRFA 3VK1A 3NF0A 2WHUA 3K1KA 3V3DA 3LVCA 1MOUA 5LTQA 3DQ7A 3BX9A 2FWQA 3DQIA 4W7EA 5HZSA 2YE0A 2Q6PA 2H5PA 2QLEA 4W7RA 3SSYA 2GW3A 4ZBLA 2Z6YA 3UG0A 1OXDA 4OHSA 3SG4A 3DQNA 4Z4MA 2FL1A 3DQCA 4DXNA 2HQKA 3P8UA 3U8PA 4Q9WA 5FHVA 3WLDA 3LF4B 3MGFA 2VVHA 5LTRA 3WLCA 3CFAA 3OGOA 1HCJA 3ST0A 4J8AA 4OGSA 5DTZA 1Z1PA 4H3MA 3SVCA 4ANJA 3LVDA 3SG7A 5BQLA 5H87A 5DTLA 2QLIA 1JBZA 1EMCA 3I19A 5DPGA 1ZGOA 1YHGA 3WCKA 2QU1A 3W1DA 4Q9XA 5DQMA 4BDUA 1CV7A 4RTCA 3SSHA 2AHAA 2ZO7A 3H1RA 3OSQA 3O78A 3SV5A 4PPJA 4AR7A 3DQJA 2HQZA 3E5WA 4DXMA 3M22A 4DKMA 2H8QA 2GX0A 2A56B 2OGRA 2HFCA 1JC0A 4KF4A 3SVBA 4KW9A 3SSVA 2H6VA 3IP2A 2EMOA 3SSPA 4GOBA 1EMFA 1XQMA 2WIQA 3SVOA 4EMQA 3CGLA 4W6TA 3DQAA 1Q4AA 2V4EC 3DQ4A 4DKNA 4B30A 2A47A 2G6XA 3PJ5A 4KW8A 1EMEA 3BXBA 1KYSA 2YDZA 2A50B 4GF6B 4JEOA 3DQUA 4W7CA 2ICRA 1UISA 3SG6A 4IK5A 3SSKA 4PPKA 3SG5A 4DXIA 1EMMA 2DUIA 1Q4CA 2DDDA 2O2BA 3GJ1A 4J88A 4P76A 2EMDA 2QRFA 3CFHA 2PXWA 2OKYA 4W69A 3ST2A 4DXPA 2G3DB 3DQKA 4XOVA 4L12A 5DTXA 2WURA 3SRYA 1Q4EA 3LS3A 4DXQA 4N3DA 4OJ0A 4IK8A 2HJOA 5H89A 4B30B 4IK4A 3CD1A 3U8CA 3ST3A 2DD9A 2OTEA 2G2SB 3CB9A 3U0KA 2DD7A 4HQCA 1ZGPA 3SSTA 2DUGA 2OTBA 3DQ5A 4LJBA 3GEXA 4JF9A 3SG2A 4W76A 3G9AA 2H5QA 3EVVA 4JFGA 4W7AA 4R6DA 3U0LA 4W7DA 3RWTA 4XOWA 1QXTA 3NEZA 1RMPA 2VVJA 4ZFSA 3DQ3A 1QYQA 2O24A 5KTGA 4GESB 1RM9A 1MOVA 2O29A 3NT9A 2PXSA 2H5OA 4EN1A 3DQ6A 3AI5A 2VAEA 2AWJA 3DQOA 3IR8A 1ZGQA 4XGYA 3LSAA 4LQTA 4ZINA 3PIBA 4W6BA 4H48A 3SVSA 1BFPA 1YHIA 2RH7A 3E5VA 3LF3A 4W77A 5DU0A 1QYFA 3SVRA 3BXAA 4JC2A 5EXBA 3S05A 2HGDA 2EMNA 4IK3A 2WSOA 2A53B 4W6IA 4W6DA 4ZF4A 2DUEA 5BT0A 2AWMA 2ZMWA 5FVIA 5F9GA 4XL5A 1YZWA 3KCTA 4W6JA 3DQ2A 5DRGA 2ZMUA 1QY3A 3OSRA 5DY6A 2IB6A 4Q7UA 4NWSA 2JADA 4PFEA 4H3NA 4W6CA 3P28A 2WHSA 5EXUA 1S6ZA 2HPWA 2HRSA 3SVUA 2IB5A 5BTTB 2B3PA 4W6OA 3UFZA 5DTYA 2WISA 4LQUA 3ADFA 4RYSA 2QLGA 4W6UA 2AWKA 1GL4A 2A52B 5HZTA 4W7XA 3NEDA 5H88A 2Y0GA 4AS8A 5HBDA 2GW4B 2A46A 1KYRA 1OXFA 1H4UA 2YFPA 3ED8A 4KF5A 4OQWA 1MYWA 2OKWA 4U2VA 4LJDA 3U0NA 1EMLA 4H47A 2C9IA 1Q4BA 3ZULA 3EVRA 3ST4A 5FVGA 5HW9A 3DQ8A 3SS0A 4R6BA 4W74A 4W6MA 3DQFA 2QLGB 5DPJA 1KP5A 3CBEA 1W7SA 1GFLA 2Q57A 4JRBA 1XAEA 4KF5C 5EB6A 3GL4A 3GB3A 5HGEA 3EK4A 1F09A 1GGXA 3LVAA 3EKHA 4HVFA 3DPZA 4IK1A 1Q4DA 2Z6XA 3U8AA 5FVFA 3O77A 3EKJA 4H3LA 1XMZA 4IZNA 2DDCA 3VHTA 3DQHA 3DQEA 3W1CA 4W6GA 2VADA 3DQLA 4W6KA 1W7TA 3EVPA 4EULA 1RMMA 2Z6ZA 4LJCA 1XA9A 5EHUA 3SVEA 1Z1QA 1YFPA 4OY4A 4B5YA 3NT3A 3SVDA 5EJUA 5EB7A 2B3QA 5BTTA 4JGEA 4P1QA 2GX2A 2VZXA 3SSLA 3GJ2A 1EMGA 4W6LA 2G3OA 2G6EA 4W6NA 1QYOA 3DQ9A 4KAGA 5J2OA 1HUYA 5EBJA 2G5ZB 2AH8A 2AWLA 4I2YA 4W6AA 3RWAA 4EDOA 3CFFA 4IK9A 3TMTA 2P4MA 3DPXA 2G6YA 3VHTB 3H1OA 4ZF5A 5HZOA 5LTPA 2H9WA 5EXCI 2POXA 4HQ9A 3A8SA 4W73A 3PJ7A 1XSSA 3DQMA 3PJBA 4KPIA 2HGYA 5LK4A 2IE2A 3DQDA 5DPIA 4W72A 4Q7RA 4LW5A 4DXOA 1RMOA 2OJKA 4HE4A 2G16B 2V4EA 4ZB1A 1YJFA 3KCSA 2QZ0A 4ZF3A 1W7UA 1H6RA 4KGEA 4W75A 4TZAA 3AI4A 2C9JA 2BTJA 3LA1A 3ZTFA 3E5TA 1YJ2A 3DPWA 4EDSA 2HCGA 1C4FA 2YE1A 3AKOA 4KA9A 4KEXA 2IOVA 2Z1OA 4Q7TA 2VVIA 3M24A 1RRXA 1JC1A 5DQBA 1EMBA 2QT2A 3SG3A 1KYPA 1EMKA 5AQBB 4ORNA 2A48A 3EK7A 1EMAA
chains in the Genus database with same CATH superfamily
4W6SA 3BXCA 4UTSA 3ZUFA 4KW4A 2QLHA 2A54B 5DPHA 4KGFA 1OXEA 4L13A 4W6FA 1JBYA 2V4EB 4L1IA 4ZIOA 2DUHA 2FZUA 4W6RA 2WSNA 4TZGA 3VICA 4Z4KA 1G7KA 4W7FA 2WHTA 3DQ1A 3EVUA 4HQ8A 2DUFA 3ZUJA 3U0MA 5HZUA 4XVPA 5T3IA 4W6PA 2ARLA 4LJDC 2ZO6A 1YHHA 2H5RA 4J89A 1Q73A 1B9CA 3CD9A 3EK8A 4PPLA 4RYWA 4W6HA 3SVNA 3TMRA 1ZUXA 1F0BA 5DRFA 3VK1A 3NF0A 2WHUA 3K1KA 3V3DA 3LVCA 1MOUA 5LTQA 3DQ7A 3BX9A 2FWQA 3DQIA 4W7EA 5HZSA 2YE0A 2Q6PA 2H5PA 2QLEA 4W7RA 3SSYA 2GW3A 4ZBLA 2Z6YA 3UG0A 1OXDA 4OHSA 3SG4A 3DQNA 4Z4MA 2FL1A 3DQCA 4DXNA 2HQKA 3P8UA 3U8PA 4Q9WA 5FHVA 3WLDA 3LF4B 3MGFA 2VVHA 5LTRA 3WLCA 3CFAA 3OGOA 1HCJA 3ST0A 4J8AA 4OGSA 5DTZA 1Z1PA 4H3MA 3SVCA 4ANJA 3LVDA 3SG7A 5BQLA 5H87A 5DTLA 2QLIA 1JBZA 1EMCA 3I19A 5DPGA 1ZGOA 1YHGA 3WCKA 2QU1A 3W1DA 4Q9XA 5DQMA 4BDUA 1CV7A 4RTCA 3SSHA 2AHAA 2ZO7A 3H1RA 3OSQA 3O78A 3SV5A 4PPJA 4AR7A 3DQJA 2HQZA 3E5WA 4DXMA 3M22A 4DKMA 2H8QA 2GX0A 2A56B 2OGRA 2HFCA 1JC0A 4KF4A 3SVBA 4KW9A 3SSVA 2H6VA 3IP2A 2EMOA 3SSPA 4GOBA 1EMFA 1XQMA 2WIQA 3SVOA 4EMQA 3CGLA 4W6TA 3DQAA 1Q4AA 2V4EC 3DQ4A 4DKNA 4B30A 2A47A 2G6XA 3PJ5A 4KW8A 1EMEA 3BXBA 1KYSA 2YDZA 2A50B 4GF6B 4JEOA 3DQUA 4W7CA 2ICRA 1UISA 3SG6A 4IK5A 3SSKA 4PPKA 3SG5A 4DXIA 1EMMA 2DUIA 1Q4CA 2DDDA 2O2BA 3GJ1A 4J88A 4P76A 2EMDA 2QRFA 3CFHA 2PXWA 2OKYA 4W69A 3ST2A 4DXPA 2G3DB 3DQKA 4XOVA 4L12A 5DTXA 2WURA 3SRYA 1Q4EA 3LS3A 4DXQA 4N3DA 4OJ0A 4IK8A 2HJOA 5H89A 4B30B 4IK4A 3CD1A 3U8CA 3ST3A 2DD9A 2OTEA 2G2SB 3CB9A 3U0KA 2DD7A 4HQCA 1ZGPA 3SSTA 2DUGA 2OTBA 3DQ5A 4LJBA 3GEXA 4JF9A 3SG2A 4W76A 3G9AA 2H5QA 3EVVA 4JFGA 4W7AA 4R6DA 3U0LA 4W7DA 3RWTA 4XOWA 1QXTA 3NEZA 1RMPA 2VVJA 4ZFSA 3DQ3A 1QYQA 2O24A 5KTGA 4GESB 1RM9A 1MOVA 2O29A 3NT9A 2PXSA 2H5OA 4EN1A 3DQ6A 3AI5A 2VAEA 2AWJA 3DQOA 3IR8A 1ZGQA 4XGYA 3LSAA 4LQTA 4ZINA 3PIBA 4W6BA 4H48A 3SVSA 1BFPA 1YHIA 2RH7A 3E5VA 3LF3A 4W77A 5DU0A 1QYFA 3SVRA 3BXAA 4JC2A 5EXBA 3S05A 2HGDA 2EMNA 4IK3A 2WSOA 2A53B 4W6IA 4W6DA 4ZF4A 2DUEA 5BT0A 2AWMA 2ZMWA 5FVIA 5F9GA 4XL5A 1YZWA 3KCTA 4W6JA 3DQ2A 5DRGA 2ZMUA 1QY3A 3OSRA 5DY6A 2IB6A 4Q7UA 4NWSA 2JADA 4PFEA 4H3NA 4W6CA 3P28A 2WHSA 5EXUA 1S6ZA 2HPWA 2HRSA 3SVUA 2IB5A 5BTTB 2B3PA 4W6OA 3UFZA 5DTYA 2WISA 4LQUA 3ADFA 4RYSA 2QLGA 4W6UA 2AWKA 1GL4A 2A52B 5HZTA 4W7XA 3NEDA 5H88A 2Y0GA 4AS8A 5HBDA 2GW4B 2A46A 1KYRA 1OXFA 1H4UA 2YFPA 3ED8A 4KF5A 4OQWA 1MYWA 2OKWA 4U2VA 4LJDA 3U0NA 1EMLA 4H47A 2C9IA 1Q4BA 3ZULA 3EVRA 3ST4A 5FVGA 5HW9A 3DQ8A 3SS0A 4R6BA 4W74A 4W6MA 3DQFA 2QLGB 5DPJA 1KP5A 3CBEA 1W7SA 1GFLA 2Q57A 4JRBA 1XAEA 4KF5C 5EB6A 3GL4A 3GB3A 5HGEA 3EK4A 1F09A 1GGXA 3LVAA 3EKHA 4HVFA 3DPZA 4IK1A 1Q4DA 2Z6XA 3U8AA 5FVFA 3O77A 3EKJA 4H3LA 1XMZA 4IZNA 2DDCA 3VHTA 3DQHA 3DQEA 3W1CA 4W6GA 2VADA 3DQLA 4W6KA 1W7TA 3EVPA 4EULA 1RMMA 2Z6ZA 4LJCA 1XA9A 5EHUA 3SVEA 1Z1QA 1YFPA 4OY4A 4B5YA 3NT3A 3SVDA 5EJUA 5EB7A 2B3QA 5BTTA 4JGEA 4P1QA 2GX2A 2VZXA 3SSLA 3GJ2A 1EMGA 4W6LA 2G3OA 2G6EA 4W6NA 1QYOA 3DQ9A 4KAGA 5J2OA 1HUYA 5EBJA 2G5ZB 2AH8A 2AWLA 4I2YA 4W6AA 3RWAA 4EDOA 3CFFA 4IK9A 3TMTA 2P4MA 3DPXA 2G6YA 3VHTB 3H1OA 4ZF5A 5HZOA 5LTPA 2H9WA 5EXCI 2POXA 4HQ9A 3A8SA 4W73A 3PJ7A 1XSSA 3DQMA 3PJBA 4KPIA 2HGYA 5LK4A 2IE2A 3DQDA 5DPIA 4W72A 4Q7RA 4LW5A 4DXOA 1RMOA 2OJKA 4HE4A 2G16B 2V4EA 4ZB1A 1YJFA 3KCSA 2QZ0A 4ZF3A 1W7UA 1H6RA 4KGEA 4W75A 4TZAA 3AI4A 2C9JA 2BTJA 3LA1A 3ZTFA 3E5TA 1YJ2A 3DPWA 4EDSA 2HCGA 1C4FA 2YE1A 3AKOA 4KA9A 4KEXA 2IOVA 2Z1OA 4Q7TA 2VVIA 3M24A 1RRXA 1JC1A 5DQBA 1EMBA 2QT2A 3SG3A 1KYPA 1EMKA 5AQBB 4ORNA 2A48A 3EK7A 1EMAA
chains in the Genus database with same CATH topology
4W6SA 3BXCA 4UTSA 3ZUFA 4KW4A 2QLHA 2A54B 5DPHA 4KGFA 1OXEA 4L13A 4W6FA 1JBYA 2V4EB 4L1IA 4ZIOA 2DUHA 2FZUA 4W6RA 2WSNA 4TZGA 3VICA 4Z4KA 1G7KA 4W7FA 2WHTA 3DQ1A 3EVUA 4HQ8A 2DUFA 3ZUJA 3U0MA 5HZUA 4XVPA 5T3IA 4W6PA 2ARLA 4LJDC 2ZO6A 1YHHA 2H5RA 4J89A 1Q73A 1B9CA 3CD9A 3EK8A 4PPLA 4RYWA 4W6HA 3SVNA 3TMRA 1ZUXA 1F0BA 5DRFA 3VK1A 3NF0A 2WHUA 3K1KA 3V3DA 3LVCA 1MOUA 5LTQA 3DQ7A 3BX9A 2FWQA 3DQIA 4W7EA 5HZSA 2YE0A 2Q6PA 2H5PA 2QLEA 4W7RA 3SSYA 2GW3A 4ZBLA 2Z6YA 3UG0A 1OXDA 4OHSA 3SG4A 3DQNA 4Z4MA 2FL1A 3DQCA 4DXNA 2HQKA 3P8UA 3U8PA 4Q9WA 5FHVA 3WLDA 3LF4B 3MGFA 2VVHA 5LTRA 3WLCA 3CFAA 3OGOA 1HCJA 3ST0A 4J8AA 4OGSA 5DTZA 1Z1PA 4H3MA 3SVCA 4ANJA 3LVDA 3SG7A 5BQLA 5H87A 5DTLA 2QLIA 1JBZA 1EMCA 3I19A 5DPGA 1ZGOA 1YHGA 3WCKA 2QU1A 3W1DA 4Q9XA 5DQMA 4BDUA 1CV7A 4RTCA 3SSHA 2AHAA 2ZO7A 3H1RA 3OSQA 3O78A 3SV5A 4PPJA 4AR7A 3DQJA 2HQZA 3E5WA 4DXMA 3M22A 4DKMA 2H8QA 2GX0A 2A56B 2OGRA 2HFCA 1JC0A 4KF4A 3SVBA 4KW9A 3SSVA 2H6VA 3IP2A 2EMOA 3SSPA 4GOBA 1EMFA 1XQMA 2WIQA 3SVOA 4EMQA 3CGLA 4W6TA 3DQAA 1Q4AA 2V4EC 3DQ4A 4DKNA 4B30A 2A47A 2G6XA 3PJ5A 4KW8A 1EMEA 3BXBA 1KYSA 2YDZA 2A50B 4GF6B 4JEOA 3DQUA 4W7CA 2ICRA 1UISA 3SG6A 4IK5A 3SSKA 4PPKA 3SG5A 4DXIA 1EMMA 2DUIA 1Q4CA 2DDDA 2O2BA 3GJ1A 4J88A 4P76A 2EMDA 2QRFA 3CFHA 2PXWA 2OKYA 4W69A 3ST2A 4DXPA 2G3DB 3DQKA 4XOVA 4L12A 5DTXA 2WURA 3SRYA 1Q4EA 3LS3A 4DXQA 4N3DA 4OJ0A 4IK8A 2HJOA 5H89A 4B30B 4IK4A 3CD1A 3U8CA 3ST3A 2DD9A 2OTEA 2G2SB 3CB9A 3U0KA 2DD7A 4HQCA 1ZGPA 3SSTA 2DUGA 2OTBA 3DQ5A 4LJBA 3GEXA 4JF9A 3SG2A 4W76A 3G9AA 2H5QA 3EVVA 4JFGA 4W7AA 4R6DA 3U0LA 4W7DA 3RWTA 4XOWA 1QXTA 3NEZA 1RMPA 2VVJA 4ZFSA 3DQ3A 1QYQA 2O24A 5KTGA 4GESB 1RM9A 1MOVA 2O29A 3NT9A 2PXSA 2H5OA 4EN1A 3DQ6A 3AI5A 2VAEA 2AWJA 3DQOA 3IR8A 1ZGQA 4XGYA 3LSAA 4LQTA 4ZINA 3PIBA 4W6BA 4H48A 3SVSA 1BFPA 1YHIA 2RH7A 3E5VA 3LF3A 4W77A 5DU0A 1QYFA 3SVRA 3BXAA 4JC2A 5EXBA 3S05A 2HGDA 2EMNA 4IK3A 2WSOA 2A53B 4W6IA 4W6DA 4ZF4A 2DUEA 5BT0A 2AWMA 2ZMWA 5FVIA 5F9GA 4XL5A 1YZWA 3KCTA 4W6JA 3DQ2A 5DRGA 2ZMUA 1QY3A 3OSRA 5DY6A 2IB6A 4Q7UA 4NWSA 2JADA 4PFEA 4H3NA 4W6CA 3P28A 2WHSA 5EXUA 1S6ZA 2HPWA 2HRSA 3SVUA 2IB5A 5BTTB 2B3PA 4W6OA 3UFZA 5DTYA 2WISA 4LQUA 3ADFA 4RYSA 2QLGA 4W6UA 2AWKA 1GL4A 2A52B 5HZTA 4W7XA 3NEDA 5H88A 2Y0GA 4AS8A 5HBDA 2GW4B 2A46A 1KYRA 1OXFA 1H4UA 2YFPA 3ED8A 4KF5A 4OQWA 1MYWA 2OKWA 4U2VA 4LJDA 3U0NA 1EMLA 4H47A 2C9IA 1Q4BA 3ZULA 3EVRA 3ST4A 5FVGA 5HW9A 3DQ8A 3SS0A 4R6BA 4W74A 4W6MA 3DQFA 2QLGB 5DPJA 1KP5A 3CBEA 1W7SA 1GFLA 2Q57A 4JRBA 1XAEA 4KF5C 5EB6A 3GL4A 3GB3A 5HGEA 3EK4A 1F09A 1GGXA 3LVAA 3EKHA 4HVFA 3DPZA 4IK1A 1Q4DA 2Z6XA 3U8AA 5FVFA 3O77A 3EKJA 4H3LA 1XMZA 4IZNA 2DDCA 3VHTA 3DQHA 3DQEA 3W1CA 4W6GA 2VADA 3DQLA 4W6KA 1W7TA 3EVPA 4EULA 1RMMA 2Z6ZA 4LJCA 1XA9A 5EHUA 3SVEA 1Z1QA 1YFPA 4OY4A 4B5YA 3NT3A 3SVDA 5EJUA 5EB7A 2B3QA 5BTTA 4JGEA 4P1QA 2GX2A 2VZXA 3SSLA 3GJ2A 1EMGA 4W6LA 2G3OA 2G6EA 4W6NA 1QYOA 3DQ9A 4KAGA 5J2OA 1HUYA 5EBJA 2G5ZB 2AH8A 2AWLA 4I2YA 4W6AA 3RWAA 4EDOA 3CFFA 4IK9A 3TMTA 2P4MA 3DPXA 2G6YA 3VHTB 3H1OA 4ZF5A 5HZOA 5LTPA 2H9WA 5EXCI 2POXA 4HQ9A 3A8SA 4W73A 3PJ7A 1XSSA 3DQMA 3PJBA 4KPIA 2HGYA 5LK4A 2IE2A 3DQDA 5DPIA 4W72A 4Q7RA 4LW5A 4DXOA 1RMOA 2OJKA 4HE4A 2G16B 2V4EA 4ZB1A 1YJFA 3KCSA 2QZ0A 4ZF3A 1W7UA 1H6RA 4KGEA 4W75A 4TZAA 3AI4A 2C9JA 2BTJA 3LA1A 3ZTFA 3E5TA 1YJ2A 3DPWA 4EDSA 2HCGA 1C4FA 2YE1A 3AKOA 4KA9A 4KEXA 2IOVA 2Z1OA 4Q7TA 2VVIA 3M24A 1RRXA 1JC1A 5DQBA 1EMBA 2QT2A 3SG3A 1KYPA 1EMKA 5AQBB 4ORNA 2A48A 3EK7A 1EMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W6S A;  3BXC A;  4UTS A;  3ZUF A;  4KW4 A;  2QLH A;  2A54 B;  5DPH A;  4KGF A;  1OXE A;  4L13 A;  4W6F A;  1JBY A;  2V4E B;  4L1I A;  4ZIO A;  2DUH A;  2FZU A;  4W6R A;  2WSN A;  4TZG A;  3VIC A;  4Z4K A;  1G7K A;  4W7F A;  2WHT A;  3DQ1 A;  3EVU A;  4HQ8 A;  2DUF A;  3ZUJ A;  3U0M A;  5HZU A;  4XVP A;  5T3I A;  4W6P A;  2ARL A;  4LJD C;  2ZO6 A;  1YHH A;  2H5R A;  4J89 A;  1Q73 A;  1B9C A;  3CD9 A;  3EK8 A;  4PPL A;  4RYW A;  4W6H A;  3SVN A;  3TMR A;  1ZUX A;  1F0B A;  5DRF A;  3VK1 A;  3NF0 A;  2WHU A;  3K1K A;  3V3D A;  3LVC A;  1MOU A;  5LTQ A;  3DQ7 A;  3BX9 A;  2FWQ A;  3DQI A;  4W7E A;  5HZS A;  2YE0 A;  2Q6P A;  2H5P A;  2QLE A;  4W7R A;  3SSY A;  2GW3 A;  4ZBL A;  2Z6Y A;  3UG0 A;  1OXD A;  4OHS A;  3SG4 A;  3DQN A;  4Z4M A;  2FL1 A;  3DQC A;  4DXN A;  2HQK A;  3P8U A;  3U8P A;  4Q9W A;  5FHV A;  3WLD A;  3LF4 B;  3MGF A;  2VVH A;  5LTR A;  3WLC A;  3CFA A;  3OGO A;  1HCJ A;  3ST0 A;  4J8A A;  4OGS A;  5DTZ A;  1Z1P A;  4H3M A;  3SVC A;  4ANJ A;  3LVD A;  3SG7 A;  5BQL A;  5H87 A;  5DTL A;  2QLI A;  1JBZ A;  1EMC A;  3I19 A;  5DPG A;  1ZGO A;  1YHG A;  3WCK A;  2QU1 A;  3W1D A;  4Q9X A;  5DQM A;  4BDU A;  1CV7 A;  4RTC A;  3SSH A;  2AHA A;  2ZO7 A;  3H1R A;  3OSQ A;  3O78 A;  3SV5 A;  4PPJ A;  4AR7 A;  3DQJ A;  2HQZ A;  3E5W A;  4DXM A;  3M22 A;  4DKM A;  2H8Q A;  2GX0 A;  2A56 B;  2OGR A;  2HFC A;  1JC0 A;  4KF4 A;  3SVB A;  4KW9 A;  3SSV A;  2H6V A;  3IP2 A;  2EMO A;  3SSP A;  4GOB A;  1EMF A;  1XQM A;  2WIQ A;  3SVO A;  4EMQ A;  3CGL A;  4W6T A;  3DQA A;  1Q4A A;  2V4E C;  3DQ4 A;  4DKN A;  4B30 A;  2A47 A;  2G6X A;  3PJ5 A;  4KW8 A;  1EME A;  3BXB A;  1KYS A;  2YDZ A;  2A50 B;  4GF6 B;  4JEO A;  3DQU A;  4W7C A;  2ICR A;  1UIS A;  3SG6 A;  4IK5 A;  3SSK A;  4PPK A;  3SG5 A;  4DXI A;  1EMM A;  2DUI A;  1Q4C A;  2DDD A;  2O2B A;  3GJ1 A;  4J88 A;  4P76 A;  2EMD A;  2QRF A;  3CFH A;  2PXW A;  2OKY A;  4W69 A;  3ST2 A;  4DXP A;  2G3D B;  3DQK A;  4XOV A;  4L12 A;  5DTX A;  2WUR A;  3SRY A;  1Q4E A;  3LS3 A;  4DXQ A;  4N3D A;  4OJ0 A;  4IK8 A;  2HJO A;  5H89 A;  4B30 B;  4IK4 A;  3CD1 A;  3U8C A;  3ST3 A;  2DD9 A;  2OTE A;  2G2S B;  3CB9 A;  3U0K A;  2DD7 A;  4HQC A;  1ZGP A;  3SST A;  2DUG A;  2OTB A;  3DQ5 A;  4LJB A;  3GEX A;  4JF9 A;  3SG2 A;  4W76 A;  3G9A A;  2H5Q A;  3EVV A;  4JFG A;  4W7A A;  4R6D A;  3U0L A;  4W7D A;  3RWT A;  4XOW A;  1QXT A;  3NEZ A;  1RMP A;  2VVJ A;  4ZFS A;  3DQ3 A;  1QYQ A;  2O24 A;  5KTG A;  4GES B;  1RM9 A;  1MOV A;  2O29 A;  3NT9 A;  2PXS A;  2H5O A;  4EN1 A;  3DQ6 A;  3AI5 A;  2VAE A;  2AWJ A;  3DQO A;  3IR8 A;  1ZGQ A;  4XGY A;  3LSA A;  4LQT A;  4ZIN A;  3PIB A;  4W6B A;  4H48 A;  3SVS A;  1BFP A;  1YHI A;  2RH7 A;  3E5V A;  3LF3 A;  4W77 A;  5DU0 A;  1QYF A;  3SVR A;  3BXA A;  4JC2 A;  5EXB A;  3S05 A;  2HGD A;  2EMN A;  4IK3 A;  2WSO A;  2A53 B;  4W6I A;  4W6D A;  4ZF4 A;  2DUE A;  5BT0 A;  2AWM A;  2ZMW A;  5FVI A;  5F9G A;  4XL5 A;  1YZW A;  3KCT A;  4W6J A;  3DQ2 A;  5DRG A;  2ZMU A;  1QY3 A;  3OSR A;  5DY6 A;  2IB6 A;  4Q7U A;  4NWS A;  2JAD A;  4PFE A;  4H3N A;  4W6C A;  3P28 A;  2WHS A;  5EXU A;  1S6Z A;  2HPW A;  2HRS A;  3SVU A;  2IB5 A;  5BTT B;  2B3P A;  4W6O A;  3UFZ A;  5DTY A;  2WIS A;  4LQU A;  3ADF A;  4RYS A;  2QLG A;  4W6U A;  2AWK A;  1GL4 A;  2A52 B;  5HZT A;  4W7X A;  3NED A;  5H88 A;  2Y0G A;  4AS8 A;  5HBD A;  2GW4 B;  2A46 A;  1KYR A;  1OXF A;  1H4U A;  2YFP A;  3ED8 A;  4KF5 A;  4OQW A;  1MYW A;  2OKW A;  4U2V A;  4LJD A;  3U0N A;  1EML A;  4H47 A;  2C9I A;  1Q4B A;  3ZUL A;  3EVR A;  3ST4 A;  5FVG A;  5HW9 A;  3DQ8 A;  3SS0 A;  4R6B A;  4W74 A;  4W6M A;  3DQF A;  2QLG B;  5DPJ A;  1KP5 A;  3CBE A;  1W7S A;  1GFL A;  2Q57 A;  4JRB A;  1XAE A;  4KF5 C;  5EB6 A;  3GL4 A;  3GB3 A;  5HGE A;  3EK4 A;  1F09 A;  1GGX A;  3LVA A;  3EKH A;  4HVF A;  3DPZ A;  4IK1 A;  1Q4D A;  2Z6X A;  3U8A A;  5FVF A;  3O77 A;  3EKJ A;  4H3L A;  1XMZ A;  4IZN A;  2DDC A;  3VHT A;  3DQH A;  3DQE A;  3W1C A;  4W6G A;  2VAD A;  3DQL A;  4W6K A;  1W7T A;  3EVP A;  4EUL A;  1RMM A;  2Z6Z A;  4LJC A;  1XA9 A;  5EHU A;  3SVE A;  1Z1Q A;  1YFP A;  4OY4 A;  4B5Y A;  3NT3 A;  3SVD A;  5EJU A;  5EB7 A;  2B3Q A;  5BTT A;  4JGE A;  4P1Q A;  2GX2 A;  2VZX A;  3SSL A;  3GJ2 A;  1EMG A;  4W6L A;  2G3O A;  2G6E A;  4W6N A;  1QYO A;  3DQ9 A;  4KAG A;  5J2O A;  1HUY A;  5EBJ A;  2G5Z B;  2AH8 A;  2AWL A;  4I2Y A;  4W6A A;  3RWA A;  4EDO A;  3CFF A;  4IK9 A;  3TMT A;  2P4M A;  3DPX A;  2G6Y A;  3VHT B;  3H1O A;  4ZF5 A;  5HZO A;  5LTP A;  2H9W A;  5EXC I;  2POX A;  4HQ9 A;  3A8S A;  4W73 A;  3PJ7 A;  1XSS A;  3DQM A;  3PJB A;  4KPI A;  2HGY A;  5LK4 A;  2IE2 A;  3DQD A;  5DPI A;  4W72 A;  4Q7R A;  4LW5 A;  4DXO A;  1RMO A;  2OJK A;  4HE4 A;  2G16 B;  2V4E A;  4ZB1 A;  1YJF A;  3KCS A;  2QZ0 A;  4ZF3 A;  1W7U A;  1H6R A;  4KGE A;  4W75 A;  4TZA A;  3AI4 A;  2C9J A;  2BTJ A;  3LA1 A;  3ZTF A;  3E5T A;  1YJ2 A;  3DPW A;  4EDS A;  2HCG A;  1C4F A;  2YE1 A;  3AKO A;  4KA9 A;  4KEX A;  2IOV A;  2Z1O A;  4Q7T A;  2VVI A;  3M24 A;  1RRX A;  1JC1 A;  5DQB A;  1EMB A;  2QT2 A;  3SG3 A;  1KYP A;  1EMK A;  5AQB B;  4ORN A;  2A48 A;  3EK7 A;  1EMA A; 
#chains in the Genus database with same CATH topology
 4W6S A;  3BXC A;  4UTS A;  3ZUF A;  4KW4 A;  2QLH A;  2A54 B;  5DPH A;  4KGF A;  1OXE A;  4L13 A;  4W6F A;  1JBY A;  2V4E B;  4L1I A;  4ZIO A;  2DUH A;  2FZU A;  4W6R A;  2WSN A;  4TZG A;  3VIC A;  4Z4K A;  1G7K A;  4W7F A;  2WHT A;  3DQ1 A;  3EVU A;  4HQ8 A;  2DUF A;  3ZUJ A;  3U0M A;  5HZU A;  4XVP A;  5T3I A;  4W6P A;  2ARL A;  4LJD C;  2ZO6 A;  1YHH A;  2H5R A;  4J89 A;  1Q73 A;  1B9C A;  3CD9 A;  3EK8 A;  4PPL A;  4RYW A;  4W6H A;  3SVN A;  3TMR A;  1ZUX A;  1F0B A;  5DRF A;  3VK1 A;  3NF0 A;  2WHU A;  3K1K A;  3V3D A;  3LVC A;  1MOU A;  5LTQ A;  3DQ7 A;  3BX9 A;  2FWQ A;  3DQI A;  4W7E A;  5HZS A;  2YE0 A;  2Q6P A;  2H5P A;  2QLE A;  4W7R A;  3SSY A;  2GW3 A;  4ZBL A;  2Z6Y A;  3UG0 A;  1OXD A;  4OHS A;  3SG4 A;  3DQN A;  4Z4M A;  2FL1 A;  3DQC A;  4DXN A;  2HQK A;  3P8U A;  3U8P A;  4Q9W A;  5FHV A;  3WLD A;  3LF4 B;  3MGF A;  2VVH A;  5LTR A;  3WLC A;  3CFA A;  3OGO A;  1HCJ A;  3ST0 A;  4J8A A;  4OGS A;  5DTZ A;  1Z1P A;  4H3M A;  3SVC A;  4ANJ A;  3LVD A;  3SG7 A;  5BQL A;  5H87 A;  5DTL A;  2QLI A;  1JBZ A;  1EMC A;  3I19 A;  5DPG A;  1ZGO A;  1YHG A;  3WCK A;  2QU1 A;  3W1D A;  4Q9X A;  5DQM A;  4BDU A;  1CV7 A;  4RTC A;  3SSH A;  2AHA A;  2ZO7 A;  3H1R A;  3OSQ A;  3O78 A;  3SV5 A;  4PPJ A;  4AR7 A;  3DQJ A;  2HQZ A;  3E5W A;  4DXM A;  3M22 A;  4DKM A;  2H8Q A;  2GX0 A;  2A56 B;  2OGR A;  2HFC A;  1JC0 A;  4KF4 A;  3SVB A;  4KW9 A;  3SSV A;  2H6V A;  3IP2 A;  2EMO A;  3SSP A;  4GOB A;  1EMF A;  1XQM A;  2WIQ A;  3SVO A;  4EMQ A;  3CGL A;  4W6T A;  3DQA A;  1Q4A A;  2V4E C;  3DQ4 A;  4DKN A;  4B30 A;  2A47 A;  2G6X A;  3PJ5 A;  4KW8 A;  1EME A;  3BXB A;  1KYS A;  2YDZ A;  2A50 B;  4GF6 B;  4JEO A;  3DQU A;  4W7C A;  2ICR A;  1UIS A;  3SG6 A;  4IK5 A;  3SSK A;  4PPK A;  3SG5 A;  4DXI A;  1EMM A;  2DUI A;  1Q4C A;  2DDD A;  2O2B A;  3GJ1 A;  4J88 A;  4P76 A;  2EMD A;  2QRF A;  3CFH A;  2PXW A;  2OKY A;  4W69 A;  3ST2 A;  4DXP A;  2G3D B;  3DQK A;  4XOV A;  4L12 A;  5DTX A;  2WUR A;  3SRY A;  1Q4E A;  3LS3 A;  4DXQ A;  4N3D A;  4OJ0 A;  4IK8 A;  2HJO A;  5H89 A;  4B30 B;  4IK4 A;  3CD1 A;  3U8C A;  3ST3 A;  2DD9 A;  2OTE A;  2G2S B;  3CB9 A;  3U0K A;  2DD7 A;  4HQC A;  1ZGP A;  3SST A;  2DUG A;  2OTB A;  3DQ5 A;  4LJB A;  3GEX A;  4JF9 A;  3SG2 A;  4W76 A;  3G9A A;  2H5Q A;  3EVV A;  4JFG A;  4W7A A;  4R6D A;  3U0L A;  4W7D A;  3RWT A;  4XOW A;  1QXT A;  3NEZ A;  1RMP A;  2VVJ A;  4ZFS A;  3DQ3 A;  1QYQ A;  2O24 A;  5KTG A;  4GES B;  1RM9 A;  1MOV A;  2O29 A;  3NT9 A;  2PXS A;  2H5O A;  4EN1 A;  3DQ6 A;  3AI5 A;  2VAE A;  2AWJ A;  3DQO A;  3IR8 A;  1ZGQ A;  4XGY A;  3LSA A;  4LQT A;  4ZIN A;  3PIB A;  4W6B A;  4H48 A;  3SVS A;  1BFP A;  1YHI A;  2RH7 A;  3E5V A;  3LF3 A;  4W77 A;  5DU0 A;  1QYF A;  3SVR A;  3BXA A;  4JC2 A;  5EXB A;  3S05 A;  2HGD A;  2EMN A;  4IK3 A;  2WSO A;  2A53 B;  4W6I A;  4W6D A;  4ZF4 A;  2DUE A;  5BT0 A;  2AWM A;  2ZMW A;  5FVI A;  5F9G A;  4XL5 A;  1YZW A;  3KCT A;  4W6J A;  3DQ2 A;  5DRG A;  2ZMU A;  1QY3 A;  3OSR A;  5DY6 A;  2IB6 A;  4Q7U A;  4NWS A;  2JAD A;  4PFE A;  4H3N A;  4W6C A;  3P28 A;  2WHS A;  5EXU A;  1S6Z A;  2HPW A;  2HRS A;  3SVU A;  2IB5 A;  5BTT B;  2B3P A;  4W6O A;  3UFZ A;  5DTY A;  2WIS A;  4LQU A;  3ADF A;  4RYS A;  2QLG A;  4W6U A;  2AWK A;  1GL4 A;  2A52 B;  5HZT A;  4W7X A;  3NED A;  5H88 A;  2Y0G A;  4AS8 A;  5HBD A;  2GW4 B;  2A46 A;  1KYR A;  1OXF A;  1H4U A;  2YFP A;  3ED8 A;  4KF5 A;  4OQW A;  1MYW A;  2OKW A;  4U2V A;  4LJD A;  3U0N A;  1EML A;  4H47 A;  2C9I A;  1Q4B A;  3ZUL A;  3EVR A;  3ST4 A;  5FVG A;  5HW9 A;  3DQ8 A;  3SS0 A;  4R6B A;  4W74 A;  4W6M A;  3DQF A;  2QLG B;  5DPJ A;  1KP5 A;  3CBE A;  1W7S A;  1GFL A;  2Q57 A;  4JRB A;  1XAE A;  4KF5 C;  5EB6 A;  3GL4 A;  3GB3 A;  5HGE A;  3EK4 A;  1F09 A;  1GGX A;  3LVA A;  3EKH A;  4HVF A;  3DPZ A;  4IK1 A;  1Q4D A;  2Z6X A;  3U8A A;  5FVF A;  3O77 A;  3EKJ A;  4H3L A;  1XMZ A;  4IZN A;  2DDC A;  3VHT A;  3DQH A;  3DQE A;  3W1C A;  4W6G A;  2VAD A;  3DQL A;  4W6K A;  1W7T A;  3EVP A;  4EUL A;  1RMM A;  2Z6Z A;  4LJC A;  1XA9 A;  5EHU A;  3SVE A;  1Z1Q A;  1YFP A;  4OY4 A;  4B5Y A;  3NT3 A;  3SVD A;  5EJU A;  5EB7 A;  2B3Q A;  5BTT A;  4JGE A;  4P1Q A;  2GX2 A;  2VZX A;  3SSL A;  3GJ2 A;  1EMG A;  4W6L A;  2G3O A;  2G6E A;  4W6N A;  1QYO A;  3DQ9 A;  4KAG A;  5J2O A;  1HUY A;  5EBJ A;  2G5Z B;  2AH8 A;  2AWL A;  4I2Y A;  4W6A A;  3RWA A;  4EDO A;  3CFF A;  4IK9 A;  3TMT A;  2P4M A;  3DPX A;  2G6Y A;  3VHT B;  3H1O A;  4ZF5 A;  5HZO A;  5LTP A;  2H9W A;  5EXC I;  2POX A;  4HQ9 A;  3A8S A;  4W73 A;  3PJ7 A;  1XSS A;  3DQM A;  3PJB A;  4KPI A;  2HGY A;  5LK4 A;  2IE2 A;  3DQD A;  5DPI A;  4W72 A;  4Q7R A;  4LW5 A;  4DXO A;  1RMO A;  2OJK A;  4HE4 A;  2G16 B;  2V4E A;  4ZB1 A;  1YJF A;  3KCS A;  2QZ0 A;  4ZF3 A;  1W7U A;  1H6R A;  4KGE A;  4W75 A;  4TZA A;  3AI4 A;  2C9J A;  2BTJ A;  3LA1 A;  3ZTF A;  3E5T A;  1YJ2 A;  3DPW A;  4EDS A;  2HCG A;  1C4F A;  2YE1 A;  3AKO A;  4KA9 A;  4KEX A;  2IOV A;  2Z1O A;  4Q7T A;  2VVI A;  3M24 A;  1RRX A;  1JC1 A;  5DQB A;  1EMB A;  2QT2 A;  3SG3 A;  1KYP A;  1EMK A;  5AQB B;  4ORN A;  2A48 A;  3EK7 A;  1EMA A; 
#chains in the Genus database with same CATH homology
 4W6S A;  3BXC A;  4UTS A;  3ZUF A;  4KW4 A;  2QLH A;  2A54 B;  5DPH A;  4KGF A;  1OXE A;  4L13 A;  4W6F A;  1JBY A;  2V4E B;  4L1I A;  4ZIO A;  2DUH A;  2FZU A;  4W6R A;  2WSN A;  4TZG A;  3VIC A;  4Z4K A;  1G7K A;  4W7F A;  2WHT A;  3DQ1 A;  3EVU A;  4HQ8 A;  2DUF A;  3ZUJ A;  3U0M A;  5HZU A;  4XVP A;  5T3I A;  4W6P A;  2ARL A;  4LJD C;  2ZO6 A;  1YHH A;  2H5R A;  4J89 A;  1Q73 A;  1B9C A;  3CD9 A;  3EK8 A;  4PPL A;  4RYW A;  4W6H A;  3SVN A;  3TMR A;  1ZUX A;  1F0B A;  5DRF A;  3VK1 A;  3NF0 A;  2WHU A;  3K1K A;  3V3D A;  3LVC A;  1MOU A;  5LTQ A;  3DQ7 A;  3BX9 A;  2FWQ A;  3DQI A;  4W7E A;  5HZS A;  2YE0 A;  2Q6P A;  2H5P A;  2QLE A;  4W7R A;  3SSY A;  2GW3 A;  4ZBL A;  2Z6Y A;  3UG0 A;  1OXD A;  4OHS A;  3SG4 A;  3DQN A;  4Z4M A;  2FL1 A;  3DQC A;  4DXN A;  2HQK A;  3P8U A;  3U8P A;  4Q9W A;  5FHV A;  3WLD A;  3LF4 B;  3MGF A;  2VVH A;  5LTR A;  3WLC A;  3CFA A;  3OGO A;  1HCJ A;  3ST0 A;  4J8A A;  4OGS A;  5DTZ A;  1Z1P A;  4H3M A;  3SVC A;  4ANJ A;  3LVD A;  3SG7 A;  5BQL A;  5H87 A;  5DTL A;  2QLI A;  1JBZ A;  1EMC A;  3I19 A;  5DPG A;  1ZGO A;  1YHG A;  3WCK A;  2QU1 A;  3W1D A;  4Q9X A;  5DQM A;  4BDU A;  1CV7 A;  4RTC A;  3SSH A;  2AHA A;  2ZO7 A;  3H1R A;  3OSQ A;  3O78 A;  3SV5 A;  4PPJ A;  4AR7 A;  3DQJ A;  2HQZ A;  3E5W A;  4DXM A;  3M22 A;  4DKM A;  2H8Q A;  2GX0 A;  2A56 B;  2OGR A;  2HFC A;  1JC0 A;  4KF4 A;  3SVB A;  4KW9 A;  3SSV A;  2H6V A;  3IP2 A;  2EMO A;  3SSP A;  4GOB A;  1EMF A;  1XQM A;  2WIQ A;  3SVO A;  4EMQ A;  3CGL A;  4W6T A;  3DQA A;  1Q4A A;  2V4E C;  3DQ4 A;  4DKN A;  4B30 A;  2A47 A;  2G6X A;  3PJ5 A;  4KW8 A;  1EME A;  3BXB A;  1KYS A;  2YDZ A;  2A50 B;  4GF6 B;  4JEO A;  3DQU A;  4W7C A;  2ICR A;  1UIS A;  3SG6 A;  4IK5 A;  3SSK A;  4PPK A;  3SG5 A;  4DXI A;  1EMM A;  2DUI A;  1Q4C A;  2DDD A;  2O2B A;  3GJ1 A;  4J88 A;  4P76 A;  2EMD A;  2QRF A;  3CFH A;  2PXW A;  2OKY A;  4W69 A;  3ST2 A;  4DXP A;  2G3D B;  3DQK A;  4XOV A;  4L12 A;  5DTX A;  2WUR A;  3SRY A;  1Q4E A;  3LS3 A;  4DXQ A;  4N3D A;  4OJ0 A;  4IK8 A;  2HJO A;  5H89 A;  4B30 B;  4IK4 A;  3CD1 A;  3U8C A;  3ST3 A;  2DD9 A;  2OTE A;  2G2S B;  3CB9 A;  3U0K A;  2DD7 A;  4HQC A;  1ZGP A;  3SST A;  2DUG A;  2OTB A;  3DQ5 A;  4LJB A;  3GEX A;  4JF9 A;  3SG2 A;  4W76 A;  3G9A A;  2H5Q A;  3EVV A;  4JFG A;  4W7A A;  4R6D A;  3U0L A;  4W7D A;  3RWT A;  4XOW A;  1QXT A;  3NEZ A;  1RMP A;  2VVJ A;  4ZFS A;  3DQ3 A;  1QYQ A;  2O24 A;  5KTG A;  4GES B;  1RM9 A;  1MOV A;  2O29 A;  3NT9 A;  2PXS A;  2H5O A;  4EN1 A;  3DQ6 A;  3AI5 A;  2VAE A;  2AWJ A;  3DQO A;  3IR8 A;  1ZGQ A;  4XGY A;  3LSA A;  4LQT A;  4ZIN A;  3PIB A;  4W6B A;  4H48 A;  3SVS A;  1BFP A;  1YHI A;  2RH7 A;  3E5V A;  3LF3 A;  4W77 A;  5DU0 A;  1QYF A;  3SVR A;  3BXA A;  4JC2 A;  5EXB A;  3S05 A;  2HGD A;  2EMN A;  4IK3 A;  2WSO A;  2A53 B;  4W6I A;  4W6D A;  4ZF4 A;  2DUE A;  5BT0 A;  2AWM A;  2ZMW A;  5FVI A;  5F9G A;  4XL5 A;  1YZW A;  3KCT A;  4W6J A;  3DQ2 A;  5DRG A;  2ZMU A;  1QY3 A;  3OSR A;  5DY6 A;  2IB6 A;  4Q7U A;  4NWS A;  2JAD A;  4PFE A;  4H3N A;  4W6C A;  3P28 A;  2WHS A;  5EXU A;  1S6Z A;  2HPW A;  2HRS A;  3SVU A;  2IB5 A;  5BTT B;  2B3P A;  4W6O A;  3UFZ A;  5DTY A;  2WIS A;  4LQU A;  3ADF A;  4RYS A;  2QLG A;  4W6U A;  2AWK A;  1GL4 A;  2A52 B;  5HZT A;  4W7X A;  3NED A;  5H88 A;  2Y0G A;  4AS8 A;  5HBD A;  2GW4 B;  2A46 A;  1KYR A;  1OXF A;  1H4U A;  2YFP A;  3ED8 A;  4KF5 A;  4OQW A;  1MYW A;  2OKW A;  4U2V A;  4LJD A;  3U0N A;  1EML A;  4H47 A;  2C9I A;  1Q4B A;  3ZUL A;  3EVR A;  3ST4 A;  5FVG A;  5HW9 A;  3DQ8 A;  3SS0 A;  4R6B A;  4W74 A;  4W6M A;  3DQF A;  2QLG B;  5DPJ A;  1KP5 A;  3CBE A;  1W7S A;  1GFL A;  2Q57 A;  4JRB A;  1XAE A;  4KF5 C;  5EB6 A;  3GL4 A;  3GB3 A;  5HGE A;  3EK4 A;  1F09 A;  1GGX A;  3LVA A;  3EKH A;  4HVF A;  3DPZ A;  4IK1 A;  1Q4D A;  2Z6X A;  3U8A A;  5FVF A;  3O77 A;  3EKJ A;  4H3L A;  1XMZ A;  4IZN A;  2DDC A;  3VHT A;  3DQH A;  3DQE A;  3W1C A;  4W6G A;  2VAD A;  3DQL A;  4W6K A;  1W7T A;  3EVP A;  4EUL A;  1RMM A;  2Z6Z A;  4LJC A;  1XA9 A;  5EHU A;  3SVE A;  1Z1Q A;  1YFP A;  4OY4 A;  4B5Y A;  3NT3 A;  3SVD A;  5EJU A;  5EB7 A;  2B3Q A;  5BTT A;  4JGE A;  4P1Q A;  2GX2 A;  2VZX A;  3SSL A;  3GJ2 A;  1EMG A;  4W6L A;  2G3O A;  2G6E A;  4W6N A;  1QYO A;  3DQ9 A;  4KAG A;  5J2O A;  1HUY A;  5EBJ A;  2G5Z B;  2AH8 A;  2AWL A;  4I2Y A;  4W6A A;  3RWA A;  4EDO A;  3CFF A;  4IK9 A;  3TMT A;  2P4M A;  3DPX A;  2G6Y A;  3VHT B;  3H1O A;  4ZF5 A;  5HZO A;  5LTP A;  2H9W A;  5EXC I;  2POX A;  4HQ9 A;  3A8S A;  4W73 A;  3PJ7 A;  1XSS A;  3DQM A;  3PJB A;  4KPI A;  2HGY A;  5LK4 A;  2IE2 A;  3DQD A;  5DPI A;  4W72 A;  4Q7R A;  4LW5 A;  4DXO A;  1RMO A;  2OJK A;  4HE4 A;  2G16 B;  2V4E A;  4ZB1 A;  1YJF A;  3KCS A;  2QZ0 A;  4ZF3 A;  1W7U A;  1H6R A;  4KGE A;  4W75 A;  4TZA A;  3AI4 A;  2C9J A;  2BTJ A;  3LA1 A;  3ZTF A;  3E5T A;  1YJ2 A;  3DPW A;  4EDS A;  2HCG A;  1C4F A;  2YE1 A;  3AKO A;  4KA9 A;  4KEX A;  2IOV A;  2Z1O A;  4Q7T A;  2VVI A;  3M24 A;  1RRX A;  1JC1 A;  5DQB A;  1EMB A;  2QT2 A;  3SG3 A;  1KYP A;  1EMK A;  5AQB B;  4ORN A;  2A48 A;  3EK7 A;  1EMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...