3ST8A

Crystal structure of glmu from mycobacterium tuberculosis in complex with coenzyme a, glucosamine 1-phosphate and uridine-diphosphate-n-acetylglucosamine
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
475
structure length
475
Chain Sequence
DTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDGTSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional protein glmU
publication title Structure of Mycobacterium tuberculosis GlmU in complex with Acetyl CoA
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 179
structure length 475
sequence length 475
ec nomenclature ec 2.3.1.157: Glucosamine-1-phosphate N-acetyltransferase.
pdb deposition date 2011-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3st8A02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3st8A01
2FKOA 4Y7TA 3IOJA 1K4VA 4CVHA 5ADXV 4Y64A 1XZ6A 3I0FA 3D5NA 2W0VA 4M2BA 2FYAA 4Y63A 4MZUA 4D11C 5C48A 2Z87A 1FGGA 4ASJA 1IINA 4J09A 5C4CA 4P00A 4AYLA 3I0KA 2JF2A 1YROB 3BSWA 1G8OA 1G97A 3OC9A 1MC3A 1JV3A 4HO0A 3MC4A 3KWEA 4FRBA 5EJ1A 4HCQA 2YC3A 2QIVX 1VPAA 2GGQA 2FYBA 3RSBA 3QVBA 4Y6UA 4ECMA 1ZI3A 5FYEA 3R2WA 2VS4A 2D7IA 1QRFA 2PA4A 3V8YA 1MR9A 2V0LA 1VGTA 2ZU7A 1V83A 4EE5A 1KGQA 4BQHA 1R7VA 5CMHA 3VNPA 1H5SA 2OEFA 1JYLA 1R81A 4FRMA 1MP5A 4HURA 2VD4A 1WT1A 3U2VA 2QH5A 1V67A 3CKOA 3SX3A 1LL2A 1QRLA 2P6WA 2WVMA 3D8VA 2XMEA 3FS8A 3R5CA 3TISA 5C36A 1GWWA 2AECA 1R7XA 4Y6NA 1HJJA 3ZLLA 1TVYA 2RJ9A 4E6TA 5L6VA 3R0SA 1ZJOA 2TDTA 4E6UA 4R37A 1FR9A 1QRMA 4M9CA 1G0RA 2O1GA 2VS5A 1MP3A 1T3DA 3TDTA 1NHEB 1V84A 1H7FA 3I3XA 3V4EA 5HS2A 3VBPA 3ECTA 1VH1A 1O7OA 5FU0A 1G3LA 3BXYA 2RJ6A 4CJBA 2WVKA 1VGWA 1ZI5A 3EEVA 1Z90A 1NWGB 3BCVA 4FQWA 2A8UA 1QWJA 1FWYA 3FWWA 4L41C 3VBMA 1S4PA 3SX5A 5C1GA 5CMGX 1TW1A 3P1BA 4HO8A 1YP3A 2WAWA 2E3DA 3V0OA 4AC3A 1H4DA 1KRRA 5E3QA 1TDTA 1WT0A 3E25A 2VFZA 4HO6A 1H5SC 1LVWA 4FRPA 1ZIZA 3HJJA 2IU8A 1KK4A 1FG5N 1W57A 2P73A 3I0GA 3V0LA 2V0JA 4B4BA 1TW5A 1VZUA 2X60A 3V0MA 1VZTA 2WLFA 2O1FA 2Y4KA 3U2XA 1H7GA 1S4OA 3BRKX 3DHOA 1W77A 4JD0A 4Y7FA 3USRA 3GVDA 5L6SA 1ZI4A 1GX4A 1I52A 5C4EA 4B2WA 4FCUA 1LL3A 1ZJPA 4IHHA 5CQOA 2WGZA 1SS9A 3T57A 3EG4A 1ZCUA 1G95A 3K8EA 4AYJA 1MRLA 3V90A 3SX8A 1HM0A 1LL0A 3OH4A 1LZ7A 2WLCA 5E3PA 1TZFA 3P47A 4M28A 1LZIA 3SXGA 3GUEA 1H5SD 4AAWA 3OTMA 2X5ZA 3JQYA 2YQCA 2BO6A 4KQLA 2XMHA 3I0DA 5AJPA 4HZCA 1YP2A 1S80A 2FFVA 3ZLKA 3PNNA 2RIZA 5AFUV 2P72A 4R7PA 4EE4A 4MNDA 1ZDGA 2JCLA 2D7RA 4FRLA 3VBKA 2Y6PA 2APCA 3BSSA 1INJA 3FSYA 5BXCA 4K6RA 2FYDB 4FRDA 3FOQA 1OQMB 1NQIB 3OH3A 1H7QA 3CGXA 4FRQA 1KHRA 2OEGA 3VBJA 2V0IA 4DE7A 3Q1XA 2Y4LA 2OI5A 2YCMA 1H7TA 1IIMA 3I0CA 4NALA 5EJZA 5CMJA 4HG6A 3HL3A 2OI7A 3SXCA 5AFUU 1ZCVA 1G93A 2AE7A 2Z86A 3TK8A 3E26A 4M98A 4HUSA 4HOCA 1PZYB 3IOHA 2QIAA 2O1HA 1KK6A 2AQ9A 4E1KA 2XATA 2YESA 5C8RA 1R82A 3VBNA 1XHBA 1R7UA 1PZTA 3CKJA 2ICXA 4D48A 2FFUA 4B4MA 3I0IX 3FSXA 1H5RA 1ZJ0A 4Y7VA 1WVCA 5FTVA 4EQYA 5AJNA 2I5KA 2RJ7A 3PMOA 4D0ZA 2YQJA 3NZ2A 1O7QA 1FR8A 4UEGA 3C8VA 1QG8A 3KWDA 1G9RA 1HM8A 3VBIA 1ZDFA 3DJ4A 3KWCA 1NMMB 2RIJA 3PKQA 3CKNA 2FY7A 4EEOA 3R5BA 1H5RB 3U0YA 2YQSA 1LZ0A 3I0JA 1E5KA 3IXCA 1GWVA 1WT2A 4P02A 3IOIA 4J18A 2QGIA 4G3PA 4KXOA 4LW3A 4M4KA 2JCJA 1FRWA 4ZDQA 2AGDA 1FXOA 2RITA 2UX8A 4N6AA 5AJOA 3ZGFA 4G87A 5IDSA 1V82A 2X5SA 1ON8A 4G3SA 1OCXA 2I5EA 1FZWA 5C3DA 5DG3A 2A8WA 1JVDA 5C1LA 4EABA 4Y7GA 3HSQA 1FO9A 1H5TA 3I0EA 1HV9A 1JVGA 3I0HA 3SXAA 3NGWA 2RIYA 2WLEA 5C4FA 2AH9A 3POLA 1O0RA 1VZXA 1H4EA 5C49A 3ZGGA 2VHEA 1QREA 2Y4MA 4IRQA 3R1WA 1KWSA 3T7MA 3TV0A 2VS3A 3ZF8A 4IHFA 4B2XA 5F42A 4D0TA 1QQ0A 1H3MA 2IU9A 2WLDA 4CJCA 2P2OA 1H5TB 4XWIA 5CQLX 1QGSA 5DEMA 2VSHA 1XHDA 3Q4SA 3OW5A 5I1FA 1H4CA 1EYRA 4FCEA 5CQPA 2AESA 1QGQA 3ST8A 2PGVA 3USQA 4M99A 1G2VA 1SSQA 4AA7A 3V91A 4EE3A 5JQQA 1QRGA 2BO7A 1LXAA 5C3BA 4HO3A 3F1YA 1HM9A 1FOAA 3JUJA 3K8DA 3GOSA 3TWDA 3FSBA 3R3RA 1THJA 1S4NA 2DPWA 2V0KA 3DK5A 4GBPA 5FUHA 1SSTA 1WT3A 3TIOA 2ZU8A 4E75A 1FO8A 5IFYA 4HO4A 1VGUA 4BMAA 3PKPA 3CJ8A 1R7TA 2E8BA 4M2AA 1GA8A 1HJLA 2WLGA 1KQAA 2RJ1A 4ASYA 2V0HA 2RJ5A 3BFPA 3OH0A 2Y4JA 5C4BA 4E79A 1ZJ3A 4NAIA 3F1CA 3TQDA 2Y7AA 4ARWA 2XWLA 2W0WA 3EH0A 4Y62A 4DDZA 3VBLA 3JTJA 1H7HA 2BO8A 2YQHA 3R3IA 3T7NA 1GQ9A 4MFGA 5FV9A 3SPTA 3Q7UA 1G23A 2JCKA 3F1XA 2MZBA 5C38A 4KC2A 4HO5A 4HO9A 5C1HA 3SRTA 2AM5A 4EGGA 2X65A 2AM4A 1OMXA 5ADXU 2GGOA 2WEEA 1KK5A 1JV1A 3CKQA 4KC4A 1EZIA 3EE5A 4DCLA 3SX7A 4ISXA 3BSYA 3OKRA 3SXDA 1KRUA 4Y7UA 1NKHB 4C2SA 3V0QA 5IDTA 1OMZA 3MQGA 1XATA 2XWMA 3DUVA 4B5BA 3TZTA 3LW6A 5CMFX 1KRVA 1W55A 1ZJ2A 1MR7A 5CQMX 5CMIA 4N6BA 5J49A 2QKXA 3O3PA 1WSZA 4N69A 2WE9A 3OH2A 4FREA 3MQHA 2BO4A 2I7BA 5FU8A 1H7EA 2CU2A 2RJ8A 4Y9XA 4CJ8A 3D98A 3OH1A 1H5SB 4MYBA 5C3AA 5E3RA 5DEPA 1ZCYA 4B42A 1G1LA 1H7LA 3RMVA 3V8ZA 3R8YA 1V3WA 1NF5B 1MP4A 5U2KA 1JYKA 2RJ4A 4FROA 4EVWA 4LW6A 2IUAA 2JF3A 2OI6A 2PX7A 3KIAA 3OAMA 3IGJA 2XWNA 5FTSA 1R7YA 1FXJA 4H7OA 1O23B 5CQNX 2ZU9A 4KPZA 1GX0A 1ON6A 3U2UA 2RJ0A 1FGXA 4HZDA 3I3AA 4YS8A 3U2WA 3OUPA 4G3QA 3U0XA 4MYOA 4D11A 2NXVA 4EEAA 1VM8A 2RIXA 3JUKA 3R5DA 1GQCA 5C4DA 3CU0A 2VXLA 4KC1A 1VGZA 2YC5A 1J2ZA 1VICA 5C47A 2JCOA 2Q4JA 4DECA 4KPXA 1VH3A 1ZJ1A 4EA7A 4EA8A 2IC7A 4EA9A 3V0PA 3U2TA 3OU9A 4EEGA 4N27A 1R80A 1KGTA 4IRPA 1ZCTA 2VXMA 1INIA 5DDVA 4B4GA 4B3UA 3RMWA 2AM3A 3OGZA 4KNRA 4NAKA 4EEMA 1LZJA 4FRHA 3T7OA 4JISA 2PGYA 4KNXA 4R36A 4EAAA 3FTTA 4KT7A 4FRAA 1ZHJA 3OTZA 4KRVA 4HO2A 3CKVA 5EIYA 2VSIA 3SXEA 3FSCA 1ZI1A 3N9WA 3V0NA 1SSMA 2NPOA 3Q80A 2D0JA 4NANA 4IHGA 2WVLA 3I0LA 1YP4A 2ICYA 3R5AA 5DDTA 2FYCB 3SXBA
chains in the Genus database with same CATH superfamily
2FKOA 4Y7TA 3IOJA 1K4VA 4CVHA 5ADXV 4Y64A 1XZ6A 3I0FA 3D5NA 2W0VA 4M2BA 2FYAA 4Y63A 4MZUA 4D11C 5C48A 2Z87A 1FGGA 4ASJA 1IINA 4J09A 5C4CA 4P00A 4AYLA 3I0KA 2JF2A 1YROB 3BSWA 1G8OA 1G97A 3OC9A 1MC3A 1JV3A 4HO0A 3MC4A 3KWEA 4FRBA 5EJ1A 4HCQA 2YC3A 2QIVX 1VPAA 2GGQA 2FYBA 3RSBA 3QVBA 4Y6UA 4ECMA 1ZI3A 5FYEA 3R2WA 2VS4A 2D7IA 1QRFA 2PA4A 3V8YA 1MR9A 2V0LA 1VGTA 2ZU7A 1V83A 4EE5A 1KGQA 4BQHA 1R7VA 5CMHA 3VNPA 1H5SA 2OEFA 1JYLA 1R81A 4FRMA 1MP5A 4HURA 2VD4A 1WT1A 3U2VA 2QH5A 1V67A 5D92A 3CKOA 3SX3A 1LL2A 1QRLA 2P6WA 4O6MA 1M8NA 2WVMA 3D8VA 2XMEA 3FS8A 3R5CA 3TISA 5C36A 1GWWA 2AECA 1R7XA 4Y6NA 1HJJA 3ZLLA 1TVYA 2RJ9A 4E6TA 5L6VA 3R0SA 1ZJOA 1EWWA 2TDTA 4E6UA 4R37A 1FR9A 1QRMA 4M9CA 1G0RA 2O1GA 2VS5A 1MP3A 1T3DA 3TDTA 1NHEB 1V84A 1H7FA 3I3XA 3V4EA 5HS2A 3VBPA 3ECTA 1VH1A 1O7OA 5FU0A 1G3LA 3BXYA 2RJ6A 4CJBA 2WVKA 1VGWA 1ZI5A 3EEVA 1Z90A 1NWGB 3BCVA 4FQWA 2A8UA 1QWJA 1FWYA 3FWWA 4L41C 3VBMA 1S4PA 3SX5A 5C1GA 5CMGX 1TW1A 3P1BA 4HO8A 1YP3A 2WAWA 2E3DA 3V0OA 4AC3A 1H4DA 1KRRA 5E3QA 1TDTA 3GQ9A 1WT0A 3E25A 2VFZA 4HO6A 1H5SC 1LVWA 4FRPA 1ZIZA 3HJJA 3GQAA 2IU8A 1KK4A 1FG5N 1W57A 2P73A 3I0GA 3V0LA 2V0JA 4B4BA 1TW5A 1VZUA 2X60A 3V0MA 1VZTA 2WLFA 2O1FA 2Y4KA 3GQ8A 1H7GA 3U2XA 1S4OA 3BRKX 3DHOA 1W77A 4JD0A 4Y7FA 3USRA 3GVDA 5L6SA 1ZI4A 1GX4A 1I52A 5C4EA 4B2WA 4FCUA 1LL3A 1ZJPA 4IHHA 5CQOA 2WGZA 1SS9A 3T57A 3EG4A 1ZCUA 1G95A 3K8EA 4AYJA 1MRLA 1L0SA 3V90A 3SX8A 1HM0A 1LL0A 3OH4A 1LZ7A 2WLCA 5E3PA 1TZFA 3P47A 4M28A 1LZIA 3SXGA 3GUEA 1H5SD 4AAWA 4FIYA 3OTMA 2X5ZA 3JQYA 2YQCA 2BO6A 4KQLA 2XMHA 3I0DA 5AJPA 4HZCA 1YP2A 1S80A 2FFVA 3ZLKA 3PNNA 2RIZA 5AFUV 2P72A 4R7PA 4EE4A 4MNDA 1ZDGA 2JCLA 2D7RA 4FRLA 3VBKA 2Y6PA 2APCA 4MIXA 3BSSA 1INJA 3FSYA 5BXCA 4K6RA 2FYDB 2C0NA 2J0AA 4FRDA 3FOQA 1OQMB 3OH3A 1NQIB 1H7QA 3CGXA 4FRQA 1KHRA 2OEGA 3VBJA 2V0IA 4DE7A 3Q1XA 2Y4LA 2OI5A 2YCMA 1H7TA 1IIMA 3I0CA 4NALA 5EJZA 5CMJA 4HG6A 3HL3A 2OI7A 3SXCA 5AFUU 1ZCVA 1G93A 2AE7A 2Z86A 3TK8A 3E26A 4M98A 4HUSA 4HOCA 1PZYB 3IOHA 2QIAA 2O1HA 1KK6A 2AQ9A 4E1KA 2XATA 2YESA 5C8RA 1R82A 3VBNA 1XHBA 1R7UA 1PZTA 3CKJA 2ICXA 4D48A 2FFUA 4B4MA 3I0IX 3FSXA 1H5RA 1ZJ0A 4Y7VA 1WVCA 5FTVA 4EQYA 5AJNA 2I5KA 2RJ7A 3PMOA 4D0ZA 2YQJA 3NZ2A 1O7QA 1FR8A 4UEGA 3C8VA 1QG8A 3KWDA 1G9RA 1HM8A 3VBIA 1Z2FA 1ZDFA 3DJ4A 3KWCA 1NMMB 2RIJA 3PKQA 3CKNA 2FY7A 4EEOA 3R5BA 1H5RB 3U0YA 2J0BA 1LZ0A 2YQSA 1E5KA 3I0JA 3IXCA 1GWVA 1WT2A 4P02A 3IOIA 4J18A 2QGIA 4G3PA 4KXOA 4LW3A 4M4KA 2JCJA 1FRWA 4ZDQA 2AGDA 1FXOA 2RITA 2UX8A 4N6AA 5AJOA 3ZGFA 4G87A 5IDSA 1V82A 2X5SA 1ON8A 4G3SA 1OCXA 2I5EA 1FZWA 5C3DA 5DG3A 2A8WA 1JVDA 5C1LA 4EABA 4Y7GA 3HSQA 1FO9A 1H5TA 3I0EA 1HV9A 1JVGA 3I0HA 3SXAA 3NGWA 2RIYA 2WLEA 5C4FA 2AH9A 3POLA 1O0RA 1VZXA 1H4EA 5C49A 3ZGGA 2VHEA 1QREA 2Y4MA 4IRQA 3R1WA 1KWSA 3T7MA 3TV0A 2VS3A 3ZF8A 4IHFA 4B2XA 5F42A 4D0TA 1QQ0A 4O6NA 1H3MA 2IU9A 2WLDA 4CJCA 2P2OA 1H5TB 4XWIA 5CQLX 1QGSA 5DEMA 2VSHA 1XHDA 3Q4SA 3OW5A 5I1FA 1H4CA 1EYRA 4FCEA 5CQPA 2AESA 1QGQA 3ST8A 2PGVA 3USQA 4M99A 1G2VA 1SSQA 4AA7A 4Q7CA 3V91A 4EE3A 5JQQA 1QRGA 5D91A 2BO7A 1LXAA 5C3BA 4HO3A 3F1YA 1HM9A 1FOAA 3JUJA 3K8DA 3GOSA 3TWDA 3FSBA 3R3RA 1THJA 1S4NA 2DPWA 2V0KA 3DK5A 4GBPA 5FUHA 1SSTA 1WT3A 3TIOA 2ZU8A 4E75A 1FO8A 5IFYA 4HO4A 1VGUA 4BMAA 3PKPA 3CJ8A 1R7TA 2E8BA 4M2AA 1GA8A 1HJLA 2WLGA 1KQAA 2RJ1A 4ASYA 2V0HA 3OH0A 3BFPA 2RJ5A 2Y4JA 5C4BA 4E79A 1ZJ3A 4NAIA 3F1CA 3TQDA 2Y7AA 4ARWA 2XWLA 2W0WA 3EH0A 4Y62A 4DDZA 3VBLA 3JTJA 1H7HA 2BO8A 2YQHA 3R3IA 3T7NA 1GQ9A 4MFGA 5FV9A 3SPTA 3Q7UA 1G23A 2JCKA 3F1XA 2MZBA 5C38A 4KC2A 4HO5A 4HO9A 5C1HA 3GQ7A 3SRTA 2AM5A 4EGGA 2X65A 2AM4A 1OMXA 5ADXU 2GGOA 2WEEA 1KK5A 1JV1A 3CKQA 4KC4A 1EZIA 3EE5A 4DCLA 3SX7A 4ISXA 3BSYA 3OKRA 3SXDA 1KRUA 4Y7UA 1NKHB 4C2SA 3V0QA 5IDTA 1OMZA 3MQGA 1XATA 2XWMA 3DUVA 4B5BA 3TZTA 3LW6A 5CMFX 3SUCA 1KRVA 1W55A 1ZJ2A 1MR7A 5CQMX 5CMIA 4N6BA 5J49A 2QKXA 3O3PA 1WSZA 4N69A 2WE9A 3OH2A 4FREA 3MQHA 2BO4A 2I7BA 1N4IA 5FU8A 1H7EA 2CU2A 2RJ8A 4Y9XA 4CJ8A 3D98A 3OH1A 1H5SB 4MYBA 5C3AA 5E3RA 5DEPA 4FIXA 1ZCYA 4B42A 1G1LA 1H7LA 3RMVA 3V8ZA 3R8YA 1V3WA 1NF5B 1MP4A 5U2KA 1JYKA 2RJ4A 4FROA 4EVWA 4LW6A 2IUAA 2JF3A 2OI6A 2PX7A 3KIAA 3OAMA 3IGJA 2XWNA 5FTSA 1R7YA 1FXJA 4H7OA 1O23B 5CQNX 2ZU9A 4KPZA 1GX0A 1ON6A 3U2UA 2RJ0A 1FGXA 4HZDA 3I3AA 4YS8A 3U2WA 3OUPA 4G3QA 3U0XA 4MYOA 4D11A 2NXVA 4EEAA 1VM8A 2RIXA 3JUKA 3R5DA 1GQCA 5C4DA 3CU0A 2VXLA 4KC1A 1VGZA 2YC5A 1J2ZA 1VICA 5C47A 2JCOA 2Q4JA 4DECA 2VK9A 4KPXA 1VH3A 1ZJ1A 4EA7A 4EA8A 2IC7A 4EA9A 3V0PA 3U2TA 3OU9A 4EEGA 4N27A 1R80A 1KGTA 4IRPA 1ZCTA 2VXMA 1INIA 5DDVA 4B4GA 4B3UA 3RMWA 2AM3A 3OGZA 4KNRA 4NAKA 4EEMA 1LZJA 4FRHA 3T7OA 4JISA 2PGYA 4KNXA 4R36A 4EAAA 3FTTA 4KT7A 4FRAA 1ZHJA 3OTZA 4KRVA 4HO2A 3CKVA 5EIYA 2VSIA 3SXEA 3FSCA 1ZI1A 3N9WA 3V0NA 1SSMA 2NPOA 3Q80A 2D0JA 4NANA 4IHGA 2WVLA 3I0LA 1YP4A 2ICYA 3R5AA 5DDTA 2FYCB 3SXBA
chains in the Genus database with same CATH topology
2FKOA 4Y7TA 3IOJA 1K4VA 4CVHA 5ADXV 4Y64A 1XZ6A 3I0FA 3D5NA 2W0VA 4M2BA 2FYAA 4Y63A 4MZUA 4D11C 5C48A 2Z87A 1FGGA 4ASJA 1IINA 4J09A 5C4CA 4P00A 4AYLA 3I0KA 2JF2A 1YROB 3BSWA 1G8OA 1G97A 3OC9A 1MC3A 1JV3A 4HO0A 3MC4A 3KWEA 4FRBA 5EJ1A 4HCQA 2YC3A 2QIVX 1VPAA 2GGQA 2FYBA 3RSBA 3QVBA 4Y6UA 4ECMA 1ZI3A 5FYEA 3R2WA 2VS4A 2D7IA 1QRFA 2PA4A 3V8YA 1MR9A 2V0LA 1VGTA 2ZU7A 1V83A 4EE5A 1KGQA 4BQHA 1R7VA 5CMHA 3VNPA 1H5SA 2OEFA 1JYLA 1R81A 4FRMA 1MP5A 4HURA 2VD4A 1WT1A 3U2VA 2QH5A 1V67A 5D92A 3CKOA 3SX3A 1LL2A 1QRLA 2P6WA 4O6MA 2WVMA 3D8VA 2XMEA 3FS8A 3R5CA 3TISA 5C36A 1GWWA 2AECA 1R7XA 4Y6NA 1HJJA 3ZLLA 1TVYA 2RJ9A 4E6TA 5L6VA 3R0SA 1ZJOA 2TDTA 4E6UA 4R37A 1FR9A 1QRMA 4M9CA 1G0RA 2O1GA 2VS5A 1MP3A 1T3DA 3TDTA 1NHEB 1V84A 1H7FA 3I3XA 3V4EA 5HS2A 3VBPA 3ECTA 1VH1A 1O7OA 5FU0A 1G3LA 3BXYA 2RJ6A 4CJBA 2WVKA 1VGWA 1ZI5A 3EEVA 1Z90A 1NWGB 3BCVA 4FQWA 2A8UA 1QWJA 1FWYA 3FWWA 4L41C 3VBMA 1S4PA 3SX5A 5C1GA 5CMGX 1TW1A 3P1BA 4HO8A 1YP3A 2WAWA 2E3DA 3V0OA 4AC3A 1H4DA 1KRRA 5E3QA 1TDTA 1WT0A 3E25A 2VFZA 4HO6A 1H5SC 1LVWA 4FRPA 1ZIZA 3HJJA 2IU8A 1KK4A 1FG5N 1W57A 2P73A 3I0GA 3V0LA 2V0JA 4B4BA 1TW5A 1VZUA 2X60A 3V0MA 1VZTA 2WLFA 2O1FA 2Y4KA 3U2XA 1H7GA 1S4OA 3BRKX 3DHOA 1W77A 4JD0A 4Y7FA 3USRA 3GVDA 5L6SA 1ZI4A 1GX4A 1I52A 5C4EA 4B2WA 4FCUA 1LL3A 1ZJPA 4IHHA 5CQOA 2WGZA 1SS9A 3T57A 3EG4A 1ZCUA 1G95A 3K8EA 4AYJA 1MRLA 3V90A 3SX8A 1HM0A 1LL0A 3OH4A 1LZ7A 2WLCA 5E3PA 1TZFA 3P47A 4M28A 1LZIA 3SXGA 3GUEA 1H5SD 4AAWA 4FIYA 3OTMA 2X5ZA 3JQYA 2YQCA 2BO6A 4KQLA 2XMHA 3I0DA 5AJPA 4HZCA 1YP2A 1S80A 2FFVA 3ZLKA 3PNNA 2RIZA 5AFUV 2P72A 4R7PA 4EE4A 4MNDA 1ZDGA 2JCLA 2D7RA 4FRLA 3VBKA 2Y6PA 2APCA 4MIXA 3BSSA 1INJA 3FSYA 5BXCA 4K6RA 2FYDB 2C0NA 2J0AA 4FRDA 3FOQA 1OQMB 1NQIB 3OH3A 1H7QA 3CGXA 4FRQA 1KHRA 2OEGA 3VBJA 2V0IA 4DE7A 3Q1XA 2Y4LA 2OI5A 2YCMA 1H7TA 1IIMA 3I0CA 4NALA 5EJZA 5CMJA 4HG6A 3HL3A 2OI7A 3SXCA 5AFUU 1ZCVA 1G93A 2AE7A 2Z86A 3TK8A 3E26A 4M98A 4HUSA 4HOCA 1PZYB 3IOHA 2QIAA 2O1HA 1KK6A 2AQ9A 4E1KA 2XATA 2YESA 5C8RA 1R82A 3VBNA 1XHBA 1R7UA 1PZTA 3CKJA 2ICXA 4D48A 2FFUA 4B4MA 3I0IX 3FSXA 1H5RA 1ZJ0A 4Y7VA 1WVCA 5FTVA 4EQYA 5AJNA 2I5KA 2RJ7A 3PMOA 4D0ZA 2YQJA 3NZ2A 1O7QA 1FR8A 4UEGA 3C8VA 1QG8A 3KWDA 1G9RA 1HM8A 3VBIA 1ZDFA 3DJ4A 3KWCA 1NMMB 2RIJA 3PKQA 3CKNA 2FY7A 4EEOA 3R5BA 1H5RB 3U0YA 2J0BA 1LZ0A 2YQSA 1E5KA 3I0JA 3IXCA 1GWVA 1WT2A 4P02A 3IOIA 4J18A 2QGIA 4G3PA 4KXOA 4LW3A 4M4KA 2JCJA 1FRWA 4ZDQA 2AGDA 1FXOA 2RITA 2UX8A 4N6AA 5AJOA 3ZGFA 4G87A 5IDSA 1V82A 2X5SA 1ON8A 4G3SA 1OCXA 2I5EA 1FZWA 5C3DA 5DG3A 2A8WA 1JVDA 5C1LA 4EABA 4Y7GA 3HSQA 1FO9A 1H5TA 3I0EA 1HV9A 1JVGA 3I0HA 3SXAA 3NGWA 2RIYA 2WLEA 5C4FA 2AH9A 3POLA 1O0RA 1VZXA 1H4EA 5C49A 3ZGGA 2VHEA 1QREA 2Y4MA 4IRQA 3R1WA 1KWSA 3T7MA 3TV0A 2VS3A 3ZF8A 4IHFA 4B2XA 5F42A 4D0TA 1QQ0A 4O6NA 1H3MA 2IU9A 2WLDA 4CJCA 2P2OA 1H5TB 4XWIA 5CQLX 1QGSA 5DEMA 2VSHA 1XHDA 3Q4SA 3OW5A 5I1FA 1H4CA 1EYRA 4FCEA 5CQPA 2AESA 1QGQA 3ST8A 2PGVA 3USQA 4M99A 1G2VA 1SSQA 4AA7A 4Q7CA 3V91A 4EE3A 5JQQA 1QRGA 5D91A 2BO7A 1LXAA 5C3BA 4HO3A 3F1YA 1HM9A 1FOAA 3JUJA 3K8DA 3GOSA 3TWDA 3FSBA 3R3RA 1THJA 1S4NA 2DPWA 2V0KA 3DK5A 4GBPA 5FUHA 1SSTA 1WT3A 3TIOA 2ZU8A 4E75A 1FO8A 5IFYA 4HO4A 1VGUA 4BMAA 3PKPA 3CJ8A 1R7TA 2E8BA 4M2AA 1GA8A 1HJLA 2WLGA 1KQAA 2RJ1A 4ASYA 2V0HA 2RJ5A 3BFPA 3OH0A 2Y4JA 5C4BA 4E79A 1ZJ3A 4NAIA 3F1CA 3TQDA 2Y7AA 4ARWA 2XWLA 2W0WA 3EH0A 4Y62A 4DDZA 3VBLA 3JTJA 1H7HA 2BO8A 2YQHA 3R3IA 3T7NA 1GQ9A 4MFGA 5FV9A 3SPTA 3Q7UA 1G23A 2JCKA 3F1XA 2MZBA 5C38A 4KC2A 4HO5A 4HO9A 5C1HA 3SRTA 2AM5A 4EGGA 2X65A 2AM4A 1OMXA 5ADXU 2GGOA 2WEEA 1KK5A 1JV1A 3CKQA 4KC4A 1EZIA 3EE5A 4DCLA 3SX7A 4ISXA 3BSYA 3OKRA 3SXDA 1KRUA 4Y7UA 1NKHB 4C2SA 3V0QA 5IDTA 1OMZA 3MQGA 1XATA 2XWMA 3DUVA 4B5BA 3TZTA 3LW6A 5CMFX 1KRVA 1W55A 1ZJ2A 1MR7A 5CQMX 5CMIA 4N6BA 5J49A 2QKXA 3O3PA 1WSZA 4N69A 2WE9A 3OH2A 4FREA 3MQHA 2BO4A 2I7BA 5FU8A 1H7EA 2CU2A 2RJ8A 4Y9XA 4CJ8A 3D98A 3OH1A 1H5SB 4MYBA 5C3AA 5E3RA 5DEPA 4FIXA 1ZCYA 4B42A 1G1LA 1H7LA 3RMVA 3V8ZA 3R8YA 1V3WA 1NF5B 1MP4A 5U2KA 1JYKA 2RJ4A 4FROA 4EVWA 4LW6A 2IUAA 2JF3A 2OI6A 2PX7A 3KIAA 3OAMA 3IGJA 2XWNA 5FTSA 1R7YA 1FXJA 4H7OA 1O23B 5CQNX 2ZU9A 4KPZA 1GX0A 1ON6A 3U2UA 2RJ0A 1FGXA 4HZDA 3I3AA 4YS8A 3U2WA 3OUPA 4G3QA 3U0XA 4MYOA 4D11A 2NXVA 4EEAA 1VM8A 2RIXA 3JUKA 3R5DA 1GQCA 5C4DA 3CU0A 2VXLA 4KC1A 1VGZA 2YC5A 1J2ZA 1VICA 5C47A 2JCOA 2Q4JA 4DECA 2VK9A 4KPXA 1VH3A 1ZJ1A 4EA7A 4EA8A 2IC7A 4EA9A 3V0PA 3U2TA 3OU9A 4EEGA 4N27A 1R80A 1KGTA 4IRPA 1ZCTA 2VXMA 1INIA 5DDVA 4B4GA 4B3UA 3RMWA 2AM3A 3OGZA 4KNRA 4NAKA 4EEMA 1LZJA 4FRHA 3T7OA 4JISA 2PGYA 4KNXA 4R36A 4EAAA 3FTTA 4KT7A 4FRAA 1ZHJA 3OTZA 4KRVA 4HO2A 3CKVA 5EIYA 2VSIA 3SXEA 3FSCA 1ZI1A 3N9WA 3V0NA 1SSMA 2NPOA 3Q80A 2D0JA 4NANA 4IHGA 2WVLA 3I0LA 1YP4A 2ICYA 3R5AA 5DDTA 2FYCB 3SXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKO A;  4Y7T A;  3IOJ A;  1K4V A;  4CVH A;  5ADX V;  4Y64 A;  1XZ6 A;  3I0F A;  3D5N A;  2W0V A;  4M2B A;  2FYA A;  4Y63 A;  4MZU A;  4D11 C;  5C48 A;  2Z87 A;  1FGG A;  4ASJ A;  1IIN A;  4J09 A;  5C4C A;  4P00 A;  4AYL A;  3I0K A;  2JF2 A;  1YRO B;  3BSW A;  1G8O A;  1G97 A;  3OC9 A;  1MC3 A;  1JV3 A;  4HO0 A;  3MC4 A;  3KWE A;  4FRB A;  5EJ1 A;  4HCQ A;  2YC3 A;  2QIV X;  1VPA A;  2GGQ A;  2FYB A;  3RSB A;  3QVB A;  4Y6U A;  4ECM A;  1ZI3 A;  5FYE A;  3R2W A;  2VS4 A;  2D7I A;  1QRF A;  2PA4 A;  3V8Y A;  1MR9 A;  2V0L A;  1VGT A;  2ZU7 A;  1V83 A;  4EE5 A;  1KGQ A;  4BQH A;  1R7V A;  5CMH A;  3VNP A;  1H5S A;  2OEF A;  1JYL A;  1R81 A;  4FRM A;  1MP5 A;  4HUR A;  2VD4 A;  1WT1 A;  3U2V A;  2QH5 A;  1V67 A;  3CKO A;  3SX3 A;  1LL2 A;  1QRL A;  2P6W A;  2WVM A;  3D8V A;  2XME A;  3FS8 A;  3R5C A;  3TIS A;  5C36 A;  1GWW A;  2AEC A;  1R7X A;  4Y6N A;  1HJJ A;  3ZLL A;  1TVY A;  2RJ9 A;  4E6T A;  5L6V A;  3R0S A;  1ZJO A;  2TDT A;  4E6U A;  4R37 A;  1FR9 A;  1QRM A;  4M9C A;  1G0R A;  2O1G A;  2VS5 A;  1MP3 A;  1T3D A;  3TDT A;  1NHE B;  1V84 A;  1H7F A;  3I3X A;  3V4E A;  5HS2 A;  3VBP A;  3ECT A;  1VH1 A;  1O7O A;  5FU0 A;  1G3L A;  3BXY A;  2RJ6 A;  4CJB A;  2WVK A;  1VGW A;  1ZI5 A;  3EEV A;  1Z90 A;  1NWG B;  3BCV A;  4FQW A;  2A8U A;  1QWJ A;  1FWY A;  3FWW A;  4L41 C;  3VBM A;  1S4P A;  3SX5 A;  5C1G A;  5CMG X;  1TW1 A;  3P1B A;  4HO8 A;  1YP3 A;  2WAW A;  2E3D A;  3V0O A;  4AC3 A;  1H4D A;  1KRR A;  5E3Q A;  1TDT A;  1WT0 A;  3E25 A;  2VFZ A;  4HO6 A;  1H5S C;  1LVW A;  4FRP A;  1ZIZ A;  3HJJ A;  2IU8 A;  1KK4 A;  1FG5 N;  1W57 A;  2P73 A;  3I0G A;  3V0L A;  2V0J A;  4B4B A;  1TW5 A;  1VZU A;  2X60 A;  3V0M A;  1VZT A;  2WLF A;  2O1F A;  2Y4K A;  3U2X A;  1H7G A;  1S4O A;  3BRK X;  3DHO A;  1W77 A;  4JD0 A;  4Y7F A;  3USR A;  3GVD A;  5L6S A;  1ZI4 A;  1GX4 A;  1I52 A;  5C4E A;  4B2W A;  4FCU A;  1LL3 A;  1ZJP A;  4IHH A;  5CQO A;  2WGZ A;  1SS9 A;  3T57 A;  3EG4 A;  1ZCU A;  1G95 A;  3K8E A;  4AYJ A;  1MRL A;  3V90 A;  3SX8 A;  1HM0 A;  1LL0 A;  3OH4 A;  1LZ7 A;  2WLC A;  5E3P A;  1TZF A;  3P47 A;  4M28 A;  1LZI A;  3SXG A;  3GUE A;  1H5S D;  4AAW A;  3OTM A;  2X5Z A;  3JQY A;  2YQC A;  2BO6 A;  4KQL A;  2XMH A;  3I0D A;  5AJP A;  4HZC A;  1YP2 A;  1S80 A;  2FFV A;  3ZLK A;  3PNN A;  2RIZ A;  5AFU V;  2P72 A;  4R7P A;  4EE4 A;  4MND A;  1ZDG A;  2JCL A;  2D7R A;  4FRL A;  3VBK A;  2Y6P A;  2APC A;  3BSS A;  1INJ A;  3FSY A;  5BXC A;  4K6R A;  2FYD B;  4FRD A;  3FOQ A;  1OQM B;  1NQI B;  3OH3 A;  1H7Q A;  3CGX A;  4FRQ A;  1KHR A;  2OEG A;  3VBJ A;  2V0I A;  4DE7 A;  3Q1X A;  2Y4L A;  2OI5 A;  2YCM A;  1H7T A;  1IIM A;  3I0C A;  4NAL A;  5EJZ A;  5CMJ A;  4HG6 A;  3HL3 A;  2OI7 A;  3SXC A;  5AFU U;  1ZCV A;  1G93 A;  2AE7 A;  2Z86 A;  3TK8 A;  3E26 A;  4M98 A;  4HUS A;  4HOC A;  1PZY B;  3IOH A;  2QIA A;  2O1H A;  1KK6 A;  2AQ9 A;  4E1K A;  2XAT A;  2YES A;  5C8R A;  1R82 A;  3VBN A;  1XHB A;  1R7U A;  1PZT A;  3CKJ A;  2ICX A;  4D48 A;  2FFU A;  4B4M A;  3I0I X;  3FSX A;  1H5R A;  1ZJ0 A;  4Y7V A;  1WVC A;  5FTV A;  4EQY A;  5AJN A;  2I5K A;  2RJ7 A;  3PMO A;  4D0Z A;  2YQJ A;  3NZ2 A;  1O7Q A;  1FR8 A;  4UEG A;  3C8V A;  1QG8 A;  3KWD A;  1G9R A;  1HM8 A;  3VBI A;  1ZDF A;  3DJ4 A;  3KWC A;  1NMM B;  2RIJ A;  3PKQ A;  3CKN A;  2FY7 A;  4EEO A;  3R5B A;  1H5R B;  3U0Y A;  2YQS A;  1LZ0 A;  3I0J A;  1E5K A;  3IXC A;  1GWV A;  1WT2 A;  4P02 A;  3IOI A;  4J18 A;  2QGI A;  4G3P A;  4KXO A;  4LW3 A;  4M4K A;  2JCJ A;  1FRW A;  4ZDQ A;  2AGD A;  1FXO A;  2RIT A;  2UX8 A;  4N6A A;  5AJO A;  3ZGF A;  4G87 A;  5IDS A;  1V82 A;  2X5S A;  1ON8 A;  4G3S A;  1OCX A;  2I5E A;  1FZW A;  5C3D A;  5DG3 A;  2A8W A;  1JVD A;  5C1L A;  4EAB A;  4Y7G A;  3HSQ A;  1FO9 A;  1H5T A;  3I0E A;  1HV9 A;  1JVG A;  3I0H A;  3SXA A;  3NGW A;  2RIY A;  2WLE A;  5C4F A;  2AH9 A;  3POL A;  1O0R A;  1VZX A;  1H4E A;  5C49 A;  3ZGG A;  2VHE A;  1QRE A;  2Y4M A;  4IRQ A;  3R1W A;  1KWS A;  3T7M A;  3TV0 A;  2VS3 A;  3ZF8 A;  4IHF A;  4B2X A;  5F42 A;  4D0T A;  1QQ0 A;  1H3M A;  2IU9 A;  2WLD A;  4CJC A;  2P2O A;  1H5T B;  4XWI A;  5CQL X;  1QGS A;  5DEM A;  2VSH A;  1XHD A;  3Q4S A;  3OW5 A;  5I1F A;  1H4C A;  1EYR A;  4FCE A;  5CQP A;  2AES A;  1QGQ A;  3ST8 A;  2PGV A;  3USQ A;  4M99 A;  1G2V A;  1SSQ A;  4AA7 A;  3V91 A;  4EE3 A;  5JQQ A;  1QRG A;  2BO7 A;  1LXA A;  5C3B A;  4HO3 A;  3F1Y A;  1HM9 A;  1FOA A;  3JUJ A;  3K8D A;  3GOS A;  3TWD A;  3FSB A;  3R3R A;  1THJ A;  1S4N A;  2DPW A;  2V0K A;  3DK5 A;  4GBP A;  5FUH A;  1SST A;  1WT3 A;  3TIO A;  2ZU8 A;  4E75 A;  1FO8 A;  5IFY A;  4HO4 A;  1VGU A;  4BMA A;  3PKP A;  3CJ8 A;  1R7T A;  2E8B A;  4M2A A;  1GA8 A;  1HJL A;  2WLG A;  1KQA A;  2RJ1 A;  4ASY A;  2V0H A;  2RJ5 A;  3BFP A;  3OH0 A;  2Y4J A;  5C4B A;  4E79 A;  1ZJ3 A;  4NAI A;  3F1C A;  3TQD A;  2Y7A A;  4ARW A;  2XWL A;  2W0W A;  3EH0 A;  4Y62 A;  4DDZ A;  3VBL A;  3JTJ A;  1H7H A;  2BO8 A;  2YQH A;  3R3I A;  3T7N A;  1GQ9 A;  4MFG A;  5FV9 A;  3SPT A;  3Q7U A;  1G23 A;  2JCK A;  3F1X A;  2MZB A;  5C38 A;  4KC2 A;  4HO5 A;  4HO9 A;  5C1H A;  3SRT A;  2AM5 A;  4EGG A;  2X65 A;  2AM4 A;  1OMX A;  5ADX U;  2GGO A;  2WEE A;  1KK5 A;  1JV1 A;  3CKQ A;  4KC4 A;  1EZI A;  3EE5 A;  4DCL A;  3SX7 A;  4ISX A;  3BSY A;  3OKR A;  3SXD A;  1KRU A;  4Y7U A;  1NKH B;  4C2S A;  3V0Q A;  5IDT A;  1OMZ A;  3MQG A;  1XAT A;  2XWM A;  3DUV A;  4B5B A;  3TZT A;  3LW6 A;  5CMF X;  1KRV A;  1W55 A;  1ZJ2 A;  1MR7 A;  5CQM X;  5CMI A;  4N6B A;  5J49 A;  2QKX A;  3O3P A;  1WSZ A;  4N69 A;  2WE9 A;  3OH2 A;  4FRE A;  3MQH A;  2BO4 A;  2I7B A;  5FU8 A;  1H7E A;  2CU2 A;  2RJ8 A;  4Y9X A;  4CJ8 A;  3D98 A;  3OH1 A;  1H5S B;  4MYB A;  5C3A A;  5E3R A;  5DEP A;  1ZCY A;  4B42 A;  1G1L A;  1H7L A;  3RMV A;  3V8Z A;  3R8Y A;  1V3W A;  1NF5 B;  1MP4 A;  5U2K A;  1JYK A;  2RJ4 A;  4FRO A;  4EVW A;  4LW6 A;  2IUA A;  2JF3 A;  2OI6 A;  2PX7 A;  3KIA A;  3OAM A;  3IGJ A;  2XWN A;  5FTS A;  1R7Y A;  1FXJ A;  4H7O A;  1O23 B;  5CQN X;  2ZU9 A;  4KPZ A;  1GX0 A;  1ON6 A;  3U2U A;  2RJ0 A;  1FGX A;  4HZD A;  3I3A A;  4YS8 A;  3U2W A;  3OUP A;  4G3Q A;  3U0X A;  4MYO A;  4D11 A;  2NXV A;  4EEA A;  1VM8 A;  2RIX A;  3JUK A;  3R5D A;  1GQC A;  5C4D A;  3CU0 A;  2VXL A;  4KC1 A;  1VGZ A;  2YC5 A;  1J2Z A;  1VIC A;  5C47 A;  2JCO A;  2Q4J A;  4DEC A;  4KPX A;  1VH3 A;  1ZJ1 A;  4EA7 A;  4EA8 A;  2IC7 A;  4EA9 A;  3V0P A;  3U2T A;  3OU9 A;  4EEG A;  4N27 A;  1R80 A;  1KGT A;  4IRP A;  1ZCT A;  2VXM A;  1INI A;  5DDV A;  4B4G A;  4B3U A;  3RMW A;  2AM3 A;  3OGZ A;  4KNR A;  4NAK A;  4EEM A;  1LZJ A;  4FRH A;  3T7O A;  4JIS A;  2PGY A;  4KNX A;  4R36 A;  4EAA A;  3FTT A;  4KT7 A;  4FRA A;  1ZHJ A;  3OTZ A;  4KRV A;  4HO2 A;  3CKV A;  5EIY A;  2VSI A;  3SXE A;  3FSC A;  1ZI1 A;  3N9W A;  3V0N A;  1SSM A;  2NPO A;  3Q80 A;  2D0J A;  4NAN A;  4IHG A;  2WVL A;  3I0L A;  1YP4 A;  2ICY A;  3R5A A;  5DDT A;  2FYC B;  3SXB A; 
#chains in the Genus database with same CATH topology
 2FKO A;  4Y7T A;  3IOJ A;  1K4V A;  4CVH A;  5ADX V;  4Y64 A;  1XZ6 A;  3I0F A;  3D5N A;  2W0V A;  4M2B A;  2FYA A;  4Y63 A;  4MZU A;  4D11 C;  5C48 A;  2Z87 A;  1FGG A;  4ASJ A;  1IIN A;  4J09 A;  5C4C A;  4P00 A;  4AYL A;  3I0K A;  2JF2 A;  1YRO B;  3BSW A;  1G8O A;  1G97 A;  3OC9 A;  1MC3 A;  1JV3 A;  4HO0 A;  3MC4 A;  3KWE A;  4FRB A;  5EJ1 A;  4HCQ A;  2YC3 A;  2QIV X;  1VPA A;  2GGQ A;  2FYB A;  3RSB A;  3QVB A;  4Y6U A;  4ECM A;  1ZI3 A;  5FYE A;  3R2W A;  2VS4 A;  2D7I A;  1QRF A;  2PA4 A;  3V8Y A;  1MR9 A;  2V0L A;  1VGT A;  2ZU7 A;  1V83 A;  4EE5 A;  1KGQ A;  4BQH A;  1R7V A;  5CMH A;  3VNP A;  1H5S A;  2OEF A;  1JYL A;  1R81 A;  4FRM A;  1MP5 A;  4HUR A;  2VD4 A;  1WT1 A;  3U2V A;  2QH5 A;  1V67 A;  5D92 A;  3CKO A;  3SX3 A;  1LL2 A;  1QRL A;  2P6W A;  4O6M A;  1M8N A;  2WVM A;  3D8V A;  2XME A;  3FS8 A;  3R5C A;  3TIS A;  5C36 A;  1GWW A;  2AEC A;  1R7X A;  4Y6N A;  1HJJ A;  3ZLL A;  1TVY A;  2RJ9 A;  4E6T A;  5L6V A;  3R0S A;  1ZJO A;  1EWW A;  2TDT A;  4E6U A;  4R37 A;  1FR9 A;  1QRM A;  4M9C A;  1G0R A;  2O1G A;  2VS5 A;  1MP3 A;  1T3D A;  3TDT A;  1NHE B;  1V84 A;  1H7F A;  3I3X A;  3V4E A;  5HS2 A;  3VBP A;  3ECT A;  1VH1 A;  1O7O A;  5FU0 A;  1G3L A;  3BXY A;  2RJ6 A;  4CJB A;  2WVK A;  1VGW A;  1ZI5 A;  3EEV A;  1Z90 A;  1NWG B;  3BCV A;  4FQW A;  2A8U A;  1QWJ A;  1FWY A;  3FWW A;  4L41 C;  3VBM A;  1S4P A;  3SX5 A;  5C1G A;  5CMG X;  1TW1 A;  3P1B A;  4HO8 A;  1YP3 A;  2WAW A;  2E3D A;  3V0O A;  4AC3 A;  1H4D A;  1KRR A;  5E3Q A;  1TDT A;  3GQ9 A;  1WT0 A;  3E25 A;  2VFZ A;  4HO6 A;  1H5S C;  1LVW A;  4FRP A;  1ZIZ A;  3HJJ A;  3GQA A;  2IU8 A;  1KK4 A;  1FG5 N;  1W57 A;  2P73 A;  3I0G A;  3V0L A;  2V0J A;  4B4B A;  1TW5 A;  1VZU A;  2X60 A;  3V0M A;  1VZT A;  2WLF A;  2O1F A;  2Y4K A;  3GQ8 A;  1H7G A;  3U2X A;  1S4O A;  3BRK X;  3DHO A;  1W77 A;  4JD0 A;  4Y7F A;  3USR A;  3GVD A;  5L6S A;  1ZI4 A;  1GX4 A;  1I52 A;  5C4E A;  4B2W A;  4FCU A;  1LL3 A;  1ZJP A;  4IHH A;  5CQO A;  2WGZ A;  1SS9 A;  3T57 A;  3EG4 A;  1ZCU A;  1G95 A;  3K8E A;  4AYJ A;  1MRL A;  1L0S A;  3V90 A;  3SX8 A;  1HM0 A;  1LL0 A;  3OH4 A;  1LZ7 A;  2WLC A;  5E3P A;  1TZF A;  3P47 A;  4M28 A;  1LZI A;  3SXG A;  3GUE A;  1H5S D;  4AAW A;  4FIY A;  3OTM A;  2X5Z A;  3JQY A;  2YQC A;  2BO6 A;  4KQL A;  2XMH A;  3I0D A;  5AJP A;  4HZC A;  1YP2 A;  1S80 A;  2FFV A;  3ZLK A;  3PNN A;  2RIZ A;  5AFU V;  2P72 A;  4R7P A;  4EE4 A;  4MND A;  1ZDG A;  2JCL A;  2D7R A;  4FRL A;  3VBK A;  2Y6P A;  2APC A;  4MIX A;  3BSS A;  1INJ A;  3FSY A;  5BXC A;  4K6R A;  2FYD B;  2C0N A;  2J0A A;  4FRD A;  3FOQ A;  1OQM B;  3OH3 A;  1NQI B;  1H7Q A;  3CGX A;  4FRQ A;  1KHR A;  2OEG A;  3VBJ A;  2V0I A;  4DE7 A;  3Q1X A;  2Y4L A;  2OI5 A;  2YCM A;  1H7T A;  1IIM A;  3I0C A;  4NAL A;  5EJZ A;  5CMJ A;  4HG6 A;  3HL3 A;  2OI7 A;  3SXC A;  5AFU U;  1ZCV A;  1G93 A;  2AE7 A;  2Z86 A;  3TK8 A;  3E26 A;  4M98 A;  4HUS A;  4HOC A;  1PZY B;  3IOH A;  2QIA A;  2O1H A;  1KK6 A;  2AQ9 A;  4E1K A;  2XAT A;  2YES A;  5C8R A;  1R82 A;  3VBN A;  1XHB A;  1R7U A;  1PZT A;  3CKJ A;  2ICX A;  4D48 A;  2FFU A;  4B4M A;  3I0I X;  3FSX A;  1H5R A;  1ZJ0 A;  4Y7V A;  1WVC A;  5FTV A;  4EQY A;  5AJN A;  2I5K A;  2RJ7 A;  3PMO A;  4D0Z A;  2YQJ A;  3NZ2 A;  1O7Q A;  1FR8 A;  4UEG A;  3C8V A;  1QG8 A;  3KWD A;  1G9R A;  1HM8 A;  3VBI A;  1Z2F A;  1ZDF A;  3DJ4 A;  3KWC A;  1NMM B;  2RIJ A;  3PKQ A;  3CKN A;  2FY7 A;  4EEO A;  3R5B A;  1H5R B;  3U0Y A;  2J0B A;  1LZ0 A;  2YQS A;  1E5K A;  3I0J A;  3IXC A;  1GWV A;  1WT2 A;  4P02 A;  3IOI A;  4J18 A;  2QGI A;  4G3P A;  4KXO A;  4LW3 A;  4M4K A;  2JCJ A;  1FRW A;  4ZDQ A;  2AGD A;  1FXO A;  2RIT A;  2UX8 A;  4N6A A;  5AJO A;  3ZGF A;  4G87 A;  5IDS A;  1V82 A;  2X5S A;  1ON8 A;  4G3S A;  1OCX A;  2I5E A;  1FZW A;  5C3D A;  5DG3 A;  2A8W A;  1JVD A;  5C1L A;  4EAB A;  4Y7G A;  3HSQ A;  1FO9 A;  1H5T A;  3I0E A;  1HV9 A;  1JVG A;  3I0H A;  3SXA A;  3NGW A;  2RIY A;  2WLE A;  5C4F A;  2AH9 A;  3POL A;  1O0R A;  1VZX A;  1H4E A;  5C49 A;  3ZGG A;  2VHE A;  1QRE A;  2Y4M A;  4IRQ A;  3R1W A;  1KWS A;  3T7M A;  3TV0 A;  2VS3 A;  3ZF8 A;  4IHF A;  4B2X A;  5F42 A;  4D0T A;  1QQ0 A;  4O6N A;  1H3M A;  2IU9 A;  2WLD A;  4CJC A;  2P2O A;  1H5T B;  4XWI A;  5CQL X;  1QGS A;  5DEM A;  2VSH A;  1XHD A;  3Q4S A;  3OW5 A;  5I1F A;  1H4C A;  1EYR A;  4FCE A;  5CQP A;  2AES A;  1QGQ A;  3ST8 A;  2PGV A;  3USQ A;  4M99 A;  1G2V A;  1SSQ A;  4AA7 A;  4Q7C A;  3V91 A;  4EE3 A;  5JQQ A;  1QRG A;  5D91 A;  2BO7 A;  1LXA A;  5C3B A;  4HO3 A;  3F1Y A;  1HM9 A;  1FOA A;  3JUJ A;  3K8D A;  3GOS A;  3TWD A;  3FSB A;  3R3R A;  1THJ A;  1S4N A;  2DPW A;  2V0K A;  3DK5 A;  4GBP A;  5FUH A;  1SST A;  1WT3 A;  3TIO A;  2ZU8 A;  4E75 A;  1FO8 A;  5IFY A;  4HO4 A;  1VGU A;  4BMA A;  3PKP A;  3CJ8 A;  1R7T A;  2E8B A;  4M2A A;  1GA8 A;  1HJL A;  2WLG A;  1KQA A;  2RJ1 A;  4ASY A;  2V0H A;  3OH0 A;  3BFP A;  2RJ5 A;  2Y4J A;  5C4B A;  4E79 A;  1ZJ3 A;  4NAI A;  3F1C A;  3TQD A;  2Y7A A;  4ARW A;  2XWL A;  2W0W A;  3EH0 A;  4Y62 A;  4DDZ A;  3VBL A;  3JTJ A;  1H7H A;  2BO8 A;  2YQH A;  3R3I A;  3T7N A;  1GQ9 A;  4MFG A;  5FV9 A;  3SPT A;  3Q7U A;  1G23 A;  2JCK A;  3F1X A;  2MZB A;  5C38 A;  4KC2 A;  4HO5 A;  4HO9 A;  5C1H A;  3GQ7 A;  3SRT A;  2AM5 A;  4EGG A;  2X65 A;  2AM4 A;  1OMX A;  5ADX U;  2GGO A;  2WEE A;  1KK5 A;  1JV1 A;  3CKQ A;  4KC4 A;  1EZI A;  3EE5 A;  4DCL A;  3SX7 A;  4ISX A;  3BSY A;  3OKR A;  3SXD A;  1KRU A;  4Y7U A;  1NKH B;  4C2S A;  3V0Q A;  5IDT A;  1OMZ A;  3MQG A;  1XAT A;  2XWM A;  3DUV A;  4B5B A;  3TZT A;  3LW6 A;  5CMF X;  3SUC A;  1KRV A;  1W55 A;  1ZJ2 A;  1MR7 A;  5CQM X;  5CMI A;  4N6B A;  5J49 A;  2QKX A;  3O3P A;  1WSZ A;  4N69 A;  2WE9 A;  3OH2 A;  4FRE A;  3MQH A;  2BO4 A;  2I7B A;  1N4I A;  5FU8 A;  1H7E A;  2CU2 A;  2RJ8 A;  4Y9X A;  4CJ8 A;  3D98 A;  3OH1 A;  1H5S B;  4MYB A;  5C3A A;  5E3R A;  5DEP A;  4FIX A;  1ZCY A;  4B42 A;  1G1L A;  1H7L A;  3RMV A;  3V8Z A;  3R8Y A;  1V3W A;  1NF5 B;  1MP4 A;  5U2K A;  1JYK A;  2RJ4 A;  4FRO A;  4EVW A;  4LW6 A;  2IUA A;  2JF3 A;  2OI6 A;  2PX7 A;  3KIA A;  3OAM A;  3IGJ A;  2XWN A;  5FTS A;  1R7Y A;  1FXJ A;  4H7O A;  1O23 B;  5CQN X;  2ZU9 A;  4KPZ A;  1GX0 A;  1ON6 A;  3U2U A;  2RJ0 A;  1FGX A;  4HZD A;  3I3A A;  4YS8 A;  3U2W A;  3OUP A;  4G3Q A;  3U0X A;  4MYO A;  4D11 A;  2NXV A;  4EEA A;  1VM8 A;  2RIX A;  3JUK A;  3R5D A;  1GQC A;  5C4D A;  3CU0 A;  2VXL A;  4KC1 A;  1VGZ A;  2YC5 A;  1J2Z A;  1VIC A;  5C47 A;  2JCO A;  2Q4J A;  4DEC A;  2VK9 A;  4KPX A;  1VH3 A;  1ZJ1 A;  4EA7 A;  4EA8 A;  2IC7 A;  4EA9 A;  3V0P A;  3U2T A;  3OU9 A;  4EEG A;  4N27 A;  1R80 A;  1KGT A;  4IRP A;  1ZCT A;  2VXM A;  1INI A;  5DDV A;  4B4G A;  4B3U A;  3RMW A;  2AM3 A;  3OGZ A;  4KNR A;  4NAK A;  4EEM A;  1LZJ A;  4FRH A;  3T7O A;  4JIS A;  2PGY A;  4KNX A;  4R36 A;  4EAA A;  3FTT A;  4KT7 A;  4FRA A;  1ZHJ A;  3OTZ A;  4KRV A;  4HO2 A;  3CKV A;  5EIY A;  2VSI A;  3SXE A;  3FSC A;  1ZI1 A;  3N9W A;  3V0N A;  1SSM A;  2NPO A;  3Q80 A;  2D0J A;  4NAN A;  4IHG A;  2WVL A;  3I0L A;  1YP4 A;  2ICY A;  3R5A A;  5DDT A;  2FYC B;  3SXB A; 
#chains in the Genus database with same CATH homology
 2FKO A;  4Y7T A;  3IOJ A;  1K4V A;  4CVH A;  5ADX V;  4Y64 A;  1XZ6 A;  3I0F A;  3D5N A;  2W0V A;  4M2B A;  2FYA A;  4Y63 A;  4MZU A;  4D11 C;  5C48 A;  2Z87 A;  1FGG A;  4ASJ A;  1IIN A;  4J09 A;  5C4C A;  4P00 A;  4AYL A;  3I0K A;  2JF2 A;  1YRO B;  3BSW A;  1G8O A;  1G97 A;  3OC9 A;  1MC3 A;  1JV3 A;  4HO0 A;  3MC4 A;  3KWE A;  4FRB A;  5EJ1 A;  4HCQ A;  2YC3 A;  2QIV X;  1VPA A;  2GGQ A;  2FYB A;  3RSB A;  3QVB A;  4Y6U A;  4ECM A;  1ZI3 A;  5FYE A;  3R2W A;  2VS4 A;  2D7I A;  1QRF A;  2PA4 A;  3V8Y A;  1MR9 A;  2V0L A;  1VGT A;  2ZU7 A;  1V83 A;  4EE5 A;  1KGQ A;  4BQH A;  1R7V A;  5CMH A;  3VNP A;  1H5S A;  2OEF A;  1JYL A;  1R81 A;  4FRM A;  1MP5 A;  4HUR A;  2VD4 A;  1WT1 A;  3U2V A;  2QH5 A;  1V67 A;  5D92 A;  3CKO A;  3SX3 A;  1LL2 A;  1QRL A;  2P6W A;  4O6M A;  2WVM A;  3D8V A;  2XME A;  3FS8 A;  3R5C A;  3TIS A;  5C36 A;  1GWW A;  2AEC A;  1R7X A;  4Y6N A;  1HJJ A;  3ZLL A;  1TVY A;  2RJ9 A;  4E6T A;  5L6V A;  3R0S A;  1ZJO A;  2TDT A;  4E6U A;  4R37 A;  1FR9 A;  1QRM A;  4M9C A;  1G0R A;  2O1G A;  2VS5 A;  1MP3 A;  1T3D A;  3TDT A;  1NHE B;  1V84 A;  1H7F A;  3I3X A;  3V4E A;  5HS2 A;  3VBP A;  3ECT A;  1VH1 A;  1O7O A;  5FU0 A;  1G3L A;  3BXY A;  2RJ6 A;  4CJB A;  2WVK A;  1VGW A;  1ZI5 A;  3EEV A;  1Z90 A;  1NWG B;  3BCV A;  4FQW A;  2A8U A;  1QWJ A;  1FWY A;  3FWW A;  4L41 C;  3VBM A;  1S4P A;  3SX5 A;  5C1G A;  5CMG X;  1TW1 A;  3P1B A;  4HO8 A;  1YP3 A;  2WAW A;  2E3D A;  3V0O A;  4AC3 A;  1H4D A;  1KRR A;  5E3Q A;  1TDT A;  1WT0 A;  3E25 A;  2VFZ A;  4HO6 A;  1H5S C;  1LVW A;  4FRP A;  1ZIZ A;  3HJJ A;  2IU8 A;  1KK4 A;  1FG5 N;  1W57 A;  2P73 A;  3I0G A;  3V0L A;  2V0J A;  4B4B A;  1TW5 A;  1VZU A;  2X60 A;  3V0M A;  1VZT A;  2WLF A;  2O1F A;  2Y4K A;  3U2X A;  1H7G A;  1S4O A;  3BRK X;  3DHO A;  1W77 A;  4JD0 A;  4Y7F A;  3USR A;  3GVD A;  5L6S A;  1ZI4 A;  1GX4 A;  1I52 A;  5C4E A;  4B2W A;  4FCU A;  1LL3 A;  1ZJP A;  4IHH A;  5CQO A;  2WGZ A;  1SS9 A;  3T57 A;  3EG4 A;  1ZCU A;  1G95 A;  3K8E A;  4AYJ A;  1MRL A;  3V90 A;  3SX8 A;  1HM0 A;  1LL0 A;  3OH4 A;  1LZ7 A;  2WLC A;  5E3P A;  1TZF A;  3P47 A;  4M28 A;  1LZI A;  3SXG A;  3GUE A;  1H5S D;  4AAW A;  4FIY A;  3OTM A;  2X5Z A;  3JQY A;  2YQC A;  2BO6 A;  4KQL A;  2XMH A;  3I0D A;  5AJP A;  4HZC A;  1YP2 A;  1S80 A;  2FFV A;  3ZLK A;  3PNN A;  2RIZ A;  5AFU V;  2P72 A;  4R7P A;  4EE4 A;  4MND A;  1ZDG A;  2JCL A;  2D7R A;  4FRL A;  3VBK A;  2Y6P A;  2APC A;  4MIX A;  3BSS A;  1INJ A;  3FSY A;  5BXC A;  4K6R A;  2FYD B;  2C0N A;  2J0A A;  4FRD A;  3FOQ A;  1OQM B;  1NQI B;  3OH3 A;  1H7Q A;  3CGX A;  4FRQ A;  1KHR A;  2OEG A;  3VBJ A;  2V0I A;  4DE7 A;  3Q1X A;  2Y4L A;  2OI5 A;  2YCM A;  1H7T A;  1IIM A;  3I0C A;  4NAL A;  5EJZ A;  5CMJ A;  4HG6 A;  3HL3 A;  2OI7 A;  3SXC A;  5AFU U;  1ZCV A;  1G93 A;  2AE7 A;  2Z86 A;  3TK8 A;  3E26 A;  4M98 A;  4HUS A;  4HOC A;  1PZY B;  3IOH A;  2QIA A;  2O1H A;  1KK6 A;  2AQ9 A;  4E1K A;  2XAT A;  2YES A;  5C8R A;  1R82 A;  3VBN A;  1XHB A;  1R7U A;  1PZT A;  3CKJ A;  2ICX A;  4D48 A;  2FFU A;  4B4M A;  3I0I X;  3FSX A;  1H5R A;  1ZJ0 A;  4Y7V A;  1WVC A;  5FTV A;  4EQY A;  5AJN A;  2I5K A;  2RJ7 A;  3PMO A;  4D0Z A;  2YQJ A;  3NZ2 A;  1O7Q A;  1FR8 A;  4UEG A;  3C8V A;  1QG8 A;  3KWD A;  1G9R A;  1HM8 A;  3VBI A;  1ZDF A;  3DJ4 A;  3KWC A;  1NMM B;  2RIJ A;  3PKQ A;  3CKN A;  2FY7 A;  4EEO A;  3R5B A;  1H5R B;  3U0Y A;  2J0B A;  1LZ0 A;  2YQS A;  1E5K A;  3I0J A;  3IXC A;  1GWV A;  1WT2 A;  4P02 A;  3IOI A;  4J18 A;  2QGI A;  4G3P A;  4KXO A;  4LW3 A;  4M4K A;  2JCJ A;  1FRW A;  4ZDQ A;  2AGD A;  1FXO A;  2RIT A;  2UX8 A;  4N6A A;  5AJO A;  3ZGF A;  4G87 A;  5IDS A;  1V82 A;  2X5S A;  1ON8 A;  4G3S A;  1OCX A;  2I5E A;  1FZW A;  5C3D A;  5DG3 A;  2A8W A;  1JVD A;  5C1L A;  4EAB A;  4Y7G A;  3HSQ A;  1FO9 A;  1H5T A;  3I0E A;  1HV9 A;  1JVG A;  3I0H A;  3SXA A;  3NGW A;  2RIY A;  2WLE A;  5C4F A;  2AH9 A;  3POL A;  1O0R A;  1VZX A;  1H4E A;  5C49 A;  3ZGG A;  2VHE A;  1QRE A;  2Y4M A;  4IRQ A;  3R1W A;  1KWS A;  3T7M A;  3TV0 A;  2VS3 A;  3ZF8 A;  4IHF A;  4B2X A;  5F42 A;  4D0T A;  1QQ0 A;  4O6N A;  1H3M A;  2IU9 A;  2WLD A;  4CJC A;  2P2O A;  1H5T B;  4XWI A;  5CQL X;  1QGS A;  5DEM A;  2VSH A;  1XHD A;  3Q4S A;  3OW5 A;  5I1F A;  1H4C A;  1EYR A;  4FCE A;  5CQP A;  2AES A;  1QGQ A;  3ST8 A;  2PGV A;  3USQ A;  4M99 A;  1G2V A;  1SSQ A;  4AA7 A;  4Q7C A;  3V91 A;  4EE3 A;  5JQQ A;  1QRG A;  5D91 A;  2BO7 A;  1LXA A;  5C3B A;  4HO3 A;  3F1Y A;  1HM9 A;  1FOA A;  3JUJ A;  3K8D A;  3GOS A;  3TWD A;  3FSB A;  3R3R A;  1THJ A;  1S4N A;  2DPW A;  2V0K A;  3DK5 A;  4GBP A;  5FUH A;  1SST A;  1WT3 A;  3TIO A;  2ZU8 A;  4E75 A;  1FO8 A;  5IFY A;  4HO4 A;  1VGU A;  4BMA A;  3PKP A;  3CJ8 A;  1R7T A;  2E8B A;  4M2A A;  1GA8 A;  1HJL A;  2WLG A;  1KQA A;  2RJ1 A;  4ASY A;  2V0H A;  2RJ5 A;  3BFP A;  3OH0 A;  2Y4J A;  5C4B A;  4E79 A;  1ZJ3 A;  4NAI A;  3F1C A;  3TQD A;  2Y7A A;  4ARW A;  2XWL A;  2W0W A;  3EH0 A;  4Y62 A;  4DDZ A;  3VBL A;  3JTJ A;  1H7H A;  2BO8 A;  2YQH A;  3R3I A;  3T7N A;  1GQ9 A;  4MFG A;  5FV9 A;  3SPT A;  3Q7U A;  1G23 A;  2JCK A;  3F1X A;  2MZB A;  5C38 A;  4KC2 A;  4HO5 A;  4HO9 A;  5C1H A;  3SRT A;  2AM5 A;  4EGG A;  2X65 A;  2AM4 A;  1OMX A;  5ADX U;  2GGO A;  2WEE A;  1KK5 A;  1JV1 A;  3CKQ A;  4KC4 A;  1EZI A;  3EE5 A;  4DCL A;  3SX7 A;  4ISX A;  3BSY A;  3OKR A;  3SXD A;  1KRU A;  4Y7U A;  1NKH B;  4C2S A;  3V0Q A;  5IDT A;  1OMZ A;  3MQG A;  1XAT A;  2XWM A;  3DUV A;  4B5B A;  3TZT A;  3LW6 A;  5CMF X;  1KRV A;  1W55 A;  1ZJ2 A;  1MR7 A;  5CQM X;  5CMI A;  4N6B A;  5J49 A;  2QKX A;  3O3P A;  1WSZ A;  4N69 A;  2WE9 A;  3OH2 A;  4FRE A;  3MQH A;  2BO4 A;  2I7B A;  5FU8 A;  1H7E A;  2CU2 A;  2RJ8 A;  4Y9X A;  4CJ8 A;  3D98 A;  3OH1 A;  1H5S B;  4MYB A;  5C3A A;  5E3R A;  5DEP A;  4FIX A;  1ZCY A;  4B42 A;  1G1L A;  1H7L A;  3RMV A;  3V8Z A;  3R8Y A;  1V3W A;  1NF5 B;  1MP4 A;  5U2K A;  1JYK A;  2RJ4 A;  4FRO A;  4EVW A;  4LW6 A;  2IUA A;  2JF3 A;  2OI6 A;  2PX7 A;  3KIA A;  3OAM A;  3IGJ A;  2XWN A;  5FTS A;  1R7Y A;  1FXJ A;  4H7O A;  1O23 B;  5CQN X;  2ZU9 A;  4KPZ A;  1GX0 A;  1ON6 A;  3U2U A;  2RJ0 A;  1FGX A;  4HZD A;  3I3A A;  4YS8 A;  3U2W A;  3OUP A;  4G3Q A;  3U0X A;  4MYO A;  4D11 A;  2NXV A;  4EEA A;  1VM8 A;  2RIX A;  3JUK A;  3R5D A;  1GQC A;  5C4D A;  3CU0 A;  2VXL A;  4KC1 A;  1VGZ A;  2YC5 A;  1J2Z A;  1VIC A;  5C47 A;  2JCO A;  2Q4J A;  4DEC A;  2VK9 A;  4KPX A;  1VH3 A;  1ZJ1 A;  4EA7 A;  4EA8 A;  2IC7 A;  4EA9 A;  3V0P A;  3U2T A;  3OU9 A;  4EEG A;  4N27 A;  1R80 A;  1KGT A;  4IRP A;  1ZCT A;  2VXM A;  1INI A;  5DDV A;  4B4G A;  4B3U A;  3RMW A;  2AM3 A;  3OGZ A;  4KNR A;  4NAK A;  4EEM A;  1LZJ A;  4FRH A;  3T7O A;  4JIS A;  2PGY A;  4KNX A;  4R36 A;  4EAA A;  3FTT A;  4KT7 A;  4FRA A;  1ZHJ A;  3OTZ A;  4KRV A;  4HO2 A;  3CKV A;  5EIY A;  2VSI A;  3SXE A;  3FSC A;  1ZI1 A;  3N9W A;  3V0N A;  1SSM A;  2NPO A;  3Q80 A;  2D0J A;  4NAN A;  4IHG A;  2WVL A;  3I0L A;  1YP4 A;  2ICY A;  3R5A A;  5DDT A;  2FYC B;  3SXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...