3STEA

Crystal structure of a mutant (q202a) of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
250
Chain Sequence
b'MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLAGGRRAQALDLALAGMATRLAGLFLELHLLEDFLIRIKALDDLIKSQPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title An Extended (beta)7(alpha)7 Substrate-Binding Loop Is Essential for Efficient Catalysis by 3-Deoxy-D-manno-Octulosonate 8-Phosphate Synthase
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 79
structure length 250
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3steA00
4N9BA 2OMAA 3DFSA 1YPIA 1IIHA 1OF8A 2X1UA 2RH9A 3DFPA 1I8JA 1G7VA 3KVKA 3QH2A 4CQAA 1OFQA 4CNNA 2NXIA 2A6NA 1QPRA 5I3KA 1H50A 2RKXA 1QMLA 5EBUA 4TIMA 4HNVA 2W79A 1Z42A 2WNNA 4O50A 5LNUA 5LGZA 3LHVA 1AW2A 4GE8A 4BI6A 3F1QA 3TW7A 3PG8A 1C29A 4B5NA 2WSYA 2ZZ1A 4RZ4A 1C8VA 5G2HA 4DQWA 4LU0A 3A21A 2YGYA 3DHFA 2TSYA 2QCEA 3P81A 4RCXA 4M19A 3ZS4A 4JX4A 3LB0A 1LORA 2ALDA 3KAOA 3LLDA 4O52A 1BWKA 4WOZA 5D2WA 1F76A 3SJ3A 5F2IA 5F4XA 3PWAA 4O10A 4PC8A 4OGZA 2FTPA 3TSMA 3UWUA 4DPPA 1K3UA 2FB3A 4DXVA 4OBTA 2DZUA 4MY1A 3TSDA 4MLJA 3L9CA 1TREA 5G2IA 3STGA 3OVQA 3R12A 4K7VA 1T0OA 4NJJA 4FF7A 3S1VA 2OJPA 2DP3A 4TO8A 2Y7GA 4ZVJA 1GG0A 3H55A 4WY0F 2C0AA 3W70A 1MEIA 3NM3A 1BTMA 3OBKA 2QEZA 2OCZA 3S1WA 4HKPA 1G7UA 5DXYA 5E0KA 3W84A 3R5EA 1VYPX 1ME8A 3LM7A 3UD6A 3W7EA 2X2GA 1KV8A 4Z0JA 4TMBA 1QOQA 4QNWA 2CLMA 2H3BA 3S1UA 4NU7A 5K3VA 3B0UX 1IIGA 2ZA3A 3BPWA 4RXGA 5AHEA 3FEMA 5AOUA 1GYNA 3W6YA 3NOEA 4DO4A 3GK0A 2ABBA 1H1ZA 2ATSA 4L4MA 5J5DA 2HS8A 5KSWA 1TPVA 4E2BA 3M9YA 3E0IA 3KRUA 3G1DA 2BXVA 4QIUA 3GDTA 4AF0A 5C54A 1GJPA 3G3DA 3HQ1A 5LSMA 1KA9F 3G18A 1ICQA 4BFAA 5G2WA 2DZXA 1LROA 5BMWA 4RKAA 4IJBA 1K8ZA 1I4NA 3RMJA 4CNPA 1KM3A 2AAMA 1IXNA 1RV8A 3UPWA 3BGGA 4EWND 4K38A 4LC8A 2B4GA 2RHGA 4N02A 3FKKA 4I9AA 5KMYA 1H51A 3RNDA 5K9CA 1S3HA 3M43A 4QITA 3LGEA 3DXIA 4YWIA 4HPXA 4E2DA 2VENA 1LOLA 3PUDA 1QPNA 3B05A 3NL5A 3DFOA 4OQVA 1L2UA 3ABSA 3T4CA 1W3TA 1TQXA 3O05A 3W88A 1YTDA 3LHYA 1I2NA 1X1ZA 2FQIA 2G5WA 5U4NA 1ZCOA 2V81A 4RR4A 1SW3A 2FB2A 1WAUA 3EX6A 4K37A 4FB7A 3UPBA 4RLIA 3PSVA 4X22A 1OFAA 4O54A 1KFEA 1FWSA 1ML1A 2WO5A 2ZYFA 1S5VA 1TCDA 2J9YA 4RV8A 4UFKA 2V30A 1IXQA 2X16A 2Y62A 3IIOA 4O28A 4JY8A 3IGUA 4XKYA 3BK0A 1GWJA 4S2BA 4JTHA 3DI0A 5SWUA 1SO4A 2Z1BA 3W7NA 1GYLA 1XBVA 1R2RA 5I3HA 5AHNA 3E12A 3W1RA 1SR9A 3NGJA 3NYZA 1GVSA 2ZZ4A 3LX9A 5DXXA 3FYPA 1W37A 1GEQA 4GXMA 3NQEA 2ZBTA 5F1UA 3VCRA 2LLEA 1EP3A 4EF9A 2Y85A 3KHJA 3IGSA 3WFAA 4FNTA 3W85A 4AWSA 1M6JA 2NLIA 3WJSA 1RZMA 1RD5A 4N4QA 3W71A 4AB4A 1OFRA 3QW3A 3GAKA 4MY8A 1TB3A 4ZMGA 4MFDA 4XQ6A 2VEPA 4BI7A 1F74A 2A85A 4O57A 2C1HA 4HPJA 4QAIA 4BWLC 1YXCA 4WY0B 4ZL1A 3CT7A 4M6VA 4ZQOA 4I7VA 3T78A 2WPBA 3O06A 1LOSA 1ZAJA 4OV9A 3TH6A 2P0OA 1FX6A 1M7PA 2A4AA 3PBYA 4BWLA 2QUTA 4FNSA 1VHNA 2QF7A 3VFLA 3W72A 2A5HA 4P2VA 4NVTA 2ISVA 3LRMA 4UTWC 2Y63A 3CB8A 4AEOA 1KBJA 2YYTA 5KTLA 2PCQA 4GNJA 3KVJA 3NDOA 4X3ZA 3W2UA 2ATMA 3G1SA 1QWGA 3A23A 2Y6ZA 4HNUA 5HR7A 1FCQA 1VR6A 4MPQA 3FS2A 1LP6A 2CLOA 1OX4B 2ZZ7A 4XBKA 5LNRA 1LCOA 1W56A 3DHDA 4MZ1A 1U5JA 4OU1A 1GT8A 4EF8A 1B4KA 3QMTA 3W7GA 1TV8A 1QCWA 3KVLA 1SZNA 4ZQPA 4O53A 3FOKA 2QJIA 3EWYA 3HG3A 4WX2A 4QQ3A 3BLIA 4N4PA 2A2IA 3C52A 4O17A 2NV2A 4JIPA 3A22A 3W7CA 4H4IA 4KFOA 2R91A 3W22A 5IBXA 1MEHA 5HNRA 5TQLA 3UWVA 1FBAA 3NQFA 4IUOA 1W5OA 4LY8A 2W6RA 3QW4B 2IQTA 5HUPA 4JTIA 4BI5A 2NV1A 5CKSA 4O4VA 3NZRA 1UUMA 4LS0A 1G67A 4GBUA 4NUWA 2Y70A 3MP5A 2C16A 1R2SA 3FA5A 3TQKA 3MP3A 5CPOA 1QPOA 4UNKA 5J5RA 3W1QA 4YCPA 5HULA 1HG3A 2ZRUA 4UIOA 1TQJA 3P61A 2VEKA 3NAVA 3O1NA 4LUJA 3EWUA 2PC4A 3MW7A 4CNOA 5G1TA 5DY3A 3DI1A 3HB9A 4MJZA 3A5FA 4LRSA 4Y90A 1XM3A 3BLFA 2VFDA 3IEBA 1WBJA 1K02A 4C1LA 2A6LA 3R13A 1WOBA 2RDWA 3QC3A 2RDUA 3DH7A 3LI0A 3QEZA 4CLMA 3USBA 1VJIA 1SFLA 3W1TA 1GTEA 4MLRA 3G1HA 4WQ6A 2HTMA 1IXPA 2QCGA 3GYEA 3W83A 1FCUA 3KRSA 4WJEA 3T7VA 4MYXA 3FJ6A 3QMSA 3P74A 4LNYA 2J24A 2QCDB 5I3IA 2GVLA 3LTPA 3L0GA 1QPQA 3IIXA 3HGOA 3O63A 1W1ZA 2P1FA 3EX2A 3NG3A 2V9DA 4Y8FA 3OG3A 1XDMA 3TNOA 1EUNA 1QO5A 1K8YA 4L4LA 3NEVA 3STFA 4N6EA 1XUZA 3M44A 4UTHA 5FEWA 4AWUA 3LTYA 1A5SA 1GVOA 3LDVA 4DO5A 1L9WA 4Y9AA 3ABRA 2CLEA 1UJPA 2X1RA 1NAL1 2YFOA 1V7YA 2V2DA 3ATYA 1SU5A 2VEMA 3SW6A 4LW7A 3BV4A 1KBIA 4HNTA 3RU6A 2JK2A 2Y61A 1YYAA 4ZZ9A 5A5WA 2CZDA 1KV5A 2NXHA 4IMGA 1ZHAA 1NF0A 3TU9A 1EA0A 3GX9A 3O6CA 5F2LA 5AC6A 2VFEA 3GLCA 3W7KA 3WJXA 4NJIA 2JBMA 3MUXA 1ADOA 4R33A 1PV8A 2QAPA 2V5LA 3ZFHA 3LERA 3G0SA 3OIXA 3P67A 4Y96A 4O1BA 3BO9A 1YDOA 4O19A 1K8XA 3TIMA 1NVMA 1GVFA 3C0JA 3CM4A 1PL9A 3GXNA 1HL2A 3PAJA 1OABA 1R47A 3E96A 3W1NA 1NF7A 1QOPA 2PRHA 3SY5A 4LS2A 2A1YA 2WNQA 4MOZA 1SZGA 3E9AA 2OZ0A 4O0KA 1VC4A 1FDZA 3I7QA 4KWVA 1QR7A 4MJMA 5G5IA 4CCCA 1Q6RA 3W2NA 4JYEA 3S0CA 4LT9A 3PSWA 2VXNA 5EYWA 1F5ZA 5G1YA 2RFGA 4AAJA 3KVMA 3W7LA 3LCLA 4K39A 1FCVA 3SSJA 3IIZA 3ELFA 4IPJA 4JD4A 2Y7FA 4O14A 5AYYA 1YADA 3W7OA 4JTUA 3MHGA 4DF0A 1EPXA 3C6CA 4N6FA 2Y89A 4FNUA 5C2XA 1SSDA 5K2ZA 4ZQMA 4PA8A 3MBFA 1MSSA 1GTHA 4DEFA 1F6KA 1OJXA 3W7QA 3OVRA 2EGZA 3F03K 2VFHA 1W5QA 1FWNA 4UTIA 5GVJA 3P7YA 3PUOA 2FPVA 5F1VA 6TIMA 4NX0A 3VI2A 4QISA 4AHOA 1TMHA 4RX0A 3HGRA 1F73A 3L5MA 3LCGA 2A7NA 1IF2A 3DBPA 3LRLA 1UUOA 3UNDA 5D2YA 3GVGA 3TMLA 3EWBX 1VYRA 3KFTA 1JCXA 4WY0A 3N2MA 1P4CA 4HN4A 4O13A 1OHLA 3UZJA 2R94A 3UY8A 2NX1A 4O15A 1GQNA 4BK9A 3JS3A 4I7WA 4Z0SA 4BF9A 3TV8A 3I7RA 3GNNA 2QCHA 1DQWA 5K9XA 3LBCA 1EWDA 3HGJA 2FPTA 1LBLA 5F4SA 3SIZA 1G69A 1X6UA 2E5DA 3W3OA 4XUGA 5I3GA 3L5AA 1IGSA 5ABTA 3NQGA 3Q2DA 3LCHA 1B57A 1PCKA 2XFWA 3EXRA 1RVGA 3QYQA 4JYFA 3L65A 5FESA 5AYZA 1OK4A 1TV7A 5C55A 5HINA 1SFJA 3YPIA 5F2GA 1VCGA 3TROA 4GJ1A 3C8FA 3IVUA 1OX4A 5AYXA 2C6QA 5AFDA 1M5WA 2FPYA 3B06A 3B04A 4UTJA 1BWLA 3RF9A 5C6MA 4LS1A 3GNDA 1OFOA 3IVSA 2QUVA 5D30A 1MEWA 4H6KA 4K8EA 1AW1A 3BW3A 4JR5A 4EVZA 3LV6A 4LVDA 1W5PA 3CQ0A 1Q3NA 4ML9A 5F4WA 2YPIA 4QJ1A 1EP2A 1BEUA 5EMUA 4I7UA 3GXPA 1TPWA 3NL2A 4EIVA 4GC4A 3JRKA 3UXAA 3GZ3A 2OX1A 2J88A 3VE7A 3BG9A 1DKWA 3W1LA 1JCYA 3S9YA 3TDFA 3NZ1A 2EKCA 3BG3A 1XC4A 1G4EA 1DL3A 3CU2A 4JDBA 3CPRA 5AHFA 1Z41A 4ADUA 1K7XA 2JGQA 5CZJA 4RXFA 3DKLA 3S6DA 4MFEA 4WZHA 2NWSA 3LOTA 4PH6A 3CEPA 4E0CA 1FWTA 3S42A 4KFNA 3DZ1A 1JULA 4QM1A 4Y6GA 3G1VA 3C2OA 3MI3A 1QFEA 5D09A 2FIQA 1GVQA 1JUEA 3BLEA 4A2RA 1SO5A 3UWZA 4JX5A 1WA3A 1ZAIA 3UWQA 2VFGA 4HT3A 5CPLA 3KX6A 5DCEA 3W86A 3E49A 3V1PA 3O15A 1JCLA 1X8FA 1Y0EA 4UFLA 4DBEA 2C15A 1KTNA 1P0KA 2YYUA 3Q37A 3A24A 2BWGA 2CZEA 5HWNA 1VCFA 1XBZA 4FNQA 3R2GA 5CSRA 3W1UA 1J4EA 2QCDA 4IMFA 3QQ0A 5D2VA 1SZFA 1AL7A 1D9EA 1VH7A 1XBXA 2FDSA 3C61A 1SW0A 3EXTA 3BARA 2NWRA 3HBLA 3SECA 1C9DA 3U2OA 3C2VA 5LZLA 3N2XA 1SO6A 4LOCA 2J9XA 4MKNA 1KM4A 2O7SA 2Y7EA 4M7TA 3FIGA 4GUFA 2E1DA 4RJEA 3WK1A 3P8IA 1X1OA 4JS3A 2AQWA 1TSIA 2Q3RA 1AK5A 1ZNNA 1QAPA 4LUIA 3NM1A 1OFPA 3EX3A 1W0MA 5CZ0A 4UMBA 3EKZA 2QDHA 4IWWA 3GAYA 2E6DA 4WUIA 5AHIA 3W7PA 1TTIA 5HUOA 4UMAA 3LV5A 2B0MA 2YFNA 1KW1A 3LXCA 1AG1O 5TBOA 3PC0A 1H7WA 1T99A 1LDCA 2E5BA 3HPSA 2F84A 4N2YA 3WK2A 3QF0A 1HTIA 3NQ2A 1LLZA 4FNRA 1XI3A 5D33A 2ZTKA 1RR2A 3T55A 5IM51 2NX9A 2Y88A 4OT7A 4LVGA 3TCEA 1XL9A 2DZTA 3DAQA 1VLIA 3W1PA 1JR1A 1YTEA 2OT0A 3QJAA 1TPFA 3MO7A 4JTEA 2E6AA 3FFSA 3NQ6A 3TKFA 2DZVA 2ZCGA 2VOMA 3IVTA 1SSGA 1M7OA 3ZWTA 2WV8A 2WSQA 4LV9A 1H7RA 3FLUA 4A29A 4UTUA 4UTWA 1HFBA 4UTKA 1K7FA 3NR0A 3M6YA 3HG2A 4UNLA 3EX1A 5LHEA 4KWWA 1A5CA 1ZALA 3W2MA 3HO8A 3TE9A 3WJWA 3QPYA 2TMDA 3S1XA 3QSRA 4AMAA 2Q3OA 5D2XA 3SGZA 4JTTA 2X30A 3CEUA 5AHLA 1SPQA 3H54A 3PB0A 2H90A 1PIIA 4FNPA 2GVGA 2Z0IA 3MYOA 4HSNA 3N3MA 1DQXA 4M5PA 1B9BA 4YMZA 3M47A 3HF3A 1SZEA 2QCMA 3QM3A 4NQ1A 1I2OA 4D2JA 3TX9A 3FYOA 5CSSA 1VHCA 5HWJA 2C3ZA 5U7SA 1S5WA 2DZPA 5BOOA 3NQ8A 2EAWA 1O5KA 2ZZ3A 3EEGA 3LHWA 5CZTA 3NL6A 3IGXA 4ONVA 3BW2A 4LV4A 1PVNA 2V0TA 4TU1A 1KFCA 1H7XA 3MJYA 4JTKA 4AHPA 5AB3A 3INPA 4UFJA 4UR7A 1RQBA 3ATZA 3S5NA 2ZZ2A 3HGSA 2QAFA 5KZMA 3N9RA 2VKZG 3G1FA 1OFEA 3RLUA 3LCIA 3P5ZA 2VFFA 5FEPA 4E38A 2FFCA 1FUYA 1V5XA 2DZWA 2ZA2A 3HMJG 1TO3A 1FXPA 3UWWA 1YPFA 1K7EA 3W07A 2BTMA 3TXVA 1X7FA 4P61A 5MHBA 2C13A 3E02A 3GDLA 5FEZA 5I3JA 1FQ0A 1JQXA 4ZQNA 4A2SA 3I6RA 1GOXA 1PE1A 3MHUA 2E77A 3O16A 1GZGA 5HQEA 5K4ZA 3TA6A 5CG7A 3OEXA 1Z48A 1VCVA 3VNDA 1E51A 3TK7A 3I7SA 4KKXA 3LCXA 1LOQA 3C2FA 3RK8A 3GKFA 3NL3A 1VRDA 3WK3A 2G97A 4LC6A 3G24A 1KM5A 3IIVA 2CFFA 2WSRA 3GR8A 3NXFA 2E6YA 3W2JA 4U28A 3SI9A 3L66A 4NNAA 3TUUA 4S1FA 3TQVA 2CLLA 2QKFA 4CCDA 1FY6A 3K30A 1TPUA 2PRMA 3EWWA 1LBMA 3F4NA 3IV3A 2CLKA 4XTDA 3T40A 3G0UA 5FF4A 3C2EA 2YZRA 2C14A 3PF3A 1WOAA 2GJNA 3P80A 1TPEA 5LNVA 5G4EA 1PHQA 3VE9A 2YW3A 3W73A 3WJZA 1J5TA 5HR6A 4WXYA 3M5VA 1EEPA 4FX7A 2GUUA 1UASA 4KFPA 1W5NA 4HSOA 3MWAA 5DBTA 4NXKA 2R14A 3CLMA 1N55A 1O94A 3R89A 2ZFAA 1XBYA 4K36A 1FDYA 3TSBA 1LRQA 1KLYA 6ALDA 4AH7A 2O7QA 3W7JA 1N8FA 1W54A 3Q94A 3NQ7A 4DBDA 5D04C 5BW6A 3M5ZA 5K9DA 1U83A 3W2KA 2ABAA 1GG1A 1UB3A 4HNNA 2UV8G 2PE4A 4MIMA 5L9FA 1JVNA 1H7NA 2E6FA 1F2JA 4OWGA 3SGUA 2EF9A 3UWYA 3L68A 1H62A 3PBWA 1L6WA 2QCNA 5LGXA 1VQTA 2TRSA 3PULA 3W7RA 2QJHA 2C18A 2QJGA 3IRDA 4FXRA 2ZRXA 5KITA 2BSLA 3MI2A 1Q45A 1QDSA 1FXQA 4JEQA 1I2QA 3TQ0A 3GIYA 1W3IA 4U4MA 3TW6A 1KFLA 3KXQA 1Q6QA 2F7FA 4DELA 3O6DA 2ZRWA 1EWEA 3BW4A 1XXXA 5K4XA 3NPWA 4TR9A 3H53A 1OX6A 2CWNA 4FO4A 2E09A 2E5CA 3TAOA 1KFKA 1DJQA 1OFDA 1DJNA 4NJHA 2TYSA 5LHFA 2CW6A 1NEYA 3A9IA 3S8HA 5T26A 3NA8A 1LYXA 1YDVA 2X1TA 4TMCA 2TPSA 5FF7A 2GQ9A 2DORA 4JYDA 3U8GA 3TJXA 4AHQA 3O8AA 5D37A 4UTMA 1W3NA 2XN0A 3NQVA 4FXSA 2QCLA 1HO1A 1XDLA 3MHFA 2YDAA 1H61A 1OFBA 2KZHA 4IPIA 1YTKA 3P5YA 3KRZA 3LHTA 5DCBA 3TFCA 2D73A 4LVAA 7TIMA 4A3UA 4N9CA 2H8XA 3OVPA 4PEKA 3CWOX 4JGDA 2A7RA 1TYGA 1O60A 4NJGA 5D03A 4GRSA 1B4EA 3HPXA 5FF0A 3W1AA 3AJXA 3PR2A 1DVJA 1OYCA 4JX6A 4UC5A 1LLWA 3V75A 2ZDRA 3BGJA 4XWUA 4NZJA 2Q8LA 1TJRA 1WX0A 2H8ZA 3DENA 4IMDA 3CC1A 1P1XA 5EPDA 5K7JA 4O11A 4MYAA 3UXDA 1TPC1 3P60A 4RZ6A 4WOQA 2GVJA 4FX6M 4JTLA 3QZEA 3B0VC 4JICA 4MY9A 4NX5A 4UMCA 1ZENA 3PY2A 4AXKA 3W74A 1SO3A 1K03A 4JTSA 1R30A 1FWRA 4NZFA 4LRTA 4XTIA 3NO5A 1D3GA 3STCA 4JIQA 3HOJA 3QPZA 1A53A 4IOTA 1KM0A 2AGKA 3DFTA 4Q32A 5HWMA 2R8WA 4ORMA 1Z44A 4MUZA 2JGYA 1YXDA 4LVFA 3PB2A 1O5XA 4IMEA 3CHVA 1B3OA 3DFNA 4K7YA 2NUXA 3W23A 3C56A 1RQEA 1ZAHA 3EXSA 4GUGA 3MMTA 2WOQA 1VGAA 1T8XA 1N7KA 3C2RA 2V5BA 1Q6LA 3LCFA 2PURA 4BR1A 2PRLA 1DHPA 4JN6A 4K8HA 4Z1DA 5CGQA 5H2ZA 1TPH1 1YDNA 3LI1A 4DO6A 1G4TA 4EOUA 3W87A 1PCWA 3DKJA 4CCEA 1ZJIA 3UZ5A 4UFIA 2EPHA 5DCDA 3W76A 1ALDA 1OG0A 2NZLA 1O4UA 2YX0A 4FEZA 3ZWSA 4PCFA 2YCEA 2Z2UA 1XKYA 1CI1A 2QUUA 3GB6A 4GFSA 1TPB1 1TJPA 4A22A 1DV7A 4O4WA 4M6QA 3LHUA 4M7SA 2GQAA 3IIPA 1TV5A 3L21A 2B7NA 3EWZA 1L6SA 4Q33A 3GKAA 1AMKA 1G6CA 3LCWA 1KLZA 1F7BA 3C3NA 5FF3A 4JTFA 1LZOA 1J2WA 2NUYA 1G4PA 1BKSA 3TXZA 2NXGA 1MO0A 3SFKA 3ZR4A 3L67A 1OYBA 5TIMA 3LXAA 5EL1A 1RQHA 2HSAA 3NVTA 4NT0A 3M0ZA 3AO0A 1A5BA 4LWWA 2DJLA 3GDRA 4IX0A 5EKYA 3S5YA 2VELA 3G3MA 3MYPA 3QFEA 3GDKA 1ME7A 3BVJA 4M6PA 3LHZA 3L0KA 3O6YX 3CWNA 4UTTC 3I68A 5F2MA 3M1ZA 3GR7A 2J9ZA 4YXGA 3G8EA 4O1AA 3MP4A 3QQ1A 4S2CA 4HHPA 4UTTA 5LNWA 5LNSA 1KTCA 2Z6JA 3L5LA 5KZDA 4IGHA 2JKEA 1P0NA 2WQPA 2VC6A 1LTDA 3M7WA 3LTSA 4XBSA 1EUAA 1A5AA 2H3DA 4CQ9A 1L6YA 3FJLA 1IXOA 3W7HA 3NQCA 5HMSA 1I2RA 3LRKA 1AW5A 2FLIA 3I65A 3LXBA 5FI8A 1DORA 4NXSA 5A8GA 3LBMA 3CIWA 3PS7A 3QSTA 1FWWA 4FX8A 3W7DA 1JRCA 3NQAA 3QRHA 2I1OA 5D02A 1DOSA 4Z1BA 4R7JA 2J6XA 3BG5A 3PUEA 1WDWA 3ABQA 1CX9A 3TC7A 5E1QA 3L2IA 3W1XA 1WBHA 2CZ5A 1RPXA 3T44A 1W31A 4LTSA 5KINA 3O07A 4GUJA 2NX3A 2BLEA 4O18A 5DN1A 3N14A 4PL1A 3N73A 2QCFA 2H6RA 3WJYA 3TMQA 3UQNA 3STEA 3PG9A 3PBUA 4NNCA 5AHMA 3S5ZA 1YLVA 1SUXA 2ZTJA 4FIQA 2WKJA 2P10A 5EY5A 4AVFA 3Q58A 3TFXA 4MZ8A 3F4WA 2FJKA 4IQLA 4GUIA 4A21A 2HS6A 4JXCA 4UFHA 4RK8A 1LBFA 4H3DA 3M5XA 1NFBA 1KTBA 4R34A 1H63A 4UXDA 4X9SA 1ICSA 2W0UA 2ZRYA 2BX7A 3G1AA 4WXZA 5AC8A 5BRBA 4RZ5A 1A50A 4Q4KA 1KM6A 5KZEA 3HPZA 1LRTA 4YLWA 2JKAA 1FDJA 5EA9A 3P62A 4JTGA 5AN7A 4W9TA 3HIJA 3TR2A 3THAA 3N19B 2XN2A 1I45A 3DU0A 2BZNA 4FIRA 3B0PA 3FKRA 2V2CA 2ZRVA 1SQ7A 5DY2A 3OA3A 2J27A 2ZA1A 2GQ8A 2GPTA 2YXGA 5FEXA 4J9JA 4Z08A 1JQVA 1SW7A 4O1CA 4YL2A 1HO4A 1EX5A 3HG5A 3W2LA 3ABOA 5D32A 3EX4A 4Z1AA 5HJLA 3W9ZA 3EB2A 3PVFA 2GOUA 4UR8A 5DBUA 4O16A 3SZ8A 3RLVA 5BMXA 3NPVA 2DU2A 3B8DA 4N9EA 3B03A 3CTLA 4OE7A 4PFMA 5BNKA 1TTQA 3G22A 4QNEA 1GPWA 5E93A 3PM6A 4JY9A 4O1DA 1VLWA 1WQ5A 2CLHA 4NNBA 3GXTA 3M16A 2ZQ0A 2ZZ6A 3D0CA 5FF2A 3MBDA 3DGRA 4GWEA 4JNMA 5IBXC 3G1YA 1TTPA 5AC7A 5G4WA 4OHQA 4YCOA 1H60A 4IX2A 3OHIA 1KM2A 1ZY9A 2ISWA 4MVAA 1OX5A 2EHHA 4ZQCA 2HMCA 1F6PA 1TRIA 3TJLA 2B7OA 1KFBA 5DLCA 2Y7DA 1JUBA 4JDYA 1GVRA 1EP1A 3ANYA 1VZWA 4PL2A 5CZSA 3NPXA 2NUWA 1OVDA 1VYSX 3HG4A 3VKJA 4QSHA 3G0XA 4K6AA 3GDMA 1KFJA 1LM1A 1TRDA 1JCMP 1P5BA 4AF0B 4ICNA 2B7PA 4PODA 3G1XA 3LLFA 3NPUA 3R8RA 2G96A 4C1KA 8TIMA 4CQ8A 1THFD 1Q6OA 5I3FA 4JTJA 2A21A 2A7PA 2CZFA 2ISSA 1OF6A 3MI6A 1CW2A 4G1KA 2WJZA 4GUHA 3EKLA 2QR6A 3UYCA 3CIXA 3S5OA 1UCWA 3M5YA 1O95A 5C5YA 2XN1A 1EIXA 1NSJA 4ALDA 1I2PA 1H7PA 2JKPA 1ZFJA 1ONRA 4HIBA 3G8RA 4DF1A 2X1SA 1D3HA 4DF2A 1PHWA 1PS9A 1ME9A 1W5MA 2E68A 3N34A 4N9DA 2VFIA 1ICPA 2YSWA 3A5VA 2DZSA 3HJZA 3PBVA 1OK6A 2CLIA 3L0NA 4ADSA 1WYIA 2Z6IA 4ZQRA 3RFAA 3B4UA 3WK0A 1TPDA 1JJKA 1H7OA 3DFQA 2WNZA 4Z1CA 1VS1A 2ZRZA 3QMRA 5H91A 5D38A 3SR7A 3W1MA 4XKYB 1EB3A 1DBTA 1XFBA 4MZYA 2QCCA 1VPXA 4ADTA 4WD0A 1F05A 5D2TA 1UBSA 2DJXA 3P82A 4FHAA 1H5YA 1XCFA 1XUUA 2Q8ZA 4UCGA 1WV2A 4IXXA 4X2RA 3JR2A 1S5TA 1JRBA 5CPMA 1JCJA 1MXSA 2I9EA 3NQDA 1G4SA 1WXJA 3TAKA 4TX9A 2V82A 4OV4A 2ZZ5A 3NNTA 3W75A 3UY7A 1OYAA 1QNVA 5DELA 2YW4A 2CLFA 1FCBA 2G95A 2GJLA 4O8RA 5L6UA 3N9SA 3THQA 1LRNA 1JCNA 5LKYA 3KOFA 3C4UA 1R2TA 5D05A 1QO2A 1HUVA 4LVBA 4PTNA 4DPQA 2B7QA 2V2HA 4UFMA 4O12A 4IMCA 3EWXA 3W7IA 2RDTA 3U6WA 1JUKA 1KM1A 3P8JA 1W8SA 3TC6A 5CPNA 4R53A 2VEIA 4ORIA 4UTLA 2CU0A 3M41A 1YXYA 1TTJA 4NJKA 4POCA 2A0NA 3W7MA 1H1YA 2YR1A 1AL8A 1TIMA 1MZHA 1T96A 2I14A 4UUIA 4AWTA 1R46A 2OT1A 2V8ZA 2C19A 3NQMA 4XZ9A 2QDGA 4IXHA 4O0ZA 3P84A
chains in the Genus database with same CATH superfamily
5CPQA 2VOTA 3AS0A 3CZGA 3TWBA 3DFSA 7A3HA 3BV7A 4GIRA 2RH9A 1XS2A 4W4QA 3KVKA 4NG3A 1O1HA 4TTGA 5HNUA 4F3HA 1J93A 4TIMA 3H8AA 3PNZA 5LNUA 5LGZA 1AW2A 4GE8A 3F1QA 4JQ1A 3PG8A 1DJXA 1M7JA 4LU0A 3A21A 3DHFA 3MZNA 4HA4A 2VZSA 3IUDA 4K1WA 3V7PA 5M17A 4RCXA 1QNSA 3EGJA 3MCNA 2D3LA 2VCAA 1TWZA 4Q8WA 2ALDA 4O52A 3GBEA 5JQ9A 1BWKA 5HK4A 3SJ3A 2ZC8A 5F2IA 5F4XA 2NT0A 4V28A 4S3CA 3CL7A 2Z1XA 5JU6A 1KR1A 4AIEA 1K3UA 1NFGA 2PDUA 3O3RA 4MLJA 1TREA 1W9XA 4IL2A 3A4JA 4FF7A 1PTAA 1CXIA 3S1VA 2Y7GA 1E0UA 3W70A 4HHMA 3WD1A 1R9YA 1D3CA 1TVNA 2I5IA 4NAFB 3S1WA 2HE5A 4H7ZA 3P14A 5T8GA 4IGNA 5C9WA 3VUPA 4YU1A 3S9ZA 1QOQA 4QNWA 5K3VA 2H3BA 3S1UA 4NU7A 3S2JA 5AHEA 4KBXA 5HOSA 3FX4A 4DO4A 3GK0A 5I5RA 2OZTA 1H1ZA 1IEVA 2ATSA 4L4MA 5J5DA 5J8LA 4B4HA 4QEEA 2BXVA 3GDTA 4GGBA 2DVTA 1JDAA 3LZ5A 4AF0A 3BAWA 5CC7A 2Z00A 1R3VA 5G2WA 5BMWA 4IJBA 1UR8A 3ALFA 1K8ZA 1I4NA 3RMJA 4IT1A 4O1EA 1RV8A 6PTDA 4G7FA 3VD4A 4K38A 4LC8A 5K9CA 1LT7A 3BJSA 3PPHA 3LGEA 3DXIA 2PD5A 1PWLA 4HPXA 4KH2A 1LOLA 1EO7A 3PUDA 3E6EA 1QPNA 4L6HA 1W3LA 3VNJA 2ZE3A 3DFOA 1EHAA 3R4IA 3T4CA 3Q45A 1U33A 2D22A 4PUMA 1S5MA 2FQIA 3CUJA 4JKLA 2G50A 3W25A 5CAKA 1QVBA 1M53A 4LH8A 1VIWA 1Q4NX 1PAMA 3C5QA 4DI9A 3JZEA 3IPWA 1ML1A 4KERA 1S5VA 1TCDA 4RV8A 1OZMA 4W7VA 3WDJA 4O28A 1E6XM 2CLPA 2VQUA 3IGUA 4XKYA 1GWJA 3PNUA 5E6ZA 3SADA 3I4KA 3W7NA 3W82A 1TJ0A 3UA4A 5H8UA 2PBGA 5DXXA 1UR3M 2F6XA 2IS7A 2Y5SA 3BTNA 4UOQA 4GXMA 3RLGA 3N2BA 3VCRA 2ZBTA 5LA2A 1S2UA 4KGJA 1EP3A 2VMFA 1A47A 3QV6A 1TWDA 5T9CE 3GTFA 1F07A 4FNTA 1RY0A 3AS2A 1M6JA 3WJSA 3EMCA 1RD5A 4AB4A 3QW3A 2BVDA 2OLSA 4MY8A 1TB3A 1U5VA 2RGLA 1FH7A 2PZNA 3N25A 1GZ1A 1ZB5A 4FI4A 1QOXA 3CT7A 3UR2A 4M6VA 4ZQOA 1C7TA 4I7VA 3N11A 3O06A 2WYSA 3K4AA 3N3TA 2EJAA 1M7PA 3PBYA 2P53A 1PZ0A 1UR0A 3M6DA 3GC2A 2QF7A 4HMEA 1QJWA 2GSEA 4UTWC 3CV6A 5KTLA 3ITOA 4ZR8A 3KVJA 3N6QA 4LUTB 4X3ZA 2BFGA 3G1SA 4NRSA 5M2FX 3A23A 1E72M 3V3WA 3EAUA 1OX4B 2OFJA 1TWIA 3DGBA 1W56A 1HKJA 1GT8A 1WE5A 4J2PA 2D20A 1ZJHA 4ZQPA 5A6AA 3AXMA 3KBNA 1CGVA 4HN8A 4Z1YA 1IEIA 5AZ0A 5A69A 4ERAA 4IG2B 4BHYA 3WLTA 4QHRA 4N4PA 1EC8A 3GE7A 1HJSA 1QNOA 1M1BA 1W8GA 1XPGA 3K8MA 1IR2A 2PS2A 5IBXA 1ZJAA 4LJ3A 1AJ0A 3R10A 5LYRA 4JN7A 3UVAA 5LIUX 3QW4B 1CPUA 1H11A 4BI5A 3LU2A 4DRSA 3NZRA 2VGGA 2GDUA 1TV2A 2PODA 4TVCA 5JBDA 2P8CA 1QPOA 1KKRA 2CKRA 3KDNA 2OVLA 3WD2A 3W1QA 4W8LA 2HEJA 4H8UA 2BP1A 4C6EA 3ARXA 3BZGA 3P61A 3NAVA 3FY1A 3O1NA 3WH7A 4XZHA 3P0XA 3HB9A 2XHYA 3A5FA 2Z27A 3SCVA 4GKLA 4Y90A 4Z17A 3BLFA 1UKTA 3IEBA 1WBJA 4C1LA 2A6LA 2C0HA 3N6HA 1WOBA 3CUHA 4NAEB 2H9AA 3QEZA 1VJIA 3W1TA 1GTEA 4MLRA 3D3FA 3G1HA 4WQ6A 2XIMA 3PZQA 4GPNA 2WPGA 2VR5A 3OVGA 2J24A 2GVLA 3T9PA 4C6BA 2TODA 4WKAA 3HGOA 3NOYA 3O63A 3EX2A 3MQTA 5XINA 4UZSA 4Y8FA 5ABHA 1XDMA 1MXDA 4W93A 1OCNA 2X1IA 4YNGA 4XD4A 1ECQA 2GJXA 1UH2A 5IHSA 3RO8A 3M44A 3GM8A 2YDSA 4AWUA 2VVSA 3S9IA 1XYMA 3DG7A 1L9WA 3ABRA 1UJPA 4IPNB 2ZX8A 3SW6A 3BV4A 2YCLA 4MB3A 2F61A 2Y61A 3N1AA 3ZVIA 2XFFA 3WLPA 1JYXA 5KZ6A 1ZHAA 1EA0A 4HK6A 1U5HA 1J0HA 1E9ZB 2ZWYA 2GDVA 5C9XA 3V1HA 1GVIA 4XZIA 3TYDA 3H70A 3P67A 3T2QA 3NO3A 4GZ7A 1K8XA 4AC1X 3BQ5A 3A9BA 3C0JA 3LGGA 1HL2A 1QOPA 3SY5A 2A1YA 1OIFA 1VC4A 1P0BA 1Q5MA 2XISA 1FDZA 5FCZA 1Q6RA 1BVZA 1OY0A 3OZPA 2J13A 3KM8A 3AUJA 2RFGA 4LEFA 4KWUA 1FCVA 4R85A 3E38A 3IIZA 2QUNA 5AYYA 1FP8A 3W7OA 4PUJA 2J7EA 4GHRA 3VD3A 3AYSA 2Y89A 4FNUA 5C2XA 1FWBC 4KS0A 1VBUA 3MBFA 1MSSA 1UQZA 4M82A 2PWUA 4CD8A 4OOZA 1F6KA 4XAPA 3W7QA 4C90A 1J96A 4L1XA 5ABFB 1VBRA 5D9OA 4JTDA 3VDCA 1W5QA 3I3DA 1PKLA 3PUOA 2FPVA 1TMHA 1MI3A 2P5NA 1BPLB 2EJ1A 4YYFA 3L5MA 2A7NA 4PMQA 1UUOA 2JF6A 1NTHA 3TMLA 5DANA 3UZXA 1GOQA 1VYRA 1JCXA 1TWWA 1OHLA 3UY8A 3MZ2A 4O15A 1REQA 4BK9A 4ZTXA 3JS3A 4Z0SA 1BSLA 1C8XA 2QCHA 3GD6A 5K9XA 5KEZA 1Q13A 2ALRA 1G69A 4NF7A 4KPLA 5I3GA 3E0FA 1XSIA 1IZKA 2UWFA 3GG8A 3WD0A 5FL1A 1PCKA 3FJNA 3NZGA 4H8HA 3EXRA 2MNRA 1P0EA 5FESA 2X0YA 3YPIA 4ZOCA 4W87A 2CNCA 1UZ4A 3C8FA 3VKAA 4BJHA 5DMLA 3A64A 2XU2A 1LL7A 2PD9A 3VIGA 3CHCA 4JZ5A 2ZX9A 5C6MA 3VIFA 3T6CA 1OFOA 4Q4QA 2WZEA 1AW1A 3IACA 3BW3A 4WKFA 1VEPA 4C7FA 4JR5A 4IQEA 1K8CA 3WG6A 3VIJA 5E09A 2G3IA 4R3UA 4ZE4A 2PTXA 4QJ1A 3DFYA 4E4FA 1BEUA 1J0JA 5CC3A 1HJVA 2P50A 3KZSA 4GC4A 1X7IA 2OX1A 2J88A 4M1RA 1JCYA 3PPGA 3SO7A 2TAAA 3TDFA 3NZ1A 5FJRA 3GC4A 3CU2A 1Z41A 2DQWA 1CDGA 3WENA 3AJ7A 3C2YA 3SDOA 1UG6A 3CEPA 1IT0A 1X97A 3XINA 4E0CA 2FVLA 1FWTA 5DMNA 3S42A 1Q2RA 1DXIA 3DZ1A 3CV1A 3UFYA 1JULA 4PTVA 1QFEA 4QG6A 3BLEA 2ZOXA 4GXPA 3BAIA 4HT3A 1MVYA 1XRSA 3B9OA 2CHOA 3O15A 3EPOA 2J66A 4UFLA 3GUWA 4JN8A 3BQ6A 3F5KA 3WBYA 4PR4A 2GDQA 2CZEA 2IKIA 1S3TC 4FNQA 3R2GA 5CSRA 1J4EA 3EWCA 4IMFA 3QQ0A 3N17A 4IP5A 3VX1A 3VZYA 3AYTA 1TA3B 1D9EA 3SQLA 1XBXA 2FDSA 1NU5A 5AVNA 3EXTA 4QG8A 2NWRA 1SZRA 3ITLA 3ARYA 4MKNA 1TR1A 1HKIA 1KM4A 4M7TA 2F6KA 1E1EA 3FIGA 4GUFA 3EDJA 1ZUAX 3GU2A 3JW7A 4RJEA 3OJGA 3V4BA 3VIHA 3WK1A 1HJWA 2AQWA 4JIIX 1TSIA 1XIBA 3TYAA 2R1KA 3T1GA 3D6NA 1DYSA 6ENLA 5BCAA 3ORWA 1W0MA 2XVGA 4HVXA 5CZ0A 4IWWA 2PLMA 1CXHA 2XVLA 3BL3A 1LQ2A 2DZAA 2AL1A 4GKTA 4GI9A 3KWSA 2B0MA 1KW1A 3GHUA 1T99A 1LDCA 2F84A 4FAMA 1E55A 4N2YA 5MKGB 4UR9A 1ITQA 3WK2A 2XSXA 3NQ2A 3ZOAA 1RH9A 4FNRA 2ZTKA 5HMDA 4LVGA 3HQPA 1XL9A 1JR1A 1YTEA 2NVDA 4RE2A 3AYVA 1VKFA 3IVTA 2D69A 3ZWTA 3RM9A 3AFBA 3RN6A 4A29A 1OC7A 1T41A 3DIPA 4AIOA 1NOWA 1EOKA 3M0HA 3HG2A 3ID7A 4HK7A 1Y8BA 1A5CA 3RPDA 3CUZA 2PA6A 4YN5A 2OWWA 3WF1A 4X61A 4JTAA 3LD5A 4GMEA 3LNPA 5AHLA 1S1RA 4GX8A 3PB0A 2QW5A 1PIIA 2Z0IA 2F6UA 4HSNA 3RCNA 3KBVA 3W29A 3MTWA 4GJIA 2Z25A 4FLRA 1LJYA 4H9XA 3S2MA 3M47A 3URAA 3BLKA 3HF3A 6REQB 4D2JA 4QX4A 4IQDA 3P6LA 1XLDA 2X09A 1SMDA 3LHWA 4YTTA 2CETA 1UWRA 3IGXA 4U31A 2O4MA 3D5HA 3L23A 3MJYA 4JTKA 4CNSA 5RUBA 4PCPA 2VX4A 5A6TC 4GC3A 2ZZ2A 2QAFA 1EZ2A 2KAUC 2YJQA 2E25A 3A3WA 3NZPA 2VGFA 2J7DA 3P93A 2XSBA 3G1FA 2QIWA 3HV8A 3LCIA 4PSRA 1WKDA 3P5ZA 1MFVA 1AZ1A 3SM0A 1QT1A 2YA2A 4F0HA 1PSCA 1VJZA 3PWIA 2VD9A 4IUGA 1U22A 4OKDA 4GNKB 4W5UA 1TO3A 3W07A 4HQVA 2X8RA 3WBWA 2C13A 3UBPC 1BYCA 4FLOA 1SM9A 5I3JA 3KBMA 3I6RA 4E8GA 1GOXA 2E77A 2V5DA 4XSLA 5HQEA 4PMNA 2ZDSA 2J79A 1OT1A 3OEXA 4GJJA 1JF6A 1VCVA 3ABXA 1E51A 2R82A 3I7SA 4KKXA 2R1LA 3LCXA 4WIWA 3GH7A 2L5HA 1POJA 1VRDA 2G97A 4M0XA 2XZ7A 2DFAA 5A6JA 3S2CA 5GNXA 3E74A 1PX4A 2INFA 1I9CB 3UXIA 2WC7A 5LIYX 1EXPA 4RNIA 4GI6A 3NO1A 3BMXA 3EWWA 1LBMA 3T40A 1UWIA 3KS5A 1KR0A 5BZAA 3GIQA 2YZRA 4CNUA 3EDEA 2ODOA 4HTBA 4L4PA 2WHJA 1VFMA 3WUGA 1PHQA 4H6RA 3VKDA 1EDQA 3M5VA 1RUSA 1ZTVA 2J7HA 4KFPA 5C7HA 4Q8NA 4XO6A 2R14A 2FZNA 2YCIX 3VK5A 4PMJA 3TSBA 1QI4A 2O7QA 1N8FA 4JFUA 2XJ7A 3QPEA 5D04C 5BW6A 5K9DA 1U83A 1JD9A 2MUCA 3GQYA 4DZ5A 4H9ZA 2PWHA 2D1ZA 4QJ5B 4NZ5A 3K4WA 4RL3A 2RJHA 5FJJA 2EF9A 3PBWA 4B16A 1VQTA 3F2CA 3PULA 3QXBA 3W7RA 2J75A 4F66A 5C2GA 5EU9A 2QJGA 1E71M 3IRDA 4FXRA 1UR9A 2BY2A 4JEQA 1I2QA 3WH8A 3TQ0A 3PFRA 1W3IA 2WKLA 3QKZA 4D71A 3URQA 4F0LA 3O0KA 2ZRWA 4JIEA 4DJDC 2AMXA 4JHZA 2E09A 3TAOA 2PPGA 4AIUA 4MADA 2CW6A 9XIMA 2DZBA 4PB5A 2BGSA 1GQJA 5FAJA 4B5VA 1JGMA 1ZCCA 1C3FA 1IWBA 3TJXA 4XZWA 2OU4A 5C9ZA 3TTQA 2Y1HA 1W3NA 1JDEA 1HO1A 1XDLA 2QCLA 2YDAA 3MHFA 4W7WA 3UR8A 4C6NA 1OFBA 3L4TA 3S46A 1O6IA 4DJDD 4N9CA 4KEZA 1UOZA 3U7VA 1HVXA 4IICA 1XGEA 3ZYZA 5D03A 4IIDA 1H0IA 1HP4A 4JEJA 5FF0A 2PUZA 4XWUA 3TN4A 3AAMA 1J2BA 3DENA 4IMDA 2V63A 5K7JA 2XWDA 5I09A 3AHZA 1MYRA 2PTZA 3PTMA 2WW5A 4FX6M 3D3AA 3DERA 4JTLA 3QZEA 5HA7A 3H2OA 4JICA 4GA8A 4UMCA 1BAGA 1RA0A 2DPEA 4AXKA 4IPPA 1TZ7A 2PDHA 4IISA 4XTIA 3NO5A 3VAVA 4JIQA 1T8QA 1A53A 1UWQA 4HA3A 1B3ZA 1UKSA 4IOTA 1DJGA 4MUZA 4C7DA 4IMEA 3CHVA 1GPFA 4IG2A 1G94A 4K7YA 3NZQA 1ZAHA 3EXSA 3VMNA 1GYMA 1VGAA 1PTGA 1T8XA 4PZVA 3OIHA 2PRLA 1JZ3A 4JN6A 4K8HA 3SUSA 1TPH1 2PTYA 4EOUA 1BYAA 3DKJA 1ZJIA 1X6NA 3SY8A 4JKMA 2VGIA 5FJUA 1O4UA 2YX0A 2HPIA 3SCSA 2W91A 3UVIA 2YCEA 2V5CA 1HKWA 2GGJA 3APYA 3HJEA 4GFSA 2HWGA 4H9TA 1TJPA 4CEUC 1DV7A 1QBBA 5IRPA 3QY6A 1J9YA 3LHUA 4M3PA 1L6SA 2Z24A 2ZUTA 4Q33A 2MANA 3GXDA 2VDGA 1KNWA 1M01A 4R7WA 2W63A 5TIMA 3NVTA 2VC7A 2DJLA 4IX0A 3KW3A 1E1FA 2E1WA 3S5YA 2VELA 3G3MA 4E3VA 1QASA 3MYPA 2C91A 3CZJA 3L0KA 1LL4A 5FSDC 2J9ZA 3BOXA 1YW1A 1UWUA 3MP4A 2W92A 2GJRA 4JL1A 3N12A 4LUYA 3TTSA 1S1PA 3LPFA 2VZOA 1P0NA 1XCWA 1WZAA 4KESA 3W28A 1A5AA 1L6YA 4WSJA 1FWGC 4PBGA 1IXOA 3NQCA 3R94A 1I2RA 3I65A 3LXBA 2Q8XA 1UC4A 3VCCA 3IAPA 2UY5A 5FI8A 3LBMA 1AQMA 3QSTA 1E6PA 4LB4A 1DWIM 4FX8A 3W7DA 1VIZA 3VKCA 3KTSA 3WH5A 2I1OA 5D02A 1NDVA 4IFRA 3ZLHA 4Z1BA 1UIPA 2QVHA 1N8IA 4W8BA 3NIYA 3T44A 1UPPA 1V08A 2NX3A 2REQA 3PZTA 3N14A 3N73A 4C1NB 3UR7A 4J3SA 3WJYA 3TMQA 3UQNA 1FWHC 4WVXA 2XH4A 3VYLA 5AHMA 3VU2A 1V6WA 1YLVA 5IFPA 3DOPA 2WKJA 3GU9A 5HJXA 4AVFA 5C70A 2OGJA 2OB3A 4CD7A 2HBXA 4Q6XA 1ENUA 1CGYA 2FJKA 2GLKA 4MAZA 4JXCA 4RW5A 3LMZA 1R8LA 1KTBA 2ISFA 3CB3A 1GOOA 4H8NA 2W0UA 3O7UA 4QCEA 2BX7A 5BRBA 1LQ0A 3VOHA 4JKKA 4GK8A 3VKKA 4XISA 3B0XA 5KZEA 4YLWA 2JKAA 3LBOA 1P0DA 3KP0A 1PIFA 3SUTA 3PN8A 1RK5A 2DSVA 5HPCA 4XB3A 2XN2A 4C6QA 2ZRVA 1V7AA 5DY2A 3OA3A 2J27A 4D6GA 4HYWA 2GPTA 5FEXA 4J9JA 2EPKX 4F8XA 3W2LA 5TF0A 1X96A 4Z1AA 4UBPC 3W9ZA 2OKTA 1TFVA 2GOUA 2WCSA 3AHTA 4UR8A 3WN6A 3C3UA 3NPVA 1B2YA 2OPJA 4N9EA 2PGRA 3H4GA 3VDHA 4CEXC 1TTQA 3HM7A 5E93A 3VOIA 3PM6A 4O1DA 1VLWA 1WQ5A 2QYGA 4NNBA 3GXTA 4MMWA 2ZQ0A 2DT3A 3QYSA 1UD8A 1KCLA 3M0IA 4CD6A 3G1YA 5I6SA 1ZY9A 1A5UA 4QROA 1JPMA 3LQGA 3V0UA 1E6ZA 3WNLA 1QBAA 1VFTA 1Q6CA 2ZUSA 4ZQCA 4MPKA 1F6PA 4AZGA 2FZDA 3CAVA 4ZODA 4IGSA 3TJLA 2B7OA 4NZ4A 1OADA 4LAOA 4ZO9A 1LWIA 2Y7DA 2PP1A 1E4LA 1XH1A 3ANYA 4IFOA 2HNHA 5CZSA 2NUWA 2J8GA 3B40A 1KFJA 1LM1A 3E0LA 3FNDA 1JCMP 1P5BA 1VFLA 3H2FA 4ICNA 2B7PA 4PODA 3TOPA 2ZICA 5H8MA 3GNPA 2YDQA 2BHZA 4DWDA 4ZB0A 2RDXA 4JTJA 2A21A 3H7UA 3GUGA 2ISSA 1OF6A 3MI6A 4G1KA 3EKLA 2P3EA 2Y2WA 3GY1A 1CZ1A 3S5OA 1UCWA 2OLHA 1EIXA 1GZJA 1I2PA 4L65A 3QLDA 3LGDA 2NQJA 3G8RA 3K1DA 4PSPA 3UJRA 4AZCB 4D8ZA 4IPLA 4DUXA 3PJXA 1JXKA 4MNMA 3ITYA 3ITCA 1EEXA 1D3HA 4L7ZA 1C90A 3VD5A 3EB3A 5ENLA 1MNSA 1VEMA 1UA7A 2UY4A 4ZQRA 3TCSA 1PJ9A 1H09A 1MUMA 1KC7A 3EOLA 4JPGA 2G37A 3W1MA 2EQDA 4PFHA 1DBTA 1XFBA 4BF5A 5I77A 3QV7A 2RGMA 3VINA 9CGTA 2BHYA 3BMVA 4ADTA 4WD0A 1F05A 5D2TA 4AY7A 2YLLA 2A3CA 4FHAA 1H5YA 4UCGA 2Q8ZA 1WV2A 1A80A 1TJ1A 1XKJA 1OG6A 4REQB 1GOIA 1BGGA 1K77A 2FVMA 1S5TA 5CPMA 1JCJA 4US5A 4AZ6A 1CT5A 4JFTA 2CBJA 3OTRA 4G7EB 3EOOA 3HV9A 4OV4A 2I9UA 1OYAA 3VXGA 3WQEA 3A47A 3FAXA 2HRWA 2GJLA 1RCQA 2WMIB 1GOWA 1LRNA 1E43A 3KOFA 2A3AA 4NRRA 1LG2A 1QO2A 1HUVA 1XGDA 4F4RA 3AIWA 1TA3A 3CYVA 4US5D 1XHGA 1XIIA 4UFMA 3QR3A 4TX6A 4IMCA 3KEHA 3U6WA 5M3WA 1JUKA 1UR1A 1MRAA 1KM1A 3QY7A 4FSAA 1HJQA 2GWNA 9RUBA 1WZKA 3IK4A 1CYGA 2QULA 1OGSA 1UP0A 1WUFA 2YR1A 1TIMA 2I14A 4UUIA 4AWTA 4C6JA 3GVVA 2VX5A 3UESA 3NQMA 3P84A 5HPOA 4GH1A 4N9BA 1XRTA 1KRAC 4BQ4A 2XYLA 4CQAA 1OFQA 2V68A 5CH9A 1W1IE 4AW7A 4D8AA 3BANA 2NXIA 1PKYA 4B5WA 3DBNA 1H50A 1B3XA 1BFNA 3APGA 4RE4A 2W79A 5EMMA 1UROA 3LHVA 4GY1A 1QK2A 4QDMA 3SN0A 3ZJKA 1C29A 2WSYA 4RZ4A 1QWKA 1DJWA 4C6PA 8XIMA 3L2LA 2O0TA 2O9RA 5LA1A 5AKQA 4U2ZA 2YIHA 4XK2A 3LM3A 1EF3A 3LB0A 1JNEA 3LLDA 4WOZA 5D2WA 1GJUA 4TX8A 1ZS2A 1W1TA 3FSTA 1F3EA 4DUOA 1YHTA 2DW7A 3MJMA 3UWUA 4HTYA 3UYIA 5HAOA 4IP4A 2FB3A 3OGSA 1O66A 4UZUA 2DZUA 1R5YA 3L9CA 3STGA 3OVQA 3WO8A 3CHEA 4NJJA 1Z8AA 1A5LC 2YL6A 2OJPA 2DP3A 2WVVB 3OQEA 4AX7A 2WVSA 3ECQA 2C0AA 2OZ3A 4FOKA 1MEIA 2YBUA 1H0GA 3OBKA 5PTDA 1Z3NA 2BDQA 1G7UA 3XISA 3LZ3A 1DPMA 4GBDA 2CLMA 4W84A 1IIGA 5AOUA 1XLFA 1GYNA 1UWAA 5CBBA 4BQ5A 2J78A 3G6MA 3FGCA 4E2BA 3WDIA 4YTQA 3WQPA 3R11A 2WNWA 3GXFA 3E0IA 5DMMA 3G1DA 2INZA 1XJBA 4ILSA 3HQ1A 3G3DA 4WHBA 5C54A 3LS9A 1KA9F 4MWAB 1ICQA 3C8NA 1LROA 2QMJA 4RKAA 4UCFA 1GQIA 4CNPA 1IXNA 1UA3A 1KO0A 4EWND 1XG4A 2Y8UA 2IKHA 2OGYA 4N02A 3VOJA 4I9AA 1GJWA 2Y8VA 5JVLA 3M43A 2YDRA 1H2JA 4GVGA 1QXLA 1JFXA 4YIWA 1ELSA 3ABSA 1GHRA 4W7UA 3O05A 4DX3A 4HCDA 2VURA 3TR9A 1UJQA 1ZCOA 4HCHA 1C91A 4AD2A 1SW3A 3EX6A 1WAUA 1GOMA 4K37A 1UR4A 3DC8A 4LEQA 1W3HA 3S5SA 1PWMA 4O54A 2WO5A 3ARUA 5D8ZA 1M04A 2V30A 3MB9A 2X16A 1CEOA 4GD0A 1D8WA 3HQOA 1J18A 3IIOA 2O56A 5BRQA 3H4WA 4S2BA 3CV7A 4LSBA 2DIKA 4D6DA 1DWJM 1GYLA 2Q71A 4W86A 5AHNA 3E12A 3W1RA 1XF0A 3IJQA 1A49A 3MPGA 1Q4WA 1SGJA 1CGTA 2ZZ4A 3FYPA 1XISA 4YVXA 1GEQA 1PZ1A 3B8UA 1VFUA 1FWFC 5F1UA 2LLEA 1E6SM 5IDZA 1E4MM 5I78A 1TVLA 3W85A 4AWSA 3UPMA 1R87A 2NLIA 1PYFA 4FALA 2R1NA 3GAKA 4ZMGA 4MFDA 4XQ6A 2VEPA 4Z2LA 1F74A 4B2DA 4BWLC 1QNPA 2PDQA 2CXGA 3OOQA 3T78A 1QHPA 4I9MA 4P7QA 3WD4A 3N18A 1Q6FA 3TH6A 1IQ8A 4BWLA 1NOUA 4FNSA 1X6LA 4NVTA 3LRMA 2Y63A 3CB8A 3U5YA 1KBJA 2PCQA 2DV0A 4TTUA 3WL0A 5LXXA 3NDOA 4B2DD 3WBXA 5C2CA 2WZIA 1QWGA 4UQ9A 1E4NA 1LP6A 3DHDA 4MZ1A 1U5JA 1B4KA 2YLAA 1TV8A 3R0DA 1L2QA 4TVDA 3KVLA 3CHFA 4H41A 4O53A 2QJIA 4MM1A 1C8YA 2D3NA 1RJPA 1EYWA 4WX2A 3KRBA 5AVHA 1UP2A 1E6QM 3BLIA 2CBIA 3C52A 4PRWA 5FACA 3PJTA 3CAQA 4L61A 4H4IA 1YE6A 4BEUA 3EMZA 2Z1WA 1PKNA 1MEHA 1V6TA 5TQLA 2FTWA 1E6NA 3SUUA 1W5OA 2DQXA 2WBGA 3UG8A 4FXJA 1GQLA 3AIEA 2NV1A 2W27A 2BV9A 1GCYA 1UUMA 4LANA 5REQA 4NUWA 2Y70A 3MP5A 1R38A 1KCXA 3FA5A 3ZVHA 2XFRA 4UNKA 4ZO7A 2YBTA 1Q65A 4C60A 1GVEA 4UIOA 3AWOA 4CNOA 4MDOA 3AMGA 4MJZA 4G8TA 3KTXA 4GYKA 2OSWA 1IEXA 3GRIA 4URIA 4MWAE 1BVWA 2HBVA 2E40A 2DGAA 2FH6A 4AQLA 2RDWA 1AMYA 3LI0A 4CLMA 1MUWA 3USBA 3O9NA 1IXPA 2QCGA 3GYEA 1V3IA 4X0NA 1FCUA 2XDFA 3QMSA 1ISWA 3BWWA 1K4GA 3P74A 4LNYA 4HMNA 2QCDB 1E9LA 5I3IA 3L0GA 1QPQA 3VD7A 2F38A 1HKVA 4HU3A 1MZRA 5C0QA 1E3XA 5LXEA 4GOAA 3TNOA 4HBKA 1QO5A 4G9PA 4L4LA 3NEVA 3WBAA 3VKBA 4N6EA 1A5SA 5ECUA 4RDWA 1DJYA 3F5LA 4KEVA 2X1RA 3ATYA 2V2DA 1K1DA 4LW7A 1XC6A 3OHMB 4XKMA 4HNTA 2CESA 2JK2A 2OQLA 4IIFA 2JALA 1KV5A 4IMGA 3TU9A 3GFZA 5D4YA 2VDIA 2HJPA 1US3A 3T42A 3W7KA 1ZU8A 2DVUA 3H24A 4NJIA 2JBMA 4FF5A 1PV8A 1VD6A 3MSRA 4DY1A 1YDOA 4AG0A 1NWTA 1KQYA 4MSSA 5I23A 1FRBA 4GNVA 3ARSA 2CITA 1X38A 3GXNA 3W1NA 2DSKA 2PRHA 2OZ0A 1AD1A 4P8XA 2OWXA 3I7QA 4GIYA 5G5IA 1UYQA 2WC3A 1VBJA 7XIMA 4LT9A 6XIAA 4GG9A 2VQTA 3SUVA 5EYWA 2AKZA 1NP0A 3AMCA 3A12A 4AAJA 5CBJA 1KD0A 1B3VA 3ELFA 4IPJA 4O14A 5LA0A 2OSYA 3WELA 2QMKA 1W9PA 4JTUA 2HK0A 3T0AA 1EPXA 1POKA 5K2ZA 4ZQMA 4PA8A 3QY8A 5BOEA 3VPLA 1OJXA 3UGRA 1QUMA 4QSFA 2XIJA 3TZNA 2EGZA 1V6UA 1FWNA 5CJNA 3P7YA 5GNZA 6TIMA 2BGQA 4NX0A 3VI2A 1TJ2A 1VJSA 3IS4A 5JBFA 3LCGA 5CJMA 3ARTA 1E15A 4WY0A 4A3HA 3UZJA 2R94A 4PYSA 3RDKA 3GTXA 1GQNA 3TTOA 4Q8TA 4I7WA 4BF9A 1XWYA 3KDOA 5DT7A 1HL9A 1DQWA 3CMFA 5G4HC 3WNPA 3HGJA 1E1CA 1LG1A 2WMFA 1X6UA 2E5DA 1R3TA 3H2EA 3W3OA 3L5AA 1HN1A 1RBAA 3NQGA 4Q4MA 4Q7BA 1RVGA 1XLHA 4JYFA 3UEQA 1TV7A 4UTFA 2BS9A 5HINA 1J0ZA 1SFJA 3BMWA 4AY1A 1CWYA 2Z26A 1N2VA 4GJ1A 3IVUA 2PWFA 2C6QA 3V18A 3REQA 1TUXA 4ZSUA 3KOZA 4UTJA 3HPFA 5HBFA 3GNDA 2QUVA 1XIFA 5D30A 1MEWA 3QQWA 4H6KA 3WLKX 4XZMX 2G3MA 2W61A 4YWSA 4F40A 4EVZA 4EXBA 3LNMA 4LVDA 1JYNA 1W5PA 4A4AA 4ML9A 1KGWA 3TONA 2YPIA 3WLMA 2PC8A 1JDCA 3AROA 3UXLA 5EMUA 3VDAA 3GXPA 2E7FA 4EIVA 1I6NA 1EDGA 1CENA 2HVOA 4LUSA 3UXAA 1TV3A 4ASTA 3RU8X 1BYBA 5C8BB 1TELA 4O1FA 1FFQA 1G4EA 3MWCA 4JDBA 1R7OA 4ADUA 4KCTA 2JGQA 2BY0A 1EC7A 3VNMA 3S6DA 4MFEA 3WDPP 4G6CA 4I3GA 2NWSA 1ZPTA 3LOTA 4PH6A 4KFNA 3NDZA 5F7UA 2I16A 1F3WA 4QM1A 4EPEC 4LAUA 4J40A 4EANA 1M41A 2FIQA 1GVQA 4IIGA 4A2RA 2NVCA 2WHMA 3FJ4A 1SO5A 3UWZA 5A8NA 1WDPA 3UWQA 1FWEC 5CPLA 5C7VA 2CC0A 5DCEA 3BCJA 3W02A 2E8YA 3AMLA 2I17A 5HWNA 3AS3A 1ZJBA 1AVAA 1V0MA 5B7YA 2Q6ZA 4PUKA 1BGAA 3AXKA 3M7SA 2FMNA 3QZ6A 2FYMA 4XV0A 1TE6A 5EGRA 1M3UA 2F2HA 1DWFM 4CQCA 1JZ7A 1EFZA 3KE0A 2ACRA 2BY3A 5A6LA 1BXNA 3BARA 1QI3A 3HBLA 4WSHA 3T0BA 3U2OA 1QW8A 4KETA 2J9XA 2PU1A 2O7SA 5A8PA 3ZSSA 2E1DA 4JS3A 3TQPA 2BXZA 1AK5A 1GKRA 2QGHA 3GXMA 1QAPA 1ZQ5A 3NM1A 3MVIA 1OFPA 3EX3A 3CZEA 3RR4A 1EA9C 4UMBA 2QDHA 2E28A 3GAYA 2NV9A 4HYRA 3W7PA 4KEUA 3TN3A 3CYJA 4JTRA 3UCQA 1AG1O 1P7TB 1EIBA 1D8CA 4P8VA 4DO7A 1H1NA 1HTIA 1DIKA 2VHLA 1LLZA 4OOUA 5D33A 1RR2A 2NX9A 2DZTA 3DAQA 3W1PA 2DZVA 2ZCGA 1M7OA 2WV8A 4LV9A 2BY1A 3VMPA 4UTUA 4JQ4A 3B0YA 3M6YA 4KWWA 1ZALA 3W2MA 3TE9A 3QPYA 3OW1A 3S1XA 1XYLA 1XRFA 2Q3OA 1V51A 5D2XA 3V0SA 4JTTA 3P2VA 3CH9A 4WGHA 3V5OA 3SBFA 3MYOA 3ZT5A 3N3MA 2GGHA 2XWEA 4HNLA 1DQXA 4TV6A 3SJNA 2QPXA 3WEOA 4M5PA 3VABA 1RY8A 1UR2A 4PULA 5HWJA 4PUUA 5BOOA 3ZLFA 3R0UA 3Q65A 3KL0A 2VR2A 4ONVA 4ZSTA 2OXNA 3WX7A 4GY0A 1GOKA 1H7XA 3CV2A 3INPA 1R3QA 2G8ZA 4XO7A 4CVUA 3S5NA 1HL8A 2DUAA 5GJMA 5KZMA 3N9RA 1J12A 2WMKA 1CLVA 1V79A 1XGZA 3RLUA 4GQBA 3QV9A 2CXEA 2VFFA 2XG9A 3BLDA 3S6TA 1JZ8A 4RZBA 4FR1A 2PF0A 2V5KA 2EPOA 2ZA2A 3SQMA 1FXPA 4AUBA 1HX0A 2OEMA 3TXVA 3APTA 1M7XA 3W6LA 4LB3A 4ZQNA 3MHUA 4Q8QA 1GZGA 5A94A 5CG7A 3GU1A 1Z48A 2VUNA 4U33A 1W2VA 4OUEA 2WVTA 5TAOA 3RK8A 4D6HA 1UZ1A 3AZTA 1UKQA 2ZX7A 4W88A 1KM5A 3IIVA 2WSRA 1V3LA 3GR8A 2G4JA 4MKVA 4DHGA 4B9YA 5A6SA 3RITA 1E5JA 3GYCA 3L66A 4S1FA 3QHOA 2XM1A 2OKOA 4CCDA 1GW9A 4ZA0A 1AZ2A 1FY6A 1XPYA 2AKMA 2AL2B 3MMWA 4XD3A 2CLKA 3H2MA 1W9BM 1UUQA 3F7JA 1HZYA 3PF3A 4AYSA 2WMGA 3UERA 3NEHA 1G9HA 3P80A 3GC5A 1FH9A 2GJPA 1CTNA 1OEPA 5CZKA 1EEPA 1DTUA 1VFSA 2GUUA 2NT1A 4FX7A 1UASA 1CNVA 3WQDA 1JDDA 5DBTA 4NXKA 4I5UA 3CLMA 1O94A 3R89A 3U4FA 5I7GA 2JIEA 2OYKA 3VCNA 4AU0A 1KLYA 2B31A 6ALDA 3W7JA 2POZA 4L6DA 1L8PA 1W54A 3NQ7A 4DBDA 3W24A 1EO5A 5H6HA 3M5ZA 2ZUUA 3AXHA 3GVQA 2ABAA 1GG1A 2VI0A 4CN4A 3AXXA 1O68A 2PE4A 5L9FA 4ZXOA 1F2JA 1TZ9A 3SGUA 2BVWA 3FVDA 3CQJA 3UWYA 2VT0A 1H62A 3B9DA 1QTWA 1JAEA 1L6WA 1TE1A 2QCNA 3K1GA 5LGXA 4K68A 1NWUA 2C18A 2ZRXA 1XYAA 4LXFA 2O9TA 3ITTA 3FSUA 3KTCA 3MI2A 2WCAA 1OINA 3GIYA 2PTWA 5IHRA 3EYPA 2WHLA 4ACZB 4W89A 2GFTA 4P7NA 1ISXA 3KXQA 5CBIA 1HW6A 2GQ3A 1XXXA 2QPSA 2V67A 4GLEA 3B8IA 4IJCA 3MO4A 3H53A 1OX6A 3DDMA 2E5CA 3OPSA 5FIPA 3MVTA 2TYSA 4HMDA 5LHFA 5I03A 3A9IA 3S8HA 5T26A 4LYQA 3RLHA 3NA8A 1LYXA 1TWSA 1HKKA 3OYXA 4D6JA 3CZLA 4JYDA 1UHVA 3VIKA 3U8GA 2VJXA 4L9YA 2XN0A 1XLMA 3NQVA 4FXSA 1NOFA 2VX6A 1H61A 4IPIA 2KZHA 3KL3A 4C6FA 3KRZA 3LHTA 4GO9A 2D73A 3VMOA 3FYYA 4I8DA 3G1RA 2H8XA 3PPCA 4PEKA 4Z2IA 2A7RA 3U9IA 2VZUA 4A8NA 1EHNA 1VPQA 1Q7QA 4GVFA 1B4EA 4UC5A 4JX6A 3V75A 1LLWA 2H8ZA 2PWVA 5EPDA 5CG0A 1XX1A 4DN1A 3GDBA 4H2CA 6CGTA 1ESWA 1ODUA 3PP7A 3PY2A 4EXQA 3DN5A 4PBEA 1SO3A 5ECVA 1ECEA 1FWRA 1B9ZA 1NARA 4NZFA 1A3XA 5CSUA 4K8GA 4DZHA 4Q32A 4ORMA 1ZRQA 1LUCA 3B8WA 1XD0A 4M6UA 3SN4A 3TC3A 4UNIA 3C56A 3AIBA 3QVQA 3MMTA 4IFKB 5A6MA 3C2RA 2V5BA 2UZ9A 1KCKA 2PURA 1DHPA 4RW3A 5CGQA 5H2ZA 1YDNA 3LI1A 1LQAA 1PCWA 3RHGA 4YJ5A 4UFIA 4A3QA 2EPHA 3F4VA 4QBXA 5DCDA 6XIMA 3GFYA 3ZWSA 4EPBC 4B3LA 5CAHA 4C65A 3TYUA 3GB6A 1TPB1 3CZKA 4S39A 1YBQA 3BSGA 3G5EA 1AMKA 1G6CA 3LCWA 4HJFA 5FF3A 4L6OA 1R9ZA 4KCVA 5DRCA 4OBSA 1J2WA 2IUZA 1XRVA 1G4PA 3EPMA 3L67A 3LXAA 5EL1A 1RK6A 3M0ZA 1A5BA 3WFZA 3GDRA 3OB8A 4H9UA 4AZBA 4JHOA 2ACUA 3NFUA 3QFEA 1JFHA 1ME7A 1G5AA 3BVJA 3LHZA 3CWNA 4UTTC 3GR7A 4DIAA 4P5UA 3WQ6A 2W5FA 4ZOAA 1HNYA 5M03A 2FH8A 3OBEA 4HHPA 1S38A 4UTTA 3MS8A 3RILA 1DP0A 4IGHA 3MUAA 4L64A 4D1IA 2WQPA 1XLAA 3M7WA 3CAWA 4XBSA 2D0HA 1KB3A 5A6BA 2H3DA 2FKPA 3CIVA 3LPOA 3W7HA 5HMSA 3LRKA 4RDZA 3IJ6A 2E8ZA 1XSJA 4RE3A 1DORA 4NXSA 5A8GA 3VIIA 2ASHA 3PS7A 2FMOA 2BOEX 1JRCA 4LYPA 4DWSC 1XIHA 1PX3A 2J6XA 5BXRA 3PUEA 1CX9A 1ADDA 3S47A 3SSZA 3L2IA 1ZLPA 4RPPA 4DWSA 5A6BD 3ME3A 1BXBA 4IMAA 4DXKA 4GUJA 2PGEA 2BLEA 2QDEA 1DIDA 1G1YA 4A05A 3I3BA 5CQ1A 3PG9A 2QJNA 1MQRA 3PBUA 5I00A 4ENLA 4KEMA 4J28A 1JEZA 5J04A 2ZTJA 3KOWA 4FIQA 1F6YA 3Q58A 8CGTA 3TFXA 4MZ8A 2UBPC 3WFLA 1K9FA 3F4WA 4IQLA 4GUIA 2IPJA 1EXBA 4DWSD 5EMJA 2GZXA 4RK8A 3AS1A 4FK9A 3LSBA 4X9SA 2J7CA 4NI3A 2PDPA 1KGUA 4P7LA 1V77A 4Q4KA 1V4YA 1KM6A 1UKOA 4W9TA 1BRLA 4H6QA 3TR2A 2ADAA 1Q7ZA 3DU0A 2BZNA 3B0PA 3FKRA 4A8RA 3TJIA 4DVOA 1SQ7A 2J8TA 2C79A 4Z08A 3T0CA 1JQVA 3W6MA 1EJ7L 1HO4A 3HG5A 3K8KA 5D32A 3EX4A 1EZWA 3GNRA 3EB2A 5JMUA 3ZJ6A 5DBUA 5BMXA 1P43A 2DU2A 3Q4DA 4QE4A 2FTYA 3TWAA 3CTLA 1UMYA 4N7QA 4JY9A 4B5SA 2CLHA 1MDLA 1EF2A 3M16A 1KGXA 2OELA 3MBDA 3DGRA 1SVDA 2PGFA 5IBXC 2PDFA 1DJIA 5G4WA 5I0DA 4MF4A 4IL0A 2IQDA 2GK1A 4OUIA 4HOWA 4MVAA 1OX5A 2FJUB 2EHHA 1VFFA 2HMCA 3E1F1 1V8EA 4JCMA 5DLCA 3ARPA 4XVEA 4O8AA 5FL0A 1EP1A 2PWDA 1WUEA 3ONCA 1VYSX 2G41A 1S2VA 4QSHA 3BH4A 4K6AA 3GBDA 3GDMA 4AF0B 4BCEA 3K46A 3LLFA 1OM0A 8TIMA 2PDYA 4CQ8A 2CWXA 3QZAA 3DEQA 1UWTA 4QJ4B 1YDYA 2P8BA 4GQQA 1V0NA 3MY9A 1XIGA 4ATLA 3M5YA 1DJZA 3ARZA 4XZNX 1L8NA 1AA1B 4ALDA 3GO2A 1HKMA 4ZCWA 4HJWA 4HIBA 3RCMA 1UZHA 2J7FA 2WSKA 1WKEA 4DF2A 1FHLA 4Z2HA 4D8LA 1AH3A 1ICPA 1FKXA 3NVDA 3T4WA 2HVMA 3A5VA 3PBVA 3VGEA 4WRHA 4JBRA 4ADSA 1WYIA 1TMLA 4AZHA 4FPSA 1UP3A 1DWHM 1A5NC 5H91A 5D38A 4G1NA 3SR7A 4XKYB 5JH2A 3GH4A 2CHRA 3VZZA 3SQSA 3UCCA 5M5DA 2A3BA 1UBSA 2W67A 4CGTA 1TX2A 1XUUA 4AEEA 1IZCA 4F0KA 4FS9A 2I9EA 4UOJA 4UOZA 1WXJA 1MNZA 3H2CA 3W75A 3NNTA 1V02E 2YOCA 2OR2A 5DELA 2CLFA 2G95A 2A3LA 1PYMA 7TAAA 1RBOB 2VO5A 4AC7C 3THQA 3CJPA 3THDA 4MJ4A 4WJXA 4DPQA 1OIMA 1US0A 3L4UA 4KRUA 1JIBA 4FOUA 2OOFA 3ARWA 2CPUA 1AD4A 3W7IA 1WO2A 3DHUA 1J79A 1RXOB 5CPNA 4XAGA 2VEIA 2ZUWA 2PP0A 4NJKA 1PX8A 2QLYA 3BICA 3CO4A 3M46A 4C6KA 3PPFA 3W7MA 1H1YA 3H26A 4G2DA 4CU8A 2ESCA 1T96A 3H23A 2C19A 4XZ9A 1FOBA 1EOMA 2OMAA 3CT2A 2I56A 3N2CA 2ON3A 4XAZA 1YPIA 1IIHA 4S3BA 1OF8A 2X1UA 3DFPA 3W01A 1I8JA 3QH2A 5EMKA 1I60A 4GY7A 1RLCL 3E3HA 2XH7A 3KWXA 1CGXA 1RHCA 4YTUA 1QPRA 7REQA 7PTDA 5I3KA 2RKXA 1U2YA 5EBUA 1YQ2A 4HNVA 2ZADA 4NYYA 1Z42A 4O50A 4V2XA 4AYGA 5CLTA 5A1AA 3OZOA 3BAXA 4BI6A 3K13A 2ACQA 3L4XA 3TW7A 2CCRA 4BKNA 1C8VA 5G2HA 3OLDA 4Q8OA 1KRBC 3EA2A 4AZ7A 1BF2A 1YNQA 1XLIA 3PZUA 4M29A 1EC9A 4M19A 4H9YA 2VD8A 1LORA 1KBKA 3VNKA 3QFWA 1F76A 2RJGA 2P0IA 4PC8A 1BG4A 4OGZA 2DUZA 3W38A 3II1A 5BWAA 4DPPA 4F2TA 4DXVA 1OD0A 4RUBA 4MY1A 1TIWA 3R12A 1V03A 1T0OA 2WM1A 4GO8A 3SIMA 4TO8A 3NYDA 1BXCA 2OODA 4ZVJA 1GG0A 2H9AB 3FDGA 3DCPA 3ICJA 2EPNA 3BLLA 3STPA 1ZL1A 1WZMA 4HKPA 3UG4A 5DXYA 5E0KA 2NSXA 5HDRA 3EA3A 1J0KA 3CK5A 3R5EA 3F4DA 1VYPX 1ME8A 3CASA 3LM7A 3WQCA 4Z0JA 3WUBA 3B0UX 3AHYA 2NSOA 2B81A 2ZA3A 2HVNA 3BPWA 4RXGA 1ZBCA 3GG1A 3W6YA 2BGNE 2CYGA 2ABBA 2GJXB 2HS8A 5KSWA 5GQBA 5A2CA 1MDRA 4OVXA 5EBAA 3I3EA 3KRUA 1R9XA 2GGEA 1GJPA 3DFHA 2YCLB 1EL3A 2J6VA 2D2HA 4KGLA 4AMCA 3OGRA 4HZ7A 2V6AA 4J3TA 1KM3A 2AAMA 4PCNA 1XICA 3RG6A 4EK7A 3E5BA 2B4GA 2ICSA 3GIPA 4CU6A 2RHGA 5KMYA 1H51A 3RNDA 1VBGA 3LEPA 1DXEA 3RIKA 1E5NA 3WQWA 4Z42C 4E2DA 4S3GA 2ANUA 3B05A 2NQ5A 3NL5A 1CGWA 1W3TA 1TQXA 3H4XA 4LYKA 3ZR6A 3W88A 1FKWA 3DUGA 1YTDA 3W4RA 3LHYA 1I2NA 2G5WA 1XFCA 4UQEA 4KQNA 5FD0A 1KCZA 5AYIA 1OC6A 5U4NA 2JE8A 2V81A 4RR4A 4Q4PA 4FB7A 3UPBA 3NUKA 4RLIA 3PSVA 4GCAA 4GINA 1OFAA 3BCDA 5I3DA 2ZYFA 1F4AA 1XYBA 2J9YA 4UFKA 4PMVA 3VNYA 1IXQA 1W9DM 3M0XA 2W62A 1YNYA 3VNZA 3PZMA 3BK0A 2VGBA 4DM1A 3DI0A 5SWUA 1DQUA 3I6EA 1R2RA 4ES4A 3VC5A 4D6IA 1SR9A 3CGTA 2WWCA 4GVIA 2OSXA 3NQEA 1L6GA 3KHJA 1RLDA 3IGSA 3MSDA 2Z7GA 3VOFA 1RZMA 3VC6A 3L4ZA 4N4QA 3W71A 4RE0A 1OFRA 5DX7A 4IGMA 4BI7A 5AZ1A 4O57A 4KCUA 4M24A 2XTKA 1XD1A 1YXCA 4I6KA 3EEZA 1REQB 2WPBA 4OV9A 1YRRA 2P0OA 4LF2A 4RNJA 2QUTA 3LUTA 1VHNA 1UWSA 2QDDA 3VFLA 3W72A 4ACZA 2NQZA 3AOFA 3CUFA 1JDFA 4KF1A 5G1MA 2QNEA 5T91A 2YYTA 3H2NA 3NSMA 1RBLA 4CD4A 4N0RA 4JFWA 2PSNA 3LPGA 5I07A 3CZ8A 2FGBA 1HJXA 5E9XA 4U3AA 1FCQA 1VR6A 1EJTC 2ZVIA 4Z2GA 3TYCA 4Q8PA 2Y24A 3OG2A 1LCOA 5LNRA 1BKHA 4EF8A 5DEZA 3K5XA 3QMTA 3WZ0E 4DAFA 1QCWA 1SZNA 1D7FA 4FMVA 3R25A 3TVAA 3HPAA 1EJUC 3EWYA 3WMBA 2D2JA 1DE5A 5EMLA 1NJJA 4O17A 2NV2A 2CEQA 2VWTA 3WQGA 2R91A 3W22A 3ES7A 3EDFA 5HNRA 3MDWA 4YPJA 4RNFA 3BDKA 3FXYA 4LAMA 2W6RA 5CGTA 2IQTA 4NI8A 1WDRA 3BE7A 3VDGA 3U2CA 4O4VA 1OZQA 5E5CA 4GISA 2YCJA 1E4IA 3MP3A 4F0MA 5CPOA 3E2SA 4LYRA 1JAKA 2ZRUA 1TQJA 4HB7A 1BVNP 3DX5A 9XIAA 3EWUA 2PC4A 1KRMA 3MW7A 5G1TA 3QHNA 5EMYA 5DY3A 4XBJA 4QLJA 3AZSA 2WM0A 3WYZA 4C5YA 2VFDA 5H8PA 1RA5A 3UP8A 4FP1A 3EMQA 3M0VA 4ACYA 3O0FA 3R13A 4JQAA 2PLJA 3GNXA 3IAQA 1Z7AA 1SR0A 1SFLA 1NELA 3CQHA 1QHZA 2HTMA 4WJEA 3T7VA 4NAFA 1UD3A 2C71A 3I10A 4Y9OA 4NSBA 2R9RA 3GVWA 4QGCA 2EXOA 1W1ZA 2P1FA 4PCSA 4U2YA 2X05A 3CUGA 2V9DA 3U57A 4A8IA 1K8YA 3STFA 1O7AA 4UTHA 5FEWA 1P1MA 3LTYA 4ZFMA 3QKEA 4Y9AA 1GVYA 2HK1A 2CLEA 4AD3A 2YFOA 1SU5A 2QGYA 4LCSA 5HANA 1IV8A 1YYAA 4ZZ9A 1DEDA 4MHBA 4S3DA 5A5WA 3LENA 2CZDA 4AVNA 3WF0A 4DJEC 3GX9A 3O6CA 2WCGA 5F2LA 3IV8A 2VFEA 3UZWA 3WQFA 3R79A 3S2LA 3WJXA 5HMFA 1F9CA 3MUXA 4DJEA 3H7VA 1ADOA 4R33A 2V5LA 4J35A 3G0SA 3OIXA 2PDJA 3OZMA 4Y96A 1ZGDA 1RD6A 3AU2A 4C6LA 1GVFA 4GX9A 3QLLA 1QI5A 3GNOA 3CM4A 1PL9A 2VWSA 3PAJA 1R3RA 1OABA 3E96A 1C7SA 4LS2A 4LAZA 3E9AA 5E6YA 1OD8A 2E3ZA 3F2BA 4FLSA 4DJED 4LY4A 3W2NA 3SFWA 1W3JA 4QDPA 4R9XA 4GQ0A 1AQ0A 1F5ZA 2BASA 4WKHA 5G1YA 5CPSA 3KVMA 4K39A 1PDYA 3SSJA 4AD0A 4XVDA 1XQKA 1YADA 3BGAA 1V3JA 3MHGA 3VUSA 1SSDA 1SJCA 2P76A 1GTHA 1VF8A 1EX1A 4WF7A 2YB4A 3F03K 1Z89A 4OBRA 5GVJA 1XIDA 1O12A 5F1VA 4QISA 1H4PA 4RX0A 1F73A 2WVUA 2YL8A 3PK7A 2VEGA 3WEMA 2VYOA 3DBPA 3LRLA 1X98A 5D2YA 2BHUA 1OCQA 2V38A 3EWBX 3KFTA 4DBSA 2VEFA 1P4CA 3N2MA 4O13A 1IEWA 4HN4A 3A6OA 4PMRA 2NX1A 2QXWA 4OJYA 3MCOA 2G4FA 2QV4A 2DH2A 1E0XA 1SJBA 3GNNA 2EPMX 4IH3A 4E3TA 1EWDA 2HPMA 5F4SA 3S6OA 4XUGA 4DYEA 1IGSA 5ABTA 4GABA 2WHKA 3LCHA 1W9VA 3CQIA 1B57A 3W0KA 3GSMA 4LUTA 2VRJA 1DIOA 3L65A 1FTXA 4GYFA 1OK4A 5C55A 4PGLA 3OQ8A 3MDUA 4UQAA 4FLQA 1VCGA 4ZOEA 1OX4A 4HYVA 4AX6A 4OFCA 5AFDA 4EP8C 4DXXA 1HIZA 2FPYA 4D6FA 5CEWA 1ITCA 4B3KA 3B04A 1BWLA 4H8VA 3QGAC 1V0LA 4HZMA 3UWEA 1U1JA 4LS1A 3NGFA 3SCRA 3GW0A 4K8EA 5ABEA 1WKFA 3QOKA 3C0LA 3CQ0A 2WLYA 3AQUA 3V35A 1G0CA 1EP2A 1SFSA 5M1TA 3NL2A 4LFYA 5HJYA 1OQFA 3JRKA 3OO2A 1KQZA 3K4DA 1TR9A 3VE7A 3BG9A 1DKWA 3ZM8A 3W1LA 4B5XA 2XSAA 3S9YA 1UOKA 3BG3A 1XC4A 1WNOA 5AHFA 2XIBA 3A4XA 1XW8A 4RXFA 4S3JA 1Z32X 3DKLA 3HURA 4H00A 3RGTA 2VRKA 1B90A 3PTQA 1KWKA 4YYCA 4ZO6A 3S4TA 4P8UA 1VRXA 1H5VA 3C2OA 1JUEA 1Q66A 4Q22A 1JXJA 2J47A 2VFGA 3KX6A 1L6FA 4NAEA 3DECA 5A8QA 2PF8A 4ROQA 3IRSA 1P0KA 2KX9A 4IF2A 4XZLX 4MJ2A 3UF9A 1VCFA 4D6EA 3W1UA 4FOJA 4HOZA 1GGOA 4MNJA 3HZ3A 4PEEA 1RSCA 3FVMA 1AL7A 3AIQA 2PP3A 1VH7A 1ZBKA 4WSKA 4KIRA 3FCPA 1FWAC 1C9DA 1BWVA 2PDWA 1UD5A 1SO6A 3LN3A 3IJLA 2V3EA 4GZIA 1N8WA 1XLGA 3COTA 4KT2A 3DYOA 5ABGA 2Q3RA 1ZNNA 3FK4A 3URNA 3WLIA 4IIBA 4LUIA 4BQ2A 4OIFA 4XIAA 3TW9A 1XLJA 4WUIA 3VGFA 3GH5A 3U2EA 4UMAA 3LV5A 3B97A 3R43A 2YFNA 1OGGA 5TBOA 3CXOA 1IZJA 3LMYA 4L4OA 1UD2A 3V36A 3HFYA 4PMZA 3K8LA 4JIRA 1F4HA 1C92A 1KXTA 1PTDA 4OT7A 4GIEA 2OT0A 1Y5XA 2E6AA 3FFSA 5CC5A 2VOMA 1SSGA 4C6CA 1Q7MA 1H7RA 4WJ8A 5JIPA 2YBVA 4UTWA 2PDMA 1QK0A 3E2QA 3MKVA 4Y8EA 5LHEA 2PI6A 4IJRA 2I57A 4Y2WA 3QSRA 4AMAA 4H9MA 1C93A 3FEQA 4CQBA 1JPKA 3SGZA 3CEUA 1S2CA 2PZ0A 4PMDA 4BS0A 3H54A 4GZEA 1UMLA 4OECA 2ISDA 5GJPA 4FNPA 1CXEA 1O5RA 4NZCA 2GVGA 2ZUVA 3BAJA 3CQKA 1CXKA 3SCWA 5ABFA 1XIJA 1SZEA 3QM3A 1I2OA 4KCWA 4PUDA 3TX9A 3FYOA 1VHCA 5U7SA 2C3ZA 3B8VA 3CNYA 2EAWA 1O5KA 4DM2A 2J74A 4GGHA 2J8FA 3EEGA 4ML4A 5CZTA 2EKGA 1QU4A