3STTA

Crystal structure of tomato methylketone synthase i apo form
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
FVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIANKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Emergent Decarboxylase Activity and Attenuation of alpha/beta-Hydrolase Activity during the Evolution of Methylketone Biosynthesis in Tomato.
pubmed doi rcsb
source organism Lycopersicon hirsutum f. glabratum
molecule tags Hydrolase
molecule keywords Methylketone synthase I
total genus 89
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sttA00
3TEJA 5FUMA 2WLSA 4J0CA 4UHHA 1TQHA 5CT8A 4B85A 3F8SA 5A7FA 2J4FA 1LZKA 1R4ZA 3MVEA 2V9ZA 4N8SA 2XQIA 1XZMA 3KWFA 4AMYA 2JGFA 1XLWA 1H2WA 3STWA 1WB5A 4F21A 5ALRA 3VXKA 4F0JA 3OG9A 3IA2A 1EH5A 2BUBA 4X92A 2RONA 5AH0A 2X76A 5CT5A 1NU6A 2JGEA 2XUKA 2DQYA 3V1MA 1HPLA 3R0VA 1WHSA 1BROA 3PFCA 3AINA 4Y7DA 3V1NA 2ZSHA 5IVKA 2GBFA 5CXXA 3A2NA 1EK2A 1OILA 3ANSA 1YA4A 1P0QA 2ACKA 3IURA 4J0HA 1S8OA 3LLCA 3DYVA 2BUCA 5T4HA 2YXPX 4N8EA 2Z8ZA 1THGA 3OTQA 1YR2A 1G42A 1ODSA 2DR0A 5AP9A 3M82A 4JH0A 4UFPA 2WHPB 5JAPA 3VJLA 4Y2TA 2WIJA 1TKRA 5A7GA 2XMBA 4KACA 2PL5A 2GZSA 1UK6A 2HA4A 4CCWA 4BVLA 5DNUA 1AURA 3L1JA 3WKEA 2XUJA 1UOQA 4IH9A 1ETHA 3K2IA 4BZZA 4U2GA 4MQMA 3F9CA 3F97A 4M0FA 4MWSA 4EY8A 2QJWA 2HU8A 2DQZA 2JEZA 5EHNA 2WFMA 1TCBA 1CEXA 5HCUA 3LCRA 4WFIA 5C7YA 1VZ3A 4X6YA 5I7UA 1XZHA 1B6GA 3AZOA 4AO6A 2QMQA 3LS2A 2PU7A 4PSCA 1XFDA 1IUPA 1WPRA 5ALDA 5HFAA 2PSFA 5ALKA 3I6MA 3WA6A 2XE4A 1TAHA 1JJFA 4WDQA 2I03A 3ESDA 2IX9A 4EHBA 4X94A 5LP1A 4Q3KA 2WQZA 1R50A 1VE7A 2I3DA 4BAZA 2OGSA 2Z3ZA 3G7NA 3H04A 1RP1A 4FFWA 1DQYA 4INZA 5CRIA 5AO9A 1AMNA 5JD4A 1SCIA 4CG3A 5LKAA 2VJBA 1M33A 1W6RA 1DWQA 1CUVA 3ED1A 5ALVA 2Y6VA 5KREA 2VEOA 2BGRA 4AQDA 2O7RA 3DD5A 3WKCA 1A8UA 1QE3A 1SFRA 3WK9A 5AI5A 1ZJ5A 5SYNA 3W2TA 2HL6A 4A16A 5AIAA 3KD2A 3FWHA 4FKBA 5FRDA 3QVMA 2I3ZA 3HI4A 3W05A 4ZGBA 3ZV7A 1MJ5A 4HXGA 1N1MA 1ZD4A 3WKDA 5ALZA 3HEAA 2FUKA 1X2BA 2V98A 3DEAA 5AOAA 3WWPA 2QR5A 4K2AA 5FKJA 4G9EA 5T4BA 2VJAA 4G4JA 1QO9A 5K3BA 1F0NA 3G0IA 3FVTA 3OURA 5DTIA 1YAHA 4W9RA 1XQYA 1E8MA 2GYWA 1MNAA 4ARBA 4D9JA 1TCCA 3A2MA 2OGTA 1TIBA 3B5EA 2HDWA 4B84A 1T2NA 2C5FA 2OQIA 2O2IA 2WU3A 4WCVA 5EI5A 1DT5A 2PPLA 5H3HA 4WJLA 3ZLVA 4C89A 5IKXA 2ES4A 1CPYA 1WM1A 4KE8A 2VJCA 4BB0A 2XQGA 3T52A 5T4FA 1RYYA 2WUFA 1T4MA 4FNMA 4L0CA 3QITA 2RI6A 1AQLA 3B12A 3HXKA 4C4XA 3OM8A 6YASA 1DX6A 3NWOA 2PVSA 1R9MA 3ICWA 4DMFA 3SC2A 2VF2A 5EIHA 1HDEA 2D0DA 3DYIA 1QIFA 1O6FA 3FLBA 2EDCA 5K3CA 2HA5A 2WHPA 4CG2A 3H2HA 3LIIA 5JALA 4BVJA 3KOOA 4BCDA 1CUCA 2GBIA 1XKLA 2QRUA 2XMQA 3STTA 2C0QA 2CKMA 1BRTA 3HC7A 3C43A 5AOBA 2CZQA 2VA9A 4XVCA 4L3WA 2C4HA 4KAAA 3JWEA 4HTAA 4W1QA 3AIMA 3GUUA 2K2QB 1H2YA 4UBIA 2QVBA 1ORWA 4J0KA 5HQ3A 4HAIA 5DYYA 4CI9A 2X5XA 5BOVA 1Q0RA 5HF8A 1ZOIA 4B81A 4FDMA 1N5RA 4ZRDA 3WK5A 2ROQA 4B6GA 1U4NA 5CMLA 3BDIA 4EA6A 5AI8A 5EFZA 1EI9A 3L1HA 2CB9A 4QDXA 5ISMA 2XUHA 4CFSA 3DS8A 1YASA 4GW3A 3O4IA 5HF6A 1W52X 5CT6A 1YCDA 2RAUA 4GEGA 2YYSA 3HABA 1XQWA 3FYUB 1Z68A 1XRNA 1CQWA 4BDTA 2ORYA 4X85A 1K4YA 2OXEA 4W1RA 5HKAA 2O2GA 4QDTA 2XMDA 2QS9A 4KE6A 4Q82A 3ESAA 4HZGA 3PUIA 4H7IA 5IVDA 2J4CA 2WU4A 1W76A 1DWOA 2PU5A 4XX1A 5ALQA 2B9VA 1HQDA 5JZSA 2JGIA 3V1LA 1W1IA 3D2AA 4MEAA 5ALXA 3WIOA 1XRPA 1KU6A 5AKJA 5T4EA 3R3UA 1LPPA 3FAKA 4X91A 5ALGA 1UOPA 1UK7A 1TRHA 2PM8A 4BP8A 4EZIA 1VE6A 3H1AA 5C8XA 3R3WA 2CBGA 4Z49A 4OYYA 1FFCA 3OC0A 2VAXA 1LPBB 1QLWA 5ALTA 4A23A 1QIJA 2BUAA 2O7VA 4B9EA 4FFVA 3VVMA 2VQ6A 4QA9A 1GQRA 2WFLB 3M81A 1P0IA 3G9XA 3FYTA 5BWCA 1GQSA 2WILA 1K5PA 1JU3A 4DSAA 3ICVA 2OCIA 3BJMA 4DMKA 3HYSA 3PICA 2XMCA 1R9NA 4UFNA 2PSHA 4L72A 3R3VA 1DTEA 3WWEA 4I19A 4MYDA 3VJMA 1AZWA 3E4DA 1FFAA 5AM5A 1XZEA 4U2FA 5FP0A 2Q0XA 3QYJA 4X3CA 5ALMA 4XIIA 5E4JA 3WL6A 4KRYA 4FWBA 4UFOA 2OAGA 4P93A 1SCQA 1ZJ4A 1GZ7A 4UBNA 4BRSA 5BV7A 3WK7A 1QTIA 1R3DA 1Q84A 1VOTA 4G4IA 1UWCA 1CUXA 1F0PA 3PUHA 4B9AA 1IUNA 5I9IA 2HA3A 3W04A 5AM1A 4O08A 1U2EA 2V97A 1USWA 5AK5A 3E0XA 1MX9A 2WUDA 4OCZA 3QPDA 5JAUA 4G1FA 5JATA 3GA7A 1YS2X 2HA6A 1J1IA 1KU0A 1LPNA 7YASA 1CUYA 3UUFA 4IO0A 2G5TA 3H2IA 2B4KA 4DNFA 4FLEA 4WDRA 4EBBA 4V2IA 5CTAA 2ZJ7A 1AGYA 1HL7A 4FBMA 1LPMA 2LIPA 2WJ3A 3FSGA 3W9UA 5IH7A 4AX4A 4OUKX 3D4LA 3G8YA 2JGMA 1WHTA 1QFMA 2ZYSA 1WOMA 1G5FA 4YASA 1UT6A 3I6YA 5I8PA 2XQKA 2WFLA 2QZPA 4LXHA 5LLSA 1Q83A 4BATA 1MAHA 1CFJA 4M0MA 3EQ7A 5AKHA 5DYWA 3QM1A 2HADA 5AICA 1SC9A 1BN7A 3K9BA 3FOBA 2OGZA 5AI4A 1QIDA 3DJYA 5CT4A 5K3DA 4GHWA 1L7AA 2IIVA 4WFKA 3IVMA 1THTA 4Y2QA 1XROA 2H7XA 4IH4A 1E3QA 5CH8A 1IZ8A 2AJDA 4DLNA 5JYCA 4E14A 3HJUA 4BCBA 2XLCA 2WUEA 4OU5A 4UBOA 2GYUA 4YK7A 3Q0TA 2AJ8A 1YSCA 2ZYIA 2Z8XA 4TVKA 2ZYHA 4H7EA 3C5WP 4C4ZA 2PKYX 3DDUA 5A71A 3WK6A 1IUOA 1IZ7A 3OOSA 1DT3A 3ESCA 5K3AA 5LZ4A 2H7CA 1SCKA 3I1IA 1XZGA 2NW6A 3MGAA 2P8SA 3BIXA 4OPMA 3I2HA 4QZVA 1I6WA 1ODTC 4AO8A 2ZVDA 3O4HA 3PI6A 4HXFB 1IMJA 1XKTA 1HBJA 3QPAA 5AJHA 3FLAA 1AUOA 1QO7A 4P08A 5KWJA 4KR0A 4OD0A 1K6EA 2XUFA 3EQ8A 4OB7A 5ALFA 3STUA 3G9ZA 5LZ2A 2HIHA 3R3YA 4W1PA 1VA5A 4OSEA 1XZBA 4JEIA 2Y2VA 4FMPA 5LKRA 5AKGA 4BCCA 4M0EA 4KEAA 3FVRA 3DQZA 4E15A 1VXRA 3YASA 3STXA 3IULA 4G4GA 4HS9A 4HRYA 2XMZA 2XMGA 1HLGA 4H77A 5K3FA 2OCLA 1AKNA 3BJRA 2WKWA 4LXIA 1GPNA 3V9AA 3F67A 3KSRA 1A8QA 2DHEA 4FBLA 5ALHA 3C6XA 2HRQA 4L9AA 3ZWQA 5EHQA 1OXMA 1Q0ZA 3HRHA 5A7HA 1U8EA 3C45A 1H23A 1P0MA 3T4UA 2WIDA 4UBJA 5HKBA 4P92A 4U2DA 1OCEA 2JGKA 1CIJA 3HSSA 1BE0A 1CUSA 4K5QA 1P0PA 3C8DA 4BTVA 1C7IA 1VLQA 4Y2VA 3HACA 4AN1A 4KAJA 3DNMA 4UHBA 5ALUA 4MYSA 2WTNA 1JU4A 1D07A 4JUIA 4X6UA 4XWGA 2CEKA 2VAVA 2H1IA 1CUUA 5LZ9A 5K3EA 2ZYRA 3H2GA 4AO7A 2I78A 4H18A 1RWQA 5JD6A 1UK8A 2BGNA 4F5ZA 4J7AA 5JIBA 2WIGA 1VKHA 3I2GA 4Q3OA 3RLIA 1ZGCA 1AC5A 4A5SA 1IVYA 3C70A 2CJPA 4B82A 5DNWA 5AKIA 1WB6A 1ACJA 1CRLA 1XZFA 1GXSA 4FLFA 2WFZA 4WFJA 2JIDA 4GECA 1R88A 5AKLA 4J0IA 4E11A 4ROTA 1XZDA 1EINA 1UOOA 1CUGA 4QWMA 4DSZA 2PUJA 5ALJA 3WLAA 3IUJA 3H18A 3PE6A 5FPQA 2Z3WA 5C8VA 1JJBA 4PF1A 4BC1A 1QIMA 2AXEA 4H0CA 3WIBA 4UBLA 1SOMA 5KBYA 4BTLA 5YASA 3G02A 3D3NA 2PSEA 5AM4A 5K3FB 4C4YA 1Y37A 3DL7A 5DYTA 1YAJA 1YB7A 2XMSA 1LPAB 2FJPA 3CN7A 4K6HA 5E4TA 2BAGA 2QJRA 4GLBA 4B0OA 1YB6A 4KE7A 4C87A 4BAUA 1XQVA 1EB9A 3RM3A 3EF3A 2QUBA 4KJXA 1GGVA 2BJHA 4RGYA 3FYUC 4AZ0A 2XUDA 3BF8A 4GDMA 1WCYA 5ALWA 4JYPA 4QEKA 3D7RA 4NVRA 2VT7A 5ALYA 1WPXA 4GBGA 1QTRA 4OB8A 3D5EA 4IH1A 4N5HX 1GKKA 3BWXA 1N5MA 2GBGA 1EDBA 2HU7A 4C01A 3WA7A 5EIAA 3O95A 2PSJA 5FLKA 5JASA 3E1GA 3D0KA 4PO3X 3E3AA 1ZI8A 2R11A 3QH4A 3TGLA 5AM2A 1FSSA 3C5VA 2WUGA 1E8NA 3KXPA 3WQHA 2YASA 1JMYA 5CW2A 5ALOA 3ZLTA 2PX6A 3PF8A 3QZUA 2AJLI 4AXBA 4CG1A 1O6GA 4GWLA 3KDAA 3STYA 1C7JA 2H9YA 1FJ2A 3G9UA 3H1BA 4Y2RA 2HHAA 4DGQA 3IUQA 1F8UA 3TRDA 1EK1A 4TPKA 3BIWA 5FXMA 4LHEA 4MWTA 4H7FA 2HM7A 4GXNA 2GZRA 1ZD5A 2HA7A 5LZ5A 2XUGA 1QIKA 3WZLA 1CVLA 1EA5A 5FPPA 3JW8A 3GBSA 2VJDA 1DWPA 1ORVA 4Y2XA 3WWCA 2ZJFA 3AIKA 3H0CA 2XB6A 2Y2UA 1MN6A 4I3FA 3TJMA 4B80A 4QLAA 1CUZA 3PDCA 1FFBA 1GKLA 4NS4A 1BN6A 3SX4A 3R40A 4ITVA 1U65A 5E2IA 1JFRA 1ZICA 4IHAA 4X00A 4QDUA 2PSDA 4MEBA 1H2ZA 2C5GA 4UHFA 5LZ8A 5EHZA 1YA8A 3I2KA 1EVEA 5DNVA 3SK0A 5FV4A 2XUIA 2HFJA 1MU0A 3WJ2A 2QUAA 5D6OA 4I4CA 2EDAA 1MPXA 4P9NA 4DIUA 1EX9A 3F96A 1UKAA 3H19A 3W9BA 4N8DA 3HZOA 3G0DA 4W1SA 4WY8A 5J3JA 4Q05A 3CCBA 2OCKA 3I28A 2OCGA 4CCYB 5CBKA 1CUDA 3OPMA 2XUAA 2XUOA 1X2EA 5JARA 1XLUA 2ONCA 4PNZA 3BDVA 3G0CA 5AHXA 3V48A 4Y2PA 4TGLA 3BF7A 2C58A 5A6VA 4YX9A 3VDXA 3H2JA 4PW0A 5AK4A 3AFIA 2RIPA 4FNGA 4S0XA 2IITA 4FLMA 1LGYA 1J2EA 1W75A 4LIPD 5DWDA 1MT3A 1C4XA 4DNOA 1B41A 1H22A 4X7BA 4EB0A 3UUEA 2WG0A 5HQ3B 3N2ZB 1GPLA 1DX4A 3C6BA 4HXEB 4DYHA 4JNCA 4DNQA 1BCSA 2QXUA 4CIBA 1QOZA 4KAFA 3O9VA 4UBKA 3DCNA 1EB8A 3BL8A 1VXOA 3D2CA 1PJAA 3M3DA 2VSQA 5CH3A 3Q8WA 3QPCA 2WTMA 1QFSA 1LPSA 2DHCA 1CUBA 3L1IA 1AX9A 3AUKA 1ZI6A 2DFPA 3AIOA 1LNSA 4LXGA 2EEPA 5JANA 3MUNA 2QOEA 4RNCA 4OU4A 1ISPA 4K6KA 2H7YA 1G4HA 4ZV9A 2XLBA 4G5XA 3U1TA 1CR6A 1BU8A 3DKKA 4U2CA 4X93A 4UUQA 2XQFA 2CMFA 4J3JA 4MQLA 2GYVA 2B61A 4BBZA 1EDEA 1HKHA 3R3XA 3R41A 3EBLA 3D59A 2HA0A 5E4YA 3C6YA 4Y2UA 5ALSA 2O2HA 3VISA 1ODCA 5LZ7A 1KEZA 3HLKA 3LIPA 5FDFA 4PSUA 2BKLA 5ALLA 1UFOA 3IUMA 4QLOA 1CV2A 2HU5A 4HVTA 2RHTA 1TCAA 2R8BA 3WZMA 5EGNA 2OLEA 1MO2A 4GI1A 1K8QA 1E89A 3VVLA 3D2BA 5AK3A 2FX5A 4AN0A 1E66A 4J0JA 1GPKA 3QBJA 5KWIA 2J3DA 3BE8A 5AKYA 3AILA 1XQXA 2CUTA 4H7DA 3WYNA 5CH5A 5JAOA 2HRRA 1MAAA 4X71A 5HFNA 1ZD2P 2FJ0A 5JZ9A 1Y7IA 1ZGBA 3WMRA 2QXTA 3PF9A 5IVHA 3DL4A 2ECFA 3NUZA 2VATA 1CUHA 4DNPA 5AIBA 2BFNA 2JGJA 2WIFA 1ZI9A 1UK9A 4HRXA 5DTJA 3O0DA 3FSGD 3KWJA 5AKKA 3RARA 2BCEA 2WG1A 3DOHA 3M83A 1J07A 1XZJA 4QNNA 4Q3LA 1DQZA 2OQVA 3FCYA 4EY6A 4B83A 3IUNA 3P2MA 3IDAA 2WJ4A 4B0PA 2HA2A 3QMMA 1Y7HA 3WK8A 4N5IX 2WM2A 3S2ZA 1YS1X 5AKXA 1E8DA 2RHWA 1UKBA 5IVIA 4XJVA 4BC0A 5AM3A 1LPOA 3EQ9A 5BWBA 5JZBA 4JYMA 1VA4A 5AI0A 1ACLA 5F4ZA 4FTWA 5CURA 4Y2YA 3WKBA 2VT6A 5K5EA 2QT9A 4CIAA 3JYHA 4X90A 3B3QA 5JD5A 4FOLA 5A62A 3AZQA 2OAEA 5CXUA 1FFDA 3IIIA 4E46A 2PUHA 4RPCA 2G5PA 2W6CX 4KE9A 2OPHA 4IQ4A 3FLEA 1UKCA 4KYVA 2XUPA 1H2XA 4UHDA 3WL8A 1A88A 4F60A 3GZJA 4QDOA 4W63A 4UHCA 3DLTA 3C8HA 5ALEA 2DHDA 5C81A 1QIGA 4U2EA 1LLFA 1PFQA 2WIKA 1GT6A 2QKYA 5HF9A 2HFKA 1EXWA 3UMJA 1MX5A 1L7RA 3WL7A 3CXUA 4G8BA 4G9GA 1XRLA 4OYLA 3V1KA 4BP9A 4UHEA 3WL5A 3WKAA 5D3ZA 5FOQA 4B7ZA 1XZLA 5EIEA 4K6GA 4PQEA 2D5LA 3I2IA 3I2JA 3WWDA 4UBMA 1W4LA 4DMHA 1CUAA 2W22A 2ACEA 1JKMA 1LBSA 5AK6A 1TK3A 1CUWA 5HK8A 5LYYA 4KRXA 3WYDA 4BVKA 3O9MA 1ZIYA 2XQJA 3ZLUA 4QWWA 3CN9A 5SYMA 4C6HA 3H2KA 1ZIXA 1JJIA 4J0GA 1MTZA 1BS9A 2XMRA 2VTVA 4ZI5A 4RE5A 4Y9SA 4U2BA 3WWOA 1QZ3A 5LIPA 4H7JA 2DCMA 4LYEA 1QGED 3ESBA 3STVA 3GFFA 2XUQA 3PFBA 2WJ6A 4BE9A 1CUIA 4LKOA 3RKSA 3ZPXA 3LP5A 4ETWA 4Q1VA 2Y1KA 3SWWA 2JBWA 1BEEA 2C7BA 3GELA 3G9TA 1JT2A 4BYMA 1NU8A 3O4GA 1ZD3A 3FYUA 1A8SA 2B20A 4J03A 4RE6A 3C87A 1CLEA 1K63A 4DTCA 3ZI7A 2WG2A 1DU4A 1CUJA 2UZ0A 3X3HA 4H7HA 4WY5A 2GBCA 5JAHA 2DSNA 1X70A 5AM0A 1EHYA 3ANTA 1XZIA 1F6WA 1JI3A 5D7BA 4BAGA 4DM7A 5AKEA 2PBLA 3IB3A 4EUSA 5C8ZA 5HK9A 1XRMA 2J3QA 5EHXA 1G66A 3ILSA 3O4JA 1VJ5A 1XZCA 1FFEA 1DINA 5DLPA 1R1DA 3A70A 5JADA 3FBWA 4EY7A 3DKRA 4EY5A 5DJ5A 4G8DA 2G63A 4OB6A 3WK4A 4ZXFA 4AMZA 3W06A 4BRZA 3BXPA 1XRRA 1QIHA 3U0VA 1XZKA 5D3KA 1NX9A 1EDDA 3G0GA 4ZV7A 5AKZA 1CUFA 4X97A 1CQZA 2WHQA 1QONA 5HF5A 1XRQA 4QDZA 3H17A 2RGUA 1QIIA 4BZWA 3F98A 4ARAA 4Y2JA 4YPVA 3QMWA 2AJBA 2E3JA 5ESRA 1JMKC 3GROA 4NMWA 5ALIA 5HZGA 3WI7A 3VKFA 2QTBA 5ALPA 1UZAA 3VJKA 3I2FA 1VZ2A 2WSLA 2YH2A 4FHZA 3I6ZA 5AI6A 1CUEA 4C88A 1A7UA 1N8SA 3K6KA 5AI9A 4CCYA 2V96A 2XDWA 4PV7A 3N0TA 3G0BA 4UPDA 4BDSA 4ZREA 2X8BA 3S8YA 2OG1A 5AOCA 4Y2SA 2C0PA 3C6ZA 3AZPA 1LZLA 4NZZA 3EIOA 4MJ3A 1MNQA 2G4LA 1QIEA 2ZJ6A 3FNBA 3DOIA 1E5TA 2Y6UA 3CCCA 4AB1A 3R3ZA 4PSDA 1WB4A 1PV1A 4H7KA 1J06A 2JEYA 2XT0A 3WJ1A 2QM0A 4EY4A 3NGMA 4MXDA 1XLVA 2JF0A 2Z5GA 4LYDA 2AJCA 3QMVA 1L7QA 1UXOA 5A2GA 3RK4A 4BE4A 4QE3A 1MX1A 3I1YA 2XI4A 3AJAA 4X95A 3IBTA 4H35A 2WHRA 1XZAA 4X6XA 1BCRA 5ALNA 3A2LA 2JGLA 4DMCA 1LBTA 4J0DA 4Q34A 4G8CA 1QJ4A 1BEZA 5CT9A 4AZ3A 3NOXA 3FCXA 1EVQA 2ZSIA 3A6ZA 3MUOA 4ZWNA
chains in the Genus database with same CATH superfamily
1M75A 3K5IA 1NI4A 2M6SA 1D0IA 3EIXA 3LRTA 2DH6A 5BN5B 4AMUA 4N49A 2JCYA 2B7BA 2OOKA 4DQKA 1EGVB 1QRSA 3EZ2A 1HOXA 1EGQA 1HT0A 1JRLA 2JCGA 1QRAA 1U8XX 3L9XA 4R01A 2C3PA 2QRMA 3O8BA 5EP1A 4GMHA 5JQWA 3L2OB 1ZCZA 2J4FA 3K4QA 1EFVA 5A7FA 2CNNA 1HO3A 3PA6A 4FGKA 4KAXA 5IJ0A 4XRGA 4FR0A 3D3WA 2GAAA 3U9LA 2V9ZA 1YBHA 1GUFA 1I80A 3BHMA 3BWVA 3T54A 3QIAA 2XQIA 3E9DA 3KWFA 4A2WA 1HLPA 3KEFA 1XLWA 3GWZA 3HJTA 3OU7A 2ZRLA 2I87A 3AR3A 3CX6A 4YECA 1J99A 5PGMA 1WB5A 2PA0A 2VPTA 3EIHA 1H8HA 3D54D 4B44A 3Q7QA 5ALRA 3WNVA 1E2HA 4BKMA 4J43A 1I01A 5JWRA 2O7NA 4HDSB 3DL0A 4PAMA 4U7DA 4X60A 2GXAA 4FDVA 2V74B 1KHTA 1TVMA 3ZE9A 4AKEA 3VKUA 1UADA 1IBLB 1WU7A 4F6CA 1OD6A 2NN3C 2PBFA 1VG8A 5C7OO 2WI8A 2ZJ0A 4LJRA 4X92A 5FADA 3KZXA 3L77A 4MUIA 3BGVA 3TEFA 3WX0A 3AHGA 3QPVA 2EC5A 5E4FA 1SCJA 5C9ZA 1E3WB 4RTQA 4J9VA 5D5QA 1NU6A 1K86A 3N0VA 3O4VA 3HU5A 2PUGA 2AC2A 4EF4A 1MA3A 1NIJA 3DMHA 5ES3A 1OY1A 5AVRA 5JRZA 1XYYA 1RZRD 1VHWA 3SSNA 3ZD9A 4E2FA 3QWFA 2FSFA 1BROA 1JBKA 2LTAA 4R98A 4V1CI 4XKJA 4KLCA 3K6JA 4MTCA 5CXXA 5SY6A 1EK2A 2VYND 4DQ0A 1I4WA 4I8XA 3ANSA 4DA4A 3DL2A 3ODGA 10MHA 3BSSA 2XZLA 5DZSA 1KZGB 3HB4X 3KJXA 5GV7A 3VV2A 3M89A 2ACKA 4Q16A 2VP4A 3RK1A 3MCAA 1U4SA 3V7YA 5KNDA 1N6LA 4YJKA 3SYRA 1N7JA 1YZQA 1XDWA 4U02A 2BUCA 1QG2A 2RIRA 4V2UA 4MGYR 1VTKA 5C8DA 5T4HA 4IEFB 2NU6B 1JILA 1RABA 2G3YA 3QVLA 1USKA 3VOSA 1DDOA 5B4TA 2XF2A 1YR2A 4WOPA 3L01A 4UXJA 3ZG6A 3L7YA 3OO0A 1E7YA 3NDIA 1HMPA 3C3YA 4CTKA 3ADBA 4UFPA 4JFAA 2PX2A 1JEAA 2PZKA 2WHPB 4PAOA 5DHTA 2NACA 4K86A 2XTMA 5HDQA 4IDPA 1O3YA 2BLNA 3P27A 2W71A 4QNRA 4ROSA 5M3BA 4X1YA 4C76A 3OLVA 1TJYA 2XEXA 1XP8A 2WIJA 3JVUA 4PGGA 2WF7A 3U40A 3L0BA 2IEDA 4WLEA 4EHJA 1RACA 2AA3A 3LHIA 3QYAA 5E3HA 4DRYA 5K6AA 3BOSA 2AHOA 2BKUA 5DHAA 4EITA 3AV0B 3H7IA 2OAQ1 3GPBA 1VKNA 2G77B 1GZ3A 1HE8B 2P78A 2PL5A 2RJ3A 3DZIA 4OXQA 5EOVA 1GD1O 2HA4A 1NFQA 4TSRA 4CCWA 4EH1A 1XBTA 1ZGAA 5JTTA 5DNUA 3HVHA 1U3VA 2ZCUA 3C3PA 1I4OA 2I1WA 3H4VA 4TVOA 3DHNA 1SHLA 2QXYA 1VYTA 2QL9A 1FLDA 4YO7A 1UZUA 3I83A 3GOHA 1B6RA 4C6RA 3HM9A 2GEKA 3K2IA 1TYAE 1B8OA 1FTYA 4PFJA 4U2GA 1YQEA 2DFTA 2WA2A 1JA9A 1NWHA 3F9CA 3PEUA 3V8EA 1GUBA 1GTRA 4ND7A 1OUMA 2CSUA 4Z4GA 5JJLA 1RHJA 1TPYA 4JC0A 1MT0A 2J0SA 4MV4A 1J24A 4Q0MA 1PSDA 2MT9A 5DTEA 1OA1A 3TVYA 1PFWA 3U49A 4RACA 2HU8A 4ZCPA 3EXAA 1JEYA 2JEZA 5JVDB 5HHTA 3UG7A 4A10A 3F73A 2Z9DA 1T25A 3K09C 1G2IA 2BC9A 2HQBA 1UBNA 2JFQA 3MTGA 5B3JA 5E6SA 4G2TA 4ZYLA 2HPAA 5C7YA 4ZC1A 4Q4DA 5IFLA 1KDVA 1VZ3A 4YAOA 4XRRA 1QGZA 1DBWA 5KNBD 2POQX 2R6AA 3C6MA 1GPWB 1W94A 2RI1A 2LPMA 5C3UA 3K70B 1ID1A 5FQOA 1YDGA 4ZHQA 3W6OA 5TMPA 3AVWA 2ZJZA 1NM5C 2XRZA 3PXGA 1DRWA 2HR1A 1GLNA 3RFXA 2JAXA 3N58A 3ZJ5A 1TFRA 3H9QA 1KBQA 1ZQ9A 1K0UA 2IHYA 4GX2A 4PSCA 1YVPA 2OHOA 3K5HA 3D2LA 1QYCA 1IUPA 4NQZA 4KHZA 3KU1A 4WOKA 4KK3A 1NY5A 1YB5A 4ARSA 4DFDA 4GRAA 7AT1A 1XRSB 1K7FB 4AICA 2CVQA 1GPYA 1A7JA 3O1JC 3I6MA 1SBYA 1TM1E 3HN7A 3SDBA 3EWNA 2WM8A 3RW9A 3GEMA 3ZWPA 2ZIEA 4DMRA 1DG9A 1OWOA 4FGLA 4YAGA 4H1HA 1HDRA 1BU5A 3AK4A 4WUTA 5E9QA 3LDHA 3EGDA 3VYUB 3H2YA 1D4FA 2MJLA 4JX8A 4AAYA 3DZGA 3OJCA 4GVPA 3QX9A 4DWOA 4JC5A 1IONA 3JAWB 2FQQA 4RC9A 5DFAA 3B1ZA 3T3PB 3ZX4A 4BNGA 1T5DX 2ARKA 3I01A 4WQMA 2I3DA 2C31A 4BAZA 1DZ3A 1NXQA 4QGAA 2OGSA 3SHTA 3ZJUA 4S35A 5CYPA 3HJAA 4MPDA 4JUBA 3VO8A 2P9EA 4AW9A 2OZEA 4E5UA 1IJBA 5JS1A 5AVJA 1UODA 2H4ZA 1BGWA 1RFLA 5AJTA 1FLAA 1ENYA 1NN1A 2FPXA 3ZTYA 2WA1A 3JQ8A 2B36A 4FFWA 4CLRB 1COWD 2CFRA 4QL3A 3UAYA 2RFLA 4KXLA 1ZMRA 4AQ7A 1XPOA 4UOQA 1DEKA 2VF8A 1TD9A 3PDUA 5EC8A 3PTAA 3CVWA 2MINA 5CDTA 4XLZA 2P90A 2ODBA 3C8MA 3GUZA 1QAQA 4ML3A 1N75A 2EJCA 1G6Q1 1DWQA 2AB0A 5MFPA 1GDTA 4CDGA 2YIMA 3ESXA 1FQWA 2BMFA 3NYWA 2M1XA 1UC9A 4ED9A 3PJGA 4J6FA 4MKXA 2JFZA 3ASVA 2E37A 4AQDA 1T2AA 1J09A 3EXIB 3HYTA 1BMFA 2O7RA 5EIOA 4WOCA 4BFCA 4DJAA 3AUFA 1VLMA 2BHTA 3VVCA 4IR7A 3SFVA 1NYRA 4YJ3F 2HMYB 3GO4A 4DLTA 1A8UA 2XWSA 3WGMA 2EWWA 2XOEA 5C31A 2IOHA 2LIVA 2OFXA 3GLKA 5BT9A 3TTUA 4RVNA 1GGFA 5AI5A 2R2GA 4E3ZA 2HV9A 3LGXA 3HO6A 3CLRC 5IH3A 1N8NA 2HL6A 3TZCA 3CZRA 3KD2A 4EI7A 3VR1A 1L3CA 2VSYA 2ZSFA 1W6UA 1KDTA 3FWHA 4UHJA 1DG1G 2RB5A 3ZY4A 3HI4A 3UK7A 2WMDA 4MR7B 4ZGBA 1GVHA 4EKGA 4QELA 3LPDA 1YCFA 3TKYA 1MJ5A 2XNDA 4UAVA 2JK0A 3A6DA 3QW2A 5D00A 4YRIA 1Q6YA 1X87A 3G3EA 1TT7A 3OPYA 5AR1A 1OIVA 4KFSA 1E0JA 1GU7A 3DXYA 5ER6A 2FUKA 3Q72A 4I55B 3RS5A 3TSWA 2V98A 3DEAA 1X0XA 3U6KA 4LNUB 3NAQA 3KSBC 4G9EA 5HGXA 1MQ8B 4L8GA 5T4BA 2XGSA 3E03A 1AF4A 4QPDA 4DLSA 2W2LA 1SUPA 1U2QA 4RKFA 1QHNA 1U0FA 1MP0A 4MX8A 5K3BA 3HXMA 1L2TA 3VO2A 1ONNA 5F7JA 3T7SA 4TROA 1Z2DA 1R0XA 4MVJE 4U9IS 3OURA 4Q7JB 4ZOEA 4P4UA 1U9JA 2VTEA 3LNTA 3N8NA 4O4IF 1G8AA 1EVLA 2C5LA 4OQFA 5FOXA 1KIMA 4KU4A 3B1VA 3KAJA 4W9RA 5IVPA 1E32A 1NJ2A 1XQYA 3IQIX 4ZMSA 5CEFA 2HSWA 4WACA 2XCSB 5AW8A 4QXAA 2GYWA 1IDOA 2KQUA 1UPUA 1IB6A 3PGJA 1IHXA 1NVFA 2V7BA 4OQEA 4GGOA 3VUFA 1GNPA 1TK9A 5FX2A 2YHIB 2KB0A 1WXQA 3E5NA 1G5RA 1VG9B 1ML4A 2Q6OA 3ABRB 3M34A 4NV1A 3WFIA 3PJEA 1NUSA 2OEPA 4LRXA 5F77A 1X80A 3B5EA 3VC2A 5HSGA 5FOTA 3MYYA 1DLIA 1HXHA 1T2NA 4ICIA 4PFQA 4RVDA 3WGQA 4KLAA 3BBLA 5IT0A 3RYFB 5KQMA 2VP2A 3DAYA 2AW5A 2ZWPA 3ED5A 4O02B 3THOA 4BZQA 4EJFA 3EYAA 5EI5A 1NMYA 1PFUA 4IJ5A 2XXAB 3RTGA 3LSTA 4QPZA 4RGQA 1WE2A 4YUAA 1FMFA 2WF8A 5K0FA 3AR2A 2O1EA 4C5BA 4WJLA 4UW9A 2ES4A 3PHHA 3JQ6A 4KNVA 4BKQA 1NPDA 5A6SA 1HG0A 2R8XA 3T7AA 1BWQA 2YKGA 1NQWA 3RYCA 3AEQA 2ORWA 5BMVA 1H5UA 3BORA 3PCTA 5FWYB 1EFAA 2ZRKA 4WRRA 4ETIA 5BW4A 3IVRA 4ER5A 3DVAA 4RCVA 4ZOQI 4E3WA 1QHSA 5JDCC 2C4TA 2QROA 5GGXA 3KUUA 3A37A 4C7MA 2PNFA 1TJ4A 2R1UA 1ZUNB 4NFLA 3ZGXA 3FTDA 3KHKA 3K0HA 4FGJA 4RSMA 3BC1A 3ANLA 3BSWA 3AR4A 4CT4B 3R9WA 3HY3A 4LJ7A 2IXEA 1AQLA 1GCGA 1P74A 1KAEA 2D1YA 2P1ZA 3VKGA 3PC6A 2EZ8A 1PDVA 2H29A 2QUKA 2H1WA 2DAPA 3A4TA 4Q18A 2R6DA 4EX6A 1R00A 1OIWA 4Y3UA 3CYFA 4K87A 3BHJA 4IHJA 1PBNA 3E70C 1YS7A 1ZDMA 1E20A 3IP5A 1PJQA 3ZOZA 2AMJA 4EFDA 2Q3HA 1CJMA 1JMVA 3V8MA 4CM4B 1I1HA 3U39A 1T4CB 3DYIA 1G8MA 3VU8A 2XDAA 5BT8A 1XZPA 2OORC 2Q3MA 3CWZA 1XTVA 3VZSA 1J90A 2BZ0A 2XCUA 2P4QA 2ZE8A 4YRCA 4RD6A 4BKRA 5H80A 2EDCA 3IOYA 2BY4A 3QJYA 1D1TA 2WHPA 3EOBI 5A03A 2LCFA 1PVDA 1VB3A 3H2HA 1P17A 2DFNA 5EWLB 3R5TA 5JNSA 1JHOA 2OQ2A 4JA2A 4A92A 4BVJA 2XVXA 1NZJA 2AQ8A 4KBFA 4N0QA 1VMDA 1BYIA 2PZEA 2G9RA 2WU0A 1Q7GA 1CUCA 3JD1A 4D0RA 2C7PA 3D43A 3JQAB 1US8A 1S8NA 2Q6TA 2QT0A 2XMQA 3ZHZA 3STTA 5LQNA 3DDOA 2D5BA 4LSWA 4XQ9A 3WLTA 2CKMA 1BRTA 3AM3A 3EXFA 4OOEA 5BUCA 4CL2A 3EF0A 4NYIQ 1BS2A 1QCZA 2BKXA 3HS3A 3QKRB 4YAFA 4YRZA 2P6NA 2YFQA 3EW7A 2QL6A 3ZV4A 1JHMA 3AIMA 1DWUA 2PGDA 3V1UA 3BB1A 3L4KA 1M0EA 5CW1A 2CCGA 1RDFA 5FI1B 3WLOA 4BQQA 4N0PA 4UE3S 5BW6B 2DETA 1U0LA 5E2BA 2FX3A 2VHXA 2WTEA 4JJKA 1XTRA 2QGNA 2B1QA 3A9VA 4J91A 2PKQP 1YB4A 3OWXA 4O4LF 4DV2B 3K70C 4PG5A 2V7VA 4EUNA 3BA1A 5I4KA 3JQAA 4HAIA 1EHIA 3S1SA 1SCNE 4GKKB 4KO8A 1DUVG 4FX5A 5I01A 1Q0SA 1KI3A 2X5XA 3COJA 4WPGA 4MO9A 1AUXA 4Y6PA 1Q0RA 3PQ7A 1MW8X 1YQWA 4P32A 4V3BA 1SEVA 1VBFA 3EGIA 3FRHA 3KKOA 1GHTA 3KXKA 4FDMA 4GAEA 3C3MA 4XR4A 2UZAA 4G0ZA 4ZRDA 4NMMA 1KYWA 3RT1A 5KI6A 2FP4B 1QZUA 3GCWA 4B43A 3A1TA 1U4NA 3DFUA 5CCXA 2VG8A 2YNMD 4C4RA 3TRHA 1OREA 1JAYA 2B6NA 3LQ4A 1Z5GA 5CB4A 3C1OA 4YFVA 1K4KA 3BDIA 4Q3AA 1V47A 4JL8A 2G1AA 5AI8A 1AA9A 3NB0A 1HNXB 1Y80A 3EZGA 3NBAA 2FZEA 1ESMA 1FTQA 1MFZA 2Q5IA 3B38A 1PFGA 2VXCA 3H1TA 2I7XA 4OIMA 1EUDA 1ODIA 5COAA 5DYIA 4FOPA 4ZVVA 1VHLA 4YS6A 1DELA 3H97A 3OZXA 4CQLB 3UMSA 4C7OA 3X1JA 1T2UA 4M38A 3HNPA 2AIRA 1NSYA 5CT6A 5CK5A 4TTQA 3W8EA 5J2UA 1QHIA 4Q9HA 1XQWA 4UM8B 3T7DA 3A32A 3UAGA 1OBOA 3FYUB 1P75A 3EASA 1Z68A 3A11A 1VFPA 2OV6A 1VRCA 3AERB 3OY7A 4O2BB 1E0KA 3J80A 4BDTA 3LL4A 4XD7D 3BKXA 4HX2A 2HJ9A 5EPOA 4TWBA 3FPCA 3ZIAD 1AKTA 2ZKLA 4GYJA 2H0AA 3WGZA 5IG2A 5E0OA 2JZCA 3NVMB 4LYAA 2GKGA 1Y8QB 2DWOA 4MV9A 2QHXA 3MMZA 4YV2A 1MLDA 1Q0UA 4KE6A 3RVBA 3K0SA 1WVIA 2E6UX 3ESAA 1GU1A 4CIWA 4YN3A 4HZGA 2R5FA 1E0SA 3G13A 3BREA 3AM4A 3PUIA 4Y1RA 4CL0A 1B42A 3FPFA 3MIZA 2HF8A 1FQJA 1QB8A 4S24A 1CJUC 3GLIE 1I3MA 2HC9A 2P4SA 1M2KA 4N6NA 2J5XA 1W76A 2FSUA 4MI3A 3LT4A 1C4OA 1A4RA 2PU5A 3LQRA 4BMZA 4BFZA 2QE7D 3D3QA 4F7WA 5KQLA 5JBIA 3PFWO 2XOKD 5ALQA 3M5WA 1EWTA 3P2JA 1GKIA 1RXSA 3UHFA 3JWGA 4IJKA 2JGIA 5JZSA 3GLTA 3IILA 4AUKA 4AJHA 2YRWA 3V1LA 2BGJA 1TYZA 1E9VA 2ZWMA 4IUBS 3CLVA 2BJWA 4E2ZA 2BHSA 2P4EA 1KC1A 1SXGA 4F6RB 1WPGA 3ZU6A 1KU6A 1KMHB 3ICQB 3HI6A 1C8KA 5KOHB 4UTVA 3W6NA 1ULBA 4ENVA 2O8DA 5ALGA 3EVDA 4FMBB 2BI7A 4J1QA 4LJSA 4NEGA 2B37A 3JARB 5KAMA 4B79A 1DFHA 1I7PA 4IFBA 2EL7A 4LPKA 3H4TA 4EAAA 3SQWA 1A9SA 2C57A 4JUDX 5EXEA 4EBFA 4WX2B 4F06A 4Z49A 3O9ZA 2QVXX 1R18A 2BKEA 3DPSA 4COOA 2ZDGA 3OC0A 1DQRA 1C4WA 4HWTA 3CGWA 4GPD1 4YQYA 1XXHB 1VKZA 2JFOA 4CM8A 5IZCC 4P58A 4ETNA 2W6QA 4B9EA 1JSLA 4N0MA 1RXWA 4X3PA 5K0LA 2C2HA 2I2FA 1Z0DA 1ZMOA 2PXHA 3BGOS 2ZIWB 3QBVA 1RRGA 2D54A 1B8PA 1PHRA 1P9WA 1YI0A 2J9YB 1R4NB 2XH8A 3HU2A 5EZYB 5ITZA 4M1MA 4CI0B 2WFLB 4M9XA 3SXJA 4GR5A 1YA6A 3CR7A 5CK4A 4JLOA 1TA4A 1SH7A 2IOQA 1G2QA 1DAEA 2VYVA 1BA2A 3I5XA 1RTTA 3G9XA 5KYYA 1P4JA 4F97A 3PGVA 1D09A 5A3VA 4JQSA 2H2IA 3H8WA 4KO2S 4QUKA 1R37A 2P9TA 1SXIA 1GQSA 2PX8A 4H17A 2X6TA 4XD2A 3FFAA 4PR3A 5FAXA 1Y7LA 5EJGA 1M0WA 1QVAA 2B8JA 2P4UA 1JIVA 5J5VA 2O8CB 3EUWA 4MHTA 2DB3A 3ET5A 3KQKA 1B8NA 2PKWA 1UFQA 4UKDA 4S1OA 3FMFA 5DO9A 1ISSA 1BDBA 3CS3A 3K30A 3QENA 2N42A 1YZKA 4U6SA 4URFA 4DMKA 3QPWA 4HNUA 1G5HA 3DOFA 4IRXA 3PTLA 4MW2A 3BMOA 2AJTA 4A8TA 5KB3A 4NZ9A 2Z4TA 1GPUA 1R9NA 2A30A 2C94A 4NENB 4JR1A 3NUGA 1KYQA 2X2OA 1U7XA 2C9CA 3U4IA 1RYHA 2R4TA 4NQRA 5CA0A 4AJ2A 3FTPA 4YEDA 2SBTA 1DTEA 1SHUX 4E0BA 1YQGA 1DAIA 5F52A 4GMFA 1Y8QA 3ZZUA 1E64A 2Z08A 3TNFA 4XVQA 2D8MA 1P44A 4XD7A 2MOKA 3BQMB 4LGCA 1QU3A 2VC2B 4GVXA 2B0JA 5DN6D 5EUMA 4MGEA 5FP0A 2WWFA 1GSOA 1W0CA 3EBOA 3V3TA 3B85A 1Z6GA 4XIIA 4FXOA 1EP1B 2FPOA 4UTOA 3UZUA 3TTYA 3DB1A 2HUNA 2D3WA 2GR9A 3I9LA 1O5OA 4IVNA 4J2OA 5REQA 4UFOA 1IULA 2QAGC 2RAVA 1H05A 2OAGA 4DLXA 4CEJA 3ILYA 4JI6B 2CDCA 5P8WA 1EJ6A 2IL1A 3KWMA 2HIAA 1ZJ4A 1CF2O 1TT5A 3ZX5A 4CJXA 1P5JA 4UBNA 5DISB 1SUDA 3DQPA 4BLPA 1QTIA 4HZUA 1H9AA 1Q84A 4DV4B 1UWCA 3OE7D 1F06A 1IK4A 2LV8A 3O74A 3BXXA 2PLFA 1UDXA 2LBPA 3LGAA 4GIBA 4C14A 2XDYA 4ISBA 2G40A 3NHYA 2X2EA 3EAGA 2WJPA 5C34B 2CHQA 3UMBA 4NCHA 3AOGA 2RB4A 4F93B 3E2PA 5I9IA 3AXSA 1Z88A 2J3LA 2P3OA 3DTVD 1G8GA 4O08A 2AD5A 2D1QA 1U2EA 2KLHA 1E6KA 4KN8A 4LJ6A 4UJ3A 5AK5A 3KFVA 4RY8A 1MX9A 4HQFA 3DZJA 4FS8A 2PUCA 3IFSA 4KWIA 2WT4A 4HAZA 1P1FA 5DLEA 3GYBA 4K81B 1DMSA 4N40A 2O14A 1I2MA 2FPSA 2ZVPX 4CIXA 3N5CA 1SIBE 3AJEA 1NLFA 1MQAA 1ESZA 2ZRJA 3IAS6 1POWA 2N1MA 4KQMA 4ZZIA 1YS2X 2QENA 2IHJA 1TZKA 3DOJA 2PS9A 1T43A 2Z09A 1KU0A 1I4LD 3W2HA 4EHHA 1N6HA 3EULA 4FHCA 2G5TA 3H2IA 3L5OA 3PRHA 1I1NA 2O2EA 5H70A 1ZRMA 4HQLA 3IQWA 1EFRA 4IL5A 1DBQA 2RJNA 2IOFK 3UOGA 3SKYA 3HUDA 4V2IA 1NN3A 4RORA 1JU9A 3SCZA 1QRDA 1S9HA 1ZH0A 3D8HA 3HZZA 3SC3A 3BUSA 4XYGA 5IH7A 2I71A 3INGA 3JRXA 3Q2KA 2RHGB 4NIMA 1M6YA 4OUKX 3PQEA 4QUAA 4C6SA 1Z47A 4UU1A 4AU1A 4O33A 1NHGA 3ZY2A 1AQJA 2VDRB 4LBYA 2FXIA 3H65A 4YMTA 4BNTA 1L4LA 2PLRA 1UJMA 4FNAA 2ZYSA 2J8ZA 4ZVPA 4A2CA 2TMDA 2G06A 4FCWA 1QFZA 3OM0A 1UT6A 4FOOA 1P2TA 3K2QA 1RM3A 3OPYB 3AJ9A 1AKRA 4IG9A 5TC4A 1CP2A 3K0EA 3OIYA 3CLTC 4M7PA 1N5LA 4DYVA 5LVAA 1EIWA 2K6GA 1ZU4A 1CK4A 4X63A 1H9BA 4L9RA 5DBOA 2O1SA 1WKBA 2GZ3A 2W83A 2OK8A 5B1DA 3RHZA 4DG5A 1JSCA 3OZRA 1UAAA 2IYSA 1L7NA 3A7EA 5B55A 4NBLA 2RGNC 4E6PA 1O96B 1MIOB 4N7JA 3BRWD 3ZVRA 4V02A 4LQDA 1MEOA 4M0MA 1KEEA 1NZFA 4WBSA 2PMEA 1KRHA 2VRBA 2H57A 2HADA 1RHQA 5EZ6B 4KP7A 1HYHA 1O95C 3JU3A 4H08A 4TUYF 1KQOA 2FHSA 3F71A 5AICA 4J4HA 3EVEA 2IEYA 4FQ7A 4L5CA 1CVRA 1NBMD 1C0KA 2YJ4A 3KDSE 5JXHA 1E2KA 2OGZA 4K40A 3R6LA 1G9TA 1T9KA 1QIDA 4R1SA 1XHEA 1FP6A 5K4GA 4ZVRA 2V3CC 5K3DA 4OGFA 1M0TA 5AJUA 4NFSA 1D2GA 2IIVA 2H9AA 2QL7A 4PYQA 4EW2A 1R66A 4ER6A 2WKQA 3EN0A 5K51A 1THTA 3LF1A 3CRVA 1OSNA 4Y2QA 4HH4A 5CNJA 1XROA 1ES9A 3EPPA 5CIQA 1XK6A 3T5CA 5GONF 3TG8A 1N5KA 2AH5A 3IVCA 3OCZA 2R00C 1LF5A 4JMLA 4FYHA 2FN4A 2HY7A 1P7VA 4PYIA 1GAEO 1NBIA 2AS0A 2YS7A 4I9UA 4YP6A 2H3HA 5K6RA 2QRGA 5LP6F 1QS0A 3NEJA 4LDPA 1R8SA 4BCBA 3WDMA 3KOXA 5A4AA 2D8AA 1NTOA 4OU5A 2RGXA 4IJVA 1DDGA 1Q7RA 3L46A 4HQRA 3GLGA 3BEOA 3Q0TA 4N9QA 3G59A 4KL8S 4E5MA 1FNCA 2RGDA 4XCQA 4RZIA 3FSJX 3SYNA 1PYGA 4JVSB 3IV7A 1GG5A 1YZGA 1Z17A 3AF3A 2K2WA 3L1UA 1KQPA 1NP3A 4JVNA 2PKYX 3DDUA 4PTLA 5F7ZA 2I1VB 5BYJA 3BD8A 3GJ0A 4NF2A 3X1ZA 3Q6IA 3JVIA 1IUOA 3MHPA 3Q6NA 4IV8A 2NADA 3O83A 3QGMA 3W6ZA 1JHZA 1YNOA 3RASA 5JDIA 1IZ7A 2CL0X 3JRNA 4D02A 4RK0A 1DT3A 1Y8RB 1G4AE 1TVKA 2C99A 3I73A 2Y3IA 2H7CA 3DMGA 3URMA 2WTXA 4CF3A 1SCKA 1YJXA 1JX6A 5DPMA 4BX2A 2GAOA 1A9RA 1V95A 2F67A 2V55B 2VH1A 3FUWA 4ZALA 4B32A 1SELA 4BIMA 2JG3A 3FSRA 4HWPA 4YMIA 1HDIA 4XQCA 1PVOA 2QTRA 1ODTC 3QWIA 4GU5A 3PQ2A 1J56A 1X7HA 4RY2A 1V1MA 3FNRA 2F3QA 1T24A 4JR0A 3PNLA 3UWKA 4QG3A 1IMJA 5BV8A 2XNJA 1XPRA 3OZWA 2R4UA 3FLAA 1AUOA 4HAVA 3BBPA 1FZTA 2RHRA 1HE4A 1I24A 4GE3A 1TIPA 4FFPA 2VCEA 1T2FA 2XYPA 5LXTB 3NOVA 3Q9UA 1HYGA 3WTBA 4XI9A 3T1YB 1PS0A 4OD0A 4L6CA 4UVIA 3NM4A 4GR9A 1JQ5A 1K6EA 1GKUB 1Y4SA 5A5DA 1EJ0A 4HOYA 4ZRNA 4OB7A 1ACMA 3TB4A 3KQMA 4U7PB 3G9ZA 4MKGA 5JCOA 2YNMA 2ZBVA 1NVVR 3AF0A 3R3YA 1X7XB 1U81A 8LDHA 1BJKA 3BD6A 1EFPB 2WPDD 1XZBA 2PUTA 4JEIA 1VRVA 4HJRA 3VR2D 4OGLA 1QVZA 3WDKA 3EGVA 4MV7A 4KPFC 5AKGA 5LKRA 1FP7A 3GGSA 3QFTA 1OAOA 1Y8ZA 2AUTA 2G1JA 1M5UA 1KPHA 3W5HA 4HZIA 2O8FA 2BI8A 4RYDA 5F5NA 4HPJB 5F5LA 1D3AA 4G56A 1T3LA 1VG0B 2V7UA 1GJRA 1M1UA 1YMUA 1YD7A 2X4IA 2X9QA 2YRXA 3IULA 3RANA 4JU8A 4KI0A 3AETB 1V11A 3Q3HA 2GZHA 1V5FA 5AOVA 2V4UA 2JLBA 4GGPA 5AESA 1NBOA 5F78A 4OHWA 1Y5RA 2HCBA 2NUAA 3CB4A 3MWKA 3U37A 1HETA 1NXVA 2CHUA 3SEAA 5ECYA 1B8UA 1ST2A 4YMVA 2OCLA 2GAIA 4UVDA 4O0MA 3ZWKA 2AKYA 1PNQA 4MB0A 1IN7A 3KDPA 1ZO8A 2WKWA 4HJXA 3F67A 3VI4B 1Q92A 1WDLA 1XL1A 2GH1A 2AUMA 3B89A 4FHFA 1KOGA 2FN9A 3SIWA 4C1BA 2VZLA 1M1NB 3FKSA 2DY1A 3GEIA 3HO8A 3KL2A 3NDJA 4FBLA 3MAJA 4NZYA 5EG5A 1FCJA 4C43A 4ESHA 1E7QA 1KK1A 3NETA 4DG9A 4MRNA 3LOPA 4ZCMA 2PGIA 6Q21A 1N7HA 2DQ4A 3ZWQA 1PL6A 5EHQA 4E30A 2FMXA 1Q0ZA 2QAGB 2VN8A 4QPPA 3WRXC 2D2IA 1IYZA 1U8EA 5BNWA 1P1IA 3HB0A 3KLNA 4IOLA 3S27A 3WWZA 3LFHA 4W8HA 2F1IA 1P0MA 3O91A 1N1EA 3SDZA 1ISMA 4OFBA 2AZMA 3FNFA 1FXUA 1YH3A 1VHQA 1P33A 2FEMA 2HNAA 2WJWA 4RIEA 3H87A 4ZU3A 5IASA 3GVXA 4XH9B 5EQFA 1JG3A 4FKMA 1RCFA 3K16A 4G5GA 1PUIA 4MMZB 4NJEA 1M7BA 4I9NA 4PAWA 5BYAA 1H2BA 3SZOA 4BNDB 4CR6A 3VHRA 1TA9A 2JGKA 1HM5A 1OWMA 4JN6B 3ZLJA 2VYCA 1E1QA 3L7OA 3JASB 1BE0A 1CUSA 1GAQA 2EVWX 3DR5A 1KEUA 2JFWA 2N47A 1VBNA 4WK0B 2HJWA 5IAOA 2P69A 3D4BA 1WU8A 3LY9A 4RO0A 4AN1A 3WYAA 4O2BF 1SBTA 2R47A 1NRJB 3CW2A 1CW2B 5JYDA 1SR8A 2DYKA 4X1IA 4RELA 1NW3A 1JU4A 2O6HA 3HWSA 2OXTA 2C0CA 2I1LA 2CEAA 3FHOA 4HGOA 4JUIA 4R16A 2CEKA 2VAVA 1B8VA 4RD2A 4MDHA 4XWGA 3R7FA 2BEUA 4Y9TA 4Z3OA 1KVSA 3PLAE 3PKZA 3T7RA 3F78A 2Y76A 2VPXA 4ZGGA 1LNZA 1NVDA 1M2GA 5BSVA 3H5WA 4DIMA 1QFXA 4DT1A 3NMUF 4NICA 1XMSA 2TMGA 1NC3A 3ZXYA 3VH3A 4CETA 2BT4A 1NVUQ 3ENVA 2GYYA 2B4AA 1ZH6A 4DQVA 1EG2A 3VTKA 2C9DA 1Y9DA 1OYOA 1UZNA 2IXBA 2QVGA 2C2MA 1FMLA 5F76A 4EHLA 2VRNA 1ZGCA 4YJGA 2C4WA 1FNMA 2X14A 2L69A 3QFRA 4A5SA 2FLWA 2P2DA 4FE7A 4P4NA 4LGYA 3RYHA 3IXLA 3CPEA 2X5KO 4MW1A 3UFXA 2AYYA 1I33A 4MZDA 4F5YA 4JUAA 4PQYA 2CJPA 3SHVA 1Z5UA 1UC5B 1BJTA 3M6FA 3PFFA 4NG5A 5AKIA 2GCOB 5FTWA 4BGIA 5KJ6A 5JECA 4X6LA 1CRLA 4FFMA 1ZVVA 1GXSA 1E4VA 4MR9B 3VR2A 1H93A 2AOUB 2WFZA 5CJPA 5TB5A 1F6DA 1D4ZA 2OSVA 4NONA 4YFYA 3V5NA 1N2CB 5CXSA 1XCMA 4GI3A 3W7AA 2MCFA 5LYJA 4IIHA 1EEXB 4MUMA 5I4CA 4KPGA 4GYYA 4GR4A 4Q4JB 3ZGOA 4ROTA 4E11A 5HMLA 2VHQA 3E53A 4G5RA 4NU0A 3RC9A 1MUUA 2O3SA 1DIRA 1EZ1A 3L0YA 3LT0A 1K8ZB 4V0SA 2QG9A 4L6AA 2XYRA 1N2SA 3NIBA 4W82A 2GCPA 3LOUA 4WMLA 5DW0A 3U9TA 1G8FA 3I52A 3IIMA 1UFRA 3NDRA 2Q1WA 5FPTA 3K94A 2QQGA 4TXHA 3IUJA 3DFZA 3GV0A 1M1YE 1QMPA 3EA0A 4QXMA 5I9BA 3PE6A 4DY4A 3CNNA 5FPQA 4F4UA 3OEHA 5C8VA 3GFGA 1JJBA 2P62A 4GPZA 1GXSB 2A0KA 4FYIA 4UVHA 1HSZA 1K9VF 2QP9X 4K0KB 2FPIA 4XGRA 1EMDA 5ILGA 4UJ5A 3AEQB 3LWZA 3RSQA 3NIGB 4H0CA 5I9SA 5KNBA 4FZ3A 3DLCA 3DSRA 3EX7C 2VHEA 2AMLA 1ID8A 4TKMA 4MEJA 1DL5A 4MINA 2P2NA 2XKAA 3L0PA 1DCTA 4DIDA 4LHVA 5K1ZA 4YRTA 3NALA 1C1DB 4O8CA 3L7CA 3HPQA 2RCYA 1YAJA 1J2TA 1XO1A 3D0OA 5JHGB 2XMSA 3DGFC 3G5MA 2V8OA 5BVGB 1VECA 1VIDA 2WUVA 3V8RA 4IQGA 4Q1CA 3ON5A 1LPAB 3EA5A 3ACCA 2FJPA 4MV0A 3ZVKA 1HNZB 2YXDA 4ZOLF 4NG4A 1IN8A 2PFSA 1GRNA 1MB0A 3R44A 4FI3F 4CZ2A 5CBPB 3AHHA 2PUDA 4NNJA 2WDPA 3C3CA 2AEMA 3NASA 4OL9A 4P84A 1PW7A 4BAUA 4H7PA 2A35A 2HLDD 4I4IA 3ND9A 1M6VA 1PJBA 2YWJA 1UOEA 1G1AA 2QD3A 2XCOA 3WQBA 5JQGB 1N32B 3SG0A 2GB4A 2QUBA 1E2LA 2H4XA 3GH3A 1GGVA 3H0KA 3IAAA 3HWRA 3JY6A 3MTJA 4RGYA 4G89A 4Z51A 1SC6A 2R87A 3C5EA 4HX9A 3UXEA 4ENTA 3BTVA 3FYUC 2PGOA 1NKSA 3LKZA 3JQBC 3GJ7A 4KXVA 5JY1A 1BFDA 2JLXA 3GX1A 3TUIC 1DO2A 2O0HA 4P7BA 3UQZA 5JJBA 3EXHA 3KJEA 4KPYA 3WLKX 1UWKA 3EG9B 3ZHQA 1T9GS 2H5EA 1U9ZA 2GZDA 3OIDA 4RKEA 5ALWA 4ZAVA 3PHJA 4OBBA 4QEKA 3ZZNA 3D7RA 4ASUD 4NVRA 2FRVA 1XU4A 5DTRA 4MIOA 1RVV1 5EN4A 2G0TA 2OZPA 1J0BA 1M2VA 1RHRA 4HN2A 1W73A 3MT8A 4LCEA 4D3YA 4EYOA 1GKKA 3NYIA 2CNKA 2GBGA 4QBGB 3I58A 1G5QA 1UBOS 2BH2A 4LGMA 1EFVB 3DEKA 3I45A 1OW3B 2HU7A 3KQNA 1UXGA 2PWAA 2PMKA 2VJKA 1VJ1A 2W6JA 4RK1A 3BVPA 3CZMA 4CKBB 3E1GA 1C4KA 3FCAA 2CUKA 3D0KA 3MTEA 3QOYA 4PNPA 1FX0B 1KETA 1RQ7A 4PO3X 3TN7A 4DA8A 1ZOOA 2H4FA 5B1SA 4F84A 5JXIA 3CY6A 3BAFA 2YS6A 2G9VA 1YS9A 4GSKA 4KFTA 4IMJB 2JH9A 4WASA 3TGLA 4B5LA 1II8A 1FY2A 5AM2A 3R3SA 1FOEB 4OFZA 4JI8B 2P6RA 4BECA 3KXPA 2J48A 4B2PA 3HCCA 1I94B 1CC1S 3F7NA 2BM1A 3NHBA 3WQHA 4B3IA 2O8FB 4I6GA 5IWCA 1SD2A 1XQ6A 4J90A 5KX5A 1T3SA 3NIWA 3K73O 1SHTX 4NENA 4BQFA 1MJHA 1QHGA 2NVWA 5IBPA 1SZPA 2EKPA 2PH7A 3PF8A 4WKBA 4CIDA 3U26A 1BFUA 2ZRCA 4CG1A 1DJOA 4KHPB 4L0QA 1I0LA 1EX6A 1O6GA 5FBQB 3U44A 4GWLA 1FX0A 4KQ2A 4LVUA 1T36B 1PGNA 2AG0A 2NNLD 3WDLA 5CDYA 4MGKR 2HV8A 3FHTA 2HHAA 5KYKA 1F8UA 4QXQA 5D84A 1JIUA 3JD2A 4WD3A 3BIWA 3CNEA 1CQJB 2XBLA 1VGVA 5FXMA 4ZMBA 5KYWB 3B5IA 4MWTA 4UCXA 3PRJA 1SOAA 4CMHA 5FTKA 3COWA 3QHQA 1WZNA 1FDVA 2HM7A 2P11A 4HDCA 3T9EA 4J0FA 5HWSA 5KINB 1IPEA 5DBIA 2DTXA 2Q2WA 2GZRA 3I3OA 3QFFA 5E6RB 4YP1A 3RSSA 1TL7C 4TQUS 3FMOB 3KALA 3A4NA 3JD0A 3UMRA 3KT0A 3IJEB 4LZWA 1L8XA 1SUCA 1U0BB 3B3FA 3OJEA 1AQNA 1RBQA 2BM0A 2OO5C 4JDPA 2XBUA 3JW8A 2IXTA 5H4GA 5D3MB 2JI4A 5FEMA 1YB1A 1E6UA 4UARA 1JLSA 1ORVA 1N9ZA 3KBBA 5TXGA 4CODB 5TIIA 4JXJA 3WWCA 4C0HA 2EKQA 2ZJFA 3TPFA 3PKIA 4KQKA 4UUAA 2OB2A 3IIKA 1JLRA 2NZWA 2XB6A 3RRJA 2XIQA 4MJ7A 4I3FA 4JIMA 3KR0A 3FAZA 4ZQIA 5FO0A 1CUZA 2EHJA 3EFOB 3LUFA 4JENA 1FFBA 1Z35A 1KDYA 1F1JA 4ZCLA 4BL5A 5ADHA 1JDZA 2I80A 2P67A 3SMVA 4ZT5A 2YYAA 1TB4A 3ETEA 5TQ2A 3KVVA 4LE2A 5KNCH 2JLZA 1BVYF 3E9EA 2IZ0A 2QPLA 2IVFA 3AR7A 4QDUA 5KKNB 2PSDA 3CKYA 2DULA 1BEUB 3OICA 2IIBA 4GOJA 3I42A 1WSWA 4UHFA 5BOSA 3HL0A 5LD2C 3JX9A 4ANFA 5LZ8A 2AW3A 4CMJA 1GSIA 5EHZA 3A1CA 1YA8A 3AHEA 5JZMA 4NS1A 4J3FA 1NF2A 2E4ZA 2RHHA 4N03A 3QI7A 3Q11A 1DQPA 3F3MA 1Z4MA 3GG2A 2QZJA 2J7KA 3IPXA 4HDNB 3N0RA 1A5TA 1N25A 2HSGA 2FYTA 4KLZA 4PO8A 5DASA 3SOPA 1TTPB 1E4EB 1ZD9A 2XQVA 1VPVA 3ROTA 5IJ0B 3HUEA 4B87A 4DJEC 1E0AA 3L4BC 4N7BA 1U2DC 4OSOA 3TRIA 2GJ4A 5GONB 4WESA 2ZKIA 1RJEA 4D9IA 1XVVA 2QN3A 2YUTA 3VRHA 4HVCA 5ES4B 4RTNA 4A0RA 5EQJB 5FI5A 3A58B 4BV3A 3EGOA 4QOFA 4URUR 1QC5B 3G2HA 4WBNF 3USCS 1CR2A 1W4AA 3JVEA 3W5VA 2A5LA 4K9SA 4NV0A 4N8DA 1U2PA 3RFFA 4DIKA 1WUYA 2Z04A 1O9BA 4W1SA 2J5KA 2Q9AA 4DCUA 3DXFA 3KYDB 1NUUA 2ZREA 4EHAA 1Z16A 3S2IA 1H3FA 5IJAA 1VDZA 4O29A 3SLRA 4CF5A 2OCKA 3I28A 3TEMA 4Z4HA 1V8FA 2OCGA 2YQZA 2ZRDA 4JJGA 2C8JA 3QF7A 2IEZA 1FW6A 4D81A 5ULLA 4OIFA 2VUUA 4QYSA 3V4SA 1PK7A 3ZHRA 2ORED 5HUQA 4G0NA 3K0AB 3UXMA 5KSOA 3QELB 3AG6A 2K7ZA 3GBVA 1H4TA 2VTBB 1N3YA 2HRBA 4QDJA 2NOAA 1E4YA 4TS9A 4PNZA 4CFZA 5JARA 1PJZA 4FWIB 5AHXA 3WB9A 5JBNA 3AVOA 1BZYA 4YMUA 3BF7A 1Z56C 5EIXA 1SKMA 4GQBA 1AF7A 5KX5F 1Z6XA 4LXQA 2VYVD 4X84A 3ADPA 3OSZA 5D5PA 3ZCUA 2FZ4A 5CB6A 1T0IA 1LQ2A 4N9WA 3SHFA 1C80A 1G3UA 3D7NA 3Q9SA 3OIVA 2RIPA 2Z30A 4S0XA 4KVAA 3DEYX 5FYDA 4L8LA 5F3WB 4R1PA 1DQSA 3KCNA 2R00A 1WHTB 5HCNA 4ZT4A 1ZNQO 4KFCA 4ARCA 2HK8A 3RVPA 1C4XA 2ZRMA 1WIWA 3GVCA 1A3CA 4TZKA 3HXTA 4LCBA 2H2HA 3RAJA 3RADC 2ORVA 2VF5X 4FT2A 3EZ6A 3EWAA 1H22A 1B41A 4RLFA 2Z5LA 3AVPA 4EB0A 4GNKA 2BZSA 3D4OA 5JS8A 3JWPA 5L4SA 2IKQA 2P3LA 3P94A 1R9JA 4XQGA 5HPYB 1L4UA 4JB2A 4D3ZA 4DUZB 1R0ZA 1WMBA 3FTCA 1PF7E 4JD5A 3S7TA 3ZWYA 4E4YA 1T29A 3EEYA 1OHHA 1BWSA 3N2GB 1D1QA 5AT1A 3VU9B 3RD5A 4DNQA 1CIVA 1BVHA 3O2JA 4C0SA 3E84A 4PLTA 2IWHA 4KAFA 4PLFA 3ZCPA 3O9VA 1IVNA 4I5FA 4KUGA 4DJTA 3E2MA 4BXOB 1IN6A 1LW7A 1EB8A 2WAAA 3IAEA 3Q85A 4OH7A 1W0JD 3I32A 3M1IA 2P0YA 1VXOA 3LRXA 3I61A 2XXBA 2VQSA 2WSSA 1QHEA 3D2CA 1SBQA 1P2BA 1W96A 1JIJA 4N7MA 4BLVA 4HV4A 4O2RA 3UKJA 2W5UA 4DLVA 1ONSA 1ORTA 3K2EA 4JP3A 4PRZA 1DBRA 3O75A 4U5QA 1TC2A 3EVTA 1BE8A 3QPCA 1QYIA 5EWLA 3TO5A 1QFSA 1SQ5A 4DMUB 1C3OA 3H1PA 4PQGA 1S2LA 2PZBA 2X5JO 4GM0A 1AX9A 3AUKA 4JASB 3EUEA 5DK4A 3AIOA 1T6XA 3OFVA 3Q7RA 1Z8NA 4FZVA 4OU4A 3IGFA 2G82A 4GZ5A 1MC4A 4EUEA 4ZV9A 4DXHA 2XADA 1G0NA 3GRFA 3HA7A 3SF8B 1TJNA 4RAOA 3U1TA 1I13A 1E7RA 4PTZA 3DTVA 1CR6A 2AK2A 5FPHA 3AHDA 3ZEAA 1PN3A 1KQGA 3L4BA 1W5AA 4HDRB 1OIXA 1WXDA 2HXGA 5ED0A 1C9MA 3W5JA 1OXBB 2AE1A 2BFDA 3GCDA 4C0BA 3ZZMA 2PTGA 2GYVA 1FJHA 2D0PB 1Q1QA 1ULTA 2EIXA 3D1JA 3GMDA 4CKBA 5CA1F 3NWBA 4GH5A 4OP3A 3VR6D 1MVOA 2AZXA 1B43A 1ZUNA 1S6YA 3L8YA 1FC0A 4L9SA 3V6MA 3N2EA 3H8SA 3FTEA 2DQKA 3SZMA 5E4YA 3C6YA 2BDTA 1DKUA 1O8BA 4LSGA 3BMCB 1L0BA 2WAXA 5B7GA 5K3OA 4O5AA 4P4SB 3MMXA 1ODCA 4UPVA 1EVIA 4R6XA 1W4BA 2WTAA 3KR2A 5F33A 5LZ7A 5SICE 1NVKA 1XDZA 1DRVA 3RVDA 1W87A 1TM7E 2OSBA 3AC0A 2VHCA 4OKSA 5HILA 3DAFA 4PSUA 1E3IA 1EXNA 2GM9A 1DSSG 1NR5A 2GM5A 1DARA 4UU7A 4XGKA 3TLEA 4AG3A 4F4JA 3WGTA 1YE8A 4CLOA 1UFOA 1KEPA 1NMZA 3SHOA 4UD2A 2NZYA 5LOVF 4WESB 3ZCSA 4XSHA 4E5NA 2WQ6A 2PRJA 1ZK1A 2Y1GA 3B53X 1SB8A 3CV3A 2R8BA 3HDYA 3QG1A 3SR3A 5FEUA 2KYRA 5TJHA 1U04A 5FTLA 3SZLA 1R4MB 3DH0A 3SXUB 2V45A 1U4OA 3RYFA 4Q3EA 5IXSA 4B17A 1MO2A 3SJZA 2WF9A 3OUTA 2AFIA 2OHIA 4EQZA 1XVAA 1JQKA 2GPSA 3N8DA 2GTIA 5CDFE 3TXYA 3MJHA 1LUAA 3FWPA 4ALNA 4TTJA 5C4GB 5CFPA 5FI3A 5CFLA 3VMFA 2VZ8A 2TYSB 3I4FA 4DKJA 1E66A 2JI7A 4KUHA 1YU9A 4M89A 5AUPB 1DXOA 1GPKA 3QBJA 4GSYA 4CV2A 2J3DA 3ERCA 1S2NA 1PJ8A 1UBHS 2CUTA 1K1EA 2OXRA 2QMZA 2CK3A 3I39X 4Q3CA 5EL0A 3WYNA 3RHSA 2NUPB 4XM2A 1TNDA 2XRMA 3TNDA 4RTPA 4WVFA 1MAAA 3BTUA 3H4IA 4NCNA 4PLWA 1ZD2P 5B1HA 1P7YA 3I01M 1CY2A 4RXMA 1UM9B 1OH6A 4D9BA 2FJ0A 1ZGBA 2AYZA 5HZKA 3PF9A 2QD2A 1HG1A 2YWCA 5GWXA 2CFCA 1SBZA 3A6LA 1NW8A 4Y6OA 4KFUA 1OH8A 2ECFA 3TLYA 4UQLA 3TW8B 3NUZA 3NHZA 5EIBD 4FR2A 3TGPA 2QTCA 1CUHA 2VATA 4E1BA 4DNPA 3WYBA 2J08A 3SJUA 2Y1WA 2FLKA 4QTTB 4R1MA 5AXBA 1ZI9A 4C2TA 2GCGA 1YDWA 1UK9A 3QRWA 2WKSA 3ETJA 4HWGA 4IXNA 2NTYC 4Q3DA 3FDIA 4M8LA 4WADA 3FSGD 2IGBA 2GDJA 3B6KA 4MZXA 1W5EA 4PYRA 3G0HA 3CH6A 4RTLA 5DX0A 1K7SN 3R0IA 5EWJB 1JR3D 3ZHVA 5EQDA 1INLA 3KFXA 5CFZA 2ZU0C 1XWIA 1FQOA 1U3TA 2PLAA 4NKRA 4UTRA 4CTNA 3R3JA 3IP3A 4POAA 1YBAA 2CHEA 4W6QA 3WIDA 1QV6A 1F20A 1MX3A 1R5JA 2BTOA 2CJXA 2NO5A 2P9BA 2VJMB 4Q3LA 2D1RA 4QNNA 1DQZA 2QG6A 3CLRD 4OHCA 4CMBA 1RQGA 4EY6A 4B6FA 2IV3A 4HAOA 4IXMA 1OFVA 4WSOA 3ROPA 3QXGA 1OZAA 2HA2A 3C3JA 1Y7HA 3WK8A 5G2OA 4P0PB 2C95A 3KE9A 1G291 5G02A 1M8PA 2ZOSA 3W79A 5J2TF 4HDMA 3QLUA 1KSFX 2G5CA 2ZZKA 5CYGA 3ZJYA 2ZI4A 5E7MA 1UKBA 5IVIA 4XA8A 2YRFA 2EQBA 2BE9A 2ZI3A 1F4VA 1SUIA 2ADOA 3FYHA 4PVDA 4RHUA 2FWNA 5BWBA 2IYZA 1T5BA 3BRWA 3E5RA 3FYSA 3I9FA 3OPYI 3PC7A 2FR8C 1X38A 1MB3A 2KX7A 5DIZA 1T3HA 1XU7A 1R2QA 1ZCAA 4YC7A 5CURA 4Y2YA 3BEDA 4CM9A 4TOIA 1FFYA 2VT6A 4XWKA 1ISJA 3REQA 2BFFB 4JYCA 1U7UA 2RH5A 4CIAA 3CVYA 2JIMA 1SHZA 2PFKA 3TLXA 3CZCA 5AW6A 1YHNA 2OZLA 3NHJA 5EZYF 1IFXA 3BERA 3E7FA 3H5AA 4FOLA 1M2VB 3LW8A 4G5FA 4DBZA 5A62A 4KQFA 5IFKA 3AZQA 3SKVA 3ZY5A 1KFEB 3TSZA 5FOSA 4OXXA 1TMKA 3DV2A 4WKCA 4RPCA 4IJMA 2FOIA 5DCUA 4KE9A 4RVCA 4PHTA 3TLZA 2NYUA 3A3NA 4RK7A 3RC8A 5LFAA 3FDZB 2WJJA 5ECWA 1KI1A 2E2WA 2NMVA 1H2XA 2CJWA 3DF9A 1HUQA 4DMMA 2BE7A 3U3XA 5GADl 2A8YA 2WWGA 7REQB 5AVQA 1R27A 3WL8A 4HRVA 1FIUA 2QYTA 3FWZA 2HGZA 4GBED 3TH5A 4RX1A 4QDOA 1OB5A 1DAKA 1H6BA 4UHCA 2AKAB 3ZBTA 1FXWA 1OAAA 2ZAMA 2NTNA 4QGGA 3T3EA 4C0QC 1TQ2A 1T1IA 4K03A 3U7GA 4AIRA 4EDFA 1GTG1 3QLVC 4I7EA 1MA0A 1X13A 1QIGA 4DPKA 1XN4A 1TM2A 3AVUA 1LLFA 1PFQA 2DUWA 1ZVKA 4ZO6A 5FJIA 2WIKA 3EZFA 5IWAB 1GT6A 5HF9A 1XCGB 2C5SA 4RVOA 1RE1A 3PX3A 1L3IA 1X86B 3U16A 3WMWA 1D0SA 4S2EA 5A1TA 1QF6A 1KZ7B 1L7RA 3KQSA 3OQIB 1TLFA 2ZZMA 1VL5A 2VAWA 2ZBDA 3FH0A 4U0JA 1G60A 1PVVA 2CL6X 2HRDA 4S12A 5ENDA 5F3RA 3QXJA 3GUCA 1MDFA 1YJAA 3KKQA 4IWYA 2X13A 4OYLA 3DBIA 1FUYB 2FZKA 3FZGA 2DBQA 4BP9A 3VNBA 4E6EA 1OWPA 2NQ2C 2YICA 4EFMA 3IX7A 2I4MA 1Z7BA 3CZ4A 1PS9A 3BGSA 4IVRA 4PVCA 3RUPA 1PR6A 1MZPA 3HR8A 1MO5A 2RGRA 2Q6KA 4PQEA 3I2IA 2FMTA 3QUBA 3VYRB 4D8XA 1A1VA 3G1TA 3MS4A 2WZBA 4W8OA 3FVQA 1ODKA 2Q21A 2R6FA 5C5IA 4UBMA 3KOZA 5DRTA 5L3ZA 4JZYA 1L5HA 4DMHA 3NAZA 4PICA 2A2ZA 4JLVA 3RU7A 2C54A 4IIUA 5F4BA 4YCLA 2A9QA 2GPJA 2W22A 4EHDA 2ACEA 3I8OA 4PM4A 4OQNA 3HCAA 3NKFA 5AK6A 1C29B 1U8TA 2WWTA 4G5QA 3SJCA 1E9SA 3R0XA 4QOHA 2XR1A 5HK8A 1W36C 4MWBA 5JPDA 3A9SA 1UM8A 5LYYA 4R83A 5EJEA 3LQ1A 4KRXA 4PIMA 1O58A 1UBRS 1BGXT 1NUPA 3O9MA 3Q40A 3VDQA 1YULA 4RD4A 3W78A 4BVKA 5BN1A 4OY3A 1W4ZA 2YCBA 4TWZA 1E2IA 3CRZA 1MABB 1JZTA 1KAOA 3H11B 3KTDA 3CN9A 4LMPA 3VNSA 4BJ5A 5MFZA 3H2KA 3CQ9A 2BTQA 1EEHA 1TADA 1A8IA 2ZSUA 4DB2A 4QXPA 4HTFA 2PQ0A 1E6EA 4NE2A 4ZCSA 4J7UA 4R68A 4RYLA 4HNVA 2VTVA 3MHTA 4P6VF 1R6AA 1B7GO 4RE5A 5DI3A 1B6TA 1CJBA 3CA8A 3SR4A 3NQ41 3OD1A 2F3SA 3F3KA 1K8YB 4MQUA 4Y9SA 1LX7A 2ZTMA 1JB1A 2HIMA 2QW8A 4TL9A 4U2BA 1QZ3A 4Y1FA 3WWOA 2B4RO 3QLTA 2VDUE 3KTAA 4GM4A 4KB5A 1KO8A 4O2BA 4YBRA 3L79A 4LYEA 4F2PA 5KJCA 1Y5NA 3RHFA 1GNLA 4FP9A 2MINB 3STVA 3HNRA 2X8JA 3CLHA 3WWYA 3Q5DA 1U6KA 4F72A 4CIYA 1PUXA 2WJ6A 4KUEA 2JHPA 2OC4A 1GUAA 2ID7A 3W5UA 1XV5A 3WJ7A 3ZNPA 5BN4A 3THXA 1CERA 4QFMA 5CNIA 4KR6A 4P7JA 1ESDA 3GNLA 2PUWA 1GPH1 4Q1VA 1NBEA 1VHTA 4OJNA 4V0QA 5FNVF 4BKUA 4ZKDA 4IF4A 2GCNA 4REQA 3NBKA 2D1TA 3KB8A 4M53A 3UJCA 2WHEA 4RMGA 3RO7A 1U3CA 3N5KA 4HS4A 1VKOA 4KLRA 4NBKA 2ONZA 5EJ2A 1BEEA 3C0KA 3RJMA 3GMIA 4QBIA 4RIGA 3N87A 5L7TA 1H1TA 2ZBGA 2HK9A 4R54A 4V0MA 1F3OA 4BYMA 1Z5PA 3W3AA 5I7HA 5KS2A 5CTJA 3EPKA 1A8SA 3K20A 3GN1A 3EXFB 3AEUA 3K1AB 4RE6A 5D6NA 4DVGA 1JR3E 2FK8A 1CLEA 1K63A 1PG2A 3P2YA 5M2QA 4MAMA 4ND4A 5DT2A 4BPBA 5HR5A 1V41E 1XGKA 4MCAA 2VSFA 4TVBA 1V26A 3SZUA 3MFQA 5KSZA 3HYLA 3TQOA 1KI7A 3NNNA 1N2JA 3ZXIA 4B34A 3JQGB 2NSJA 4Y9DA 3M6VA 2XDQB 2O06A 3GDOA 4RD0A 4TV8B 1H3EA 3TDNA 1YF3A 1V7ZA 3FRJA 2QORA 5B3LA 4Y0NA 3ELUA 3JATB 5H3LA 1R12A 5TF4A 3ZNNA 4C03A 1RQPA 2C2OA 5D7BA 1PZGA 4EA8A 3Q5EA 4TL6A 3EVFA 2ZUCA 1B00A 1PQPA 4QRHA 1TM5E 1X42A 1P77A 1AHIA 5C5EA 4N4AA 2C2GA 2JCBA 1H69A 3IB3A 2H52A 1DJQA 4EUSA 5EXXA 1P4GA 1F7VA 2UXDB 2W6ZA 2LWIA 3JAMA 2JARA 3PYMA 1AZLA 1N0IA 5I3CA 2J3QA 3C3KA 1Z2CA 1VYVA 4MVJD 5BXYA 4NE9A 1UZLA 1WZIA 1IWOA 1X7ZB 3LYHA 3DHYA 3CURA 4D0GA 5F3DA 1RWOA 1U0RA 2IS1A 1P5FA 3QMPA 2F48A 2PZLA 3K5PA 3Q88A 3CT4A 4LEIA 2JFBA 3K1TA 4Q4CA 1V3VA 2YYYA 2G08A 2E9SA 1T0JB 2PXCA 5AUOB 4A2QA 1KBZA 4XYBA 4XDZA 3OTOB 3EFBA 3WGNA 3SI7A 5A4JA 1PZEA 3CF0A 3F4KA 5HIJA 4ZCIA 1E5VA 3E3LA 5DLPA 4EJMA 2C5HA 2ZBFA 1IBSA 1JDPA 1Z7EA 4HP8A 3DM9B 4TYWA 2FPPA 2B99A 3HA5A 4BO4A 4KDCA 4EY7A 5IRCD 4EY5A 3N8IA 3TTWA 4DCJA 1LJ8A 3R23A 1KK0A 3OZFA 3UTDA 4EAQA 3EOAI 3T4PA 3W4KA 2CZGA 3E9YA 1TZBA 1ECFA 2FMUA 4CT0A 4ZXFA 1J5PA 4BMXA 2JKYA 1OXXK 4KX5A 4ITUA 3GPDG 3WLHA 2V7EA 3TTSA 4BLWA 1HNWB 2IW3A 2PYDA 3BXPA 8ATCA 4I1PA 4P35A 1QIHA 2PPVA 3OQIA 1L5GB 2F4VB 4QNMA 1P39A 1YE3A 1DIHA 2WYHA 4JK3A 5AJWA 3TL3A 4GS5A 5HBGA 3OMXA 5KSWB 3P9RA 4HEQA 2Q5JA 3QBEA 4Y6RA 1EDDA 1K3TA 3ENWA 3G0GA 3GLFB 1M7HA 3FKQA 1P8JA 4D8TA 3D9QX 4KNWA 2BGTA 4FIZA 5J5AA 3NDPA 4P4GA 4ZVQA 5FUXA 2WHQA 1RJWA 1RZRA 2P9GA 1U2RA 1JIQA 1PJ4A 3NKVA 1G6HA 4QDZA 1G4UR 2NSDA 4AVYA 4BLRA 4YLEA 5BNIA 2RGUA 3UJ7A 5SY4A 1E98A 1QIIA 3OTWA 4IIEA 2Y71A 3DZBA 3T3OA 1QHHA 4BZWA 1FMTA 4ESVA 2SECE 2CZCA 2P7HA 3EE6A 3F98A 4YY3B 3VR6H 1RI3A 3X1KA 1DDIA 2XWBF 3QFSA 3T7JA 1XTZA 3ECAA 4IDGA 2Q45A 3PVZA 1N9GB 1Y5IA 2JCVA 4H16A 4L5IA 3IUSA 2IELA 2VF4X 1KPGA 2EFDB 3A1EA 3FPGA 5E1DA 3VHXA 4CM6A 5I5EA 2Q3DA 5JQGA 5IM4F 4BY9E 2IP1A 1K6JA 4PYNA 2E3JA 2O8DB 2RBGA 2RK6A 5ESRA 1Q0TA 3JQ7B 5IMBA 5G40A 1EK6A 1OKKA 4I55A 3IP9A 1DGQA 1TLTA 1FPQA 1U2ZA 1X19A 3IO5A 3GHYA 4NEHB 3WI7A 5HZGA 1Z0KA 1E5XA 2GPNA 2DUMA 3KVOA 1GGEA 5DV9A 4B3XA 4C4SA 1TCUA 3DFIA 3E9NA 3SFTA 3TQHA 3UWPA 4YV7A 3AL2A 3L6RA 1Z3IX 1AXRA 4FB5A 1Z06A 3B9BA 1R0CA 5DTMA 1KZYC 2XRFA 2JFVA 1NPYA 3PL1A 5LBUA 3LZ6A 3NBFA 3R7NA 2YH2A 3I6ZA 4AWBA 4L8YA 3FMVA 4LV5B 2H4YA 3MOSA 3SJBA 5I7OA 4RH0A 1V4VA 2QLLA 2WNIA 1XC7A 1STOA 1XOIA 5BO5A 3N76A 1LDEA 1V5WA 2BKVA 2O6LA 3FGZA 2UVPB 3LUDA 4IMRA 3TR6A 2QRVB 2D7JA 5AI9A 3LH5A 5HRCA 1T3GA 1RQNA 3CE6A 5TQVA 1ENOA 1Z25A 3NANA 4FB4A 1JSRA 1RHKA 2OHHA 2XDWA 3CTPA 3AF1A 4MI1A 3U80A 2JB9A 3SYLA 1RRPA 4N82A 3PVSA 3FJ1A 3REFA 1OI7A 3C5HA 3U9SA 4F4FA 4GP7A 2L42A 4M6WA 1CTQA 3NGXA 1M5TA 1MC8A 4H1VA 1X1AA 3QP9A 1SD1A 3S55A 4GKJB 2QTGA 1V16B 3GJ3A 4NCIA 3TZEA 4Q12A 4N1AA 2GNPA 3MWEB 2N3ZA 1M8KA 4OLFA 2C04A 1KJYA 4QREA 4EQ6A 2ZYUX 4XX0A 4OX9Y 1UQUA 2LD4A 1XT6A 3GXBA 4NZZA 2JI8A 3HBMA 4MJ3A 2OV2A 3GJQA 1M5RA 4XE5A 1U6IA 4D25A 4RJKA 1PE0A 1T5IA 4YI5A 3SU8A 5DSXA 4YWJA 5C1BA 4J9UE 3PWKA 4BQEA 4OA8A 2JL1A 1RBMA 1IOVA 1KDRA 2OHVA 3B78A 4EA9A 1CZRA 3R3ZA 2JFXA 5JJCA 2R1ZA 4B33A 3PCRB 5DOVA 1Y6FA 4PAQA 3JR3A 3ES9A 4V0OA 3GFOA 3R76A 1MG5A 3FDXA