3STVA

Crystal structure of tomato methylketone synthase i complexed with 3-hydroxyoctanoate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
FVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIANKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Emergent Decarboxylase Activity and Attenuation of alpha/beta-Hydrolase Activity during the Evolution of Methylketone Biosynthesis in Tomato.
pubmed doi rcsb
source organism Lycopersicon hirsutum f. glabratum
molecule tags Hydrolase
molecule keywords Methylketone synthase 1
total genus 88
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3stvA00
2WIKA 2CKMA 3FYUB 4BRSA 1MO2A 5ALSA 3BJMA 2CUTA 2GBIA 1JFRA 1B6GA 3P2MA 2W22A 2C5GA 3IIIA 1CVLA 1LPBB 5HF8A 2B9VA 3STTA 3F67A 2ZYHA 5LZ9A 4FLFA 4HVTA 1CUFA 3I6YA 3IUNA 1XLWA 4NVRA 1EINA 3B12A 4Q3OA 4MEBA 4H7IA 2WG1A 4QDUA 5AKXA 3W9UA 1HL7A 4W1QA 4WCVA 1VJ5A 4EBBA 4G4JA 4JNCA 5F4ZA 2C7BA 3NUZA 3FSGD 3FVTA 2WM2A 3DCNA 4N8DA 2DCMA 1W4LA 2CEKA 2WJ6A 4X85A 3H1BA 4FBLA 4H7KA 5K3EA 3QPCA 2VJBA 4Y2TA 3BL8A 1WOMA 1GXSA 2O2IA 3WYNA 1QIHA 2DQZA 4DNPA 3R40A 4Z49A 2DFPA 3FYUA 2ONCA 4P92A 1JKMA 2ZSHA 2Z3ZA 3M3DA 3C6YA 1QIIA 4D9JA 4F60A 2VATA 2VA9A 1ZD5A 4AZ3A 1SOMA 1FFDA 4NMWA 5HK8A 5DYTA 3WZLA 1WHTA 1ACLA 4UPDA 1QIGA 4S0XA 4PSUA 3WLAA 3IA2A 4XWGA 1E8MA 3N2ZB 3MGAA 3D7RA 3WIOA 4U2FA 3PF9A 3STUA 3GBSA 1PV1A 1AURA 4J0GA 4CG2A 5KBYA 3R3WA 3WL6A 1LGYA 3AILA 4C87A 5K3BA 2QXTA 4H7FA 1H22A 4M0MA 4W1PA 3D5EA 1N8SA 2JGEA 4Y9SA 1H2ZA 3R3ZA 5LZ5A 2HU8A 2WUEA 5K5EA 1XZCA 2RAUA 1YR2A 5T4FA 1IZ8A 4HZGA 1J2EA 4H18A 4L9AA 2CBGA 3HABA 3FYUC 1E8DA 4BZWA 1Q84A 4Q82A 2WUGA 2P8SA 5IKXA 4CI9A 1J06A 4U2GA 2E3JA 3ZWQA 1K6EA 1ZICA 1GT6A 2R11A 2O2HA 3DLTA 4WFKA 5ALEA 2WLSA 5ALHA 1U65A 4WJLA 1QOZA 2OCKA 3L1JA 3ED1A 1QJ4A 5E4JA 3R3YA 4WFJA 4INZA 1G4HA 2CB9A 3OPMA 2OQIA 2VAXA 4GECA 3C70A 5FP0A 2XUOA 2JGFA 4DLNA 4JUIA 4BC0A 5AO9A 2PM8A 2WTNA 1CUUA 4C6HA 1P0QA 2XMZA 2HL6A 3U1TA 4E14A 1IUOA 1EK2A 4OU4A 2WFLB 5ALOA 4AMYA 2JGLA 3OTQA 1VZ3A 5ALIA 1EK1A 5A6VA 1YS2X 4B81A 2HA7A 1WPXA 1EVQA 3BDVA 5CT5A 2Q0XA 3M82A 2ES4A 4B85A 1RP1A 2HFKA 2X5XA 4Y2QA 3IUQA 1CUEA 1R9MA 5AI8A 5EI5A 4PV7A 4L72A 4OPMA 5ALFA 5AK5A 1QIKA 1QIEA 1YB6A 3PFBA 2XLCA 3G8YA 1YB7A 3C6XA 3DJYA 5EHQA 1DWOA 1CV2A 1W76A 4AN0A 2HA2A 4TVKA 5LZ7A 3H2IA 1LZLA 2HA6A 1SFRA 3WA7A 1ZI8A 4AO6A 3QM1A 4UBJA 3SK0A 5DNWA 4ZGBA 2QTBA 3SX4A 2Y2VA 4H7DA 5CH8A 1T2NA 3O4JA 1I6WA 4A16A 5FUMA 1KU0A 2BAGA 1SC9A 4GHWA 2XUPA 2XUGA 4JEIA 4H7HA 1VLQA 1YCDA 2XUKA 3DDUA 4C4XA 5DNVA 3W04A 3FYTA 3AZPA 5AH0A 3EQ8A 2OCLA 3VKFA 2Z5GA 3O9MA 4K5QA 3G0GA 3EIOA 4HXEB 4U2CA 2PL5A 5CT8A 5EGNA 4OYLA 1U2EA 2HU7A 3G02A 5AI4A 2ECFA 3SWWA 5DTJA 4DNQA 3ZLTA 5BWCA 3H1AA 5AK4A 3G9XA 4LXGA 4EA6A 5JATA 3PICA 3WKBA 4Y2JA 4OYYA 3ZI7A 1N1MA 1QFSA 3PF8A 4UHBA 2BCEA 3C6BA 3ICWA 3PUIA 1CPYA 4Q3LA 3WKAA 1LPNA 3QPDA 1XKLA 2ZJFA 3KDAA 3LS2A 4Y2VA 3HLKA 2QUAA 1GPNA 4AO8A 3G0IA 3U0VA 1Q0ZA 3V48A 5JIBA 3KWJA 3DS8A 2DR0A 3O95A 3UUEA 1CUBA 3G0BA 3M81A 4Y2UA 1THTA 5HF5A 1CUDA 4X93A 1QTRA 5AKHA 2D5LA 1AQLA 5A71A 5FV4A 1W75A 2GZSA 2FUKA 2PU7A 2WU4A 1UFOA 4YX9A 1VE6A 5BV7A 1WHSA 3FAKA 3H2KA 3WA6A 2XB6A 4DSAA 1LPOA 2ZVDA 2Y2UA 3V1LA 4AXBA 1XZEA 5JZSA 3T52A 5E2IA 3LIIA 3T4UA 3ZPXA 5CW2A 2HHAA 4X3CA 2VTVA 2BUCA 1CQWA 2JGJA 3K6KA 4BBZA 2I78A 5JANA 4I4CA 1XZAA 3BE8A 1H2XA 5ALWA 5YASA 5DWDA 2JGIA 2WHRA 3EBLA 3IUMA 3RKSA 1C4XA 3LP5A 2J3DA 1QGED 4P08A 1EDBA 2V97A 3WKDA 5ALTA 3E0XA 5ESRA 1LPMA 5ALYA 1JMYA 4HTAA 5JD5A 4H7JA 1LZKA 2H7CA 1ODTC 1UK6A 3A6ZA 5JZBA 1BROA 2JIDA 4HS9A 1XZIA 3VJLA 5FPQA 1CUCA 4UBNA 4UFPA 2QMQA 2X76A 2XUFA 3ZLVA 4QA9A 4EY4A 2Y6VA 1IUPA 2HRQA 1X2EA 2VAVA 4KE8A 1ORWA 3L1HA 5AKYA 2WTMA 4LYEA 5HQ3B 1XQWA 2WFMA 1MT3A 3TRDA 2X8BA 1QO9A 2CZQA 1WM1A 2WJ3A 3FCYA 4TPKA 2PBLA 5LIPA 2JEYA 1B41A 4G4IA 4Y2YA 3HI4A 2WIGA 1MPXA 2XLBA 5LLSA 5K3CA 3TEJA 4GEGA 3JYHA 3WQHA 1AMNA 3R3VA 5CT4A 1DQZA 2V9ZA 1H2YA 2VJCA 1GZ7A 4C4YA 2O2GA 4BATA 2FJPA 4J0IA 1EXWA 2H9YA 4HXFB 5SYNA 2AJLI 4G8CA 1RYYA 4GLBA 2G4LA 2GYWA 2XMCA 3G0CA 1OILA 4QE3A 2WFLA 4FHZA 1EH5A 3VJKA 1YS1X 1EDDA 4ROTA 2EDAA 4K6GA 5JADA 2CMFA 1VXOA 2ORYA 1XZGA 5AM2A 3B3QA 3MVEA 5ALGA 3IURA 3STXA 4BC1A 5A7FA 2DHEA 4QWWA 3D0KA 2QR5A 2YASA 2BGRA 3WMRA 4BCDA 1DQYA 4RPCA 5KREA 4W63A 3D2AA 2HM7A 1ZJ4A 5ALMA 1K8QA 5ALJA 4FWBA 2I3ZA 3AZOA 3V1NA 5LZ4A 4GXNA 4N5HX 5DJ5A 2HU5A 3WWOA 5AI6A 3PI6A 5AKKA 5AIAA 3ZV7A 1CQZA 4DNOA 3DL4A 3PFCA 1PFQA 5BOVA 4E46A 2XMRA 1EDEA 3PUHA 2Z8ZA 3RLIA 5DTIA 3C43A 5CXXA 3RM3A 1BS9A 1E5TA 1YAHA 3D59A 3VVMA 3I2FA 3AIMA 1XZMA 4AX4A 4FLMA 1UK8A 1NU6A 3FNBA 4X71A 3A70A 4ZXFA 1E89A 4U2DA 1XRMA 4UFOA 2PPLA 3Q8WA 4MEAA 4G9EA 1ACJA 4UHCA 1E66A 3WJ1A 3MUNA 2G5PA 3FVRA 1XZHA 3QITA 4EUSA 2BGNA 5E4TA 4H7EA 4QWMA 3H04A 1QIJA 5I9IA 3O0DA 4OB8A 5FOQA 1DTEA 2IX9A 4OB7A 3G7NA 1UKCA 1AUOA 4M0EA 5A7HA 2RI6A 1W6RA 5CMLA 2OGZA 5EHNA 2WG2A 4IH1A 3HZOA 4KAFA 3QYJA 3WL7A 1C7IA 1JJIA 5EIAA 4UFNA 4IQ4A 1HDEA 4MQLA 3GA7A 2DQYA 1A8UA 5KWJA 5T4BA 2FX5A 3KOOA 3D2CA 2ZYIA 3PDCA 1DWPA 1EI9A 1XZLA 4ZI5A 3C45A 5AICA 3F9CA 1WCYA 3STYA 3WJ2A 4YK7A 1S8OA 3OOSA 2PSFA 1ZGBA 4DMFA 3E3AA 4H77A 4B7ZA 4H0CA 2Y1KA 5JAOA 4IHAA 3QMVA 1T4MA 2ZSIA 3PE6A 1PJAA 2V98A 5FXMA 1LPAB 2HDWA 4G5XA 1MJ5A 4DGQA 4AN1A 4X91A 1WPRA 3H17A 2WHPA 1QFMA 1UT6A 1CIJA 5J3JA 3I2JA 1BRTA 3I1YA 4JH0A 1A8SA 2QS9A 2GZRA 4GW3A 4EB0A 5C7YA 4KE6A 5JAHA 3I6ZA 3FOBA 1A88A 4KAAA 4PO3X 4PNZA 2ACEA 3WK9A 1XZFA 4CCYA 1DU4A 4PF1A 4V2IA 1YAJA 4J7AA 1SCIA 1XLUA 2XMSA 3I2KA 4OSEA 1CLEA 1GPKA 2QM0A 3ANTA 1XQYA 5LZ8A 4CG1A 3F8SA 3WL5A 1JU4A 2YXPX 5FDFA 4MWSA 5CTAA 4JYMA 4KAJA 4P9NA 2C5FA 4IO0A 2EEPA 4DYHA 4XIIA 1H2WA 4A23A 4E11A 3QZUA 3F97A 3DEAA 1MX1A 1K63A 3IUJA 1MAAA 2WHPB 2K2QB 4GDMA 4WDRA 1XRQA 1TQHA 5D3ZA 5ALQA 3R41A 3YASA 3QVMA 4QEKA 1YASA 1QO7A 5HZGA 2XQFA 4BYMA 3V1MA 1VA5A 1TCCA 2BJHA 1CUXA 3H2JA 5C8ZA 3EQ9A 3A2LA 1GQRA 2AJ8A 1O6GA 1UWCA 1ZD2P 2XI4A 1TKRA 5DYYA 2OCIA 2XUHA 1E3QA 3DD5A 1JJBA 4RGYA 1F6WA 4KE7A 4B9AA 5AJHA 3CCCA 4OUKX 4BRZA 5FPPA 5IVKA 4J0DA 3G9UA 2XMQA 2IIVA 5JD4A 1EB9A 3A2NA 4BVKA 2O7VA 2QRUA 3BDIA 5HK9A 3H19A 1L7RA 5K3DA 2XMGA 3I2HA 4AQDA 2HADA 1MAHA 2WJ4A 1LPSA 4LXIA 3GFFA 2G5TA 4FTWA 4UBOA 1UK7A 3HXKA 5JZ9A 1C7JA 4J03A 1XLVA 2BKLA 3R3UA 4PSDA 2PVSA 2OPHA 2VJDA 1XZJA 4UBMA 5KWIA 3FLAA 2AJDA 4QDXA 3BF7A 5AM0A 5AIBA 1CUWA 5EFZA 1SCQA 3BWXA 3WWDA 1Y37A 1EHYA 1XZDA 1ORVA 4IH4A 4UHDA 1DWQA 3WIBA 1U8EA 4CCYB 4RE5A 1XFDA 1TCAA 2WIFA 2J3QA 5C8VA 5CRIA 1UOQA 3HEAA 4FLEA 4N8SA 1XROA 4Q1VA 5D7BA 1JJFA 1BCSA 2QUBA 2I03A 2VQ6A 1F8UA 1TCBA 5EHXA 3KD2A 3WKCA 2XDWA 4X90A 1L7QA 1IZ7A 1DT5A 5AM5A 2BFNA 3CN9A 4ZREA 1IUNA 2Z3WA 1YA4A 2XMBA 1CUGA 3STVA 3DNMA 4F0JA 5I7UA 5ALNA 4B9EA 4FOLA 2GBFA 3D3NA 1ZI6A 4C4ZA 5HFAA 4C89A 2DHDA 3WI7A 1VE7A 3NGMA 5EHZA 5CURA 1CUHA 2PKYX 3ESCA 2XQKA 3WKEA 3VISA 4FNGA 1XRNA 2ZJ6A 4QDOA 1BEEA 4QDTA 1CRLA 5HFNA 2ZYSA 1XQVA 4EZIA 4RE6A 1EA5A 1KU6A 4AB1A 1USWA 2V96A 4EHBA 5E4YA 4ITVA 4Y2PA 5A62A 2OG1A 4ETWA 2H7XA 3F96A 4FMPA 2WQZA 4FKBA 3D2BA 2WG0A 2C0QA 4J0CA 1GGVA 1Y7IA 3IDAA 2XMDA 3DYIA 4W1RA 3WK7A 3ESBA 3CCBA 2OAEA 1NX9A 1F0PA 2WIDA 2PSHA 4FFWA 2RONA 2NW6A 2HA5A 2RHTA 2RIPA 2OAGA 1R88A 1X70A 2XQJA 1A8QA 3WL8A 1D07A 2O7RA 2PSDA 3HSSA 4OCZA 3AIOA 4RNCA 3W2TA 2GYVA 2AXEA 5HF9A 2H1IA 4BTVA 3TGLA 1FFBA 3AFIA 1DINA 5JAPA 4DSZA 2QOEA 2QKYA 4J0JA 2VT6A 2R8BA 1XZKA 1R9NA 2GBGA 3QMWA 3HRHA 1XQXA 2JBWA 3QPAA 1XRPA 1R50A 4BDSA 2WU3A 1P0IA 2YH2A 1ISPA 5LKAA 4X97A 5FKJA 1BEZA 4X6UA 2H7YA 3F98A 3AUKA 1R3DA 5HKBA 5AKEA 2OXEA 4CIAA 1G5FA 2RGUA 1TAHA 1H23A 1ZGCA 4X7BA 2WSLA 4X00A 5BWBA 1WB5A 3FWHA 5C8XA 4X6XA 1YA8A 3JWEA 5ALRA 4B0OA 1WB4A 5JASA 2JGMA 1HPLA 5CH5A 4J0HA 1UKAA 1YSCA 1K4YA 3W9BA 2HA0A 1ETHA 2XE4A 5FRDA 3BJRA 1Y7HA 1CEXA 4MYDA 4HXGA 5DLPA 2XUJA 1E8NA 2GYUA 3OM8A 2C4HA 4WY8A 1ODSA 2JF0A 3WWPA 3KSRA 3V9AA 1AC5A 3D4LA 1UK9A 4B84A 1MNQA 1QIMA 5CXUA 4OU5A 1TIBA 4GWLA 5H3HA 2HA3A 4KRXA 2OQVA 4MXDA 4YASA 2AJBA 1M33A 4W1SA 5ALKA 3FBWA 3VJMA 1IMJA 2XUDA 1CR6A 2WUDA 2QXUA 1SCKA 4PQEA 2VEOA 2VJAA 4P93A 1ZI9A 2B61A 4DMHA 3DOIA 3H0CA 1QE3A 4AO7A 1ZD3A 5AI0A 5D3KA 1KEZA 5K3AA 1CUYA 1UOOA 4DM7A 1U4NA 4WY5A 1CUJA 1GKKA 1ZIXA 3LCRA 4BP8A 3LLCA 4CFSA 5AM3A 3A2MA 1Q83A 3C8HA 2VF2A 1QIDA 3R3XA 5AOCA 3AZQA 4C88A 3DOHA 5I8PA 1IVYA 5AKJA 2XUAA 2WFZA 3ICVA 3OURA 1QTIA 2QZPA 4Y7DA 3STWA 4Q3KA 3DYVA 4F5ZA 4KR0A 3CN7A 1THGA 4ZWNA 1CUAA 3H18A 4I3FA 1UKBA 3S2ZA 1DX6A 1DX4A 5LYYA 1VXRA 3W06A 3DQZA 4KRYA 2ZYRA 2XQIA 2QVBA 4O08A 5DNUA 4LYDA 5AI5A 3HACA 4AZ0A 5LKRA 4BVJA 1FSSA 4U2BA 5ALLA 3DL7A 3WK4A 4QLAA 3VDXA 4NS4A 3I1IA 1LLFA 4DMCA 2C58A 1JI3A 4PW0A 4JYPA 5FLKA 4UBKA 3AINA 2AJCA 1ODCA 5JYCA 1UZAA 4G1FA 5EIHA 1MU0A 4KE9A 2G63A 4B0PA 3IB3A 4KYVA 1VZ2A 5EIEA 3O4HA 2D0DA 2Z8XA 3AJAA 3BIWA 2FJ0A 4XVCA 2QJWA 4EY6A 5ALDA 3UMJA 5AHXA 2I3DA 1VKHA 1BN6A 3C8DA 5HF6A 3HYSA 4AMZA 3L1IA 4ARAA 2XQGA 4OD0A 5AKLA 3FLEA 4J0KA 3O4GA 1EVEA 1LPPA 3SC2A 4LHEA 3RARA 1UXOA 3M83A 3JW8A 4J3JA 4I19A 5ISMA 2VSQA 2LIPA 3OG9A 1TRHA 3BIXA 5IVIA 1HKHA 1BN7A 3HJUA 3IULA 1P0PA 4E15A 3GROA 5AOAA 1N5MA 4KACA 1X2BA 4U2EA 5AOBA 4LKOA 3WWCA 5CT9A 1QLWA 4B6GA 2WIJA 5AK3A 2OLEA 1AKNA 4QDZA 3H2GA 1LBSA 1XRRA 3I6MA 5AKIA 4K2AA 1F0NA 3HC7A 1EB8A 1N5RA 3VXKA 3GZJA 1MX5A 4ZRDA 1W52X 5ALVA 4B82A 3QBJA 3BF8A 2OGTA 5JALA 1J1IA 4MQMA 2C0PA 3AIKA 1NU8A 3ILSA 4OB6A 4QLOA 1BE0A 4BAGA 2ZJ7A 1BU8A 4Y2RA 1ZD4A 4HRXA 1QZ3A 1QONA 3G9ZA 2ROQA 4Y2XA 4BE4A 3X3HA 4Q05A 1G66A 5T4EA 4FFVA 2PUJA 3TJMA 3FSGA 4MYSA 5AK6A 4UBIA 4ARBA 5HQ3A 4W9RA 1HBJA 5JAUA 2B4KA 5LP1A 4UBLA 1FFEA 2HA4A 2HRRA 4KJXA 2PX6A 1Z68A 2PU5A 4K6KA 3WK6A 3H2HA 4X92A 4YPVA 4BZZA 5CBKA 4GI1A 5JARA 4BCCA 5JD6A 4QZVA 1ZOIA 1DT3A 5T4HA 1WB6A 3QMMA 1XRLA 3CXUA 1L7AA 4BCBA 3I2GA 3VVLA 3WK5A 1MX9A 2EDCA 2PSJA 4G9GA 4KEAA 4ZV9A 2HFJA 4MJ3A 3ANSA 3WZMA 1QIFA 3OC0A 4K6HA 1XZBA 1A7UA 4Y2SA 1BCRA 4G8BA 5ALXA 1FJ2A 2XUQA 1CUIA 4EY7A 1R1DA 4PSCA 3UUFA 1J07A 4ZV7A 1CUSA 1OXMA 2VT7A 5AKZA 3LIPA 2J4FA 3R0VA 1CUZA 4B83A 6YASA 3G0DA 2YYSA 3K2IA 3O4IA 1JMKC 2GBCA 3ZLUA 1EX9A 4DIUA 3QH4A 1O6FA 3MUOA 4DNFA 4C01A 4DTCA 2IITA 3Q0TA 1CUVA 1AX9A 4HRYA 2OGSA 2PUHA 4GBGA 3C6ZA 2QJRA 1FFAA 1W1IA 2ACKA 1VOTA 4CCWA 5AI9A 5SYMA 2XUIA 1AZWA 7YASA 1MTZA 4BDTA 3KWFA 5IH7A 5D6OA 5HKAA 4NZZA 3S8YA 5A7GA 2JGKA 4FBMA 4X6YA 4TGLA 4BB0A 3B5EA 2CJPA 3KXPA 4H35A 4Q34A 4G8DA 4CG3A 2OCGA 5ALPA 2WILA 1FFCA 4UHHA 4BAZA 2W6CX 4LXHA 2QT9A 4CIBA 5LZ2A 4IH9A 1RWQA 5ALZA 4BVLA 2XT0A 4EY8A 5K3FA 4FNMA 5HCUA 3W05A 2RHWA 1GPLA 3IBTA 3NWOA 1LNSA 3WWEA 3WK8A 5AKGA 5AM4A 4UHEA 4BAUA 1ZIYA 5AM1A 3V1KA 1AGYA 1HQDA 3E1GA 3EQ7A 4BP9A 3I2IA 4WDQA 5ALUA 3DKKA 3WYDA 3E4DA 3O9VA 1VA4A 3BXPA 4XJVA 1JT2A 4F21A 1MN6A 3NOXA 3ESAA 1CFJA 1HLGA 5CT6A 1XKTA 3C5WP 3FLBA 3IVMA 4M0FA 5IVDA 3RK4A 5AP9A 5K3FB 4EY5A 4WFIA 3FCXA 4XX1A 3DKRA 3ESDA 5CH3A 3EF3A 4X94A 5A2GA 3I28A 4G4GA 2Y6UA 3N0TA 4FDMA 5IVHA 1K5PA 2PSEA 1TK3A 3C5VA 1LBTA 4DMKA 1JU3A 4X95A 4MWTA 2WKWA 4BTLA 2BUBA 4QNNA 2BUAA 3GELA 4HAIA 2HIHA 2WUFA 3G9TA 4LIPD 1P0MA 3C87A 3GUUA 1R4ZA 1OCEA 2JEZA 2B20A 2J4CA 1ZJ5A 4L0CA 4N8EA 1UOPA 4UUQA 1GKLA 1MNAA 1Q0RA 4L3WA 2UZ0A 4BE9A 4UHFA 2DHCA 5C81A 4B80A 1GQSA 3K9BA 4N5IX 1G42A 4A5SA 2WHQA 2DSNA 5DYWA
chains in the Genus database with same CATH superfamily
2IHTA 1Y82A 4MWZA 1GZUA 2CKMA 1LS6A 3PC2A 2GKGA 2WU1A 3F2IA 3QJ5A 4FFRA 4AP9A 1XU7A 5A4JA 5DN9A 2GLXA 2PQ6A 1M8GA 2GBIA 2SCUB 4CKXA 1A9SA 3KB1A 3U5TA 2IBSA 2CD7A 3IIJA 5EINA 1JFRA 2YOGA 5JH7F 4MJXA 4CGYA 2G8NA 2IP4A 3P2MA 5FUBA 2C5GA 4IAOA 4LOLA 4FVTA 3TSWA 2GH1A 1NVVR 1IIBA 1N2CE 1GOTA 1TFUA 2CEAA 5K0EA 2I3BA 3HUFA 3ORRA 1FP1D 1LV7A 2D3TA 3Q98A 3QWHA 3FDIA 1VDMA 2AMYA 1LPBB 5A5DA 1Z13A 3VNQA 2XCLA 4B2YA 2R6R1 2IDMA 4E12A 3LXRA 3UY4A 1SKYE 5JEEA 4Q9KA 4HVTA 1CUFA 3UGQA 1HE3A 4GE3A 2CLSA 3IUNA 1NATA 4NVRA 5E3JA 5GGXA 3W8RA 4C29A 1OLOA 7REQB 1FJGB 2QPTA 3PPWA 4FYKA 2DTEA 3JYOA 3LD9A 3C8MA 2R8OA 3RYHA 1MEOA 1P6XA 2HLNA 4HPJB 5MN4A 2EZ9A 1F2UB 1JAHA 3DDCA 4IGAA 3W9UA 2PZMA 4OQXA 3UAGA 1NKVA 2YJNA 1CQIA 2H1OA 3RUHA 3OLZA 4NCXA 2A5GA 1WBDA 1NLZA 3M1YA 3FYDA 1VJ5A 3JARB 1UM8A 3ZK7A 3HCPA 4ZOAA 3E03A 3I8XA 2R751 1R7RA 3HJFA 2XCOA 4LVNA 4MS3A 2ZWMA 2B0CA 4DCOA 2O54A 2O52A 3RBVA 3NUZA 3FSGD 3FVTA 4XM1A 1JNYA 2PWYA 3DCNA 3D1LA 3JZIA 4BQFA 4F2WA 4PM4A 2Q3FA 3DOCA 4QYTA 2OQRA 4G5OA 3OKFA 4NU5A 1W4LA 4XGIA 4DDVA 2VO1A 4U8HA 4BY9E 3GFQA 3P9SA 2SCUA 4DBVO 2WJVA 1NLYA 3H5RA 1G9TA 2AF3C 3JU3A 4MO2A 3KUCA 1PDVA 4F85A 2JVIA 4GS5A 4QTUB 4C7XA 1X7ZA 3OD5A 2W83A 2YXEA 4P7JA 4Y2TA 3W8FA 2VP9A 3WGNA 4FZVA 3EA4A 4YPFA 2O2IA 1U02A 4R1QA 4DPMA 1NHWA 2I7CA 5U4XA 5AVRA 1PNOA 1NF9A 3NC0C 4NYJR 2P2NA 3TNFA 1UXIA 5BNZA 5JBIA 4LJYA 2ZI5A 1KDZA 2NTJA 1C5KA 3WGLA 4BJ6A 3BRCA 1QG0A 4UE6A 3DCYA 4LDPA 5KTPA 4LI3X 3RADC 1H1DA 2NYUA 5FR1A 1XDBA 3K09C 1JKMA 2IJGX 2Z3ZA 4YUXA 3C6YA 1JEQA 3U39A 3K0AA 4OHXA 3EEOA 4CT0A 4CZ2A 3FGOA 2HPHA 1QPZA 1K97A 4N5NA 3KJIA 4OHMA 4ZO8A 4PXSA 1JHQA 2Q1YA 3RYHB 3KZMA 3IV6A 5MGBA 3P2YA 4QBGB 3UXYA 4B6JA 4CLOA 4F4FA 1CX9B 4TSFA 4BWVA 2F8TA 2JDIA 3G79A 4A3SA 1M2NA 4I50B 5EUBA 2PE5A 5LOVA 3ND6A 3KZ1E 5IXYA 1DEKA 3ZXYA 2VTBA 5CLQA 3K70B 1GGMA 1I3OA 4MVJM 4MP3A 2IPOA 2GPSA 2PRKA 5FIUA 3S3TA 1CR0A 2PR7A 3IA2A 2J7PD 4XWGA 3SXUB 1E8MA 1FMTA 5EEHA 3UFXB 5K4AA 2O57A 3SNHA 2L69A 3VI4B 3WADA 2B5OA 4IKPA 5F33A 2H2AA 4U2FA 3SYTA 1XELA 2VDQB 2NT3A 3GJ4A 4NYMR 3EC7A 1FIUA 3PF9A 4YECA 3ADBA 3E8XA 5JSYA 1U8YA 3NM6B 1AURA 2QRNA 1A2BA 2J3JA 2XD4A 3C41J 4QPZA 3GVXA 1ZNQO 1NVEA 1RIFA 3P45A 1LVGA 4YCMA 5BWMA 3WL6A 3AILA 4UASA 2OV3A 5K3BA 3TMKA 7ADHA 2I6FA 2IUFA 2RHOA 4ARUA 1H22A 1PEDA 4K46A 4K6OA 1RRPA 4GXQA 2CC2A 3A9TA 5KTMA 1QVAA 1NM5C 4X61A 3GLGB 3HFSA 3D5EA 3GX1A 1PSWA 3IE2A 1O57A 1N8SA 4I4TF 4I55F 1U31A 4Y9SA 3H7AA 3UWKA 3W6OA 3GRPA 3ZVLA 4DMRA 2ZBVA 4V39A 4YJDA 1NJ2A 5LZ5A 4R71A 2WUEA 4PPYA 3B7PA 3P0IA 5FJIA 3U3DA 2FOLA 1IB6A 2IYXA 1PJRA 2IP1A 4QXPA 1U7PA 5T4FA 3FG9A 4UDOA 1IJBA 1RYZA 5DTRA 4G9BA 4QUKA 3IRVA 3N58A 1E8DA 1E6CA 2G08A 4I08A 1YHYA 2HF8A 3AV0B 4Q82A 3EHEA 3GUCA 1THMA 3VC3A 2W6ZA 4UATA 3HYRA 2P8SA 1CJMA 4RGVA 1SKBA 4YTEA 1W88B 3D6FA 5IKXA 3SFVA 3W77A 5REQA 1QK5A 1JL3A 1J06A 2BV3A 1U99A 1FF9A 2RK4A 2WINI 3HV2A 4GT1A 3TCKA 3WO0A 1C8LA 1K6EA 2ZYGA 3SHQA 3R0IA 4ZOLF 3IKLA 1OBHA 5FWDA 2R11A 3D8HA 1P9LA 1X7XA 3N0XA 4WFKA 5CA1A 5CFNA 3J81A 5FUWA 1RQGA 2AEJA 4RS3A 3TE6A 1NF2A 4B44A 1NW9B 5C7OO 2D8AA 3ZXSA 3T5MA 3IVGA 3NI2A 4GSLA 4CLXA 3TLKA 3L02A 1HDCA 3IQDB 1M2EA 2DFKB 2ZSDA 3OF2A 4WCDA 3HBLA 2CB9A 3MN1A 4U63A 3RSZA 3VOSA 2OO7A 2VAXA 2ZUCA 5IDYA 4D9FA 3BB4A 3FM9A 2R8PA 1ZRSA 3KR1A 2JGFA 4TT3D 3ZDBA 2C5HA 1O6CA 3JSAA 3ETGA 4M1WA 4GZ5A 3TLAA 5FBVB 2BLNA 3B8EA 3N70A 5J4HA 1S96A 1K8YB 3U3KA 3B1XA 4QGAA 4C6HA 1L5WA 5LQMA 1P0QA 2Z1NA 1CHDA 1GCGA 2TS1A 3DOUA 4EW6A 2CLDX 1H4SA 1SB8A 3H8SA 3SC6A 4C08A 3WYFA 4AMYA 2JGLA 1XPOA 5DSXA 4EB8A 1N2BA 1P77A 2AI2A 1T26A 2PMCA 3NONA 4B2IA 1L7PA 1JWBB 4DUGD 3OTQA 5LP6B 3JAWA 2KM1A 9LDBA 3A2KA 1XG5A 5ALIA 5KKCA 1YS2X 4X54A 1WPXA 2EW2A 3CLTD 4N7JA 2BM8A 4GAEA 3MLAA 5JNLA 1N0UA 3ZNPA 4RVDA 3KSDO 5CT5A 3PJFA 3T5DA 1RLIA 1XF1A 1FL9A 1ISGA 4O2RA 4DA4A 4BKUA 4ZN6A 4ARIA 2G25A 1RAEA 3V8RA 3DPSA 4BLRA 5C52B 3TDKA 1WMEA 3GNQA 3IUQA 2AS0A 3GAFA 4RK5A 4RVSA 1VCNA 2BFEA 5EQFA 2Q9BA 1E9SA 1TAGA 4EGSA 4G0NA 4POAA 1C3LA 2FEPA 1JGTA 2M2IA 3IUSA 2FMUA 1BCRB 4KLZA 2QR3A 2VJQA 5ALFA 1E1YA 1MQSA 3SE0A 2DY0A 1JKJB 1QZXA 3IEPA 3TZBA 3AHDA 2EBFX 2XLCA 3G8YA 4TMZA 3C6XA 1Z5ZA 3DUFB 4S2UA 1PI3A 3N0VA 4YRQA 1D6MA 2IW3A 2VKQA 1W2GA 5JG7A 3GLRA 4RTKA 2GUWA 1L8OA 1DWOA 3W2GA 4YUZA 2C2GA 1CV2A 1W76A 1PNRA 3ODGA 4EM6A 2E2WA 2ZYTX 1Z0SA 1MXFA 5H0IA 2OHJA 4IL5A 4HJRA 1JLMA 5M29A 3ROXA 1GAQA 1SFRA 1X87A 4WY2A 3QG1A 4YJFB 3NEJA 4OQLA 1NLFA 3UF0A 4MRNA 1SVSA 4NATA 5KCMA 3GPLA 1PWEA 1J0CA 4U5QA 3QM1A 1AVTA 2Z9CA 1ZYUA 1FSPA 1SCJA 3GLHA 3ON5A 4DRXB 2UUOA 4Q4AB 2Y1OA 3G49A 4Y1RA 3SK0A 4II7A 1OXUA 4DLSA 3KSBC 5G1NA 3JRXA 3P0HA 3ED5A 1N8TA 3G82C 4W7SA 2W6IA 3OA0A 5CDFA 4CGZA 3LDHA 3DEJA 4MV1A 4BGIA 4OLFA 5IPFA 3TTWA 1T2NA 3NWEA 4CRWB 5BW6B 2XTNA 4L07A 3RVPA 2WWVD 4LGYA 2QEQA 2JAOA 4DBLE 5KOJB 2VVTA 3BAZA 3MINB 5ICEA 1KQFA 5TS2A 1RPJA 3AHGA 4FS3A 2BAGA 2H65A 1R6AA 3VR5A 3TCXB 4QDKA 3UGTA 2XUPA 3JPWA 2XUGA 4QQRA 4H7HA 4NEGA 3E9DA 4EUKA 1RPNA 3WBBA 1TA0A 4EG8A 3O31A 2L19A 2PMWB 3QFTA 3CBQA 4QU0A 1R0BA 3EOBI 3KSMA 4U7FA 1P73A 3ZXXA 4NV0A 4MVYA 4LPKA 4Q9JA 1CS0B 3PTZA 4DWWA 2EXXA 3FMVA 3OOEA 4OK3A 5EJ6A 3OBBA 4BO0A 3IAS1 4BASA 4NX2A 3WHIA 1L4KA 1FXWF 3WS7A 1XAJA 4PLPA 3QU2A 5FI1B 2Z5GA 3O9MA 3NTQA 4RMIA 3ZJUA 2YS6A 1MABA 1IB0A 1LU9A 4M49A 2YWRA 4AJNA 4ECAA 4U2CA 5DPMA 3QXHA 1M5UA 1DAPA 1U80A 1TA9A 5CT8A 5EGNA 2P9HA 3FUUA 4OYLA 1U2EA 3BBPA 3ETJA 2PJZA 2OV8A 3LC0A 3F6PA 2ECFA 4UU8A 4Q7QA 5ITWA 5DTJA 1OI4A 3IQEA 3BZBA 4H2DA 1QUFA 1VMIA 2WWGA 3ABRB 3PXDA 5BWCA 3LBAA 1K6IA 3FOWA 3FCSB 3HEBA 4PC7A 3VO2A 2NUPA 2A57A 2B2NA 3WKBA 2Y3IA 5CPBA 1T9HA 3ZU4A 2CK3D 2YRWA 5FAXA 5KTOA 4MPJA 4CKWA 4RCVA 1L7OA 4KQXA 4BE7B 1Y33E 3MB8A 4JU9A 3UPTA 1DC5A 2Q6LA 1JQBA 1N8KA 4MDYA 3ICWA 5JW6A 2VHUA 3CZ4A 3D1VA 3TK1A 2RD2A 2JVJA 1GA6A 3Q11A 2H63A 1XBTA 4D80A 3QNMA 1K2VN 2H11A 3P0EA 2P2DA 1WKBA 3QPDA 4PQGA 4EJSB 4D02A 1TD9A 1J1UA 3LJKA 3M2TA 1I5OA 3K6JA 1VLHA 3LS2A 2YXDA 3V2GA 4DVGA 1U8ZA 2V7EA 2WEKA 1U7TA 4ZAXA 1KVUA 3OOYA 1T5SA 1F7VA 2XE8A 4ZTBA 3P5BA 3H1EA 4UARA 1XDDA 3U0VA 2RG1A 1V3QE 1ZFNA 3RWBA 1U5BB 3RYCB 2Q49A 1CERA 1JTEA 2QE7D 4B5KA 2HCRA 2DR0A 5CDFE 2V0GA 1RSZA 4GH5A 1XCMA 5FJJA 1NJFA 2ZI3A 3MELA 4MUHA 2CV1A 2NN3C 4L3OA 5DLDA 1V3UA 2Q45A 3O95A 1RPTA 1DAOA 3UUEA 3U16A 1GTL1 2VQEB 2BHRA 4IJWA 4FYWA 3NKVA 3PDIA 4PNHA 2AT1A 2VF4X 4FEYA 2ALJA 4GC5A 5JLAA 3M81A 1ONNA 1NJ8A 1RM4A 2AC2A 4UPVA 4Y2UA 5B7NA 3OCVA 5MFZA 4LQCA 2YVKA 5HDQA 3WB1A 3IOMA 1UPTA 1YL7A 2XZDA 3DDWA 1G20A 4K28A 4X93A 2GD6A 4DLUA 4IDGA 4Y0NA 2KYRA 1EQAA 1IDOA 1QTRA 2O4UX 3EDRA 5K8LA 5GZ3A 1D2CA 2XT9A 2D5LA 3E53A 4REQA 1UFQA 2AYXA 3H9UA 2QIPA 4HAVA 3T5TA 2UYHA 3OPYB 4LK2A 5TPWB 1AQLA 4EYQA 3WGTA 1PV4A 3TL6A 1ZL0A 4L5YA 1TTQB 4F3NA 1W75A 5BYKA 4ZCSA 1C4KA 1B2RA 2EX1A 1NXSA 1DE0A 2WU4A 2Z43A 3BE6A 3ZCXA 1TVCA 2QLJA 1M1UA 2D5BA 2BHSA 4AJOA 3BCHA 1WHSA 1X7YA 2GO7A 1F1JA 1E7WA 2XB6A 2RGGA 4LDNA 4EOGA 4YJGB 4IEFB 1SKAA 1FLNA 2CE7A 4JJ8A 3KQYA 1V37A 4M9XA 1YZQA 2J32A 4GLLA 4B2PA 5ICCA 3O8BA 4PHGA 2EWVA 5JZSA 1MPTA 1R5BA 5REQB 3T3OA 4Y9TA 2VDNB 3CURA 1X0VA 4FZRA 4CM1A 4E2ZA 4JOBA 4EFMA 3KEOA 4B32A 3JVDA 4G25A 5KSPA 2BGIA 1Z83A 5IHPA 1YUBA 3D9QX 1TECE 4MW7A 3FBGA 3QVLA 1CQWA 2E6KA 3DAHA 1XTVA 1XZ8A 3EXEA 2SECE 3EH2A 3IHLA 4LNHA 3NEAA 4IXTA 1W29A 4US2R 5KU7A 8MHTA 3LQYA 1I4OA 4BBZA 3JQGA 4I4CA 2GRAA 3HFGA 4NBLA 3NM5A 2JC3A 4LYGA 3RTCA 3WYBA 3KKLA 5ALWA 5YASA 3GDGA 1LRKA 2D13A 3DO6A 2JGIA 2WHRA 4BP1A 2Q7XA 2WPDA 4JGGA 5IEBA 1OR8A 4KP7A 3RKSA 1WXQA 3SR4A 3CZCA 4U4AA 3T0GA 4CL0A 2AKEA 2L17A 3VYVA 2AXPA 3CA8A 1EDBA 3DHWC 1N1DA 4CIXA 1D8TA 1JJ7A 5IC6A 4WKPA 5FNVF 2QLLA 4CKCA 1DAKA 1MD9A 1GG8A 4FIZA 3I39X 2ZJ1A 4R16A 5ENZA 4M0CA 1RBYA 1E7MA 2H7CA 2CKDA 3QIVA 4F7WA 3SQMA 1GCAA 3H7IA 1A4UA 3UT6A 1NL3A 1LDBA 2OCAA 4HS9A 2DWOA 4EWLA 1ML4A 1TQ6A 4JB2A 4PLHA 5FPQA 4KWTA 2QN7A 1Z2OX 4L4ZA 2QMQA 5AVJA 4PY2A 1JSRA 3O1JC 2X76A 3GLTA 2QMZA 2XUFA 3H87A 4EA8A 1UBNA 1PFUA 3MJTA 1B43A 1ZSVA 1G20E 3TR0A 3L8EA 1V5EA 1O5TA 1SUEA 3EK2A 4MAAA 4KXFB 3CX3A 4YYEA 3PQFA 3SYNA 1E1CA 2ZXEA 4QGGA 1IVSA 2DETA 5HE9A 7ABPA 3E2IA 3NW9A 3SSOA 5DLQC 4ZTUB 1AXRA 3OCYA 4FXPA 2YBDA 1L4FA 3NHZA 1FMCA 4LYEA 4WCFB 4CKWB 4ER0A 5I4IA 1G6Q1 1ZINA 4ZJZA 2GCGA 2G09A 3NO4A 4AMVA 3IT1A 5K0GA 1VHQA 1IN4A 1H66A 1L5LA 2P2YA 4PRLA 2ERXA 4UDNA 3VDRA 4F45A 1MT3A 3ZZTA 4GRDA 4UMFA 4MWOA 1FYDA 5G2OA 2CZQA 5KU1A 1Z5NA 1E1RA 1MVNA 1P7YA 3DUFA 1DFIA 2WJ3A 2Z2ZA 3CC8A 3PDHA 1AT1A 3FCYA 3OMLA 4RDCA 5FYDA 1QO0D 3EXHA 1VLZA 2IQ5A 3R7FA 3PQ7A 3B78A 2H4YA 1EZ4A 1HNZB 1QNFA 2P1RA 1Z07A 2XOKA 5T6MA 4JI0B 3PD7A 2EW8A 3BXXA 1G8JA 1P7WA 3MXOA 5HVNA 2H4JA 2DUJA 3BBLA 3LGSA 1H6CA 4LJSA 5A3QA 4KQKA 1AA9A 1BH2A 2F8MA 2UYQA 2V9ZA 3H4TA 3KFLA 1Y3CE 1D9XA 1DCKA 3SGLA 2X2PA 4HC4A 3CLUD 5KNBD 3M6UA 2OV1A 3N7AA 4KVAA 5BPHA 3NVKI 2O2GA 4UQOA 3H9EO 4BATA 2OM6A 4JI1B 4FEGA 1OX4A 4P33A 1EXWA 3QVKA 1JI0A 2H9YA 4IJUA 4QICA 5SYNA 1J2UA 2ORWA 4G09A 3VNBA 3AKYA 1QV9A 2BCGY 2IXBA 2BBWA 2D4HA 4IW3B 4RV4A 3ZX5A 2Y1EA 3THOA 2XMCA 4MS1A 2BDTA 1B8OA 3N0RA 1GR1A 2BMVA 3RJ9A 2UAGA 4PSAA 2WFLA 1W36C 1X8JA 5B57C 3OIYA 1EJ6A 2A8YA 4MULA 4PFSA 3A3NA 4MRMA 5DF1A 2PQMA 4DWVA 4FHZA 2F62A 4PYJA 2BGUA 5FEMA 4J16A 1E6EA 3CZMA 1EIWA 1RM0A 3PR1A 3OZ7A 1UBRS 3ZR4B 2JLCA 1OAKA 4XA8A 3HM2A 1XJ5A 2A9FA 3UOWA 1U9IA 4ROTA 3GZ4A 2KLBA 1IONA 4F8JA 1DAFA 3F5MA 5DASA 4EECA 1E1CB 2CMFA 4UNRA 1VXOA 1HTBA 2F1KA 1NDQA 1RM3A 3DOFA 1P44A 1JDBB 3SIPA 3R75A 5AM2A 4C4TA 5EQDA 5DH9A 4QIHA 4ZHQA 4YMHA 3NIWA 4N6OA 1XKQA 1BHO1 2YZ2A 1U0RA 2JAXA 3LDFA 3GG2A 3TXXA 5K0FA 1EXDA 3EZ6A 3WGVA 2WABA 2Y0CA 5IXSA 4B3GA 1IWOA 2NUPB 5A7FA 3AX6A 1SZJG 2DVMA 2V0NA 1KAGA 4I9FA 3T9AA 3D0KA 3OSUA 2GTPA 3RUCA 2P8JA 4FOPA 1I32A 5LJLA 3IPAA 3A04A 3BS4A 4L73A 1YVPA 3TTSA 3RRFA 4ZVTA 2BGRA 4IDFA 3ZQUA 3IE0A 3UICA 3N8KA 1DQYA 1I4TD 4MP8A 2D0IA 4CLRA 1MJHA 4ZYVA 1JLKA 1AK2A 4FOOA 2VYVA 5ARBA 3CS3A 2IH4A 3F6SA 4ILEA 1S7CA 3D2AA 1W85A 3WDSA 3DZ8A 3BRSA 3CH5A 4M2LA 3TRHA 5EE1A 4HO1X 3NX4A 1Y1PA 1U2DC 2DPLA 4PLTA 4KH1A 3N6XA 5ALJA 1CEYA 1WA5A 2CMGA 2CNDA 2VHWA 4MKIA 4NLLA 4D8WA 5HUHA 5CAEA 4AJIA 4IOLA 1QQ7A 1NA5A 4FGZA 1W73A 4E5VA 1NC1A 2F7SA 1SXJC 4RV9A 4EO7A 2CSUA 2FX2A 4OAOA 5IK2A 4IOKA 3VHXA 1XCLA 4HUJA 1T15A 2ZRPA 1SEPA 1UQUA 2G5GX 4NZMA 1DUIA 2REOA 3RGGA 2Y1LA 3LY5A 1EG2A 3JCZA 4JP3A 1ZD9A 1KIAA 3BREA 5EYPB 5BOVA 3GFTA 1TQDA 3E5RA 3TTUA 2HQOA 2JNWA 4RZ3A 2Y4OA 3PG5A 2ESRA 2F9LA 5KUTA 1WTCA 5DU2A 1KBQA 4X3PA 4ZI7A 2QJOA 1ZP6A 3E9NA 2BFBB 4KPFC 1E32A 2QI9F 4P4LA 1VJTA 4J94A 5CXXA 5K3OA 2CUZA 3EZNA 2VTKA 2QGZA 1HFJA 2O0JA 3RBAA 1BVYF 3ORHA 4FKMA 3JD2A 3G68A 3RU2A 4DUZB 1T5OA 3BD8A 3CM0A 1NQOA 2ASVA 3I2FA 3ZWAA 2QUZA 4QSHA 1XZMA 2E37A 4Q7EA 5D00A 1KBOA 1UK8A 3EG5A 4FLMA 3G17A 5HMMA 5B4UA 1NU6A 4Q3CA 3FNBA 5BWOA 3ECCA 1ZQ1A 3IERA 4BNJA 3A70A 4UREA 2Y9PB 4ZXFA 2NU9A 4GPTA 1GCIA 4U2DA 1SUAA 1HV8A 3PWKA 4IWNA 4IVPA 4JA0A 2UDPA 3FKSA 1W2HA 4AP5A 2W2KB 1A5SB 2DBVO 2QRKA 4ND5A 2PPLA 2ZBQA 3CLSC 2XDQB 4ZQIA 4BNMA 1QQAA 1HXHA 3QUQA 4AMGA 4G9EA 4HZUA 1E66A 1T3ZA 3KYCB 3BFVA 3DFIA 3EAGA 4O4JF 3QITA 4TKLA 3L3BA 4FDTA 4KBYA 3V2IA 1KI2A 2WMDA 4QQFA 1JR2A 2BGNA 3C4VA 4KQ9A 5E4TA 2JFBA 1ZWKA 2OO3A 1V7PC 3DMPA 5FADA 1U0OC 1R0CA 2VP0A 1SKQA 3N05A 4HGPA 4K86A 4QWMA 3B6KA 3SLRA 3I9KA 1UJNA 3ZCUA 3GOQA 4CV1A 5FOQA 4HZIA 1U7ZA 3HKCA 4UXHA 1Y1KE 1YACA 4LXUA 4UTZA 4OB7A 3DVAB 3IOYA 1SK9A 5D1HA 5BSMA 1XYGA 4Q9DA 1KR5A 1MOPA 2NACA 1T8PA 1BFKA 3G7NA 3O8DA 4M0EA 1RJWA 4YB8A 3UJNA 4TSFD 4QRDA 1QHHA 1ISMA 3I23A 3L0SA 5IULC 1MVOA 1TYZA 4IH1A 1JXOA 3GLVA 4MUGA 1IRXA 4HKTA 3BHIA 4LOHA 1JJIA 1VYHA 3NWJA 1P4AA 1RRCA 2VZLA 4CHTA 3DTVA 3S1AB 3L9XA 4X24A 2J7PA 2P9TA 3WC4A 1PYGA 2IELA 3ET5A 2H0RA 4UD2A 2J67A 1HDEA 4MVJG 5DI9A 5J58A 2A9PA 3UFXA 2DQYA 3CWCA 1K98A 4QOJA 1JILA 4MR8B 5EAIA 2F3RA 2G77B 3D2CA 3KOOA 1QMPA 3ZGOA 3A1WA 3FE2A 2QTTA 1EI9A 3KVYA 1M1NB 4BX0A 2PT7A 4FCWA 3B82A 4LAFA 3D0RA 1Z7GA 4KNVA 4QUDA 4DB2A 3G2IA 2NPIA 3N5CA 1XCOA 1UJBA 4QBHA 1BXKA 3WQBA 4AXXA 1FVFA 5L9AA 1TT5A 1V1MB 2JFHA 2PX4A 4MYCA 2J9ZB 3SKVA 1PNVA 3VO9A 2FRVA 4TTPA 1BMDA 1NGSA 3Q8KA 5G0SA 4X20A 1C1XA 2AFVA 3S5JA 1MJGM 3T3GA 5LP6F 1MORA 3N7TA 1ZGBA 4LJRA 3E3AA 4MW9A 4DJTA 1JHDA 3PUKA 4R5HA 3OH8A 4C7VA 4KIGA 4D8YA 4H0CA 5F7JA 4MI3A 3AF2A 2DUNA 4N3GA 3RYIB 3KLPX 1BVRA 3QMVA 3OF3A 3F9RA 4KFTA 2RBEA 3URKA 4DTIA 2QL6A 4WRRA 1FSZA 1RKQA 5KVCA 1YQGA 2ZROA 4I5FA 4L9WA 4OGFA 5THXA 2CMHA 3ODPA 1PJAA 2OBMA 1H8ED 1H9BA 1EGHA 2C8LA 3T06B 2V98A 1LPAB 3AM5A 4DV0B 1R0ZA 4YJHA 2P9YA 2E1RA 3EULA 3VR5H 3GCGA 3FMOB 4PZCA 3K70C 4HOYA 1MJ5A 4TTTS 2VQ3A 5CTJA 2XEDA 2FSGA 2PGNA 1ADGA 1AS0A 3O92A 4AN1A 4DUGA 4KO8A 1ZBDA 2Z9BA 3DEYX 3K9GA 1HNXB 2PA3A 1QZTA 3UJBA 1QFMA 3E22B 1JB9A 1DVRA 2BM1A 1N2HA 4QGSA 4Q47A 1UT6A 5DM1A 2BI8A 3FSJX 3FVWA 2NUTB 2IV7A 2JJYA 5F7OA 4CQNA 4P4SB 4D26A 2QS9A 5KWSA 1NPYA 2BSQA 2XXAB 1WXWA 1KP3A 1XJQA 3O1LA 3KXKA 4EPXA 1D6SA 2BF4A 2ST1A 5CLGA 5I9SA 3BWDD 5KJEA 3OTWA 4IUBS 3JVEA 4Q7MB 3PHCA 2I1VB 1Z0DA 4FC6A 1LNQA 1FX0B 1TW2A 4NL4H 3GRRA 4HNVA 3HA2A 2J45A 3AU9A 4RVUA 3IL2A 4OJYA 2O8EB 1JEJA 3MWEA 3OZSA 1E59A 4GYJA 1BW9B 2EV9A 4WX2B 1OAOA 1SXHA 1A88A 4G5SA 2ENUA 4EJSC 1TD1A 4PZEA 1FUKA 1UMDA 4KAAA 5DCLA 3MWFA 2IW1A 1E4VA 1J5XA 4YALA 3AF4A 4PNZA 4HT3B 5C7LO 2HNKA 1M6YA 3I30X 1CVIA 4WVLA 3L7AA 3ZDQA 1CJVC 1R8JA 3IIKA 2XEXA 3IR5A 4ASUD 4B4KA 1YZ3A 3I0NA 2ZYWX 2SKEA 3E9YA 4NTZA 3V00A 4JLKA 4C43A 1WUTA 3F7OA 1KXZA 4UUOA 1K7EB 2J09A 3GFPA 3DBRA 4Z7QB 1X9IA 2QAJA 4EW2A 3B6IA 3EISA 4BMYA 2XMSA 3BCUA 4MUFA 2V7PA 1KDPA 2I33A 3SS9X 3KUXA 5B2FA 1CT9A 4OSEA 4EI2A 1KI6A 5JROA 3N2LA 1GPKA 2JFFA 2RHCA 4G26A 5TX7A 2V7BA 1RW4A 1XCBA 1N7IA 4KWCA 3F8SA 2IU4A 1H94A 2W48A 4YGYA 5CEFA 4A0HA 2FPLA 4MWDA 3R0ZA 5JXGA 1U3FA 5EIWA 4KN9S 1B00A 1NXVA 4OH1A 4QUEA 4HN9A 5CCXA 3FLMA 1H2WA 2B4TO 2NXCA 4QFCA 3K1TA 3FDFA 2VS1A 3W5JA 3FTPA 3FVQA 5DM70 1A9XB 1NUAA 3KG2A 3E9MA 3OOJA 3DV9A 3EWSA 3PVZA 4QFDA 3TMAA 3UZUA 5KYXB 1VRWA 5A5GA 3DEAA 2Y8EA 4RTNA 1ATIA 2OZLB 4JJKA 4YWJA 5AW9A 4TZ6A 2OMKA 3L7YA 5IU6A 1H9AA 1V0JA 1I2AA 2B83A 2GHRA 5F2OA 1KDRA 1M8JA 3CVJA 4X3OA 2X6RA 2M6LA 4F8YA 4FFLA 1MR3F 3JV7A 3UT5A 1XJCA 1ANKA 4Q7KA 4TRRA 3UTCA 1EBUA 1QGAA 2CVPA 2O6HA 3KTOA 1W25A 4ABYA 4DFDA 4CF7A 3PUVA 4A0SA 3A58B 4FFSA 2UZ4A 1RLUA 3GRVA 3TPFA 2YY7A 3MOIA 5TVGA 1TQHA 4HV4A 3R44A 1F4PA 4DM3A 1RJEA 1Y1TA 2R6GA 3AVXA 5GGYA 4ZFNA 2W0SA 3QVMA 5AUOB 3KT8A 2BM9A 3RLFA 2PFGA 4I6JA 1YASA 2AUMA 3TW0A 4XSGA 2ZS7A 5HZGA 4TN5A 4ZOBA 4IHJF 4BYMA 4PVDA 3WGZA 5DULA 2BJHA 1TOAA 1JQEA 3WSTA 3UWPA 3VR4A 1Z6AA 4WAUA 2RB4A 4JJ6A 2PKEA 4TV9F 1MAWA 1GZ6A 1KP2A 2MTBA 1CJBA 4B3FX 2I7DA 1ESZA 2W0MA 4U0JA 1Z8NA 2WAMA 3CX7A 1GQRA 2ZUVA 4LRWA 1UWCA 2WF8A 1KJ9A 2EFDB 2ZI4A 1N2XA 3HKBB 3LL7A 5DYYA 5A6SB 3TR6A 3M6IA 2FE4A 4GP6A 5B1DA 2ADFA 1XQ6A 3BORA 4OJNA 4RLFA 1YZHA 1AY0A 1IOWA 5DT2A 4DADA 1CLUA 3UHFA 4F9TA 1TFRA 5KX5F 1ZCAA 2P6UA 3CW2A 2JIQA 3DD5A 3Q7PA 3PLAE 4KU4A 5JCXA 4KV9A 4RGYA 2RHRA 1ZU4A 3R74A 3W4IA 5AJHA 1PE0A 2FN9A 2QP9X 3CCCA 3B1ZA 3OUTA 5DXFA 4PC6A 4J0DA 5TQ2A 3MWJA 4RM2A 4QJIA 2GAAA 3FKQA 3GCXA 1YC2A 3N0WA 5JD4A 2PBZA 3AY0A 4YLGA 4BVKA 1II9A 2AW3A 2CDNA 2O7VA 4A6PA 2PX0A 2Q9AA 5DWVA 4JI2B 4FM9A 4I1RA 1FK8A 4MVJP 3PPXA 1F4LA 5BT9A 5K3DA 2YS7A 1R12A 1TYAE 1ZG3A 5KTSA 3TJZA 4BNUA 4CMIB 3LM8A 2C3PA 2YOFA 1SPBS 4ESEA 4F5EA 1CE8A 2G1UA 3IO5A 3T99A 1U9ZA 1T4CA 3I9V1 1TIPA 2HADA 2XCSB 5I01A 3T3DA 4LXIA 4FMDB 5FQNA 3HKEA 2SICE 4FUTA 5DB4A 2WZQA 1LLUA 4EPTA 2BF7A 1SA0A 4OO3A 2BMJA 3GFFA 3N2NA 4ML3A 1O0BA 3KHSA 5A3SA 1JPNA 1Q1AA 4I99A 3UPDA 3ZE0B 2XE6A 2PMBA 4EJSA 3GCZA 2X86A 4ZCIA 2VNIA 1RD4A 1G5RA 3I2YX 3LSTA 2FOIA 3ORQA 3GI1A 5JZ9A 1XLVA 2IEYA 4NBSA 1BMTA 4IFEA 4P0PB 2Y1GA 1H0SA 2PBRA 4JVLA 1O94C 5H16A 1JEDA 4B48A 2ZE6A 2Z2KA 1RWVA 3CH7A 2NAPA 1RYBA 2WA2A 4YJKA 1MIOA 4I1YA 1Q6YA 1XZJA 4FFNA 3NALA 5TS3A 3PR2B 4DA0A 5GZ1A 4OHCA 4UBMA 1NVDA 4BYGA 3FLAA 4WXMA 1Z6YA 3EYAA 4YMUA 4U6NA 1TLLA 1IN5A 2PKWA 3BF7A 1GDTA 1Z17A 4QBIA 4B35A 2HF2A 2VNAA 2C9ZA 2A35A 2OHXA 1PS9A 4CUJA 4HQNA 4BN0A 2RB5A 4ZQBA 4ZMBA 5AUNB 4D2IA 3TSCA 3IAM6 3ZHOA 3W6ZA 1GVNB 2NSJA 2BFCA 1ORVA 4IH4A 4D43A 2PFSA 1JDBC 1TMYA 1NYRA 1T2AA 5KJ1A 2QD2A 4F5DA 2WPDD 4TMYA 5FTWA 2KS6A 3DQQA 2DHQA 3EIHA 4RE5A 1YDWA 1UQTA 4FR5A 3ZCRA 4OHZA 1IK6A 1XFDA 1QWOA 3H8WA 3OM1A 4KWHA 5F1OA 4IFIA 5FTJA 1H85A 3P4UA 2FW6A 3GVIA 3UCFA 1WLSA 2PNJA 3I5AA 2K4MA 1ULAA 5C8VA 5F1KA 2ZP1A 1CY6A 1JQ5A 2VLBA 4YROA 1DJMA 3BKWA 1T5BA 2CNBA 4YHBA 4EGCB 4C9BA 4ND7A 3LGAA 1Y4SA 10MHA 2QV7A 1DV1A 3CUKA 5D7BA 3X1DA 1J21A 2QUBA 2O8DA 2I03A 2VQ6A 1NXQA 3C8ZA 5JS6A 1Q2XA 2P4QA 3HPRA 1TCBA 4OXRA 4JBNA 1L5OA 3DBHB 1ZVJA 4RKFA 3ZEAA 5B55A 4KBGA 3WKCA 2C42A 5CA1B 1DG3A 2IPAB 1T9BA 3M5WA 3NC1C 4A2PA 5EJGA 3NT4A 1DIBA 4MW1A 5I47A 1RZRD 1GYPA 2OK7A 3ME5A 3AY7A 2RE8A 2YC4C 4X90A 1L7QA 3FNGA 3MS7A 1ITZA 4WOBA 1BDJA 2NSDA 3F6CA 3OM0A 5AM5A 2JAWA 2J9YB 2PX3A 3A1CA 3CN9A 2YHIB 2XOKD 3FRIA 5IWCA 5DOZA 5D7NA 5HIKA 4NU0A 3KC2A 2ICAA 3JQ8A 5HCNA 1GRRA 1G5HA 3QVJA 3RSLA 1IUNA 4A7PA 1GTSA 1YA4A 1SU6A 2IFTA 5CA0B 3IUYA 4C5CA 4NXNB 4CL8A 1FUYB 1XA3A 2SKDA 4W5HA 3DNMA 1JV2B 1JAIA 5I7UA 1SUIA 1JR3A 1L7EA 2O23A 1T9DA 3E27A 5FBQB 2DBYA 2XPCA 3NBZC 1WW3A 1NV8A 1QGYA 4UM7A 4C4ZA 3G8BA 4TS3A 3AR9A 3LZCA 1NYLA 4LHSA 4FS8A 2R84A 2C88A 1XTKA 3F5FA 5TXGA 3OMXA 3ZWMA 1SC1A 3X44A 3AWDA 4F4UA 2H2GA 3OIFA 3PK0A 1MB0A 1FY2A 1KI7A 1TAUA 3V4SA 1WIWA 3WKEA 2CY0A 4OJTA 2DEUA 4CMKA 3DJFA 4NYMQ 1B8UA 4QDOA 1YL5A 4DAEA 2M1ZA 3WNQA 4YRNA 1YI0A 4WK0B 1PVDA 4BMPB 3LY8A 2BZSA 3FHCB 2YX1A 3FPCA 4TS1A 4E4YA 2Q3DA 4F5YA 5KYUB 5LLDA 4Q03A 2CXQA 4KIFA 2ZYSA 1V48A 5LQAA 1JT9A 3LBYA 4LZJA 4RE6A 4V0KA 3GJ8A 4MW5A 1JXQA 3WGIA 2ZPUA 3E7WA 1JHYA 2FKAA 2QQEA 3AUFA 2IZ5A 1E2FA 2D1YA 2NV0A 3BK1A 3G0OA 4IXDA 1KC3A 2QVZX 4I50A 4ITUA 4R1TA 2FW9A 3ECSA 4I1SA 1BXRA 5FWAA 1S8AA 2B4QA 2LTAA 1Q6ZA 1NFRA 3H13A 3LHKA 3F96A 3MTJA 5J2TA 4FMPA 2WQZA 2WIBA 3R5HA 3X2FA 1TLTA 1VB3A 4FZ3A 4Y6LA 3T9FA 3A7DA 1SWWA 2EWMA 2I1QA 2H8KA 2WG0A 2C0QA 1QHXA 4JIGA 1RWNA 4EY3A 4P5PA 1GGVA 3B9QA 2NUAA 2NU9B 2C57A 2WA1A 5JCJA 3IDAA 2C4MA 1YRHA 2XMDA 4W1RA 4LX0A 5FL7A 1V45E 4EFNA 5LXTB 2C7PA 2OV6A 1FS4A 1GN8A 4JX9A 4KI7A 1I7SB 1LJUA 1XEWY 3CNHA 2D1QA 2JATA 3BERA 4UUPA 4Z9BA 5JSZA 1F0PA 2YR0A 3R0QA 2CLMB 3IV7A 3C15C 2RONA 2XVYA 1KA9H 3U2QA 2HXGA 2Q1WA 2GM3A 1QWSA 4V24A 1R0SA 2NW6A 2GXQA 3C1AA 3HH8A 3WGOA 3H16A 3P71T 1TVKB 1NDHA 4JUAA 2RHTA 1XTJA 2OAGA 1GARA 1JEEA 1IDN1 3O21A 2ZJ3A 3THRA 2B8WA 2B4RO 3I34X 4GI3A 1G2IA 1E5DA 1HT0A 1ZN9A 2Q2QA 1BC5A 2FEOA 3FUTA 3QY0A 4Z51A 4CR7A 1GEGA 1J5PA 1Q5PA 1Y8CA 1ZNWA 2PSDA 2VAMA 4LYJA 5TT1A 5BSFA 5EIBD 4BRWA 1RKXA 5GADl 4XGRA 1RWBA 2VXYA 2QLBA 1OKKD 3EMDA 3RYFA 4PHFA 1TK9A 3EGDB 1W0KD 2YV5A 2JIZA 1UIRA 1FS6A 2LRHA 1U94A 2JLUA 3EPHA 5F4BA 4IIHA 3LU1A 1GKUB 1D6JA 1XSEA 4LOKA 4XQ0A 2RGRA 3C3EA 1ZX1A 3WGUA 4DYVA 1PS8A 3B1JA 4N7MA 3UUWA 4CR6A 3CZ9A 2R7AA 1KZ6A 4DSZA 2NSLA 1EHCA 2EVWX 3A36A 3BEDA 3G3EA 3IP7A 3L43A 1A77A 1M2GA 1UDRA 2QKYA 4I4LA 4MR8A 1L8QA 5EPUA 5HS6A 2VUUA 3ZKWA 5EL0A 5HILA 2FWAA 4QPNA 1OTYA 5T8KC 3SD7A 2I8CA 3A3OA 3LVRE 4I9HA 3EDQA 4G5HA 1DOZA 3R7LA 3ROZA 1P80A 3MBOA 5FBLB 4WBNA 3RAPR 4ZRMA 3E0QA 4HUTA 2NO0A 2O1WA 1JZTA 2A14A 3HRHA 1XQXA 4Q93A 2JIBA 4AJLA 2JBWA 2JHAA 4CMAA 2AR9A 2OECA 1O97D 3BMXA 4LECA 4PC2A 3WTBA 3ZYCA 1XRPA 1Z3IX 1AK9A 3IEKA 4GR5A 4AS2A 4TM7A 4R3NA 2HGZA 1AGPA 2HJSA 2WU3A 1RC1A 4HFJA 1P0IA 4OV6B 2YH2A 1ISPA 3U49A 5LKAA 1A9ZA 3B1WA 3I5UA 4N03A 5FKJA 5FEUA 2YN0A 5E1OA 4UNPA 1OB2A 4YRFA 3NU1A 4F3KA 1R3DA 1LQTA 2GPTA 2J59A 3R6DA 5HFJA 4G8JA 2E5LB 1U4OA 2AMVA 2WW8A 2OGUA 1E5VA 3AHJA 3SFTA 1YS4A 3KQHA 2FN7A 4M6WA 1SH7A 1Y1SA 2WSLA 2R4QA 4LXQA 3M6VA 3MNFA 2FSUA 3BM5A 2YZGA 3JWEA 5BXQC 1PT6A 4HUQB 3TJRA 1VSUA 2C94A 2RGAA 1IY1A 1Q2UA 3CRRA 2B5WA 4M8IA 5ALRA 1XD9A 2GAJA 3WICA 2YJTD 2V45A 2IH5A 1SM4A 4HSGA 4OGLA 1IOZA 2OHVA 1Z2CA 1HPLA 1V3VA 1W48A 3E05A 3SEFA 1U9CA 4MTLA 2Z08A 4B34A 4TMTA 3RIXA 4J0HA 2GN1A 3EFBA 1YSCA 4F1KA 3KALA 2HPAA 5C7IO 4RESA 3U7RA 2G72A 2JCXA 3W9BA 1LDEA 4B6QA 1D9ZA 5JSFA 2PDAA 3W3AD 4G86A 2G1PA 1V8BA 2F1HA 1K6MA 2IKQA 5EZYA 1BQ3A 4HLDA 2B8EA 1L4NA 1ADCA 1M72A 2VK4A 1E8NA 2Q3JA 3B8HA 4MYDA 3OM8A 5IM5A 5D8DA 3ZBQA 4D0NA 2GAFA 2CSXA 2FQQA 3WTCA 3FGNA 4AJPA 1K06A 2UVDA 3JASB 3WLHA 4DL9A 5CG2A 2GF0A 2OOKA 3PNSA 1J00A 4ND8A 3V9AA 3VTAA 3D4LA 4FFOA 4F3CA 2JFXA 3IESA 1KAQA 2AOUA 2PV7A 1RQRA 4IIGA 1KY2A 1OSNA 2A2ZA 1AQYA 3N2GA 1TPYA 1F4VA 1CDEA 1JRLA 4PZ9A 5CXUA 1J22A 1J5EB 1KYVA 3L8CA 4GWLA 4PZAA 4B1FA 4H3SA 3OJOA 1D2HA 3PGJA 4DQ0A 3T1TA 2VQFB 4LN1A 1AD2A 3PGLA 5C31A 4NZ9A 4O4HB 2JAUA 3DDOA 2Q1TA 4GLOA 4DLPA 4H15A 5DEIA 2VJLA 4ARSA 3AOEA 2H1LA 1CJUC 2ET6A 2J3LA 4MLPA 4MCIA 2J48A 2HMUA 4MKFA 1H2RS 3JVVA 1C9NA 2AJBA 2VRCD 2WJJA 4HYQA 4L7VA 2HMSA 5ALKA 1B0PA 2WTAA 3GLIB 3MBKA 2A0YA 3N3AC 3HN6A 3BGWA 2V1UA 4ZVRA 1Y6RA 3M4XA 2D2VA 5EE9A 1DCTA 3B51X 3TINA 1Y8RB 1UF9A 4MP6A 1IMJA 1IZ9A 1RJ9B 2GWHA 2CL6X 1AF4A 2V7WA 2HBZA 5TE9A 3UM9A 2JH8A 3AKZA 4G0YA 4OFZA 5DHAA 2GNPA 4HL6A 2C03A 3RTGA 1EZ1A 4WGFA 3RYFB 4R6WA 2VJAA 3H6KA 4RKWA 4P93A 3M4YA 4TT3A 1ZI9A 3WNVA 8OHMA 3IIMA 3G9QA 3KZXA 5H3LA 3DOIA 3GBVA 5EERA 1B6SA 5FA5A 2Z09A 4AO7A 4IDPA 1ZD3A 2AVNA 2XF8A 1J99A 3AW8A 2HB6A 3GWZA 3NQ41 4RKEA 4U7TB 3KELA 5G3YA 3K5HA 5I7WA 3T61A 2RH9B 1UOOA 1N0VC 2E4AA 3G5AA 3MLEA 1M7HA 2YNMA 4PAOA 4TV9A 4U9HS 4E07A 4NHOA 4EMTA 4WY5A 1KEUA 1Y63A 3DD1A 4ND2A 5DP2A 1S89A 3N9IA 1L1RA 2L18A 2VYCA 3PUXA 2WUVA 2FN8A 1KEEA 3NG1A 4YMIA 3A2MA 4KBFA 3ROGA 2R48A 3GJRA 2DBRA 3KKOA 3M1LA 4MJLA 4O2AB 1L5GB 4IPTA 1W5SA 2IDJA 1IEXA 2YIVX 4FMCB 1NVTA 1J7KA 2KBEA 2JPDA 1I51A 4NC9A 4AKHA 2BDEA 3R3XA 4WUVA 3ZCTA 5AOCA 3H5LA 1Z25A 3AZQA 5KOYA 2FGJA 3FNEA 1D4ZA 3KL2A 3ZU6A 1GPH1 2PJUA 3DE1X 3F6RA 4IKEA 3TB6A 4DLYA 3OEEA 1G5TA 1SUCA 2V7GA 2XUAA 4FQ7A 1G7SA 4JQSA 4TLEA 4X45A 5DGXA 4BFYA 5ICFA 1ZOLA 1QTIA 2VPYA 4KYUA 1PUJA 3DDZX 4MOWA 1P8AA 4O4IA 2WE7A 3IVCA 3SBXA 3TRKA 2VUHB 3KWLA 2QZPA 3MBIA 4Y7DA 1WV0A 3DE7X 5C35A 4Q6BA 1ZKDA 4GL2A 5J2TB 1E2NA 3TLJA 4TWJA 4UUBA 3IQWA 5JPDA 1D2GA 1BOOA 4GZ3A 4BECA 2J3HA 5CBPA 1VI5A 2GGSA 3RVNA 3DFUA 4IYJA 3Q4GA 4YJHB 3H18A 5EMHA 5KAMA 2O8FB 4G1MB 5CA0F 3IAFA 3FWKA 3MC1A 3TX6A 3HJBA 2EG9A 3ZY6A 2UVPA 3SQXA 3S2ZA 1DX6A 4PAWA 4IYRA 3VKGA 2VHEA 4EI9A 5TMPA 3RRNA 3ACDA 1Z5PA 4Q9AA 4F9FA 3AL2A 2B99A 4Y0AA 1UFVA 3V8PA 1S2GA 4JVOA 1GNPA 1ZS9A 1I1NA 1N5KA 1VXRA 2FYTA 1LBHA 3MGBA 4RPIA 1OZGA 4KRYA 2ZWPA 3UQYS 2O8BB 2HU2A 3OEWA 5LXTF 4EHDA 3ZNQA 2OYSA 1MO6A 3V4FA 5ADWA 4CNQA 1I3KA 3TZKA 5K05A 4RORA 4K8RB 1Y81A 1NR5A 4TWIA 1WCIA 4ENTA 4TYWA 1FSSA 2F00A 3RVRA 2G1JA 2OXRA 1BJTA 3SC4A 1G6OA 2O3QA 7REQA 1J8MF 1PCXA 1V8OA 1XDUA 3EGXB 3QTLA 4HEHA 3ITKA 3T94A 3UO8B 4BFCA 3VDXA 3AXTA 5EHIA 4ANFA 2AOWA 2HHLA 4P7FA 2W6OA 4AIRA 1LLFA 1Y4AE 4ZO6A 4DMCA 1V6AA 4X1OA 1AH2A 2ZUWA 1JI3A 4PW0A 2Q6VA 2H1HA 1M2VB 3FIJA 3S8MA 4MDEA 4S24A 2BHLA 4PXYA 1OTXA 4K81B 4R2JA 4GG1A 1QAQA 4UBKA 2HRDA 3CO5A 3Q3JB 4AF7A 2AK2A 1YI8A 5JJ5A 2CXPA 2BEWB 3IT0A 2YIDA 3AEKA 3AINA 3PVSA 2PS3A 3QFHA 1A5ZA 3QY9A 2E87A 1T6NA 4F86A 1ZK3A 1ODCA 1GUDA 3K1AA 3UJ8A 1HZZC 4NZPA 5F51A 2IYZA 5L4LA 1WZIA 1U2GC 3UQZA 4ER7A 1NXXA 3PHLA 2G83A 3IBCA 4C0HA 4DQVA 1OJLA 2RSLA 2P2ZA 5LQUA 3DGFC 2MYPA 1G8SA 4C7OB 2ZUUA 2A3RA 4IGFA 1OHHD 4YT8A 2MYNA 3MW8A 3A6EA 4A0GA 4A27A 1S9DA 3CIFA 3QE9Y 2D0DA 3D8NA 1JIQA 4UDYX 2IZ7A 4HX2A 3AJAA 4DS3A 3SS7X 2I7XA 4DIKA 4JWKA 1Q20A 2FV8A 2EKPA 5DGHA 2FRXA 4V38A 3UMJA 2OLKA 2WV9A 1VPEA 4B3DA 1CRPA 3ZH9B 2K7ZA 5HEKA 1VKHA 2WYOA 3MWDB 4XWAA 3GRCA 3C8DA 3FR8A 4YLEA 1H0KA 3A11A 1NBMA 3CZ5A 3IHWA 2C7VA 2O3JA 1NVXQ 4XVUA 3FPAA 3IUEA 4N5MA 4UOZA 3EIEA 4J0KA 2ZRJA 2Q5LA 1H3NA 1OREA 1EVEA 4CV3A 1Z7WA 5K03A 4EUFA 4JB0A 1TE2A 4RTRA 3K72B 2GTHA 3JZAA 4G4SO 4UU7A 3ZGXA 3BL6A 4C2TA 4RJLA 1IQUA 4XGKA 4GBED 4TMFA 1Z8FA 4I19A 2FF7A 2PZKA 3KEQA 4GX1A 1TC1A 2XMPA 1VL8A 3SNKA 4OL0A 3GF4A 4R9VA 1J8DA 5EMNA 3AVVA 4HNGA 5A5EA 4ZVPA 1G1MA 5HJ2A 3WDLA 4OQEA 2FNAA 1UC9A 3BC1A 1Y3AA 3PHGA 2GM9A 3CJTA 4RQUA 2DYKA 4IX9A 2B5VA 1SC3A 4IBOA 1F2VA 2O5RA 2ZT6A 4IIXA 1DRKA 1FX0A 2P2LA 1UMCB 3VYTB 1WP9A 3PC6A 4ZU1X 2NSYA 1Y6FA 2A5YB 1P0PA 1WVIA 2JL1A 4E15A 1XQ1A 4LJ5A 4QG7A 1SQ5A 4YC7A 3WRYA 4ZDJA 2P9GA 2C29D 5CFMA 4M7OA 5C46F 4C30A 4U2EA 3GQBA 5JECA 3ZGYA 4J49A 1UBFA 1T8RA 4MVJE 5AOBA 2OILA 2ZJYA 3NORA 4EFDA 3KWMA 1SC6A 1YQWA 3CB2A 1LSJA 4B6GA 4DJFC 1RI3A 4FD2A 1X7WA 4EG6A 4BEJA 1YCHA 3B7GA 4WLEA 4OXQA 6Q21A 4D0SA 4B3SB 4GPBA 4O8ZA 2C8VA 1T43A 3LT1A 5AKIA 1SBTA 3D8SA 1PT7A 2R85A 4HFMA 1VCHA 4L4YA 1FLAA 1KI6B 2VZEA 3EC1A 1F60A 3DSRA 4X1KA 1AMUA 1EWQA 4HK4A 3E7DA 3EWIA 1C9EA 1XNHA 4D4GA 4D46A 4D97A 1MX5A 3N6RA 3GRUA 2VBCA 2PWBA 2B7LA 3BWBA 4Z2AA 3GLGA 2OCDA 3L7KA 3OHPA 4BMCA 1YR8A 3GEGA 4B82A 5ALVA 1ZA1A 4KXWA 3SSMA 3T95A 3LT2A 1QF9A 6CHYA 2EKLA 3QYFA 1L5HA 2VNKA 2WAAA 3KVRA 1U4SA 4E2YA 5IASA 1P72A 2QE7A 1J1IA 4NK5A 2CJWA 3G88A 5F2EA 1G6KA 1E99A 3AIKA 3CNBA 5J1TB 2YY6A 4OP3A 4LFAB 1AQIA 2QIOA 3RVJA 3SC3A 3EXIB 5JI3E 1GPAA 1PFKA 3E6AA 4ODIA 3TL3A 4BAGA 1II8A 2ORIA 5HWSA 3UNXA 4BNNA 2HHHB 2FZ4A 3GRYA 3U0BA 4D9MA 4IRUB 4Y2RA 4O2BB 3FVVA 1N9KA 3HPQA 4P7GA 1Z18A 1SJ9A 3A32A 3AM3A 5F9MA 1DO0A 4UUNA 1RAFA 2WD8A 1U7UA 3DMTC 5K8TA 2QT0A 3U9SA 3V2HA 3L8DA 2YTZA 1MC1A 4MS4A 1G66A 1DPGA 4HLNA 4KFCA 1BWQA 1L1EA 2NUAB 1G0NA 4R6XA 2Q41A 5FTNA 4GPIB 1CBUA 4QO8A 1Q3TA 2CCKA 4UHKA 4MYSA 5AK6A 4A26A 4LJ6A 2XIQA 3H11A 3RVOA 4ARBA 1C30A 4DZTA 4F1WA 1HBJA 4WK6A 1QHFA 2YMMA 4EGJA 4UBLA 4KQ6A 2R66A 3JQ6A 2K87A 2HA4A 3V5NA 1E3WA 1BS1A 1MOSA 2C2OA 3LUHA 3TQCA 4O3MA 3A0RB 4EGQA 4ZZIA 3TSOA 3QEMB 5E7QA 5E7MA 5IM4F 3KZVA 1Z68A 3RAJA 3WOHA 1KGDA 2D2FA 4M36A 2MU1A 4BZZA 1X1BA 2P4SA 4FI3F 2NU8A 1LWOA 3NHUA 2I4IA 4F1JA 3ZD9A 5TT0A 3QENA 1GZ5A 2Q3EA 2QTRA 3TSZA 2ONJA 1E4EB 3LNCA 4D9IA 1RC8A 1Y9EA 1KPIA 1FB5A 2BCJQ 5JD6A 2YN2A 1KMHA 3B3AA 3OJCA 4FYXA 1GA4A 1P2TA 2GSWA 2IZOA 3VKVA 3DOJA 2WU0A 3FZEA 4CF3A 3QMMA 3FCAA 3I6BA 2ZE7A 3KVOA 4ALKA 1BMQA 1HRDA 1L7AA 1YZGA 1UZNA 2X77A 5J40A 3RSHA 5L4SA 3ENVA 4UEKA 1E1NA 3VVLA 3WK5A 3BA1A 4BO2A 1HRKA 2R6CA 1PR2A 1T1EA 4R31A 8GPBA 5F9FA 2EDCA 1ULBA 2Z04A 3BMNA 4KEAA 5GVRA 3S40A 2F8SA 4DDWA 2FJUA 2OVBA 2ZBDA 3KAQA 1MDFA 3QOWA 5COAA 3RTDA 3RIHA 1BA3A 2R6HA 1ADBA 5KNDH 4X62B 1QP8A 3GGPA 2HFJA 2RC5A 2Y0BA 1JU9A 5EQTA 3U4IA 4TLCA 1BD4A 3N59A 4PZLA 5A5FA 4CETA 4BHTA 5BN3B 2HLPA 2RG7A 3MA0A 2A5LA 2GM5A 1UMBA 2I1LA 4BFVA 2XUQA 4JKOA 2QRMA 3LQFA 2QNRA 2PUBA 3FTEA 1E2BA 3THWA 1ZBQA 3OFND 3BSSA 1SK8A 4D5GA 5LVAA 4IQ0A 2EBUA 3DL0A 1K6JA 1WU8A 2GEVA 2B98A 2QVYX 4PLYA 1R1DA 4RA6B 4U3JB 4PSCA 1Z15A 1RWOA 3Q2KA 4H6WA 4ZV7A 4BU1A 1BGXT 1OXMA 3MRVA 4ZYZA 2O8EA 3OMWA 5HJ5A 4X41A 1P2UA 1BW9A 4OATA 5D1NA 3FZQA 2I4RA 2A5DA 2X8JB 4K3UA 3BH6A 3LK6A 3MCAA 4RSMA 4Q0MA 2VCYA 3SEZA 5DBIA 1LQUA 2FK8A 3O4IA 2Z83A 2BEWA 2C3OA 2NXJA 3O3MB 1JMKC 1G8GA 1QM5A 2GBCA 5HZKA 1KQOA 1S3IA 1R6TA 2AUTA 2QW8A 4M1QA 4QXAA 3VYWA 4DIUA 3EWAA 1Z74A 1H2HA 3MUOA 1PG5A 2DY1A 2HSGA 2ZT7A 3W7AA 4RTSA 2IS1A 3VPFA 1CUVA 1T13A 1N2EA 1FTWA 1T6ZA 4HDSB 2NADA 2M9MA 3GPDG 5CDUA 1Z3CA 3TECE 4XLTA 3AL0C 1T9AA 1OKKA 1ZC4A 2G1AA 2QORA 3DMGA 3KR0A 4J1TC 4RLQA 1ZVKA 1KSJA 3E3MA 5DYIA 4KKVA 3UAYA 3RS5A 2GPAA 2QJRA 3OZBA 4AWXA 1RHKA 2VJPA 621PA 4FHFA 1EDZA 1DJNA 1GZ4A 2O0MA 2ACKA 1XD2B 2D2IA 3UHPA 1FU7A 1UR5A 4WBSA 1RXYA 2R2AA 4YBZA 2ASEA 2WT8A 4L0QA 3WQSB 3X1JA 4DAOA 5AI9A 2SNIE 3K5IA 3IDFA 2O7NA 3T1VA 3WXBA 3M9XA 3IR7A 1JHZA 1L2TA 3GR6A 3AQIA 4ZU6X 5C32A 4BDTA 2VCHA 3PX2A 2XHEA 2ZETA 1VPVA 3G1TA 3TOSA 5IH7A 4WXYB 5IJ9B 3WRVA 1EFPA 4TUYB 5A0FA 3S8YA 4UEWA 2V5VA 1Y5LA 1J6UA 3EQZA 2H1CA 3IQXA 3QWFA 3E18A 4FGUA 4GMDA 3P2OA 4PTZA 2QJFA 5E9AA 4AJ9A 2YQ5A 4CKZA 4CFYA 2R4TA 2VXCA 3DNFA 3EGIA 4L16A 4S1PA 4AY3A 3B5EA 3LO8A 4YAIA 1KWKA 1HR0B 2JIMA 2PPVA 3KJQA 5K8JB 3VBCA 4NFHA 4EX6A 5BUZA 3GGSA 2WRZA 1SXJD 3KS9A 4O4HA 4B4DA 1BDIA 4PPFA 1S01A 5ALPA 4ZEOA 2WILA 1F51E 4NS1A 4XYLA 1UMBB 3ZVNA 2JA1A 5HM8A 2AFHA 1UL1X 4M54A 4UJ3A 4C14A 3D8BA 3LBNA 1OOEA 4CF6A 4LXHA 1U3TA 2OCYC 3HI6A 3EMKA 1PWYE 5EMJA 1DI0A 1RWQA 2GBPA 2AWOA 5ALZA 1KO4A 1BWSA 4BVLA 2XT0A 3PC3A 1EX1A 4B4WA 1E0DA 4Z1OA 3OZEA 5INTA 4JDPA 4EDFA 3LT0A 2RHWA 4QHTA 4ER3A 4LEIA 4RHYA 3BTOA 3GQBB 3LCJA 4PCUA 4KPEC 1PKEA 1W34A 2O5EA 1KRXA 3WQQA 2CE2X 1XF9A 3MIZA 2HT1A 1N9ZA 1Q1BA 2C59A 2ILTA 4LJ8A 4UHEA 5AM4A 1G59A 3L7JA 4KMSA 5L3SA 1K5DA 3B85A 3BMCA 2YINC 4EL0A 2IS2A 3E1GA 1TVMA 3NTVA 2R65A 3DT9A 1EAMA 3VA7A 4HQLA 1T35A 4AQ7A 2YHSA 1QP0A 3NGLA 1SBCA 3DTNA 3TUIC 3WYDA 1UDAA 3HRKA 2G9UA 3NBKA 1XCGB 3VNSA 2BEUB 4FWIB 3I8SA 3PFFA 4GGMX 4DHEA 4EF5A 5IMSA 1QORA 3AETA 2GJ8A 2ZI9A 3U4HA 3QUBA 1DDIA 1UP6A 1YZTA 2W37A 1ZVVA 2PUAA 2NAFA 3FOCA 3UMRA 3NOXA 4P5DA 4GKAA 3ESAA 3TG2A 4HLCA 5LUAA 3QF7A 1X80A 3HJAA 1V9LA 3OT1A 4U02A 1VG8A 2IS4A 1SCBA 2V0CA 3O90A 4M1YA 1ZZGA 4M8KA 4MQEB 2IH2A 4Y98A 4WD3A 5CT6A 3O75A 1XKTA 1C8BA 2P65A 3HXQA 1WHSB 1ODKA 1J2YA 2CNWD 1U6JA 3FLBA 3TKYA 4WESB 1ONPA 3REQA 3SVZA 2Z5VA 1IUKA 1UC5B 4GM1A 3RK4A 4J9VA 2FDXA 3ZDFA 4LYYA 4P81A 1U1EA 3R76A 1XMPA 1A76A 1G3UA 4C0AC 2YY5A 3JQPA 4BPRA 1OHHA 5LXTA 4J90A 3BX1A 1XNRB 4KO4S 2AHOA 5IKEA 3EF3A 2BMFA 4A0RA 1LBEA 1WWKA 3B1VA 3RI3A 3QHQA 1WDTA 3C5VA 1VYUA 2HWXA 3A1EA 4GL4A 4BLQA 1HH4A 4AX8A 3VR5D 3ADOA 4E5UA 1Y7PA 2CZGA 1J39A 5BOSB 3K6SB 1GL7A 1AKEA 3U40A 4MWTA 1O54A 2AH5A 1F2TA 2WKWA 5KC9A 1FS5A 2B25A 4N5LA 3ROKA 3TAUA 4QNNA 3V6LA 3JQFC 2HH9A 4D3XA 3GELA 2AA3A 4OXYA 3F6YA 5CB4A 4P38A 3LYLA 4PLFA 2CXUA 3UK2A 2DBQA 2HBYA 3C87A 3VZDA 3GUUA 2FPSA 4J2TA 3TVTA 1W87A 2I22A 3V55A 3OE4A 2JEZA 3HO8A 2H4XA 3X43A 4B7AA 1C0EA 1VIMA 3H05A 4ZAYA 3MWLA 1ZJ5A 4GF5A 1TL7C 3A31A 1UOPA 4PICA 4QHSA 4CQLB 4X63A 1OXKB 1PSZA 3BMCB 1N7HA 2XRYA 1GKLA 4KXLA 1XMJA 2OB2A 4EVRA 1T8SA 3EGXA 2G0NA 3VAYA 1W2WB 2UZ0A 4URVR 1N3YA 1JHRA 4MA5A