3SUFA

Crystal structure of ns3/4a protease variant d168a in complex with mk-5172
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
190
structure length
190
Chain Sequence
b'GSVVIVGRINLSGDTAYAQQTRGEEGCQETSQTGRDKNQVEGEVQIVSTATQTFLATSINGVLWTVYHGAGTRTIASPKGPVTQMYTNVDKDLVGWQAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVAFIPVESLETTM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NS3 protease, NS4A protein
publication title The Molecular Basis of Drug Resistance against Hepatitis C Virus NS3/4A Protease Inhibitors.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/inhibitor
total genus 36
structure length 190
sequence length 190
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sufA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3sufA01
2FOCA 3MO9A 4HZHA 3HATH 4X1NU 5LGOA 4A1XA 3SUEA 1HCGA 1CT0E 1GDNA 5F8XA 4QT8C 4MPWA 3ZVBA 1AZZA 1DSTA 1EJAA 2EI8A 1O2QA 1A0JA 2J92A 2KAIB 3GDVA 1DLKB 3RXFA 1F5KU 5CE1A 2DUCA 1QJ1B 1AE8H 1TGTA 2J4IA 3KGPA 2IJD1 2W7SA 4WH6A 1G3BA 4XOJA 1BZXE 1RD3B 1ZOMA 2BOKA 5DKMA 1J9CH 1AMHA 1DS2E 5FX5A 1YPGH 2ZA5A 3LDXH 4JYUH 4LZ1H 1ZRBA 1L1JA 2FEQH 4AX9H 4X2VA 2GTBA 5IDKA 2AMPA 2PLXA 1AVWA 3UREA 1UTOA 5C1YA 4OM9A 4OS7A 1HAHH 4K2YA 1GCTC 5DP5A 4FVDA 1TPPA 1B0EA 1YM0A 2QN5T 1W7GH 1C1TA 1FLEE 1A0LA 1TRMA 2F83A 1GBLA 4B74A 1QB1A 4O3UA 1LHDH 5GCHF 3MNSA 2BD7A 2AYWA 4FUEA 1O5BB 2NU4E 1Y59T 3T26A 3R0FA 6CHAC 1BBRH 1FN8A 3UWIA 4UDWH 1SLVB 1MKWK 2R2WU 1O2LA 1C5UA 1UVUH 5HM9A 7ESTE 2GZ7A 4CREA 5JYIA 3KNXA 1T8NA 1W13U 4ZXXH 1NRPH 1QA0A 4UE7H 2O8UA 2ZHFH 3UNRA 3BTHE 3STIA 1KYNA 1L4ZA 1C4Y2 5TCAA 4XFQA 2AIQA 1NM6A 2VIVA 3URCA 1GHVH 1EZSC 1UCYH 2ZGBH 4K8YA 5A8YA 1DWEH 1QB9A 5SGAE 1S6HA 2BYAX 4KTSA 4U2WA 1FI8A 5I25A 5A0BA 1MBQA 2H9HA 1PYTC 2PGBB 5J4QA 5EQQA 1RJXB 3UWJH 3TGIE 1A1RA 2Y81A 3LIWA 1ZZZA 4BANB 3PV4A 3VFEA 3TGJE 3BF6H 1EPTC 1W10U 1DUEA 2HVXA 3PWBA 2BD2A 1J15A 2ZFRH 2ZI2H 4NG9H 1V2MT 1EQ9A 1C1RA 1GI4A 3U69H 4HI3A 1SGYE 1S0QA 2HNTE 2GMTB 1C2GA 4Y7AA 1EB1H 2VIDA 1EAXA 4K8BA 1TBRH 2ZP0H 1GBJA 1ZJDA 2Q6DA 2PGQB 2CJIA 3RC4A 3U8OH 2BMGB 5K7RA 2G52A 2AMQA 1P0SH 5LH8A 3RXIA 1HAPH 1D3DB 3DT0H 3SZEA 2P3FH 3U9AH 4Q7XA 2G55A 1TWXB 1LKBA 1LDTT 2TGTA 2BD9A 1TNJA 1O2TA 1W0YH 1XVOA 2GVFA 3NKKA 1BRUP 2HNTF 1A3EH 2EI6A 5DJ7A 2NU0E 1QL9A 1Z71A 1KTTB 1LCYA 1GBAA 2WV5A 4DG4A 2UWLA 3F9GA 2A5KA 3NPSA 3Q76A 4ABGA 2H1UA 1BRCE 1GJ8B 3ATKA 1V2VT 2BQWB 1QIXB 3TU7H 3F9EA 1SR5C 3AK5A 4ZKNU 1V2LT 1C1VH 1RIWC 2ODYB 1UK3A 1HGTH 2QV1A 4WH8A 2PHBA 1SGRE 4HFPB 1WTHD 2ZGHA 2PTNA 4AYYB 1W2KH 1CT2E 3BTQE 4FU7A 5EXNA 1H9LB 1AO5A 1BRAA 4AB9A 3LGUA 3U1IB 1KY9A 1P03A 2D8WA 1C2DA 1O5GH 3T5FH 2XWAA 2OBOA 3KQDA 1FY5A 3OTJE 1MU6B 3E0NB 1AWFH 5DP3A 3UNQA 5AVDA 2XCNA 3FZDA 4ZUHA 2VNTA 4U01A 4E06H 1Z6EA 1CQQA 1FONA 5E0GA 1NPMA 1KSNA 1ANBA 2VWLA 1C2FA 4RKOB 3S7HB 2NU3E 1KXFA 1S83A 1BMAA 2RA3A 2QCYA 1GDUA 1V2JT 2C90B 1TGCA 1O2VA 3SNBA 4K1EA 1MZAA 3VB3A 2GDDA 5CMXH 1DUAA 1C9PA 4ABJA 2VH6A 5GWZA 2CF9H 3GCTF 4CRAA 5FCKA 1OXGA 1ZPBA 3AW0A 3RXGA 1TX8A 4FU9A 1SGEE 1QQ4A 1O2PA 1FPCH 4ABAA 1C2LA 3PV5A 1ZHMA 1UJ1A 3UOPA 5C1XA 2RCEA 1XUFA 3BTFE 1MUEB 1P9SA 1S84A 3PMAB 1A5GH 1ZJKA 2GCHF 2I6SA 1DITH 2NU1E 2EC9H 1UMAH 3D49H 2ZHEH 2F91A 2SGEE 1AB9C 1VITF 3GISB 3ZZAA 3AAUA 2FPZA 3GOVB 3PMJA 4UEHH 2ZDNA 4YT6H 1C1SA 3I77A 3D65E 2BDGA 1N6YA 1XUGA 3AASA 5ESBA 3PO1C 3SU1A 2JH0D 1GCTB 2F9UA 1RTLA 3SGAE 3SN8A 1LHFH 3EGKH 1DICA 1HV7A 2DE8A 2GV7A 1OWDA 5C3NA 3ZYEA 2SGFE 3UTUH 1C5WB 1QURH 1PFXC 2YOLA 2OC0A 4CRDA 5FX6A 3P70B 4B6EA 3SJIA 1INCA 4DOQA 4FUIA 1C1PA 1ZMJA 4MNVA 4B2AA 1K28D 1VCPA 2ZFTA 3MTYA 3L6PA 2XW9A 3IITA 4XSKU 1TLDA 3A84A 1LPZB 3GY4A 4X6MA 1YYY1 2PWXA 8ESTE 4IC6A 3SJKA 4CHAC 5EW2H 5EODA 2ZPSA 1HJ9A 1DT2A 3TJNA 1ZMLA 3JZ2B 4AFSA 1MAYA 3A8AA 5L30H 5C20A 2TIOA 2HPQH 2ZDKA 5LPEA 2PR3A 3SHAH 4ABHA 5A0AE 3UNSA 4AGJA 1IQGA 1SQTA 1AWHB 1FN6A 1THPB 3O8RA 1O5CB 2P8OC 3DFLA 4U32A 4ZKSU 2ZO3H 2FOHA 1KTSB 1LO6A 1P2QA 4AFQA 4BXWA 3H09A 4X2XA 1CGHA 2ZDVH 1V6DA 3LT3A 1TE0A 3ZVGA 1RS0A 2Z94A 1ELVA 3RXUA 4CBNA 1T8MA 1EXFA 1P8VC 2ANYA 2WV4A 4ISNA 4IN2A 3F68H 2GV6A 1ESAA 2A32A 4JZEH 4OS6A 1O5EH 1O2SA 3P8GA 3M7UA 1O5DH 2FOGA 2FODA 2G00A 2QF3A 3V0XA 3HKIB 3CENA 2BVXH 3DFJA 4Q7ZA 1BA8B 4AZ2B 1YCPK 4D9RA 5GXPA 2WPJS 1SLWB 4B73A 1GCDA 4GUXA 1AD8H 1AFQB 2F4LA 4IS5A 3PV2A 2ULLA 2O8TA 1BTUA 5DP6A 2C8ZB 1V2PT 4TWWA 4E7RG 1P11E 2CHAB 2GDEH 5GJ4B 4GHQA 1SVPA 3ZZDA 1DE7H 1QL8A 2FTLE 1J16A 2XRCA 1BMMH 1EX3A 2W3IA 2EEKA 1BRBE 3M35A 1P12E 1CGIE 3KF2A 3RXDA 1WOFA 1GMCF 1RIWB 1P3EA 3RU4D 1S6FA 2TBSA 4NIWA 5C5NA 1KXBA 5E2PA 1MBMA 2V6NA 4THNH 3KHVA 3A7WA 2BY8X 1AFEH 2PW8H 3MU0A 4KKDA 1C2HA 1GHAG 3TVJB 3UUZA 1O3KA 4I33A 4TYDA 2ODQA 1GMDG 2ZZUH 1Y5AT 2FS8A 3Q3KA 1K1IA 1HFDA 2A45B 3TK5A 3G01A 5T6DA 1O3DA 1FV9A 3M36A 2QC2A 1ELGA 1O3OA 4NZLA 1A7SA 5FBIA 3LU9B 2BB4A 5F03A 1W8BH 1P02A 4HTCH 1P2NA 3TITA 4R8TB 4XBCA 1MQ5A 2OC8A 1CHGA 3SJ8A 3F1SB 4B6FA 4FUDA 2HRVA 2SNVA 1GBEA 1DDJA 5CHAC 1EASA 1OP2A 1O33A 1GMHF 1JOUB 1BTPA 4INKA 3GCNA 1O5FH 2Q1JA 1ANCA 3B8JA 2I6QA 1VJ9U 4NIVA 4TPYA 6ESTA 1NESE 5A0CA 4I8LA 3S9BA 4UONA 1UVPA 3A83A 1GI2A 1YKTA 4B2CA 1H4WA 1BUIA 1ABJH 2D1JA 4ASHA 3V7TA 1TGSZ 2LPRA 1N6XA 2ZDAH 1F5RA 1O37A 2VIQA 4DURA 4BXSA 1CO7E 1HAVB 1X7AC 3ZV9A 5ETXA 2TGPZ 1TPAE 3ODFA 3A7TA 1OX1A 1ETSH 4MLFB 4SGBE 2WUCA 1AB9B 2PKSC 1TNIA 1C5XB 3A82A 4ZKRU 3GCHB 5EPYA 3RC5A 1T32A 5AF9H 3UQOA 4WY3A 2ZIQH 1GJ6A 3MU8A 3H5CB 3M5LA 3PLKA 1F0UA 1TNLA 2VGCC 3PO1B 2ZQ1A 4MNYA 1T7CA 1GBKA 1AN1E 2FLBH 5F8ZA 5EPNA 1HRTH 1PPFE 1H8DH 3RMNH 1NFXA 2ZHDA 3S69A 2UUKB 2OQ5A 1YCPM 1GBHA 3VGCB 2AFQB 1V2KT 5GNDA 1C5QA 1HAGE 3SZNA 3E8LA 4DVAU 1GHBG 3SI4H 1BTXA 1RFNA 2BVSH 3SORA 3P95A 1CU1A 4D9QA 1BBRE 1KXCA 1S85A 1MTVA 2EI7A 1AU8A 5FAHA 2PUQH 3OY5U 2VWMA 3PTBA 1LHCH 2BD4A 2BDYA 2BDHA 3I78A 1CT4E 4FUFA 3M7QA 2BY7X 3W95A 4CHAB 2OQUA 1FQ3A 2SNWA 1EAWA 3BIVH 4OS4A 2ILNA 1NC6A 1MCTA 3AAVA 1UCYE 1O2XA 5EQRA 1T8LA 1Y3YA 3TGKE 1LPGB 3RM0H 1JIMA 1BT7A 4M9FA 3PTNA 3E90B 1DWBH 8GCHG 1JMOH 4GHTA 1O3GA 1ZTKA 3VB7A 1VCQA 4WMFA 3MNBA 1XUKA 4RSPA 2A4QA 3N7OA 4K1TA 4YT7H 2G4UA 4ABIA 1G2MA 3EA7A 3SHCH 1GWAA 1DPOA 3K65B 3FP8E 1ANEA 1T4VH 2PTCE 4WXIA 1Q3XA 1LTOA 1TB6H 1A5HA 1ESBA 2Y82A 2WYJA 1ZHRA 1XXDA 9ESTA 2C8XB 1GI5A 2OC7A 2VJ1A 3STJA 1ZR0A 3Q77A 1C5SA 2Z3EA 4ZHMU 3RM2H 1OS8A 1SC8U 1VCWA 2G5VA 1P2IA 1A0HB 3BG4C 2JKHA 3TH3H 3M37A 1LHGH 1P10A 1Z1JA 3ZZ6A 1TX7A 1HBTH 1MCVA 4XDEA 4M7GA 3TH4H 4DJZB 4MNXA 4BAOB 5FBEA 1F0TA 2RA0A 4NIYA 3GY6A 2V3HH 3ATMA 3RXCA 1O2OA 5ABWA 4DGJA 1DOJA 4J1YA 1SGNE 1TQ7B 1UCYK 3QZRA 2EA3A 4VGCC 1Y5UT 3A8CA 3BEFB 1GHYH 4X8SH 1SPJA 5HM2A 2STBE 1MAXA 3DUXH 1MU8B 1O2ZA 5JB8S 3VB5A 1UTPA 4MVNA 1ELTA 1E37B 2Z3CA 2CXVA 2J95A 4OS5A 1PPBH 1TNGA 4MTBA 5E0HA 1O3HA 1AQ7A 1QY6A 1YBWA 5L2ZH 5JPMH 2PKAB 1W14U 2ZFQH 1G32B 3JZ1B 7GCHF 3FZZA 1FUJA 1JBUH 3BN9A 2XYAA 1QGFA 1QB6A 1FJSA 3SU6A 2UUFB 1ZSLA 4INLA 4GLYA 2RG3A 1FY4A 2G4TA 1XM1A 4ZKOU 5BRRE 1WU1A 1BHXF 4A5TS 1NT1A 4WMDA 3VB4A 3MFJA 1MKWH 2ZC9H 3FVFB 4IC5A 2ALPA 4WWYA 1SGTA 1L2EA 2R0LA 4K1SA 1EZUC 2A4GA 1IQJA 1P01A 2VU8E 1QJ7B 7LPRA 1F5LA 1BTHH 3RXMA 1ARBA 5K0HA 2FI5E 1B0FA 5DGJA 4X2YA 2YNAA 1PQAA 1GJ5H 3L33A 2OCVB 4FXGH 2ZGCA 2FOBA 5GCHG 1ELFA 5FXLA 3VXEH 2F9VA 1KDQB 1MTNC 1NROH 3ITIA 2ZWLH 3ZV8A 3A8DA 5EG4A 4H6SB 1TBQH 1SLXB 3U8TH 3OX7U 3P17H 1G37A 4DT7B 5LPRA 1K22H 1ZLRA 1ELEE 2BX4A 5E8EH 4CR5A 1FNIA 2Y7ZA 3ZYDA 1YLCA 1IQHA 2BLWA 1BTWA 5C1UA 2BD3A 5DP8A 5T1VA 1KIGH 3KIDU 4AYVB 2GCTB 4K69A 4LOYH 2BQ6B 2Q6GA 2FX6A 2R9PA 2VGCB 2ZKSA 2K1QA 3SNDA 2WPKS 1EZQA 2P94A 4RN6A 1ZGVA 1QBNA 3O8DA 4FVBA 4JZIA 1PYTD 3A8BA 2A7JA 3A88A 2HLCA 1HDTH 1XMNB 1NO9H 3T62A 4IW4E 1P05A 3NWUA 1FDPA 4WXVA 4ZAEA 1DSUA 2BLVA 1O3CA 4JK5A 2AH4X 1GVKB 4YZUA 1L1GA 3R3GB 2TGAA 4KTUA 4MDSA 4Y8YA 2Y80A 4JZFH 4GAWA 1UVSH 4CH2B 2BDBA 2ZPQA 1GBFA 4UFEH 3HGNA 3UR9A 1GI3A 1O2HA 2OLGA 4AORA 4KTCA 1HIAB 1F7ZA 4AG2A 5EGMA 1GG6B 1DFPA 1HJAB 4NZQA 3WY8A 3OY6U 4Y76A 1T4UH 2ANWA 1D9IA 1SSXA 1WCZA 2WINI 1PJPA 5LPFA 1MQ6A 3KCGH 4ZHAA 4ABEA 4IBLH 3RDZA 3KL6A 3MH6A 1V3XA 3S7KB 1OSSA 1G30B 4ABDA 2BXTH 1UK2A 2BD5A 1L0ZA 1MZDA 4JYTA 3U8RH 4YESB 1MKXK 1K1MA 2ZHWH 3BIUH 1SGDE 2R3YA 2BOHB 1CBWC 1G3DA 4K3JA 1K2I1 3TK9A 5A8XA 3ZZ8A 2Z9IA 1WV7H 3LGIA 2Z9LA 1D3PB 1TMBH 2F9BH 2OD3B 2G81E 4X8TH 2FM2A 1W12U 3TJOA 1C5ZB 5DP4A 1ORFA 2BDCA 1AVXA 1W3CA 3ZVAA 2XC5A 1XUJA 2W7UA 2C4FH 3HPTB 1SHHB 4ZH8A 1B5GH 4YM9A 2A2XH 4Y79A 4Y8XA 4XBDA 1UO6A 2NWNA 3TJVA 3LC5A 1C5OH 2SGPE 4H6TA 1ARCA 3CS7A 3LPRA 3H7OA 3A7VA 2AGEX 2B9LA 2LNCA 1HB0B 3BG4B 4GCHF 1HUTH 3UY9A 3SJ9A 3LGTA 1HLTH 4CRGA 2QYIA 1O3FA 5HMAA 2JH6D 1N8OC 4AFZA 4B2BA 3B9FH 5DP7A 4I7YH 1THRH 5HYOA 1O34A 1BMNH 2IOTA 1Z6JH 1PPEE 5J4SA 1C2KA 4Y10E 5L2YH 1ETTH 2QY0B 3MH7A 1GI6A 3CP7A 1H9IE 1FPHH 1NN6A 1SLUB 5TJXA 1AKSA 1EP5A 6CHAB 2OUAA 2Z9KA 2FWWA 4VGCB 1YP9A 3U98H 1EB2A 2BVRH 3SNCA 1XX9A 2BM2A 2ZG0H 1A5IA 3T29A 1C5LH 1UTJA 3LJOA 1E38B 5E2OA 2P3UB 5DO4H 3MNCA 3UOUA 1O30A 1K1JA 4F4OC 1TGNA 1CHOF 1AIXH 1SHYA 2ANKH 2XC0A 3LKWA 4Y71A 1A46H 4WJG2 3RXTA 1O2WA 3GCOA 3RXRA 2G5NA 1O31A 4LXBH 3BTTE 4MNWA 1C5NH 4ISLA 1BIOA 1W11U 3TH2H 5T6FA 3V3MA 3KQCA 1MD8A 5F6MA 1OWKA 2THFB 3NUMA 1VGCC 3EDXB 1FXYA 1WAYB 1QBVH 1NTPA 2GCHG 2BX3A 1GJ7B 3EA9A 4ISIH 1B7XB 2HWLB 3NZIA 3C27B 2QXJA 2ZFFH 2FOAA 2Y5HA 3BTKE 1VITG 3K6YA 1GBDA 1EPTB 2BDAA 5HXFA 2VH0A 3BTEE 3P8NA 3UIRA 3VEQB 4NFFA 3FP7E 1E0FD 5BPEA 1GI8B 4JMYA 1P06A 4YOIA 1MH0A 1GJ9B 3Q3YA 4Q7YA 3SGBE 2AEIH 1YPHC 2ZGXH 3W94A 3BEUA 2Q6FA 4FU8A 3F9FA 1O32A 1ETRH 3CS0A 2FXRA 1MTNB 4FUCA 2VWNA 1TOCB 3ELAH 2GKVE 4MPVA 2WUBA 2BXUH 2H6MA 3SV7A 1H8IH 1EJMA 1S0RA 2VWOA 3GICB 3GY3A 1GBMA 2Y7XA 3ENSB 4DY7B 1C1MA 2FYRA 2GP9B 2ZCLP 1C1UH 3LH3A 2XCFA 3RU4T 2UWOA 2ZTZA 1O2GH 1V2UT 2GT7A 3FAOA 2AS9A 3EA8A 1EKBB 2QIQA 3KQBA 2J34A 1HXFH 3SQHE 3RP2A 3HK3B 4MPUA 3ESTA 3BTWE 3IWMA 1XKBC 4O97A 2DE9A 1FIZA 2PV9B 4MG3A 5B6OA 3MH4A 1EATA 4A1VA 2C3SA 3RXPA 4OGXA 1RGQA 1ELCA 1L4DA 4PROA 2XWBI 5DG6A 3TNTA 4IN1A 1D3TB 1O2NA 4ABBA 2KAIA 1L1NA 1GBTA 5A2MH 2H9TH 5B6LA 4K5ZA 1LVBA 1O2KA 1GI0A 3SW2B 2PUXB 4AB8A 3SUFA 2ZU2A 4FUGA 5GIBA 5AFZH 1V2TT 2A5IA 1WTGH 4YOJA 2OINA 1YCPH 1W7XH 1WQVH 2QXGA 1JIRA 1UTQA 3QK1A 4I8HA 5ESTE 1ZPCA 1GDQA 2PSYA 1J8AA 3GY8A 3SJOA 1ELBA 2WZQA 4NIXA 2FX4A 8LPRA 4X8VH 2ZCKP 1TAWA 3LGWA 1P09A 1F2SE 1FZZA 1O3BA 2BLOA 1WQSA 2ZCHP 1P57B 1O3PB 4X1PU 1D6WA 5JBBS 1KLTA 1V2WT 4BTIB 5GPIB 1WXRA 1YPLH 1OWJA 1TA2A 2BHGA 1IAUA 1UTNA 2O9QA 2Z7FE 1PQ7A 3ZZCA 2OTVA 1P3CA 1P2OA 2Y5FA 2G51A 2W5EA 4B75A 1ESTA 3IG6B 1OOKB 2UUJB 3K6ZA 3GYMA 2ASUB 2WHXA 3BTDE 3OSYA 3ZVDA 4DW2U 1AHTH 1K9OE 4RKJB 2QGRA 9LPRA 3O8BA 1BITA 1NRSH 1THSH 3FFGA 1DANH 1GMCG 2VINA 4A92A 4O3TA 1IQIA 1O3JA 1K21H 5JBCS 3A7YA 1LKAA 5A8ZA 1C2JA 5JBAS 1GJ4H 6GCHG 3V13A 4YLUA 1DXPA 3QO6A 1GHWH 2M5TA 3FANA 1EZXC 1Z8JB 1V2ST 4YLQH 1XKAC 1IOEA 1V2QT 2C93B 2PSXA 3BG8A 3SO3A 1ZMNA 1TGBA 2BZAA 1KXDA 1OKXA 3P6ZB 2CV3A 2H5CA 1UTMA 5GDSH 2XBXA 1LVMA 4A7IB 1ZPZA 1F92A 1ZRKA 4DIIH 1O3LA 2A4OA 3ODDA 3Q00A 3E16B 1NFYA 1SL3A 2BDIA 3QX5H 5H4IB 1K1PA 1J14A 1C9TA 5FHTA 4X8UH 4GPGA 1SOZA 2ZFPH 3EQ0H 2HALA 1HAIH 2GZ8A 1H1BA 1ACBE 2AGIX 1EUFA 1TBZH 2C8YB 1MTUA 2FZZA 4Y8ZA 5IYTA 2R0KA 4K60A 1O5AB 1YPHE 3LGYA 4Y6DA 4IMZA 4BNRA 3SNAA 3A7ZA 3OTPA 1UTKA 2ZTXA 3KN2A 1F0SA 4GSOA 2R3UA 4NGAH 2P93A 4AN7A 2ZNKH 5EW1H 1TALA 4X0WU 1GJBB 1W0ZU 3ZVFA 1YLDA 2TGDA 2ZECA 1UHBB 3MO6A 2FOEA 1HAOH 1SQOA 1Z8IB 2ODPA 3A86A 3E6PH 5F8TA 3UFAA 1BCUH 4Y7BA 2O8WA 3H7TA 2P8OB 3MU4A 1QRXA 2OP9A 1IQKA 1TPSA 1BJVA 1C4V2 3RXBA 3UQVA 1QTFA 4SGAE 4XBBA 5JB9S 1Y3XA 1HAZB 2AGGX 4BAKB 1WSSH 1CGJE 4RI0A 2VVVA 2VBCA 1WUNH 2ZU5A 1E35B 1Y5BT 4IMQA 4O03A 4NA7A 5EU8A 4Q80A 1HJ8A 4D7GA 3LGVA 1AZ8A 5FCRA 3RXSA 1BBRK 4R0IA 2ZU4A 5T6GA 8KME2 1GGDC 2P3TB 4ISHH 7KMEH 1P2JA 4I8JA 1DY9A 2A4RA 2H5DA 3SOSA 2ZU1A 1NFWA 3SUDA 3S0NA 3FP6E 3RC6A 2P59A 1OP8A 1GHXH 1UTLM 1HIAA 2Y6TA 3T28A 3MH5A 1FY1A 1QA7A 1N1LA 2W26A 3QN7A 2FOFA 5G4BA 1KXEA 2OK5A 1EAIA 2J94A 4H42U 4I8GA 4INHA 4X1RU 3RLYH 3NXPA 3GDSA 1FY8E 3A81A 2XBWA 1HXEH 1BTYA 2BY6X 4YTAA 1C5VA 3P8OA 4X6OA 1EP6A 2TRMA 3A85A 3TJUA 1EOJA 4JK6A 3P8FA 1O36A 4U30A 3LONA 1LQEA 1TMUH 1QCPA 3K2UA 5I46H 1QL7A 3PLBA 3RXLA 2W3KA 4DIHH 1FAXA 3AW1A 2ZQ2A 4B76A 3OYPA 1NU7B 1TX6A 3KEEA 1IHTH 2JETC 1MMJN 1P2MA 1PQ5A 2OBQA 3QGJA 1RRKA 3SU5A 1C5TA 2VVUA 4X2WA 1BHXB 1JWTA 1NU9A 1O3AA 3ZZ3A 1G9IE 3GYLB 3GY7A 1PPGE 2CN0H 1C5RA 1T31A 2D2DA 4TY7A 1JRTA 3VPKA 2VVCA 5CHAB 3T2NA 3M3TA 2ZFSA 1VJAU 2A5AA 1LPKB 2ZU3A 3MOCA 3ZZ9A 4ISOA 2B8OH 2SGQE 1YGCH 2FESH 2ZF0H 1GPZA 4BTUB 4Z6AH 1OP0A 1C1WH 3M3SA 2FS9A 3A87A 3ZZ4A 2HPPH 3TPIZ 4CRBA 1TNKA 2AERH 1ANDA 2FI3E 3BTME 2WPHS 1BDAA 3TK6A 1ZSKA 3VXFH 1H9HE 1IQFA 1GL0E 4X6NA 3VB6A 1PQ8A 3F9HA 4MQAA 1CVWH 3QLPH 1JRSA 1TRNA 2FP7B 1AGJA 3QTOH 4UFDH 2AMDA 1TA6A 1NRQH 4D76A 1Z1IA 4ABFA 3PLPA 4A1TA 1VZQH 1O2RA 1XUHA 1O3IA 2PKSB 3MO3A 7GCHG 1QRWA 1ZHPA 3RXJA 1ZSJA 3MI4A 1AFQC 4WMEA 3QWCH 4CBOA 3QGNB 3NCLA 1TYNA 4BOHA 5EOKA 4E05H 2CHAC 1PPZA 2J2UA 1QFKH 2B5TB 2FDAA 3SI3H 1V2RT 4AOQA 2WPMS 2FI4E 4Y11E 2SGDE 3SV8A 3T27A 2WPIS 4YOGA 1EPTA 1SGFG 3RXHA 1SMFE 3F6UH 2FLRH 4FUBA 2FMJA 1NZQH 3E3TA 2J9NA 2QA9E 4Y0ZE 1G2LA 4A6LA 1GBIA 1K1LA 1BOQA 1C1NA 3B23B 1Q31A 3BSQA 1Z8GA 1GI7B 1SI5H 1O3NA 3HGPA 1LVOA 4KELA 1YPEH 1T8OA 1M9UA 1GVZA 1TONA 1AUJA 1E34B 3GDUA 4MPXA 1A61H 5EXLA 1RTFB 3DHKH 1YC0A 2BTCE 3AVZA 4JZDH 3E1XB 3C1KA 2GT8A 3K9XB 4DCDA 4E7NA 1KXAA 4O9VA 1NRRH 3RXKA 2CMYA 2ZPRA 4NSVA 1E36B 4JYVH 2IPHA 3PWCA 1Y3UA 2OC1A 3RXVA 1C5PA 3QTVH 1HPGA 3T25A 1G3EA 2B0FA 2CGAA 3PB1E 1CA0C 1OWHA 2P95A 4I8KA 1ABIH 2J38A 3RXOA 3PYHA 3GY2A 1SOTA 3Q3XA 4TY6A 1GJCB 3A80A 5A09A 2ZEBA 4WF8A 1GI1A 6LPRA 4OGYA 2XBYA 1KLIH 3U1JB 3ATLA 4Z0KA 5FPSA 3SQEE 2HGTH 1AY6H 2STAE 3SNEA 4NFEA 1NS3A 1AI8H 1TFXA 1AUTC 3EAJA 1EAUA 3L3TA 2FO9A 1GJDB 1GGDB 1P04A 1MD7A 1MKXH 1BJUA 1HNEE 3A89A 3RXAA 3SV6A 4JCNA 2Z3DA 1C2IA 1HAYB 1O3EA 1D4PB 3GCHC 3HKJB 1XXFA 4Y0YE 4X1SU 2Y5GA 2Z6BD 4KP0A 3UPEA 1Y3VA 2QXHA 1S82A 2GGVB 1EOLA 4ZHLU 3DA9B 3I29A 4J2YB 1WYKA 2QF0A 3RMOH 1D6RA 2R2MB 1WBGB 3V12A 3EYDA 3O8CA 1GJAB 1SG8B 1G3CA 3TNSA 3NK8A 3VGCC 3RLWH 3ZVCA 4KGAA 3URDA 4FUJA 3GCTG 1DM4B 1GBBA 5FPTA 1IQNA 3ZVEA 2JH5D 1S81A 4NWKA 1J17T 2ZDMA 3MU1A 1DWCH 1NRNH 2C8WB 5L6NH 4LK4A 5JDUB 2VB0A 4ZXYH 2D26C 2A31A 3LOXA 1HAVA 3PROA 3MNXA 2ZTYA 1O2UA 3GY5A 1LMWB 2VIOA 1IQMA 1QR3E 3SYJA 3PM3A 4CR9A 4H4FA 2JETB 3PMHB 1GHZA 3M61U 3SUGA 3MHWU 3M5OA 4OS2A 2ALVA 3TIUA 2H2ZA 1VITH 3BTGE 1MTSA 1SB1H 2FTMA 2O8MA 3MU5A 4GCHG 5EXMA 1BQYA 5C5OA 1GHAF 4AG1A 5FPYA 2BQ7B 1SQAA 1GMDF 1P9UA 5C67A 4TWYA 2A7HA 3M3VA 4UD9H 5HGGA 1F0RA 3RMMH 2F9PA 1S5SA 3M7TA 3PMBB 3QZQA 1HYLA 3SU2A 2QAAA 2PFEA 1OYQA 1LVYA 2B7DH 2XBVA 1DX5M 4I32A 1QHRB 1UVTH 1ID5H 4I31A 1SGQE 3D62A 1CHOG 1O35A 1NY22 5DP9A 1ZTLA 2VIPA 5AFYH 2Z9GA 2V3OH 1CE5A 1HAXB 4X6PA 1C4U2 1Q2WA 2RDLA 3SV9A 1C2EA 1CA8B 3MWIU 2WV9A 3BV9B 3LC3A 4XE4A 2IJOB 3EE0B 2UWPA 1QQUA 2ZHQH 3ATWA 1ELAA 1UHBA 2Z9JA 3UR6A 1PPHE 1GL1A 4GVUA 1GBCA 3LJJA 2BY5X 2AIPA 5PTPA 1C2MA 5EQSA 3ZZBA 4NA8A 3E0PB 2BLQA 3SGQE 3S9AA 1YF4A 1A3BH 1QBOA 2HOBA 1U6QA 2O8LA 1XUIA 5C2ZA 1UVOA 1O2JA 1C1OA 1UK4A 5DPAA 4B1TA 3BEIB 1Y8TA 4NWLA 5T3HA 4BAMB 3SU0A 1FY3A 1TPOA 2BD8A 6GCHF 1VR1H 2ANMH 1QRZA 1LQDB 4NCYA 3RMLH 3RUOA 1GI9B 2F3CE 1IHSH 1DLEA 3QDZB 1DY8A 1Z8RA 4TPIZ 4LZ4B 2V35A 2G8TA 4B71A 2BY9X 2A0QB 3KQEA 1ELDE 4ZMAH 1SGPE 2F9NA 4ESTE 1OPHB 1O2YA 1C5MD 1IQEA 2A2QH 2SGAA 4BTTB 1GHBF 2GX4A 1CBWB 2NU2E 2XC4A 3QUMP 1SBWA 5AHGH 1Y3WA 1CA0B 4Q2KA 4D7FA 1AKSB 1O0DH 2IN2A 2A7CA 1TIOA 2GMTC 1O3MA 3ZZ7A 1C5YB 2QXIA 1O2IA 2CF8H 4CRFA 2WPLS 1A4WH 1G36A 2VIWA 2XXLA 1TQ0B 1TABE 3MMGA 1DXWA 4BAHB 1FMGA 2PKAA 3M5MA 1BTZA 1TNHA 3SV2H 2F9OA 1CSOE 1V2NT 1SFIA 2P16A 2XTTB 4IGDA 1BMLA 2GD4B 3RXQA 2H9EH 1NFUA 2GZ9A 4CH8B 1SGCA 1TOMH 8GCHF 1GVLA 4UFGH 1EJNA 2SFAA 5DK1A 2V0BA 1KLJH 1RXPA 4OS1A 1A2CH 1TMTH 1N8OB 1O2MA 1LHEH 2TPIZ 2HNTC 3DD2H 2ESTE 2YNBA 1YPKH 1JXPA 1QNJA 1FAKH 1K1OA 2GCTC 3A7XA 1FIWA 4AFUA 2FYQA 1BB0B 3OU0A 1RTKA 3D23A 4AGKA 1SGFA 3M5NA 3LH1A 2UUYA 4F49A 3SU4A 1P2KA 5E0JA 1OYTH 1PPCE 1AVGH 3P92A 2XNIA 1C1QA 2ZDLA 3ZZ5A 2FOMB 1GMHG 1IQLA 1ZYOA 1K1NA 1DWDH 4UFFH 3RU4E 1AE5A 1YPJH 3RXEA 1YPMH 5TCCA 4NSYA 2OXSA 1KDQA 4CRCA 1OWIA 4HGCA 3S9CA 4ZROA 1D3QB 1OWEA 4FUHA 1XVMA 3MYWA 2WYGA 1MTWA 3SBKA 1O38A 4NA9H 3HK6B 1ZGIA 4D8NA 1Z7KA 1SGIB 1QJ6B 2BZ6H 1TRYA 2ZGJA 4X1QU 1V2OT 3ATIA 1O39A 5JBTA 4WVPE 1GG6C 1VGCB 3TLOA 4BAQB 3SU3A 1HJAC 2A1DB 1ZTJA 4JZ1A 2FIRH 4YO9A 1DVAH 3E91A 1SFQB
chains in the Genus database with same CATH superfamily
2FOCA 3MO9A 4HZHA 4F48B 3HATH 4X1NU 5LGOA 4A1XA 3SUEA 1HCGA 1CT0E 1GDNA 5F8XA 4QT8C 4MPWA 3ZVBA 1AZZA 1DSTA 1EJAA 2EI8A 1O2QA 1A0JA 2J92A 2KAIB 3GDVA 1DLKB 3RXFA 1F5KU 5CE1A 2DUCA 2F43B 1QJ1B 1AE8H 1TGTA 2J4IA 3KGPA 2IJD1 2W7SA 3MQKC 4WH6A 1G3BA 4XOJA 1BZXE 4P00A 3UAIC 1RD3B 1ZOMA 2BOKA 5DKMA 1J9CH 1AMHA 1DS2E 5FX5A 1YPGH 2ZA5A 3LDXH 4JYUH 4LZ1H 1ZRBA 1L1JA 1OHHD 2FEQH 4AX9H 4X2VA 2GTBA 5IDKA 2AMPA 2PLXA 3F2GA 1AVWA 3UREA 1UTOA 5C1YA 4OM9A 4OS7A 1HAHH 4K2YA 1GCTC 5DP5A 4FVDA 1TPPA 1B0EA 1YM0A 2M2AA 2QN5T 1W7GH 1C1TA 1FLEE 2KZ4A 1A0LA 1TRMA 2F83A 1GBLA 4B74A 1QB1A 4O3UA 1LHDH 5GCHF 3MNSA 2BD7A 2AYWA 4FUEA 1O5BB 2NU4E 1Y59T 3T26A 3R0FA 6CHAC 1BBRH 1FN8A 3UWIA 4UDWH 1SLVB 1MKWK 2R2WU 1O2LA 1C5UA 1UVUH 5HM9A 7ESTE 2GZ7A 4CREA 5JYIA 3KNXA 1T8NA 1W13U 4ZXXH 1NRPH 1QA0A 4UE7H 2O8UA 2ZHFH 3UNRA 3BTHE 3STIA 1KYNA 2YMSD 1L4ZA 1C4Y2 5TCAA 4XFQA 2AIQA 1NM6A 2VIVA 3URCA 1GHVH 1EZSC 1UCYH 2ZGBH 4K8YA 5A8YA 1DWEH 4I86A 1QB9A 5SGAE 1S6HA 2BYAX 4KTSA 4U2WA 1FI8A 5I25A 4FOUC 5A0BA 1MBQA 2H9HA 1PYTC 2PGBB 5J4QA 3F2HA 5EQQA 1RJXB 3UWJH 3TGIE 1A1RA 2Y81A 3LIWA 1ZZZA 4BANB 3PV4A 3VFEA 5C17A 3TGJE 3BF6H 1EPTC 1W10U 1DUEA 2HVXA 3PWBA 2BD2A 1J15A 2ZFRH 2ZI2H 4NG9H 1V2MT 1EQ9A 1C1RA 1GI4A 3U69H 2JDID 4HI3A 1SGYE 1S0QA 2HNTE 2GMTB 1C2GA 4Y7AA 1EB1H 2VIDA 1EAXA 4K8BA 1TBRH 2ZP0H 1GBJA 1ZJDA 2Q6DA 2PGQB 2CJIA 3RC4A 3U8OH 2BMGB 5K7RA 4P02A 2K8IA 2G52A 2AMQA 1P0SH 5LH8A 3RXIA 3SZEA 1D3DB 3DT0H 1HAPH 2P3FH 3U9AH 4Q7XA 2G55A 1TWXB 1LKBA 1LDTT 2QF4A 2TGTA 2BD9A 1TNJA 1O2TA 1W0YH 5C0UA 1XVOA 2GVFA 3NKKA 2HVYB 1BRUP 2HNTF 1A3EH 2EI6A 5DJ7A 2NU0E 1QL9A 1Z71A 1KTTB 1LCYA 1GBAA 2J98A 2WV5A 2UWLA 4DG4A 3F9GA 2A5KA 3NPSA 3Q76A 4ABGA 2H1UA 1BRCE 1GJ8B 3ATKA 1V2VT 2BQWB 1QIXB 3TU7H 3F9EA 1SR5C 3AK5A 4ZKNU 1V2LT 1C1VH 1RIWC 2ODYB 1UK3A 1HGTH 2QV1A 4WH8A 2PHBA 1SGRE 4HFPB 4TT3D 1WTHD 2ZGHA 2PTNA 4AYYB 1W2KH 1CT2E 3BTQE 4FU7A 5EXNA 1H9LB 1AO5A 1BRAA 4AB9A 3LGUA 3U1IB 1KY9A 1P03A 2D8WA 1C2DA 1O5GH 3T5FH 2XWAA 2OBOA 5KEDA 3KQDA 1FY5A 3OTJE 1MU6B 3E0NB 1AWFH 3W1EA 5DP3A 3UNQA 5AVDA 1SKYE 2XCNA 3FZDA 4ZUHA 2VNTA 4U01A 4E06H 1Z6EA 1CQQA 1FONA 5E0GA 1NPMA 1KSNA 1ANBA 2VWLA 1C2FA 4RKOB 3S7HB 2NU3E 1KXFA 1S83A 1BMAA 2RA3A 2QCYA 1GDUA 1V2JT 2C90B 1TGCA 1O2VA 3SNBA 4K1EA 1MZAA 3VB3A 2GDDA 2YMSB 5CMXH 1DUAA 1C9PA 4ABJA 2VH6A 5GWZA 2CF9H 3GCTF 4CRAA 5FCKA 1OXGA 4Q63A 1ZPBA 3AW0A 3RXGA 1TX8A 4FU9A 1SGEE 1QQ4A 1O2PA 1FPCH 4ABAA 1C2LA 3PV5A 1ZHMA 1UJ1A 3UOPA 5C1XA 2RCEA 1XUFA 3BTFE 1MUEB 1P9SA 1S84A 3PMAB 1A5GH 1ZJKA 2GCHF 2I6SA 1DITH 2NU1E 2EC9H 1UMAH 3D49H 2ZHEH 2F91A 2SGEE 1AB9C 5HKKD 3UB0A 1VITF 1YLNA 3GISB 1WDIA 3ZZAA 3AAUA 2FPZA 3GOVB 3PMJA 4UEHH 2ZDNA 4YT6H 1C1SA 3I77A 3D65E 2BDGA 1N6YA 1XUGA 3AASA 5ESBA 3PO1C 3SU1A 2JH0D 1GCTB 2F9UA 1RTLA 3SGAE 3SN8A 1LHFH 3EGKH 1DICA 1HV7A 2DE8A 2GV7A 1OWDA 5C3NA 3ZYEA 2SGFE 3UTUH 1C5WB 1QURH 1PFXC 2YOLA 2OC0A 4CRDA 5FX6A 2WSSD 3P70B 1W0KD 4B6EA 3SJIA 1INCA 4DOQA 4FUIA 1C1PA 1ZMJA 4MNVA 4B2AA 1K28D 1VCPA 2ZFTA 3MTYA 3L6PA 5DN6D 2XW9A 3IITA 4XSKU 1TLDA 3A84A 1LPZB 3GY4A 4X6MA 1YYY1 2PWXA 8ESTE 4IC6A 3SJKA 4CHAC 5EW2H 5EODA 2ZPSA 1HJ9A 1DT2A 3TJNA 1ZMLA 3JZ2B 4AFSA 1MAYA 3A8AA 5L30H 5C20A 2TIOA 2HPQH 2ZDKA 5LPEA 2PR3A 3SHAH 4ABHA 5A0AE 3UNSA 4AGJA 1IQGA 1SQTA 1AWHB 1FN6A 1THPB 3O8RA 1O5CB 1UW7A 2P8OC 3DFLA 4U32A 4ZKSU 2ZO3H 2FOHA 1KTSB 1LO6A 1P2QA 3H09A 5CHBA 4AFQA 4BXWA 4X2XA 1CGHA 2ZDVH 1V6DA 3LT3A 1TE0A 3ZVGA 1RS0A 2Z94A 1ELVA 3RXUA 4CBNA 1T8MA 1EXFA 1P8VC 2ANYA 2WV4A 4ISNA 4IN2A 3F68H 2GV6A 1ESAA 2A32A 4JZEH 4OS6A 1O5EH 1O2SA 3P8GA 3M7UA 1O5DH 2FOGA 2FODA 2G00A 2QF3A 3V0XA 3HKIB 3CENA 2BVXH 3DFJA 4Q7ZA 1BA8B 4AZ2B 1YCPK 4D9RA 5CDFE 5GXPA 2WPJS 5EJ1A 1SLWB 4B73A 1GCDA 4GUXA 1AD8H 1AFQB 2F4LA 4IS5A 3PV2A 2ULLA 2O8TA 1BTUA 5DP6A 2C8ZB 1V2PT 4TWWA 4E7RG 1P11E 2CHAB 2GDEH 5GJ4B 4GHQA 1SVPA 3ZZDA 1DE7H 1QL8A 2FTLE 1J16A 2XRCA 1BMMH 1EX3A 2W3IA 2EEKA 1BRBE 3M35A 1P12E 1CGIE 3KF2A 3RXDA 2XNDD 1WOFA 1GMCF 1RIWB 1P3EA 3RU4D 1S6FA 2TBSA 4NIWA 5C5NA 1KXBA 5E2PA 1MBMA 2V6NA 4THNH 3KHVA 3A7WA 2BY8X 1AFEH 2PW8H 2XOKD 3MU0A 1C2HA 1GHAG 4KKDA 3TVJB 3UUZA 1O3KA 4I33A 4TYDA 2ODQA 2JJ1D 1GMDG 2ZZUH 1Y5AT 2FS8A 3Q3KA 1K1IA 3OEHD 1HFDA 2A45B 3TK5A 3G01A 5T6DA 1O3DA 1FV9A 3M36A 2QC2A 1ELGA 1O3OA 2KCOA 4NZLA 1A7SA 5FBIA 2K0QA 2BB4A 3LU9B 5F03A 1W8BH 1P02A 4HTCH 1P2NA 3TITA 4R8TB 4XBCA 1MQ5A 2OC8A 1CHGA 3SJ8A 3F1SB 4B6FA 4FUDA 2HRVA 2SNVA 1GBEA 1DDJA 5CHAC 1EASA 1OP2A 1O33A 1GMHF 1JOUB 1VKYA 1BTPA 4INKA 3GCNA 1O5FH 2Q1JA 1ANCA 3B8JA 2I6QA 1VJ9U 4NIVA 4TPYA 6ESTA 1NESE 5A0CA 4I8LA 3S9BA 4UONA 1UVPA 3A83A 1GI2A 1YKTA 4B2CA 1H4WA 1BUIA 1ABJH 2D1JA 4ASHA 3V7TA 1TGSZ 2LPRA 1N6XA 2ZDAH 1F5RA 1O37A 2VIQA 4DURA 4BXSA 1CO7E 1HAVB 1X7AC 3ZV9A 5ETXA 2TGPZ 1TPAE 3ODFA 3A7TA 1OX1A 1ETSH 4DT4A 4MLFB 4SGBE 2WUCA 1AB9B 2PKSC 1TNIA 1C5XB 2W6ID 3A82A 4ZKRU 3GCHB 5EPYA 3RC5A 1T32A 4Z1MD 5AF9H 3UQOA 4WY3A 2ZIQH 1GJ6A 3MU8A 3H5CB 3M5LA 3PLKA 1F0UA 1TNLA 2VGCC 3NRLA 3PO1B 2ZQ1A 4MNYA 1T7CA 1GBKA 1AN1E 2FLBH 5F8ZA 5EPNA 1HRTH 1PPFE 1H8DH 3RMNH 3WW7A 1NFXA 2ZHDA 3S69A 2UUKB 2OQ5A 1YCPM 1GBHA 3VGCB 2AFQB 1V2KT 5GNDA 1C5QA 1HAGE 3SZNA 3E8LA 4DVAU 1GHBG 3SI4H 1BTXA 1RFNA 2BVSH 3SORA 3P95A 1CU1A 4D9QA 1BBRE 1KXCA 1S85A 1MTVA 1W0JD 1AU8A 2EI7A 5FAHA 2PUQH 3OY5U 3F3BA 2VWMA 3PTBA 1LHCH 2BD4A 2BDYA 2BDHA 3I78A 1CT4E 4FUFA 3M7QA 2BY7X 3W95A 5HIZA 4CHAB 2OQUA 1FQ3A 2SNWA 1EAWA 3BIVH 4OS4A 2ILNA 1NC6A 1MCTA 3AAVA 1UCYE 1O2XA 5EQRA 1T8LA 1Y3YA 1MABB 3TGKE 1LPGB 3RM0H 1JIMA 1BT7A 4M9FA 3PTNA 3E90B 1DWBH 4AC9A 8GCHG 1JMOH 4GHTA 1O3GA 1ZTKA 3VB7A 1VCQA 4WMFA 3MNBA 1XUKA 4RSPA 2A4QA 3N7OA 4K1TA 4YT7H 2G4UA 4ABIA 1G2MA 3EA7A 3SHCH 1GWAA 1DPOA 3K65B 3FP8E 1ANEA 1T4VH 2PTCE 4WXIA 1Q3XA 1LTOA 1TB6H 1A5HA 1ESBA 2Y82A 1H8ED 2WYJA 1ZHRA 1XXDA 9ESTA 2C8XB 1GI5A 2OC7A 2VJ1A 3STJA 1ZR0A 3Q77A 1C5SA 2Z3EA 4ZHMU 3RM2H 1OS8A 1SC8U 1VCWA 2G5VA 1P2IA 2KCPA 1A0HB 3BG4C 2JKHA 3TH3H 3M37A 1LHGH 1P10A 1Z1JA 3ZZ6A 1TX7A 1YWUA 1HBTH 1MCVA 4XDEA 4M7GA 3TH4H 4DJZB 4MNXA 4BAOB 5FBEA 1F0TA 2W6JD 2RA0A 4NIYA 3GY6A 2V3HH 3ATMA 3RXCA 1O2OA 5ABWA 4DGJA 1DOJA 4J1YA 1SGNE 1TQ7B 1UCYK 3QZRA 2EA3A 4VGCC 3N7EA 1Y5UT 3A8CA 3BEFB 1GHYH 4X8SH 1SPJA 5HM2A 2STBE 1MAXA 3DUXH 1MU8B 1O2ZA 5JB8S 3VB5A 1UTPA 4MVNA 1ELTA 1E37B 2Z3CA 2CXVA 2J95A 4OS5A 1PPBH 1TNGA 4MTBA 5E0HA 1O3HA 1AQ7A 1QY6A 1YBWA 5L2ZH 5JPMH 2PKAB 1W14U 2ZFQH 1G32B 3JZ1B 7GCHF 3FZZA 1FUJA 1JBUH 3BN9A 2LELA 2XYAA 1QGFA 1QB6A 1FJSA 3SU6A 2UUFB 1ZSLA 4INLA 4GLYA 2RG3A 1FY4A 2G4TA 1XM1A 3DSGA 4ZKOU 5BRRE 1WU1A 1BHXF 1EFRD 4A5TS 1NT1A 4WMDA 3VB4A 3MFJA 1MKWH 2J5UA 2ZC9H 3FVFB 4IC5A 2ALPA 4WWYA 1SGTA 1L2EA 2R0LA 4K1SA 1EZUC 2A4GA 1IQJA 1P01A 2VU8E 1QJ7B 7LPRA 1F5LA 1BTHH 3RXMA 1ARBA 3GS9A 5K0HA 2FI5E 1B0FA 5DGJA 4X2YA 2YNAA 1PQAA 1GJ5H 3L33A 2OCVB 4FXGH 1NBME 2ZGCA 2FOBA 5GCHG 1ELFA 5FXLA 3VXEH 2F9VA 1KDQB 1MTNC 1NROH 3ITIA 2ZWLH 3ZV8A 3A8DA 5EG4A 4H6SB 1TBQH 1SLXB 3U8TH 3OX7U 3P17H 1G37A 4DT7B 5LPRA 1K22H 1ZLRA 1ELEE 2CK3D 2BX4A 5E8EH 4CR5A 1FNIA 2Y7ZA 3ZYDA 1YLCA 1IQHA 2BLWA 1BTWA 5C1UA 3F2FA 2LP6A 2BD3A 1COWD 5DP8A 5T1VA 1KIGH 3KIDU 4AYVB 2GCTB 4K69A 4LOYH 2GJGA 2BQ6B 2Q6GA 2FX6A 2R9PA 2VGCB 2ZKSA 2K1QA 3SNDA 2WPKS 1EZQA 2P94A 4RN6A 1ZGVA 1QBNA 3O8DA 4FVBA 4JZIA 1PYTD 3A8BA 2A7JA 3A88A 2HLCA 1HDTH 1XMNB 1NO9H 3T62A 4IW4E 1P05A 3NWUA 1FDPA 4WXVA 4ZAEA 1DSUA 2BLVA 1O3CA 4JK5A 2AH4X 1GVKB 4YZUA 1L1GA 3R3GB 2TGAA 4KTUA 4MDSA 4Y8YA 2Y80A 4JZFH 4GAWA 1UVSH 4CH2B 2BDBA 2ZPQA 1GBFA 4UFEH 3HGNA 3UR9A 1GI3A 1O2HA 2OLGA 4AORA 4KTCA 1HIAB 1F7ZA 4AG2A 5EGMA 1GG6B 1DFPA 1HJAB 4NZQA 3WY8A 3OY6U 4Y76A 1T4UH 2ANWA 1D9IA 1SSXA 1WCZA 2WINI 1PJPA 5LPFA 1MQ6A 3KCGH 4ZHAA 4ABEA 4IBLH 3RDZA 3KL6A 3MH6A 1V3XA 3S7KB 2RFKC 1OSSA 2RDEA 1G30B 4ABDA 2BXTH 1UK2A 2BD5A 1L0ZA 1MZDA 4JYTA 3U8RH 4YESB 1MKXK 1K1MA 2ZHWH 3BIUH 1SGDE 2R3YA 2BOHB 1CBWC 1G3DA 4K3JA 1K2I1 3TK9A 5A8XA 3ZZ8A 2Z9IA 1WV7H 3LGIA 2Z9LA 1D3PB 1TMBH 2F9BH 2OD3B 2G81E 4X8TH 2FM2A 1W12U 3TJOA 1C5ZB 5DP4A 1ORFA 2BDCA 1AVXA 1W3CA 3ZVAA 2XC5A 1XUJA 2W7UA 2C4FH 3HPTB 1SHHB 4ZH8A 1B5GH 4YM9A 3PRDA 2A2XH 4Y79A 4Y8XA 4XBDA 1UO6A 2NWNA 3TJVA 3LC5A 1C5OH 2SGPE 4H6TA 1ARCA 3CS7A 3LPRA 3H7OA 3A7VA 2AGEX 2B9LA 2LNCA 1HB0B 3BG4B 4GCHF 1HUTH 3UY9A 3SJ9A 3LGTA 1HLTH 4CRGA 2QYIA 1O3FA 5HMAA 2JH6D 1N8OC 4AFZA 4B2BA 3B9FH 5DP7A 4I7YH 1THRH 5HYOA 1O34A 1BMNH 2IOTA 1Z6JH 1PPEE 5J4SA 1C2KA 4Y10E 5L2YH 1ETTH 2QY0B 3MH7A 1GI6A 3CP7A 1H9IE 1FPHH 1NN6A 1SLUB 5TJXA 1AKSA 1EP5A 6CHAB 2OUAA 2Z9KA 2FWWA 4VGCB 1YP9A 4YXWD 3U98H 5KECA 1EB2A 2BVRH 3SNCA 1XX9A 2BM2A 2ZG0H 1A5IA 3T29A 1C5LH 1UTJA 2HLDD 3LJOA 1E38B 5E2OA 2P3UB 5DO4H 3MNCA 2AHME 3UOUA 1O30A 1K1JA 4F4OC 1FX0B 1TGNA 1CHOF 1AIXH 1SHYA 2ANKH 2XC0A 3LKWA 4Y71A 1A46H 4WJG2 3RXTA 1O2WA 3GCOA 3RXRA 2G5NA 1O31A 4LXBH 3BTTE 4MNWA 1C5NH 4ISLA 1BIOA 1W11U 3TH2H 5T6FA 3V3MA 3KQCA 1MD8A 5F6MA 1OWKA 2THFB 3NUMA 1VGCC 3EDXB 1FXYA 1WAYB 1QBVH 1NTPA 2GCHG 2BX3A 1GJ7B 3EA9A 4ISIH 1B7XB 2HWLB 4XD7D 3NZIA 3C27B 2QXJA 2ZFFH 2FOAA 2Y5HA 2IPQX 3BTKE 1VITG 3K6YA 1GBDA 1EPTB 2BDAA 5HXFA 2VH0A 3BTEE 3P8NA 3UIRA 3VEQB 4NFFA 3FP7E 1E0FD 5BPEA 1GI8B 4JMYA 1P06A 4YOIA 3WWBA 1MH0A 1GJ9B 3F0OA 3Q3YA 4Q7YA 3SGBE 2AEIH 1YPHC 2ZGXH 3W94A 3BEUA 2Q6FA 4FU8A 3F9FA 1O32A 1ETRH 3CS0A 2KFWA 2FXRA 1MTNB 4FUCA 2VWNA 1TOCB 3ELAH 2GKVE 4MPVA 2WUBA 2BXUH 2H6MA 3SV7A 1H8IH 1EJMA 1S0RA 2VWOA 3GICB 3GY3A 4ZCNA 1GBMA 2Y7XA 3ENSB 4DY7B 1C1MA 2FYRA 2GP9B 2ZCLP 1C1UH 3LH3A 2XCFA 3RU4T 2UWOA 2ZTZA 1O2GH 1V2UT 2GT7A 3FAOA 2AS9A 3EA8A 1EKBB 2QIQA 3KQBA 2J34A 1HXFH 3SQHE 3RP2A 3HK3B 4MPUA 3ESTA 3BTWE 3IWMA 1XKBC 4O97A 2DE9A 1FIZA 2PV9B 4MG3A 5B6OA 3MH4A 1EATA 3FO8D 4A1VA 2C3SA 3RXPA 4OGXA 1RGQA 1ELCA 1L4DA 4PROA 2XWBI 5DG6A 3TNTA 4IN1A 1D3TB 1O2NA 3OAAD 2KAIA 4ABBA 1L1NA 1GBTA 5A2MH 2H9TH 5B6LA 3N7DA 4K5ZA 1LVBA 1O2KA 1GI0A 3SW2B 2PUXB 4AB8A 3SUFA 3U28C 2ZU2A 4FUGA 5GIBA 5AFZH 1V2TT 2A5IA 1WTGH 4YOJA 2OINA 1YCPH 1W7XH 1WQVH 2QXGA 1JIRA 1UTQA 3QK1A 4I8HA 5ESTE 1ZPCA 1GDQA 2PSYA 1J8AA 3GY8A 3SJOA 1ELBA 1SQRA 2WZQA 4NIXA 1E1QD 2FX4A 4X8VH 2ZCKP 8LPRA 1TAWA 3LGWA 1P09A 2KCYA 1F2SE 1FZZA 1O3BA 2BLOA 1WQSA 2ZCHP 1P57B 1O3PB 2KX4A 4X1PU 1D6WA 5JBBS 1KLTA 1V2WT 4BTIB 5GPIB 4Q4LA 1WXRA 1YPLH 1OWJA 1TA2A 2BHGA 1IAUA 1UTNA 2O9QA 2Z7FE 1PQ7A 3ZZCA 2OTVA 1P3CA 1P2OA 2Y5FA 2G51A 2W5EA 4B75A 1ESTA 3IG6B 1OOKB 2UUJB 3K6ZA 1E79D 2WHXA 2ASUB 3GYMA 3BTDE 3OSYA 3ZVDA 4DW2U 1AHTH 1K9OE 4RKJB 2QGRA 9LPRA 3O8BA 2JJ2D 1BITA 1NRSH 1THSH 3FFGA 1DANH 1GMCG 2VINA 4A92A 4O3TA 1IQIA 1O3JA 1K21H 5JBCS 2V3MA 3A7YA 1LKAA 5A8ZA 1C2JA 1YY3A 5JBAS 1GJ4H 6GCHG 3V13A 4YLUA 1DXPA 3QO6A 1GHWH 2M5TA 3FANA 1EZXC 1Z8JB 1V2ST 4YLQH 1XKAC 1IOEA 3OFND 3KYGA 1V2QT 2C93B 2PSXA 3BG8A 3SO3A 1ZMNA 1TGBA 2BZAA 1KXDA 3FOAA 1OKXA 3P6ZB 2PP6A 2CV3A 2H5CA 1UTMA 5GDSH 2XBXA 1LVMA 4A7IB 1ZPZA 1F92A 1ZRKA 4DIIH 1O3LA 2A4OA 3ODDA 3Q00A 3E16B 1NFYA 1SL3A 5IK2D 2BDIA 3QX5H 5H4IB 1K1PA 1J14A 3VG8A 1C9TA 5FHTA 4X8UH 4GPGA 2J97A 1SOZA 2ZFPH 3EQ0H 2HALA 1HAIH 2GZ8A 1H1BA 1ACBE 2AGIX 1EUFA 1TBZH 2C8YB 1MTUA 2FZZA 4Y8ZA 5IYTA 2R0KA 4K60A 1O5AB 1YPHE 3LGYA 4Y6DA 4IMZA 4BNRA 3SNAA 3A7ZA 3OTPA 2WPDD 3FN8A 1UTKA 2ZTXA 3KN2A 1F0SA 4HG6A 4GSOA 2R3UA 4NGAH 2P93A 4AN7A 2ZNKH 5EW1H 1TALA 4X0WU 1GJBB 1W0ZU 3ZVFA 1YLDA 2TGDA 2ZECA 1UHBB 3MO6A 2FOEA 1HAOH 1SQOA 1Z8IB 2ODPA 3A86A 3E6PH 5F8TA 3UFAA 1BCUH 4Y7BA 2O8WA 3H7TA 2P8OB 3MU4A 1QRXA 2OP9A 1IQKA 1TPSA 1BJVA 1C4V2 3RXBA 3UQVA 1QTFA 4SGAE 4XBBA 5JB9S 1Y3XA 2YMSC 1HAZB 2AGGX 4BAKB 1WSSH 1CGJE 4TSFD 4RI0A 2VVVA 2VBCA 1WUNH 2ZU5A 1NBMD 1E35B 1Y5BT 4IMQA 4O03A 4NA7A 5EU8A 4Q80A 1HJ8A 4D7GA 5EJZA 3LGVA 1AZ8A 3OE7D 5FCRA 3RXSA 1BBRK 4R0IA 2ZU4A 5T6GA 1K0HA 8KME2 1GGDC 2P3TB 4ISHH 7KMEH 1P2JA 4I8JA 1DY9A 2A4RA 2H5DA 3SOSA 2ZU1A 1NFWA 4RT0A 3SUDA 3S0NA 3FP6E 3RC6A 2P59A 1OP8A 1GHXH 1UTLM 1HIAA 2Y6TA 3T28A 3MH5A 1FY1A 1QA7A 1N1LA 2W26A 3QN7A 2FOFA 5G4BA 1KXEA 2OK5A 1EAIA 2J94A 4H42U 4I8GA 4INHA 4X1RU 3RLYH 3NXPA 3GDSA 1FY8E 3A81A 2XBWA 1HXEH 1BTYA 2BY6X 3EE7A 4YTAA 5DSFA 1C5VA 3P8OA 4X6OA 1EP6A 2TRMA 3A85A 3TJUA 1EOJA 4JK6A 3P8FA 1O36A 4U30A 3LONA 1LQEA 1TMUH 1QCPA 3K2UA 5I46H 1QL7A 4XRNA 3PLBA 3RXLA 2W3KA 4DIHH 1FAXA 3AW1A 2ZQ2A 4B76A 3OYPA 1NU7B 1TX6A 3KEEA 1IHTH 2JETC 1QZ8A 1MMJN 1P2MA 1PQ5A 2OBQA 3QGJA 1RRKA 3SU5A 1C5TA 2VVUA 4X2WA 1BHXB 1JWTA 1NU9A 1O3AA 3ZZ3A 1G9IE 3GYLB 3GY7A 1PPGE 2CN0H 1C5RA 1T31A 2D2DA 4TY7A 1JRTA 3VPKA 2VVCA 5CHAB 3T2NA 3M3TA 2ZFSA 1VJAU 2A5AA 1LPKB 2ZU3A 3MOCA 3ZZ9A 4ISOA 2B8OH 2SGQE 1YGCH 2FESH 2ZF0H 1GPZA 4BTUB 4Z6AH 1OP0A 1C1WH 3M3SA 2FS9A 3A87A 3ZZ4A 2HPPH 3TPIZ 4CRBA 1TNKA 2AERH 1ANDA 2FI3E 3BTME 3PRBA 2WPHS 1BDAA 3TK6A 1ZSKA 3VXFH 1H9HE 1IQFA 1GL0E 4X6NA 3VB6A 1PQ8A 3F9HA 4MQAA 1CVWH 3QLPH 1JRSA 1TRNA 2FP7B 1AGJA 3QTOH 4UFDH 2AMDA 1TA6A 1NRQH 4D76A 1Z1IA 4ABFA 3PLPA 4A1TA 1VZQH 1O2RA 1XUHA 1O3IA 2PKSB 3DCLA 3MO3A 7GCHG 1QRWA 1ZHPA 3RXJA 1ZSJA 3MI4A 1AFQC 4WMEA 3QWCH 4CBOA 3QGNB 3NCLA 1TYNA 4BOHA 5EOKA 4E05H 2CHAC 1PPZA 2J2UA 1QFKH 2B5TB 2FDAA 3SI3H 1V2RT 4AOQA 2WPMS 2FI4E 4Y11E 5F53A 2SGDE 3SV8A 3T27A 2WPIS 4YOGA 1EPTA 1SGFG 5HIYA 3RXHA 1SMFE 3F6UH 2FLRH 4FUBA 2FMJA 5EJLA 1NZQH 3E3TA 2J9NA 2QA9E 4Y0ZE 1G2LA 4A6LA 1GBIA 1K1LA 1BOQA 1C1NA 3B23B 1Q31A 3BSQA 1Z8GA 4F55A 1GI7B 1SI5H 3N99A 1O3NA 3HGPA 1LVOA 4KELA 1YPEH 1T8OA 1M9UA 1GVZA 1TONA 1AUJA 1E34B 3GDUA 2KR7A 4MPXA 1A61H 5EXLA 1RTFB 3DHKH 1YC0A 2BTCE 3WWFA 3AVZA 4JZDH 3E1XB 3C1KA 5KGOA 2GT8A 3K9XB 4DCDA 4E7NA 1KXAA 4O9VA 1NRRH 3RXKA 2CMYA 2ZPRA 4NSVA 1E36B 4JYVH 2IPHA 3PWCA 1Y3UA 2OC1A 3RXVA 1C5PA 3QTVH 1HPGA 3T25A 1G3EA 2B0FA 2CGAA 3PB1E 1CA0C 1OWHA 4RT1A 2P95A 4I8KA 1ABIH 2J38A 3RXOA 3PYHA 3GY2A 1SOTA 3Q3XA 4TY6A 1GJCB 3A80A 5A09A 4ACBA 2ZEBA 2EQNA 4WF8A 1GI1A 6LPRA 4OGYA 2XBYA 1KLIH 3U1JB 3ATLA 4Z0KA 5FPSA 3SQEE 2HGTH 1AY6H 2STAE 2L74A 3SNEA 4NFEA 1NS3A 1AI8H 1TFXA 1AUTC 3EAJA 1EAUA 3L3TA 2FO9A 1GJDB 1GGDB 1P04A 1MD7A 1MKXH 1BJUA 1HNEE 3A89A 3RXAA 3SV6A 4JCNA 2Z3DA 1C2IA 3DSPA 1HAYB 1O3EA 1D4PB 3GCHC 3HKJB 1XXFA 4Y0YE 4X1SU 2Y5GA 2Z6BD 4KP0A 3UPEA 1Y3VA 2QXHA 1S82A 2GGVB 1EOLA 4ZHLU 3DA9B 2JIZD 3I29A 4J2YB 1WYKA 1KMHB 2QF0A 3RMOH 1D6RA 2R2MB 1WBGB 3V12A 3EYDA 3O8CA 1GJAB 1SG8B 1G3CA 3TNSA 3NK8A 3VGCC 3RLWH 3ZVCA 4KGAA 3URDA 4FUJA 3GCTG 1DM4B 1GBBA 5FPTA 1IQNA 3ZVEA 2JH5D 1S81A 4NWKA 1J17T 2ZDMA 3MU1A 1DWCH 1NRNH 2C8WB 5L6NH 4LK4A 5JDUB 2VB0A 4ZXYH 2D26C 2V7QD 2A31A 3LOXA 1HAVA 3PROA 3MNXA 2ZTYA 1O2UA 3GY5A 1LMWB 3KYFA 2VIOA 1IQMA 1QR3E 3SYJA 3PM3A 4CR9A 4H4FA 2JETB 2J98B 3PMHB 1GHZA 3M61U 3SUGA 3MHWU 3M5OA 4OS2A 5C0TA 2ALVA 3TIUA 2H2ZA 1VITH 5C94A 1BMFD 3BTGE 1MTSA 1SB1H 2FTMA 2O8MA 1S6LA 3MU5A 3F0PA 4GCHG 5EXMA 2QF5A 1BQYA 5C5OA 1GHAF 4AG1A 5FPYA 2BQ7B 1SQAA 1GMDF 1P9UA 5C67A 4TWYA 4ASUD 2A7HA 3M3VA 4UD9H 5HGGA 3ZIAD 1F0RA 3RMMH 2F9PA 1S5SA 3M7TA 3PMBB 3QZQA 1HYLA 3SU2A 2QAAA 2PFEA 1OYQA 1LVYA 2B7DH 2XBVA 1DX5M 4I32A 1QHRB 1UVTH 1ID5H 4I31A 1SGQE 3D62A 1CHOG 1O35A 1NY22 5DP9A 1ZTLA 2VIPA 5AFYH 2Z9GA 2V3OH 1CE5A 1HAXB 4X6PA 1C4U2 1Q2WA 2RDLA 3SV9A 1C2EA 1CA8B 2WV9A 3MWIU 3BV9B 3LC3A 4XE4A 2IJOB 3EE0B 2UWPA 1QQUA 2ZHQH 3ATWA 1ELAA 1UHBA 2Z9JA 3UR6A 1PPHE 1GL1A 4GVUA 3DSOA 1GBCA 3LJJA 2BY5X 2AIPA 5PTPA 1C2MA 5EQSA 3ZZBA 4NA8A 3E0PB 2BLQA 3SGQE 3S9AA 1YF4A 1A3BH 1QBOA 5FL7D 2HOBA 1H8HD 1U6QA 2O8LA 1XUIA 5C2ZA 1UVOA 1O2JA 1C1OA 1UK4A 5DPAA 4B1TA 3BEIB 1Y8TA 3CNRA 4NWLA 1E1RD 2QE7D 4ACAA 5T3HA 4BAMB 3SU0A 1FY3A 1TPOA 2BD8A 6GCHF 1VR1H 4FETA 2ANMH 1QRZA 1LQDB 4NCYA 3RMLH 3RUOA 1GI9B 2F3CE 1IHSH 1DLEA 3QDZB 1DY8A 1Z8RA 4TPIZ 4LZ4B 2V35A 2G8TA 4B71A 2BY9X 2A0QB 3KQEA 1ELDE 4ZMAH 1SGPE 2F9NA 4ESTE 1OPHB 1O2YA 1C5MD 1IQEA 2A2QH 2SGAA 4BTTB 1GHBF 2GX4A 1CBWB 2NU2E 2XC4A 3QUMP 1SBWA 5AHGH 1Y3WA 1CA0B 4Q2KA 4D7FA 1AKSB 1O0DH 2IN2A 2A7CA 1TIOA 2GMTC 1O3MA 3ZZ7A 3KQ5A 1C5YB 2KM0A 2QXIA 1O2IA 2CF8H 4CRFA 2WPLS 1A4WH 1G36A 2VIWA 2XXLA 1TQ0B 1TABE 3MMGA 1DXWA 4BAHB 1FMGA 2PKAA 3M5MA 1BTZA 1TNHA 3SV2H 2F9OA 1CSOE 1V2NT 1SFIA 2P16A 2XTTB 4IGDA 1BMLA 5EIYA 2GD4B 3RXQA 2H9EH 1NFUA 2GZ9A 4CH8B 1SGCA 1TOMH 8GCHF 1GVLA 4UFGH 1EJNA 2SFAA 5DK1A 2V0BA 1KLJH 1RXPA 4OS1A 1A2CH 1TMTH 1N8OB 1O2MA 1LHEH 2TPIZ 2HNTC 3DD2H 2ESTE 2YNBA 1YPKH 1JXPA 1QNJA 1FAKH 1K1OA 2GCTC 3A7XA 1FIWA 4AFUA 2FYQA 1BB0B 3OU0A 1RTKA 3D23A 4AGKA 1SGFA 3M5NA 3FKSD 3LH1A 2UUYA 4F49A 3SU4A 1P2KA 5E0JA 1OYTH 1PPCE 1AVGH 2L6OA 3OEED 3P92A 2XNIA 1C1QA 2ZDLA 3ZZ5A 2FOMB 1GMHG 1IQLA 1ZYOA 1K1NA 1DWDH 4UFFH 3RU4E 1AE5A 1YPJH 3RXEA 1YPMH 5TCCA 4NSYA 2OXSA 1KDQA 4CRCA 1OWIA 4HGCA 3S9CA 4ZROA 1D3QB 1OWEA 4FUHA 1XVMA 3MYWA 2WYGA 1MTWA 3SBKA 1O38A 4NA9H 3HK6B 2EY4C 1ZGIA 4D8NA 1Z7KA 1SGIB 1QJ6B 2BZ6H 1TRYA 2ZGJA 4X1QU 1V2OT 3ATIA 1O39A 5JBTA 4WVPE 1GG6C 1VGCB 3TLOA 4BAQB 3SU3A 1HJAC 2A1DB 1ZTJA 4JZ1A 2FIRH 4YO9A 1DVAH 2KCAA 3E91A 1SFQB
chains in the Genus database with same CATH topology
2FOCA 3MO9A 4HZHA 3HATH 4X1NU 5LGOA 4A1XA 3SUEA 1HCGA 1CT0E 1GDNA 5F8XA 4QT8C 4MPWA 3ZVBA 1AZZA 1DSTA 1EJAA 2EI8A 1O2QA 1A0JA 2J92A 2KAIB 3GDVA 1DLKB 3RXFA 1F5KU 5CE1A 2DUCA 2F43B 1QJ1B 1AE8H 1TGTA 2J4IA 3KGPA 2IJD1 2W7SA 4WH6A 1G3BA 4XOJA 1BZXE 1RD3B 1ZOMA 2BOKA 5DKMA 1J9CH 1AMHA 1DS2E 5FX5A 1YPGH 2ZA5A 3LDXH 4JYUH 4LZ1H 1ZRBA 1L1JA 2FEQH 4AX9H 1OHHD 4X2VA 2GTBA 5IDKA 2AMPA 2PLXA 3F2GA 1AVWA 3UREA 1UTOA 5C1YA 4OM9A 4OS7A 1HAHH 4K2YA 1GCTC 5DP5A 4FVDA 1TPPA 1B0EA 1YM0A 2M2AA 2QN5T 1W7GH 1C1TA 1FLEE 2KZ4A 1A0LA 1TRMA 2F83A 1GBLA 4B74A 1QB1A 4O3UA 1LHDH 5GCHF 3MNSA 2BD7A 2AYWA 4FUEA 1O5BB 2NU4E 1Y59T 3T26A 3R0FA 6CHAC 1BBRH 1FN8A 3UWIA 4UDWH 1SLVB 1MKWK 2R2WU 1O2LA 1C5UA 1UVUH 5HM9A 7ESTE 2GZ7A 4CREA 5JYIA 3KNXA 1T8NA 1W13U 4ZXXH 1NRPH 1QA0A 4UE7H 2O8UA 2ZHFH 3UNRA 3BTHE 3STIA 1KYNA 2YMSD 1L4ZA 1C4Y2 5TCAA 4XFQA 2AIQA 1NM6A 2VIVA 3URCA 1GHVH 1EZSC 1UCYH 2ZGBH 4K8YA 5A8YA 1DWEH 1QB9A 5SGAE 1S6HA 2BYAX 4KTSA 4U2WA 1FI8A 5I25A 5A0BA 1MBQA 2H9HA 1PYTC 2PGBB 5J4QA 3F2HA 5EQQA 1RJXB 3UWJH 3TGIE 1A1RA 2Y81A 3LIWA 1ZZZA 4BANB 3PV4A 3VFEA 3TGJE 5C17A 3BF6H 1EPTC 1W10U 1DUEA 2HVXA 3PWBA 2BD2A 1J15A 2ZFRH 2ZI2H 4NG9H 1V2MT 1EQ9A 1C1RA 1GI4A 3U69H 2JDID 4HI3A 1SGYE 1S0QA 2HNTE 2GMTB 1C2GA 4Y7AA 1EB1H 2VIDA 1EAXA 4K8BA 1TBRH 2ZP0H 1GBJA 1ZJDA 2Q6DA 2PGQB 2CJIA 3RC4A 3U8OH 2BMGB 5K7RA 2K8IA 2G52A 2AMQA 1P0SH 5LH8A 3RXIA 1HAPH 1D3DB 3DT0H 3SZEA 2P3FH 3U9AH 4Q7XA 2G55A 1TWXB 1LKBA 1LDTT 2QF4A 2TGTA 2BD9A 1TNJA 1O2TA 1W0YH 5C0UA 1XVOA 2GVFA 3NKKA 1BRUP 2HNTF 1A3EH 2EI6A 5DJ7A 2NU0E 1QL9A 1Z71A 1KTTB 1LCYA 1GBAA 2WV5A 4DG4A 2UWLA 3F9GA 2A5KA 3NPSA 3Q76A 4ABGA 2H1UA 1BRCE 1GJ8B 3ATKA 1V2VT 2BQWB 1QIXB 3TU7H 3F9EA 1SR5C 3AK5A 4ZKNU 1V2LT 1C1VH 1RIWC 2ODYB 1UK3A 1HGTH 2QV1A 4WH8A 2PHBA 1SGRE 4HFPB 4TT3D 1WTHD 2ZGHA 2PTNA 4AYYB 1W2KH 1CT2E 3BTQE 4FU7A 5EXNA 1H9LB 1AO5A 1BRAA 4AB9A 3LGUA 3U1IB 1KY9A 1P03A 2D8WA 1C2DA 1O5GH 3T5FH 2XWAA 2OBOA 3KQDA 1FY5A 3OTJE 1MU6B 3E0NB 1AWFH 3W1EA 5DP3A 3UNQA 5AVDA 1SKYE 2XCNA 3FZDA 4ZUHA 2VNTA 4U01A 4E06H 1Z6EA 1CQQA 1FONA 5E0GA 1NPMA 1KSNA 1ANBA 2VWLA 1C2FA 4RKOB 3S7HB 2NU3E 1KXFA 1S83A 1BMAA 2RA3A 2QCYA 1GDUA 1V2JT 2C90B 1TGCA 1O2VA 3SNBA 4K1EA 1MZAA 3VB3A 2GDDA 2YMSB 5CMXH 1DUAA 1C9PA 4ABJA 2VH6A 5GWZA 2CF9H 3GCTF 4CRAA 5FCKA 1OXGA 4Q63A 1ZPBA 3AW0A 3RXGA 1TX8A 4FU9A 1SGEE 1QQ4A 1O2PA 1FPCH 4ABAA 1C2LA 3PV5A 1ZHMA 1UJ1A 3UOPA 5C1XA 2RCEA 1XUFA 3BTFE 1MUEB 1P9SA 1S84A 3PMAB 1A5GH 1ZJKA 2GCHF 2I6SA 1DITH 2NU1E 2EC9H 1UMAH 3D49H 2ZHEH 2F91A 2SGEE 1AB9C 5HKKD 3UB0A 1VITF 3GISB 3ZZAA 3AAUA 2FPZA 3GOVB 3PMJA 4UEHH 2ZDNA 4YT6H 1C1SA 3I77A 3D65E 2BDGA 1N6YA 1XUGA 3AASA 5ESBA 3PO1C 3SU1A 2JH0D 1GCTB 2F9UA 1RTLA 3SGAE 3SN8A 1LHFH 3EGKH 1DICA 1HV7A 2DE8A 2GV7A 1OWDA 5C3NA 3ZYEA 2SGFE 3UTUH 1C5WB 1QURH 1PFXC 2YOLA 2OC0A 4CRDA 5FX6A 2WSSD 3P70B 1W0KD 4B6EA 3SJIA 1INCA 4DOQA 4FUIA 1C1PA 1ZMJA 4MNVA 4B2AA 1K28D 1VCPA 2ZFTA 3MTYA 3L6PA 5DN6D 2XW9A 3IITA 4XSKU 1TLDA 3A84A 1LPZB 3GY4A 4X6MA 1YYY1 2PWXA 8ESTE 4IC6A 3SJKA 4CHAC 5EW2H 5EODA 2ZPSA 1HJ9A 1DT2A 3TJNA 1ZMLA 3JZ2B 4AFSA 1MAYA 3A8AA 5L30H 5C20A 2TIOA 2HPQH 2ZDKA 5LPEA 2PR3A 3SHAH 4ABHA 5A0AE 3UNSA 4AGJA 1IQGA 1SQTA 1AWHB 1FN6A 1THPB 3O8RA 1O5CB 2P8OC 3DFLA 4U32A 4ZKSU 2ZO3H 2FOHA 1KTSB 1LO6A 1P2QA 4AFQA 4BXWA 3H09A 5CHBA 4X2XA 1CGHA 2ZDVH 1V6DA 3LT3A 1TE0A 3ZVGA 1RS0A 2Z94A 1ELVA 3RXUA 4CBNA 1T8MA 1EXFA 1P8VC 2ANYA 2WV4A 4ISNA 4IN2A 3F68H 2GV6A 1ESAA 2A32A 4JZEH 4OS6A 1O5EH 1O2SA 3P8GA 3M7UA 1O5DH 2FOGA 2FODA 2G00A 2QF3A 3V0XA 3HKIB 3CENA 2BVXH 3DFJA 4Q7ZA 1BA8B 4AZ2B 1YCPK 4D9RA 5GXPA 5CDFE 2WPJS 1SLWB 4B73A 1GCDA 4GUXA 1AD8H 1AFQB 2F4LA 4IS5A 3PV2A 2ULLA 2O8TA 1BTUA 5DP6A 2C8ZB 1V2PT 4TWWA 4E7RG 1P11E 2CHAB 2GDEH 5GJ4B 4GHQA 1SVPA 3ZZDA 1DE7H 1QL8A 2FTLE 1J16A 2XRCA 1BMMH 1EX3A 2W3IA 2EEKA 1BRBE 3M35A 1P12E 1CGIE 3KF2A 3RXDA 2XNDD 1WOFA 1GMCF 1RIWB 1P3EA 3RU4D 1S6FA 2TBSA 4NIWA 5C5NA 1KXBA 5E2PA 1MBMA 2V6NA 4THNH 3KHVA 3A7WA 2BY8X 1AFEH 2PW8H 3MU0A 4KKDA 1C2HA 1GHAG 3TVJB 3UUZA 2XOKD 1O3KA 4I33A 4TYDA 2ODQA 2JJ1D 1GMDG 2ZZUH 1Y5AT 2FS8A 3Q3KA 1K1IA 3OEHD 1HFDA 2A45B 3TK5A 3G01A 5T6DA 1O3DA 1FV9A 3M36A 2QC2A 1ELGA 1O3OA 4NZLA 2KCOA 1A7SA 5FBIA 3LU9B 2BB4A 2K0QA 5F03A 1W8BH 1P02A 4HTCH 1P2NA 3TITA 4R8TB 4XBCA 1MQ5A 2OC8A 1CHGA 3SJ8A 3F1SB 4B6FA 4FUDA 2HRVA 2SNVA 1GBEA 1DDJA 5CHAC 1EASA 1OP2A 1O33A 1GMHF 1JOUB 1BTPA 4INKA 3GCNA 1O5FH 2Q1JA 1ANCA 3B8JA 2I6QA 1VJ9U 4NIVA 4TPYA 6ESTA 1NESE 5A0CA 4I8LA 3S9BA 4UONA 1UVPA 3A83A 1GI2A 1YKTA 4B2CA 1H4WA 1BUIA 1ABJH 2D1JA 4ASHA 3V7TA 1TGSZ 2LPRA 1N6XA 2ZDAH 1F5RA 1O37A 2VIQA 4DURA 4BXSA 1CO7E 1HAVB 1X7AC 3ZV9A 5ETXA 2TGPZ 1TPAE 3ODFA 3A7TA 1OX1A 1ETSH 4DT4A 4MLFB 4SGBE 2WUCA 1AB9B 2PKSC 1TNIA 1C5XB 3A82A 4ZKRU 2W6ID 3GCHB 5EPYA 3RC5A 1T32A 4Z1MD 5AF9H 3UQOA 4WY3A 2ZIQH 1GJ6A 3MU8A 3H5CB 3M5LA 3PLKA 1F0UA 1TNLA 2VGCC 3PO1B 3NRLA 2ZQ1A 4MNYA 1T7CA 1GBKA 1AN1E 2FLBH 5F8ZA 5EPNA 1HRTH 1PPFE 1H8DH 3RMNH 3WW7A 1NFXA 2ZHDA 3S69A 2UUKB 2OQ5A 1YCPM 1GBHA 3VGCB 2AFQB 1V2KT 5GNDA 1C5QA 1HAGE 3SZNA 3E8LA 4DVAU 1GHBG 3SI4H 1BTXA 1RFNA 2BVSH 3SORA 3P95A 1CU1A 4D9QA 1BBRE 1KXCA 1S85A 1MTVA 2EI7A 1AU8A 5FAHA 1W0JD 2PUQH 3OY5U 3F3BA 2VWMA 3PTBA 1LHCH 2BD4A 2BDYA 2BDHA 3I78A 1CT4E 4FUFA 3M7QA 2BY7X 3W95A 4CHAB 2OQUA 1FQ3A 2SNWA 1EAWA 3BIVH 4OS4A 2ILNA 1NC6A 1MCTA 3AAVA 1UCYE 1O2XA 5EQRA 1T8LA 1Y3YA 3TGKE 1MABB 1LPGB 3RM0H 1JIMA 1BT7A 4M9FA 3PTNA 3E90B 1DWBH 8GCHG 1JMOH 4GHTA 1O3GA 1ZTKA 3VB7A 1VCQA 4WMFA 3MNBA 1XUKA 4RSPA 2A4QA 3N7OA 4K1TA 4YT7H 2G4UA 4ABIA 1G2MA 3EA7A 3SHCH 1GWAA 1DPOA 3K65B 3FP8E 1ANEA 1T4VH 2PTCE 4WXIA 1Q3XA 1LTOA 1TB6H 1A5HA 1ESBA 2Y82A 1H8ED 2WYJA 1ZHRA 1XXDA 9ESTA 2C8XB 1GI5A 2OC7A 2VJ1A 3STJA 1ZR0A 3Q77A 1C5SA 2Z3EA 4ZHMU 3RM2H 1OS8A 1SC8U 1VCWA 2G5VA 1P2IA 2KCPA 1A0HB 3BG4C 2JKHA 3TH3H 3M37A 1LHGH 1P10A 1Z1JA 3ZZ6A 1TX7A 1HBTH 1MCVA 4XDEA 4M7GA 3TH4H 4DJZB 4MNXA 4BAOB 5FBEA 1F0TA 2W6JD 2RA0A 4NIYA 3GY6A 2V3HH 3ATMA 3RXCA 1O2OA 5ABWA 4DGJA 1DOJA 4J1YA 1SGNE 1TQ7B 1UCYK 3QZRA 2EA3A 4VGCC 3N7EA 1Y5UT 3A8CA 3BEFB 1GHYH 4X8SH 1SPJA 5HM2A 2STBE 1MAXA 3DUXH 1MU8B 1O2ZA 5JB8S 3VB5A 1UTPA 4MVNA 1ELTA 1E37B 2Z3CA 2CXVA 2J95A 4OS5A 1PPBH 1TNGA 4MTBA 5E0HA 1O3HA 1AQ7A 1QY6A 1YBWA 5L2ZH 5JPMH 2PKAB 1W14U 2ZFQH 1G32B 3JZ1B 7GCHF 3FZZA 1FUJA 1JBUH 3BN9A 2LELA 2XYAA 1QGFA 1QB6A 1FJSA 3SU6A 2UUFB 1ZSLA 4INLA 4GLYA 2RG3A 1FY4A 2G4TA 1XM1A 4ZKOU 5BRRE 1WU1A 1BHXF 1EFRD 4A5TS 1NT1A 4WMDA 3VB4A 3MFJA 1MKWH 2ZC9H 2J5UA 3FVFB 4IC5A 2ALPA 4WWYA 1SGTA 1L2EA 2R0LA 4K1SA 1EZUC 2A4GA 1IQJA 1P01A 2VU8E 1QJ7B 7LPRA 1F5LA 1BTHH 3RXMA 1ARBA 3GS9A 5K0HA 2FI5E 1B0FA 5DGJA 4X2YA 2YNAA 1PQAA 1GJ5H 3L33A 2OCVB 4FXGH 1NBME 2ZGCA 2FOBA 5GCHG 1ELFA 5FXLA 3VXEH 2F9VA 1KDQB 1MTNC 1NROH 3ITIA 2ZWLH 3ZV8A 3A8DA 5EG4A 4H6SB 1TBQH 1SLXB 3U8TH 3OX7U 3P17H 1G37A 4DT7B 5LPRA 1K22H 1ZLRA 1ELEE 2CK3D 2BX4A 5E8EH 4CR5A 1FNIA 2Y7ZA 3ZYDA 1YLCA 1IQHA 2BLWA 1BTWA 5C1UA 3F2FA 2BD3A 1COWD 5DP8A 5T1VA 1KIGH 3KIDU 4AYVB 2GCTB 4K69A 4LOYH 2BQ6B 2Q6GA 2FX6A 2R9PA 2VGCB 2ZKSA 2K1QA 3SNDA 2WPKS 1EZQA 2P94A 4RN6A 1ZGVA 1QBNA 3O8DA 4FVBA 4JZIA 1PYTD 3A8BA 2A7JA 3A88A 2HLCA 1HDTH 1XMNB 1NO9H 3T62A 4IW4E 1P05A 3NWUA 1FDPA 4WXVA 4ZAEA 1DSUA 2BLVA 1O3CA 4JK5A 2AH4X 1GVKB 4YZUA 1L1GA 3R3GB 2TGAA 4KTUA 4MDSA 4Y8YA 2Y80A 4JZFH 4GAWA 1UVSH 4CH2B 2BDBA 2ZPQA 1GBFA 4UFEH 3HGNA 3UR9A 1GI3A 1O2HA 2OLGA 4AORA 4KTCA 1HIAB 1F7ZA 4AG2A 5EGMA 1GG6B 1DFPA 1HJAB 4NZQA 3WY8A 3OY6U 4Y76A 1T4UH 2ANWA 1D9IA 1SSXA 1WCZA 2WINI 1PJPA 5LPFA 1MQ6A 3KCGH 4ZHAA 4ABEA 4IBLH 3RDZA 3KL6A 3MH6A 1V3XA 3S7KB 1OSSA 1G30B 4ABDA 2BXTH 1UK2A 2BD5A 1L0ZA 1MZDA 4JYTA 3U8RH 4YESB 1MKXK 1K1MA 2ZHWH 3BIUH 1SGDE 2R3YA 2BOHB 1CBWC 1G3DA 4K3JA 1K2I1 3TK9A 5A8XA 3ZZ8A 2Z9IA 1WV7H 3LGIA 2Z9LA 1D3PB 1TMBH 2F9BH 2OD3B 2G81E 4X8TH 2FM2A 1W12U 3TJOA 1C5ZB 5DP4A 1ORFA 2BDCA 1AVXA 1W3CA 3ZVAA 2XC5A 1XUJA