3SUFA

Crystal structure of ns3/4a protease variant d168a in complex with mk-5172
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
190
structure length
190
Chain Sequence
b'GSVVIVGRINLSGDTAYAQQTRGEEGCQETSQTGRDKNQVEGEVQIVSTATQTFLATSINGVLWTVYHGAGTRTIASPKGPVTQMYTNVDKDLVGWQAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVAFIPVESLETTM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Molecular Basis of Drug Resistance against Hepatitis C Virus NS3/4A Protease Inhibitors.
pubmed doi rcsb
molecule keywords NS3 protease, NS4A protein
source organism Hepatitis c virus
molecule tags Hydrolase/inhibitor
total genus 36
structure length 190
sequence length 190
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sufA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3sufA01
4B2CA 4K3JA 5DP6A 3T62A 1T8OA 5CMXH 4TPYA 4XBCA 2FMJA 3Q00A 1C5LH 1W0YH 1BHXF 1ABIH 3V7TA 7KMEH 4B6EA 8GCHF 1BCUH 1ZSLA 4Q7ZA 5DK1A 1O2IA 1UTLM 1O36A 1B5GH 3SNCA 3QZRA 1ESBA 2V0BA 3M35A 4MG3A 1O33A 1C5YB 1XXFA 1GI2A 1GVZA 4KTUA 5FCRA 1SGFG 1AHTH 2FOGA 2Y5FA 3OY6U 4K1TA 4RSPA 3W95A 1ZJDA 5DGJA 2Y7XA 5H4IB 1KLIH 1PPHE 2AYWA 3D49H 4ZKRU 4D9QA 5PTPA 4FVBA 1O2WA 4B71A 1CVWH 2FOAA 1AFQC 1HBTH 5T3HA 1LO6A 1C9PA 1ZHPA 1Z8RA 3NUMA 1UTKA 1QQUA 2WINI 1DOJA 1C1VH 3RXAA 1BITA 2ZGBH 2WV5A 1LCYA 1FZZA 4E05H 1UCYE 1NFUA 1NTPA 2BDCA 2G8TA 1C1OA 4E06H 4A1TA 3VEQB 1TPOA 1QL7A 2W3IA 2J92A 1PQ7A 1QIXB 2G52A 2HRVA 1UJ1A 3ODDA 3VB6A 1OWEA 1KDQB 1OKXA 1NU9A 1PPCE 3HPTB 1GG6B 2BDBA 1VJ9U 2SGAA 2GDEH 4GVUA 1QFKH 1HDTH 3E8LA 1O37A 2F3CE 2UWLA 4CRFA 1KXAA 3SZEA 1P3EA 2HNTF 3SJ9A 1Y3XA 2TGAA 2OQUA 4OS7A 3TK5A 1ZZZA 5A2MH 1O31A 1TBRH 1K1LA 5A8XA 2FO9A 1GBDA 2O8MA 1RTFB 5AFZH 9LPRA 1S5SA 4X1SU 2Q1JA 1FV9A 3TH3H 1C1WH 2TPIZ 4BNRA 1YLCA 3QWCH 2GCHF 1BTZA 1AMHA 3SYJA 1D3TB 1OWJA 1YGCH 5T6GA 2BX3A 1T7CA 1NS3A 1W13U 3LPRA 2NU4E 1LTOA 2P16A 1AN1E 2O8UA 4UD9H 2PR3A 4GUXA 2EI8A 1QR3E 4U01A 1C1UH 1ESTA 4DIIH 3BV9B 3SUEA 2CHAC 1LHDH 2PUQH 3U69H 1Y5UT 1CHGA 1GBKA 2A5KA 1UTOA 3RP2A 5JBTA 4HTCH 1E37B 1GI6A 1P02A 2HPPH 3PO1C 3RM0H 1GJBB 3U98H 1SOTA 3OX7U 1TGBA 1BB0B 1KXDA 3MOCA 4Y8YA 4B1TA 3P8GA 1A7SA 1PPFE 2PUXB 1O3HA 4TWWA 1ZRBA 3PV2A 2HALA 2Z3DA 1E36B 4I32A 1QB9A 4O03A 2QV1A 3M5MA 5LH8A 3M61U 3K2UA 1LPZB 5CE1A 1O2ZA 1Z8JB 2FOEA 2VIWA 3SZNA 3VPKA 1EAXA 3HGNA 3HGPA 1HLTH 3RMMH 4ZKOU 2SGDE 2ZHEH 1FAKH 1DM4B 1LVBA 2XTTB 3ZZ3A 1ELTA 2VWOA 2FZZA 2XW9A 4WY3A 5FX5A 1LVOA 4WXVA 3MNSA 1AGJA 3I78A 1XUHA 5CHAC 1GBCA 1TOCB 4WMFA 3E90B 1VJAU 3Q76A 3RXGA 1C2MA 4INKA 2AS9A 1O3MA 5A09A 3RU4D 2FPZA 4ZHAA 2A31A 2I6QA 1E38B 2FP7B 3SORA 1DWCH 2QXJA 1XM1A 3A8BA 4DG4A 3SU6A 1J8AA 2HWLB 1GJDB 5T6FA 4AG1A 1SHHB 4MNYA 4B76A 2BY8X 1G2LA 3E16B 1DY9A 5G4BA 1F5LA 1GJ4H 1UCYK 5LGOA 1YCPH 3RXSA 2PHBA 3SBKA 1K1JA 2BD2A 2GCTB 4FXGH 1ZJKA 1O3IA 1AE5A 1V2KT 3GY6A 1C9TA 1ELVA 3KNXA 5JB9S 3M3TA 2JETB 2SGFE 3U8RH 2ZHDA 3ATIA 1SSXA 2XNIA 4OGYA 4DCDA 2BY6X 1DS2E 1EB2A 1XVOA 1YPJH 5TCAA 3I29A 2ZFQH 5E8EH 4I7YH 1HXEH 1A61H 3BTQE 3DFJA 1IOEA 4Q80A 4UFGH 3SJIA 5K7RA 1AZZA 1F0UA 1UVOA 2ZTYA 2B0FA 1J17T 3SUFA 1LKBA 1BTXA 2FOMB 1DX5M 1IAUA 3F68H 3L33A 2A1DB 1P8VC 3SN8A 2PV9B 3GCHC 3KF2A 1JRTA 1F92A 3A7YA 1L1NA 4NFFA 5FCKA 4O3TA 3SI4H 1SQOA 1AUTC 5LPRA 2F9NA 2ULLA 4OS5A 1C2EA 1NY22 3VXEH 5DP3A 1SGPE 1V2JT 3QX5H 3A80A 4MLFB 1EX3A 3D23A 2AGEX 5DP8A 3L6PA 1HFDA 2IPHA 3MU1A 4M7GA 3SV6A 1D6WA 4XFQA 1TAWA 5EW1H 1QJ1B 2JH6D 5A0CA 2YNBA 2VIOA 1MCTA 1GI8B 1HJ9A 1SC8U 2OQ5A 2QN5T 5HM2A 2BD4A 1CBWB 3RXCA 1T8LA 4AFQA 3H09A 1C2LA 3QDZB 4X1QU 3RU4E 3SHCH 5HYOA 3ZVCA 3H7TA 1BHXB 3RC5A 3TITA 4GCHG 2OK5A 4I33A 1LHEH 2OC7A 4U32A 1QA7A 3A7XA 2Z7FE 3LKWA 1JBUH 2ZU1A 4E7NA 1BDAA 3PTBA 1NESE 1HIAB 1YLDA 2AIQA 1O3KA 1HCGA 3VB3A 4I31A 1GCTC 1P0SH 2BY9X 1UK3A 2GZ9A 1BTWA 1UTQA 1OPHB 4D76A 5SGAE 4M9FA 2C8WB 1KXBA 1P01A 1SR5C 4VGCC 2HPQH 1V2UT 3SW2B 5F6MA 2WZQA 1Y3YA 3UR9A 1TGSZ 1BMNH 1V2ST 4OGXA 2FLRH 3VB5A 4JYVH 1O30A 1EKBB 1W2KH 2AGGX 1GHZA 3TK6A 1GMDG 3P70B 1ZLRA 3GCNA 3HK6B 1KYNA 4MDSA 1LHGH 2H9TH 3ESTA 1J16A 1NU7B 5ETXA 1WOFA 3URCA 1TLDA 1P03A 2QXGA 7LPRA 1BRBE 3ZYEA 1THRH 2I6SA 3BTEE 3C1KA 3P92A 1ZPZA 4KELA 3DD2H 5C1XA 1ELBA 5HXFA 4DOQA 1O2UA 4Y8XA 1DWDH 1NO9H 1YC0A 1P04A 2PTCE 1D3DB 2J95A 3RXOA 1UMAH 5K0HA 1LVYA 4X1NU 1YPMH 2BY5X 4YOJA 1BUIA 1OYQA 1YPGH 1UHBA 2OBQA 2H6MA 4LOYH 4WXIA 1MTNC 4X1RU 3SUDA 1C1SA 3FP6E 1SGQE 4XE4A 3RXUA 3MU5A 5B6OA 1GJ8B 1B0EA 1GHXH 1YF4A 1HAPH 3AVZA 2H5DA 4OS4A 1Y8TA 1DITH 3DT0H 1ANDA 1C5NH 5E0GA 2Q6GA 4ABHA 5JYIA 1PQ5A 4K1SA 1AVXA 5EPYA 2FOHA 3UPEA 1XKBC 2DUCA 1Z1JA 1UVPA 1FN6A 2ZCLP 2FI4E 4HFPB 3VGCB 1TNHA 1EJNA 1V2VT 1AB9C 3S9AA 3A7TA 2F91A 3PB1E 2FOCA 1QURH 1KLTA 1ZTKA 3TIUA 3Q3KA 2JKHA 2ODPA 3SGAE 1V2OT 1K1OA 3IITA 5ESBA 1E34B 2A4RA 2Y80A 1TE0A 1RFNA 3ATMA 1BT7A 5DPAA 2AMDA 2XCNA 1RRKA 3D65E 1GHAG 4UDWH 1XUJA 2ZECA 3A87A 1BTYA 2XC5A 4AYVB 1GBBA 1ZTLA 3V0XA 4H6TA 3AW0A 2ZDAH 3RXIA 3GY2A 1G9IE 4GSOA 1KXFA 2AH4X 1O3OA 3SNAA 1JMOH 1THSH 2FYQA 2PSXA 1K22H 4ZUHA 2J38A 2KAIB 2P8OB 5FPYA 3RXEA 4CHAC 3LU9B 1O2PA 3K6ZA 3M36A 4NSVA 4IC6A 3KIDU 1UK2A 1DUEA 3AAVA 3FZZA 1QRWA 2F9BH 4R8TB 1C5MD 2XYAA 5ESTE 5EOKA 2ZTZA 4GCHF 1UVSH 1A2CH 1ZRKA 5F8XA 4TY7A 1SFQB 1Z8IB 2C8ZB 1Y3UA 1FPHH 1XUFA 1VGCB 3SNDA 1P2KA 1QBNA 1SBWA 1TQ7B 1S6FA 2C90B 1A5IA 2OCVB 2WV9A 1PPGE 3RXKA 3LT3A 8ESTE 2R0LA 1HAVB 1AKSB 4THNH 2ANYA 4ZHMU 2STAE 5EODA 1YM0A 4AGJA 2PW8H 1B0FA 1F0SA 2XBYA 4Y7AA 2C8XB 1J14A 3TJOA 2ALPA 3FVFB 3ELAH 1TB6H 1QB6A 3RXMA 4F4OC 2ZNKH 1O5EH 5FXLA 1BJUA 3ZZCA 3VXFH 1TONA 1AI8H 1TGNA 1V2MT 2CXVA 1YPEH 1W11U 1BIOA 1MMJN 3KCGH 4ZHLU 1P2NA 3HKJB 1TMUH 3MNCA 3UR6A 5E0HA 2PLXA 4KKDA 1ETTH 1OYTH 3SU1A 1GJCB 1GMDF 1N1LA 2XWBI 2A7JA 1PQ8A 3UREA 4UFEH 1C1PA 3ZZBA 3U1IB 5GDSH 3ZVEA 1TPPA 1TMTH 1KXEA 1UK4A 1RTLA 1TX6A 2A5IA 3TK9A 3BG4C 3KN2A 1RXPA 2HGTH 2UUYA 4BAOB 4FUDA 3RXLA 4F49A 3Q77A 3UQVA 1NC6A 3DFLA 3MNBA 9ESTA 3A86A 1H9IE 2WPMS 2OXSA 4RN6A 1HAIH 3U8OH 5AF9H 1FLEE 2W7UA 1EP6A 2HOBA 4NFEA 4AGKA 1CA0B 1MQ6A 1P2JA 1YPHC 5C67A 4GPGA 2QIQA 1MTWA 3PMAB 2SNVA 2C4FH 4YLQH 4KP0A 1MKWK 1BMLA 2OC0A 4ZKSU 2Q6DA 1O3PB 4BOHA 2O8TA 3T25A 1T4UH 2BDAA 3STJA 4A6LA 5FPSA 1AD8H 3P8FA 4JYTA 3EA8A 3GYLB 1OOKB 4AX9H 5DG6A 1GBHA 1MZDA 2GKVE 2TBSA 1ELFA 3M5OA 1S85A 2J34A 1DWEH 1P2MA 2FODA 3RXJA 2J2UA 1TNJA 5LPEA 2C8YB 2ZHQH 1GBEA 2ODYB 4Y10E 1C1RA 1UTPA 4WVPE 6LPRA 2FTLE 1GBLA 1ZMNA 1D6RA 1DLEA 1MBMA 5JDUB 1TOMH 3BEUA 1PYTD 1CSOE 3UNRA 3B8JA 4JK6A 2PKAA 2VVCA 3RXVA 5L30H 3NXPA 2XWAA 2VGCB 1GBIA 4D7GA 1C2KA 1CQQA 4H4FA 1GGDB 1P12E 1O5FH 5DKMA 3P95A 1C2DA 4RKOB 1GHAF 1DANH 1IHSH 3S7KB 1GI7B 3MYWA 1NFWA 1L4DA 3URDA 3V13A 3LH3A 1AFQB 2FOFA 4WH8A 1G2MA 1GG6C 1DVAH 2GV7A 4ZKNU 2NU2E 4Y6DA 1SGDE 1HAYB 4B2AA 2DE9A 2BD9A 4B73A 2FS8A 2BLOA 1INCA 1O2SA 1A0LA 2F9PA 4NWKA 4DY7B 1IQHA 1EAUA 4IS5A 1H8IH 2GGVB 4YLUA 2LPRA 1GI0A 2P59A 1MTUA 3RC4A 2ZFSA 2Z9JA 3M7QA 5C2ZA 4CBNA 1ZHMA 1BA8B 5GXPA 2J9NA 2PWXA 1AVGH 1T4VH 3ZZ6A 1G3DA 1SHYA 3V12A 1K1IA 1QL9A 2CJIA 4X2XA 5C5OA 1UVTH 1GBMA 3R0FA 3TJVA 3RM2H 1P2QA 2BTCE 2XBWA 1J9CH 1Y5AT 5C5NA 2ZQ1A 2WYJA 1C4Y2 1Y3WA 2ZWLH 2O8WA 1CT2E 3BIUH 2AGIX 1UVUH 1LQEA 4X2YA 1GJAB 1C5RA 2YOLA 3O8RA 1WTGH 4O97A 4WF8A 5FPTA 2XC4A 1F0TA 1C5UA 2RA3A 1O2NA 2ZU5A 2FDAA 3A89A 1EZQA 2BQWB 2FX6A 2V35A 2CV3A 3E3TA 4AORA 1QBOA 4CH2B 4WH6A 2FYRA 3GDSA 1XXDA 5L2ZH 1WXRA 1MQ5A 4A1XA 2R2WU 1BRUP 1GBAA 1SFIA 1TNLA 1DWBH 1SMFE 2FTMA 1SQAA 1TX7A 3MO6A 1CGIE 1JWTA 3PO1B 1P57B 3LJJA 1DT2A 2PGBB 3OTJE 3RU4T 4AYYB 2A2XH 3NCLA 4ABAA 4LZ1H 1BTUA 2D2DA 5DP7A 1N6XA 2B5TB 3S7HB 2ZGCA 2NU1E 4HGCA 1UTNA 1IQNA 1WQVH 2VWLA 1SI5H 2UUKB 1GL1A 1LHCH 1BOQA 1NRQH 5EXMA 1OWDA 4H42U 3BTFE 1IQIA 4K2YA 1C5OH 4ZXXH 1TRYA 1TA6A 1O2OA 1ZGIA 1DLKB 4FUCA 2TGDA 2BDIA 2FLBH 1C5SA 2ZFRH 3F9EA 1A5GH 1EZXC 2BXUH 2ZDNA 4YM9A 1SGEE 2ZGXH 1F0RA 1O3EA 2B7DH 2ZP0H 3GY5A 2F9VA 1WYKA 3RXDA 3PWCA 4ABDA 1QY6A 2Z9LA 3RXRA 3GDVA 3NZIA 2V6NA 2FWWA 2HNTE 3UOUA 1OWHA 1EAIA 4E7RG 1O3LA 1HNEE 3SHAH 1W14U 1GI4A 4YZUA 3LGUA 3U9AH 1GJ5H 1SB1H 1SLXB 4DJZB 5FX6A 3MH6A 3PROA 2QY0B 3SU5A 3ZZ5A 5I46H 1GMHG 1XUGA 3RLYH 2VU8E 2JH5D 1FIWA 1Q2WA 1NN6A 2P93A 2FI3E 4NCYA 2GP9B 5FBEA 3MH4A 5T6DA 2UUFB 1G3EA 4R0IA 4NA7A 1W7XH 1MKXH 3PYHA 1TA2A 1C1MA 3SV8A 4OM9A 1K1MA 1H4WA 1Z71A 1WU1A 1HAHH 2ZPQA 2V3HH 2NWNA 2A7HA 4X8TH 3H7OA 4BAMB 3A7ZA 1VITG 3BTKE 3GY4A 1SLWB 4CBOA 2GDDA 3M5NA 4NSYA 4DGJA 1MZAA 4NIVA 1E0FD 1FIZA 5GWZA 4DT7B 4INLA 1MU6B 2RG3A 3VB4A 1OXGA 3GCOA 2WUCA 4JYUH 4IGDA 1MTVA 4BAHB 4ISLA 4XBDA 1C4V2 2ZQ2A 1O2LA 5AVDA 2QXIA 1RJXB 5GIBA 4GLYA 3MU0A 1ANBA 4ZH8A 1HIAA 4X6OA 4OS2A 3ZVAA 1SGRE 1NFYA 1O32A 4AB8A 1IQGA 2F9OA 2VH6A 3U8TH 1T8NA 1A5HA 1FN8A 1HJ8A 4I8GA 3LGTA 5JBBS 1TX8A 3UTUH 4KTCA 2GVFA 1P2OA 2ZFFH 3A8AA 1DPOA 3ZZAA 1TNIA 3RC6A 3GCTG 4BAQB 4AG2A 1FY8E 1LVMA 2W26A 1MD7A 1BJVA 1P3CA 2GMTB 3NKKA 4WMEA 1Y59T 2G5NA 1DXPA 1ZGVA 2QF3A 2TGTA 4X6NA 1EZSC 1V2NT 3N7OA 3TPIZ 2QF0A 1Z1IA 1AQ7A 1HYLA 1HB0B 1W10U 3EDXB 1CGHA 1KSNA 1GI5A 1TPSA 3TGIE 2IOTA 1S82A 4K1EA 1ANCA 1D3PB 3ODFA 2WPHS 4FUJA 1O39A 1Q31A 5C1YA 3RXFA 4IBLH 1KXCA 1GBFA 1E35B 1KY9A 1OWKA 2H9EH 2OC8A 3RLWH 1Y3VA 1H1BA 1O3NA 1GVLA 4U2WA 2WPJS 1KLJH 2BY7X 1HJAC 4FUEA 2OBOA 3HKIB 7GCHG 2QAAA 3T29A 2OTVA 1C5XB 1VR1H 2A4OA 4JZIA 1K9OE 1PFXC 3QUMP 4BTIB 4BTTB 1WAYB 1CGJE 1GJ7B 3MU4A 4LXBH 1D3QB 1GCTB 1W3CA 1MH0A 4Q7YA 4AB9A 3TLOA 3W94A 4RI0A 2HVXA 1JIMA 3SU2A 5HMAA 3PMBB 1ZR0A 1BBRE 4DW2U 3FANA 5BPEA 1O2YA 2GZ8A 2G81E 2GT7A 4K60A 2UUJB 1WQSA 2BD8A 3BTDE 2OD3B 1NZQH 1P11E 2OINA 5EG4A 1UTMA 4NZQA 4NIXA 4B6FA 3KQCA 3GISB 4BXSA 3C27B 1IQEA 4FU7A 4CREA 1ZHRA 1UO6A 3DHKH 3M7TA 1O3JA 2AIPA 1C5WB 3U1JB 4FUIA 5E2OA 1C4U2 1TYNA 4K69A 3AK5A 1EJAA 4BXWA 1O3CA 1GMHF 2FI5E 4ESTE 3MI4A 1S84A 4KTSA 2XBVA 3NPSA 2G4TA 1NRSH 1C2GA 1O5AB 3QK1A 2DE8A 2IJD1 3IWMA 3E91A 1TWXB 3QTOH 3SNBA 1A0JA 1O5CB 3SO3A 2A7CA 3B23B 2D8WA 4X1PU 1MTNB 2ZDLA 3BTHE 3VGCC 1RTKA 2ESTE 3A85A 4A5TS 2W7SA 1X7AC 1N8OB 5L2YH 1M9UA 2VWMA 1C5ZB 1CO7E 4RKJB 2P3TB 3P6ZB 2BHGA 1FNIA 2KAIA 4Y79A 2BLQA 4INHA 1VITF 1OX1A 5JBAS 2QA9E 3QO6A 4NGAH 1NPMA 2ZU3A 1FMGA 2V3OH 4AFUA 6CHAB 2Z9GA 4Y11E 1WBGB 2AERH 1YKTA 5A0AE 2VNTA 1A46H 4XBBA 1GDUA 4JZFH 3LGVA 1EB1H 3A82A 4Y0ZE 3MTYA 3ZYDA 1UHBB 1O2QA 1AB9B 1ARBA 4ABBA 2IJOB 2BOHB 2EC9H 1RS0A 5B6LA 2A45B 2B8OH 1GBJA 1OP8A 4MTBA 3UIRA 2R3UA 3CENA 2WPKS 3G01A 2VJ1A 1O3AA 3PTNA 1TIOA 1A3EH 1TQ0B 3F1SB 1G36A 1SGFA 3NWUA 1BMMH 4IMQA 1EPTA 4LZ4B 1G37A 1CA8B 2PKSB 3QLPH 1BTHH 3KL6A 4GHQA 2ZPRA 3TH4H 1CE5A 1OS8A 2D26C 3S9BA 1O2VA 1ZPBA 4TWYA 3GCTF 2VIDA 1T8MA 3GYMA 2SGEE 1O2MA 3HK3B 2TIOA 4IMZA 3LIWA 2WPLS 5EQQA 2SFAA 5IYTA 1GL0E 3LGYA 4UFFH 1ZTJA 1IHTH 1RIWC 2Y5HA 4X8UH 1O35A 1QQ4A 1LPKB 4MNXA 3ZZ7A 3O8CA 2GT8A 1S0RA 2ZFTA 1EPTC 2ZPSA 5IDKA 4YOIA 3PLPA 5A0BA 4MPXA 4NG9H 5TCCA 3UNSA 5ABWA 1NROH 1FPCH 2UWPA 1W0ZU 2FS9A 2QXHA 1AWFH 1MAXA 2VVUA 7GCHF 2FIRH 1O5BB 1ETRH 2VIQA 1TBZH 1JXPA 3PV5A 5E2PA 2ANMH 1OWIA 2Y82A 3FAOA 3TJNA 2J4IA 1DSTA 3MWIU 2FESH 5EQSA 3SU4A 3SOSA 6ESTA 2BD7A 1T32A 1KTSB 2ZCKP 2NU3E 1BTPA 1V2RT 4WWYA 4SGBE 3TNSA 3ZV9A 1AY6H 1HAGE 2WHXA 4ASHA 1ORFA 2CF9H 2G51A 1AWHB 4NA8A 3P8OA 2Z3EA 2QCYA 4FU8A 1F2SE 1Z6JH 1LKAA 3BTME 3VB7A 4YT6H 2Z94A 3CP7A 1OP2A 2ZTXA 1IQLA 1CA0C 1O3FA 2RA0A 4CRBA 2BVSH 4UE7H 4CRDA 3P17H 2BX4A 2TGPZ 1HUTH 3HATH 1WV7H 4LK4A 4CR9A 3SGQE 3LONA 4X6PA 1L4ZA 2AMQA 3BG4B 1EP5A 3ZVBA 1ELAA 3ZVGA 3A8DA 2AFQB 3BSQA 4OS6A 1V2QT 3SUGA 4A7IB 1O2GH 4ZMAH 3EGKH 1C5VA 4ABIA 5F8ZA 2BLWA 4IC5A 4K5ZA 1G30B 3QGJA 3GOVB 3MO9A 4GAWA 1TNKA 4Y76A 1KDQA 5FAHA 3MO3A 1S6HA 3OY5U 3A83A 2Y7ZA 3PWBA 3RUOA 1HGTH 3QTVH 4MPUA 1BRAA 3NK8A 4AZ2B 3MU8A 1AFEH 3ZVFA 1NFXA 2ZC9H 2VGCC 2SGPE 1QTFA 2AMPA 1GGDC 2EI6A 6GCHG 1ZSKA 2WPIS 1XKAC 2R3YA 3T5FH 2C93B 1C2JA 1ESAA 4NIWA 2R0KA 1DICA 3UQOA 3PLBA 1FY3A 3LC3A 1SGIB 2RCEA 3M3VA 2ZA5A 5EXLA 1RGQA 1BBRH 2A0QB 4XSKU 4I8HA 2Y6TA 1FY1A 1LMWB 4A1VA 4FUGA 1KTTB 2Z6BD 2FM2A 3RXTA 1LHFH 1EAWA 1O3BA 1MD8A 4XOJA 1DFPA 1RD3B 5J4QA 1EXFA 2GX4A 1C1NA 1QA0A 2R9PA 3SJOA 4IN1A 1GDNA 2H1UA 1K2I1 2BXTH 1MU8B 1WSSH 4X8SH 1LPGB 1LQDB 1O2HA 1TABE 2BZ6H 4D9RA 5I25A 1Z6EA 1Q3XA 4ZAEA 3ZZ9A 2BB4A 1ELGA 2G5VA 1TFXA 2NU0E 2Y5GA 3UUZA 1GDQA 2ZF0H 3SJKA 4NWLA 8KME2 4Z0KA 4AFZA 3PV4A 4K8BA 4UEHH 3TVJB 2PKAB 3M37A 4JZ1A 2CMYA 4FUFA 3MFJA 4DIHH 3T26A 4WMDA 2Z9KA 1WTHD 3EE0B 1EOJA 3EAJA 1DXWA 4XDEA 3OYPA 1MKWH 2P94A 1YPLH 4ABEA 1Z8GA 4YTAA 1QJ7B 1L1JA 1GMCG 5TJXA 3SV2H 1F5KU 1O0DH 5DO4H 1VZQH 1PQAA 5GJ4B 1ELDE 4NA9H 2HLCA 1MAYA 4X0WU 3LGWA 2ZO3H 4X2WA 1YCPK 2W3KA 1MUEB 3GY3A 2BZAA 1FAXA 3KQDA 1S0QA 1MTSA 4FUHA 1BMAA 4DVAU 3UOPA 1K21H 1V2LT 2EI7A 3KGPA 4Y71A 4TY6A 1O2TA 3TJUA 1W7GH 3SNEA 3ITIA 1QBVH 3MH7A 2EA3A 4Q7XA 4ABJA 1SPJA 2ZU4A 3DA9B 1PPBH 3WY8A 2CHAB 2Y81A 1O2JA 1NRRH 2GZ7A 1MKXK 3MMGA 3M7UA 2EEKA 2XC0A 1CT4E 4JCNA 2GV6A 3KQBA 2OLGA 1UTJA 3LC5A 2H5CA 2ZI2H 1FXYA 1L2EA 4K8YA 2SNWA 3K6YA 1QL8A 3JZ2B 1C1TA 4JK5A 4IW4E 3F9GA 1ZSJA 2QC2A 4MNVA 1HRTH 1GJ6A 1GVKB 3UFAA 4ABGA 3ZVDA 4Q2KA 1IQJA 2RDLA 2D1JA 1OSSA 2Q6FA 1QGFA 1YCPM 3BEFB 3PLKA 3Q3XA 1W12U 2ZGJA 2VIPA 1T31A 3M3SA 1ABJH 1D9IA 3A81A 3UWIA 1OP0A 1TMBH 1A4WH 1QNJA 1FI8A 5EPNA 3SQEE 2FX4A 1HV7A 4U30A 1ZPCA 2ASUB 3RMOH 4WJG2 1Z7KA 2QYIA 1FQ3A 3E1XB 1U6QA 3O8BA 5CHAB 5J4SA 2QGRA 6GCHF 3SJ8A 1A0HB 5HGGA 1GI9B 2ZHFH 1JRSA 1S81A 2GCTC 1C2FA 1FY4A 5HM9A 2TRMA 3MHWU 1PPEE 3FP7E 4YO9A 1F7ZA 1GI1A 1TRNA 3SV7A 1P05A 2JETC 1QRXA 3GY7A 2C3SA 4CRCA 3RXQA 4MPVA 1AUJA 2CN0H 1TALA 2GD4B 2JH0D 4FUBA 4ISNA 3IG6B 4HZHA 1GJ9B 5C20A 1IQFA 1VCWA 5DJ7A 1BRCE 1S83A 1O5DH 4MNWA 3UNQA 3PM3A 2B9LA 3GY8A 1ZMJA 1XMNB 1W8BH 1YPKH 3LJOA 1SG8B 1YBWA 2PTNA 1SQTA 3S0NA 2P95A 2G4UA 1L0ZA 5JPMH 4I8LA 2UWOA 1ANEA 1C2HA 1GPZA 4Y0YE 3BG8A 4BAKB 1ETSH 4H6SB 5AFYH 3PMHB 2BLVA 1KIGH 4X8VH 1VITH 1NRPH 3ENSB 1GHYH 1FONA 2ZKSA 3A8CA 2FOBA 5FBIA 2BDHA 1YP9A 1EASA 1GBTA 4ZROA 4YOGA 1GCDA 1AE8H 1SGYE 1AO5A 2A5AA 3E6PH 4TYDA 1AU8A 1TPAE 2Z9IA 3KQEA 4KGAA 4OS1A 8LPRA 2BOKA 3RXPA 1V6DA 1C5TA 4YESB 2WYGA 3L3TA 3QGNB 1P10A 2J94A 2XBXA 1XVMA 2ZGHA 1F5RA 1MCVA 2Z3CA 3T2NA 1GMCF 4I8JA 2ALVA 3BN9A 3GCHB 2PGQB 2A4GA 2FEQH 1CBWC 3VFEA 1QJ6B 2VB0A 4ZXYH 3FZDA 1CU1A 3RMLH 3FP8E 1XX9A 1DY8A 1TRMA 2A2QH 1DUAA 2OUAA 5C3NA 2ZDKA 4ISIH 1AZ8A 1O2RA 2GMTC 4FVDA 1XUIA 2BD3A 2OC1A 2ZCHP 2WV4A 5L6NH 1Y5BT 1HXFH 2W5EA 1H9HE 2SGQE 4B2BA 2STBE 3LH1A 3S9CA 5GCHG 3SI3H 1C2IA 1EQ9A 1PYTC 2OP9A 1SGTA 3K65B 3RXHA 3MH5A 5DP9A 1IQKA 3TNTA 3BTGE 3H5CB 4MQAA 1C1QA 1UCYH 1FUJA 1K28D 1O38A 1O5GH 3GDUA 4CH8B 4MPWA 3AAUA 1V3XA 1WUNH 2AEIH 3PMJA 4TPIZ 3S69A 1ACBE 1QB1A 2P3UB 5AHGH 3MNXA 1DE7H 1EUFA 3STIA 1GWAA 3UWJH 1SLVB 2R2MB 1O2KA 1BZXE 3RDZA 2ILNA 4VGCB 1GHBG 1FJSA 1NM6A 4B74A 1P09A 4X6MA 4D8NA 4Y7BA 3TGKE 3M5LA 3LDXH 1O3DA 3DUXH 1HJAB 2G55A 3GICB 3ZV8A 2ZZUH 4AFSA 1VCQA 2VH0A 1EZUC 2O8LA 3A7WA 4GHTA 1A3BH 1CHOG 2BM2A 2VVVA 1SVPA 1A1RA 4X2VA 5FHTA 3AASA 3ATKA 2BD5A 2HNTC 4IN2A 1V2WT 2ZDMA 1MBQA 2LNCA 5EW2H 3BIVH 2P3FH 3BTWE 4AN7A 3FFGA 1SGCA 1P2IA 1D4PB 3F6UH 3I77A 5JBCS 1V2PT 2ZG0H 3A7VA 3A88A 2ZDVH 3EQ0H 3F9FA 3OSYA 1VCPA 2YNAA 1HAXB 1TBQH 1YPHE 2BQ7B 2H9HA 3V3MA 3SU3A 1QHRB 2ZHWH 5EGMA 3ZZ8A 1P9SA 7ESTE 1NT1A 1HPGA 8GCHG 1ELCA 3UY9A 4FU9A 1N8OC 1PJPA 4J1YA 5F8TA 4QT8C 2BVXH 1HAZB 1ZYOA 4DURA 2ZIQH 2ANWA 2BYAX 1WCZA 4ISOA 5EQRA 3EYDA 4MVNA 5EU8A 2PFEA 1FDPA 6CHAC 4B75A 2ZFPH 2BDYA 3O8DA 4UFDH 1ZMLA 1AIXH 1O3GA 2ZEBA 4J2YB 2H2ZA 1V2TT 4Z6AH 3LGIA 4JZEH 1ELEE 3OTPA 1CT0E 4PROA 1G3BA 1B7XB 1QRZA 1HAOH 2XXLA 3ZZ4A 3TGJE 1HAVA 4O3UA 1AKSA 3EA9A 3A84A 3EA7A 2P8OC 3SV9A 2K1QA 4BANB 4BTUB 2PKSC 3KHVA 4CR5A 1SL3A 3RXBA 3P8NA 4AOQA 5JB8S 1ARCA 3T27A 2VWNA 1L1GA 2IN2A 2M5TA 4SGAE 4ABFA 2PSYA 2G00A 3JZ1B 1C5QA 2ODQA 3E0PB 1DSUA 3ATLA 1TGCA 5GPIB 1J15A 3OU0A 3D62A 1VGCC 2BDGA 5EXNA 1LDTT 1THPB 1EOLA 2CF8H 3F9HA 3TH2H 1AVWA 1JIRA 1N6YA 4CRGA 4YT7H 2VBCA 2F4LA 5GCHF 3ZZDA 4JMYA 4HI3A 3SGBE 3BF6H 3ATWA 1K1PA 4CHAB 3AW1A 1NRNH 2BVRH 1G3CA 1FY5A 2CGAA 4I8KA 4JZDH 3BEIB 1ID5H 4Y8ZA 5LPFA 2ZU2A 3SQHE 4CRAA 1QCPA 1GI3A 3RMNH 5A8ZA 2GCHG 5C1UA 3T28A 1G32B 5GNDA 3QN7A 1RIWB 1K1NA 4A92A 1YYY1 2WUBA 2VINA 4NIYA 3SU0A 1BQYA 2F9UA 1EJMA 5T1VA 3R3GB 1EPTB 2F83A 3K9XB 5BRRE 1ZOMA 2FXRA 1SLUB 1SOZA 2THFB 2VIVA 3Q3YA 1BBRK 5A8YA 1GHBF 2XCFA 2O9QA 3LOXA 3CS7A 3E0NB 1PPZA 5DP5A 1P06A 1P9UA 4O9VA 1DDJA 2A32A 1O34A 5F03A 4NZLA 5DP4A 1H8DH 1IQMA 1C5PA 1SGNE 1XUKA 1CHOF 2BMGB 5E0JA 2BQ6B 4ISHH 1EATA 1JOUB 4UONA 3TU7H 3BTTE 2XRCA 1O2XA 1TGTA 4D7FA 1H9LB 3CS0A 2ANKH 2A4QA 1GHWH 1GHVH 1TNGA 3B9FH 2GTBA 3QZQA 3KEEA
chains in the Genus database with same CATH superfamily
4B2CA 4K3JA 5EJZA 5DP6A 3T62A 1T8OA 5CMXH 4TPYA 4XBCA 2FMJA 3Q00A 1C5LH 1W0YH 3DCLA 1BHXF 1ABIH 3V7TA 7KMEH 4B6EA 8GCHF 1BCUH 1ZSLA 4Q7ZA 5DK1A 1O2IA 1UTLM 1O36A 1B5GH 3SNCA 3QZRA 1ESBA 2V0BA 3M35A 4MG3A 1O33A 1C5YB 1XXFA 1GI2A 1GVZA 4KTUA 5FCRA 1SGFG 1AHTH 2FOGA 2Y5FA 3OY6U 5C0TA 4K1TA 4RSPA 3W95A 1ZJDA 5DGJA 2Y7XA 5H4IB 1KLIH 1PPHE 2AYWA 3D49H 2WSSD 4ZKRU 4D9QA 5PTPA 4FVBA 1O2WA 4B71A 1CVWH 2FOAA 1AFQC 1HBTH 5T3HA 1LO6A 1C9PA 1ZHPA 1Z8RA 3NUMA 2JDID 1UTKA 1QQUA 2WINI 1DOJA 1C1VH 3RXAA 1KMHB 1BITA 2ZGBH 2WV5A 1LCYA 1FZZA 4E05H 1UCYE 1NFUA 1NTPA 2BDCA 2G8TA 1C1OA 4E06H 4A1TA 3VEQB 1TPOA 1QL7A 2W3IA 2J92A 1PQ7A 1QIXB 2G52A 2HRVA 1UJ1A 3ODDA 3VB6A 1OWEA 1KDQB 1OKXA 3CNRA 1NU9A 1PPCE 3HPTB 1GG6B 2BDBA 4Q63A 4ZCNA 1VJ9U 4F48B 2SGAA 2GDEH 4GVUA 1QFKH 1HDTH 3E8LA 1O37A 2F3CE 2UWLA 4CRFA 1KXAA 3SZEA 1P3EA 2HNTF 3SJ9A 1Y3XA 2TGAA 2OQUA 4OS7A 3TK5A 1ZZZA 5A2MH 1O31A 1TBRH 1K1LA 5A8XA 2FO9A 1GBDA 2O8MA 1RTFB 5AFZH 9LPRA 1S5SA 4X1SU 2Q1JA 1FV9A 3TH3H 1C1WH 2TPIZ 4BNRA 1YLCA 3QWCH 2GCHF 1BTZA 1AMHA 3SYJA 1D3TB 1OWJA 1YGCH 5T6GA 2BX3A 1T7CA 1NS3A 1W13U 3LPRA 2NU4E 1LTOA 2P16A 1AN1E 2O8UA 4UD9H 2PR3A 4GUXA 2EI8A 1QR3E 4U01A 1C1UH 1ESTA 4DIIH 3BV9B 3SUEA 2CHAC 1LHDH 2V7QD 2PUQH 3U69H 1Y5UT 1CHGA 1GBKA 2A5KA 1UTOA 3RP2A 5JBTA 4HTCH 1E37B 1GI6A 1P02A 2HPPH 3PO1C 3RM0H 1GJBB 3U98H 1SOTA 3OX7U 1TGBA 1BB0B 1KXDA 3MOCA 4Y8YA 4B1TA 3P8GA 1A7SA 1PPFE 2PUXB 1O3HA 4TWWA 1ZRBA 3PV2A 2HALA 2Z3DA 1E36B 4I32A 1QB9A 4O03A 2QV1A 3M5MA 5LH8A 3M61U 3K2UA 1LPZB 5CE1A 1O2ZA 1Z8JB 2FOEA 2VIWA 3SZNA 3VPKA 1EAXA 3HGNA 3HGPA 1HLTH 3RMMH 4ZKOU 2SGDE 2ZHEH 1FAKH 2K0QA 1DM4B 1LVBA 2XTTB 3ZZ3A 1ELTA 2VWOA 2FZZA 2XW9A 4WY3A 5FX5A 1LVOA 5KEDA 4WXVA 3MNSA 1AGJA 3I78A 1XUHA 5CHAC 1GBCA 1TOCB 4WMFA 2KFWA 3OAAD 3E90B 1VJAU 3Q76A 3RXGA 1C2MA 5F53A 4INKA 2AS9A 1O3MA 5A09A 3RU4D 2FPZA 4ZHAA 2A31A 2I6QA 1E38B 2FP7B 3SORA 1DWCH 2QXJA 1XM1A 3A8BA 4DG4A 3SU6A 1J8AA 2HWLB 1GJDB 5T6FA 4AG1A 1SHHB 4MNYA 4B76A 2BY8X 1G2LA 5HIYA 3E16B 1DY9A 5G4BA 1F5LA 1GJ4H 1UCYK 5LGOA 1YCPH 3RXSA 2PHBA 3SBKA 1K1JA 1W0JD 2BD2A 2GCTB 4FXGH 1ZJKA 1O3IA 1AE5A 1V2KT 3GY6A 1C9TA 1ELVA 3KNXA 5JB9S 4AC9A 3M3TA 2JETB 2SGFE 3U8RH 2ZHDA 3ATIA 1SSXA 2XNIA 4OGYA 4DCDA 2BY6X 1DS2E 1EB2A 1XVOA 1YPJH 5TCAA 3I29A 2ZFQH 5E8EH 4I7YH 1HXEH 1A61H 3BTQE 3DFJA 1IOEA 4Q80A 4UFGH 3SJIA 5K7RA 1AZZA 1F0UA 1UVOA 2ZTYA 2B0FA 1J17T 3SUFA 1LKBA 1BTXA 2FOMB 1DX5M 1IAUA 3F68H 3L33A 2A1DB 1P8VC 3SN8A 2PV9B 3GCHC 3KF2A 1JRTA 1F92A 3A7YA 1L1NA 4NFFA 5FCKA 4O3TA 3SI4H 1SQOA 1AUTC 5LPRA 2F9NA 2ULLA 4OS5A 1C2EA 1NY22 3VXEH 5DP3A 3WWBA 1SGPE 1V2JT 3QX5H 3A80A 4MLFB 1EX3A 3D23A 2AGEX 5DP8A 3L6PA 1HFDA 2IPHA 3MU1A 4M7GA 3SV6A 1D6WA 4XFQA 1TAWA 2KCPA 5EW1H 1QJ1B 2JH6D 5A0CA 2YNBA 2VIOA 1MCTA 1GI8B 1HJ9A 1SC8U 2OQ5A 2QN5T 5HM2A 2BD4A 1CBWB 3RXCA 1T8LA 3H09A 4AFQA 1C2LA 3QDZB 4X1QU 5CHBA 3RU4E 3SHCH 5HYOA 3ZVCA 3H7TA 1BHXB 3RC5A 3TITA 4GCHG 2OK5A 4I33A 1LHEH 2OC7A 4U32A 1QA7A 3A7XA 2Z7FE 3LKWA 1JBUH 2ZU1A 1E79D 4E7NA 1BDAA 3PTBA 1NESE 1HIAB 1YLDA 2CK3D 2AIQA 1NBME 1O3KA 1HCGA 3VB3A 4I31A 1GCTC 1P0SH 2BY9X 1UK3A 2GZ9A 1BTWA 1UTQA 1OPHB 4D76A 4M9FA 5SGAE 2C8WB 1KXBA 1P01A 1SR5C 4VGCC 2HPQH 1V2UT 3SW2B 5F6MA 2WZQA 1Y3YA 3UR9A 1TGSZ 1BMNH 1V2ST 4OGXA 2FLRH 3VB5A 4JYVH 1O30A 1EKBB 1W2KH 2AGGX 1GHZA 3TK6A 1GMDG 2JJ1D 3P70B 1ZLRA 3GCNA 3HK6B 1KYNA 4MDSA 1LHGH 2J97A 2H9TH 3ESTA 1J16A 1NU7B 2AHME 5ETXA 1WOFA 3URCA 1TLDA 1P03A 2QXGA 7LPRA 1BRBE 3ZYEA 1THRH 2I6SA 3BTEE 3C1KA 3P92A 1ZPZA 4KELA 3DD2H 5C1XA 1ELBA 5HXFA 4DOQA 1O2UA 4Y8XA 1DWDH 1NO9H 1YC0A 1P04A 2PTCE 2RDEA 1D3DB 2J95A 3RXOA 1UMAH 5K0HA 1LVYA 4X1NU 1YPMH 2BY5X 4YOJA 1BUIA 1OYQA 1YPGH 1UHBA 2OBQA 2H6MA 4LOYH 4WXIA 1MTNC 4X1RU 3SUDA 1C1SA 3FP6E 1SGQE 4XE4A 3RXUA 3MU5A 5B6OA 1GJ8B 1B0EA 1GHXH 1YF4A 1HAPH 3AVZA 2H5DA 4OS4A 1Y8TA 1DITH 3DT0H 1ANDA 1C5NH 5E0GA 2Q6GA 4ABHA 5JYIA 1W0KD 1PQ5A 4K1SA 1AVXA 5EPYA 2FOHA 3UPEA 1XKBC 2DUCA 1Z1JA 1UVPA 1FN6A 2ZCLP 2FI4E 4HFPB 3VGCB 1TNHA 1EJNA 1V2VT 1AB9C 3S9AA 3A7TA 2F91A 3PB1E 2FOCA 1QURH 1KLTA 1ZTKA 3TIUA 3Q3KA 2JKHA 2ODPA 3SGAE 1V2OT 4TT3D 1K1OA 3IITA 5ESBA 1E34B 2A4RA 2Y80A 2JJ2D 1TE0A 1RFNA 2XOKD 3ATMA 1BT7A 5DPAA 3KYGA 2AMDA 2XCNA 1RRKA 1EFRD 3D65E 1GHAG 4UDWH 1XUJA 2ZECA 3A87A 1BTYA 2XC5A 4AYVB 1GBBA 1ZTLA 3V0XA 4H6TA 3AW0A 2ZDAH 3RXIA 3GY2A 1G9IE 4GSOA 1KXFA 2AH4X 1O3OA 3SNAA 1JMOH 1THSH 2FYQA 2PSXA 1K22H 4ZUHA 2J38A 1K0HA 2KAIB 2P8OB 5FPYA 3RXEA 4CHAC 3LU9B 1O2PA 3K6ZA 3M36A 4NSVA 4IC6A 3KIDU 1UK2A 1DUEA 3AAVA 3FZZA 5CDFE 1QRWA 2F9BH 4R8TB 1C5MD 2XYAA 5ESTE 5EOKA 2ZTZA 4GCHF 1UVSH 1A2CH 1ZRKA 5F8XA 4TY7A 1SFQB 1Z8IB 2C8ZB 1Y3UA 1FPHH 1XUFA 1VGCB 3SNDA 1P2KA 1QBNA 1SBWA 1TQ7B 1S6FA 2C90B 1A5IA 2OCVB 2WV9A 1PPGE 3RXKA 3LT3A 8ESTE 2R0LA 1HAVB 1AKSB 4THNH 2ANYA 4ZHMU 2STAE 5EODA 1YM0A 4AGJA 5DN6D 2PW8H 1B0FA 1F0SA 2XBYA 4Y7AA 2C8XB 1J14A 3TJOA 2ALPA 3FVFB 2KX4A 3ELAH 1TB6H 1QB6A 3RXMA 4F4OC 2ZNKH 1O5EH 5FXLA 1BJUA 3ZZCA 3KQ5A 3VXFH 1TONA 1AI8H 1TGNA 1V2MT 2CXVA 1YPEH 1W11U 1BIOA 1MMJN 3KCGH 4ZHLU 1P2NA 3HKJB 1TMUH 3MNCA 3UR6A 5E0HA 2PLXA 4KKDA 1ETTH 1OYTH 3SU1A 1GJCB 1GMDF 1N1LA 2YMSC 2XWBI 2A7JA 1PQ8A 3UREA 4UFEH 1C1PA 3ZZBA 3U1IB 5GDSH 3OEHD 3ZVEA 1TPPA 1TMTH 1KXEA 1UK4A 1RTLA 1TX6A 2A5IA 3TK9A 3BG4C 3KN2A 3N7DA 1RXPA 2HGTH 2UUYA 4XD7D 4BAOB 4FUDA 3RXLA 4F49A 3Q77A 3UQVA 1NC6A 3DFLA 3MNBA 9ESTA 3A86A 1H9IE 2WPMS 2OXSA 4XRNA 4RN6A 1HAIH 3U8OH 5AF9H 1FLEE 2W7UA 1EP6A 2HOBA 4NFEA 4AGKA 1CA0B 1MQ6A 1P2JA 1YPHC 5C67A 4GPGA 2QIQA 1MTWA 3PMAB 2SNVA 2C4FH 4YLQH 4KP0A 1MKWK 1BMLA 2OC0A 4ZKSU 2Q6DA 1O3PB 4BOHA 2O8TA 3T25A 1T4UH 2BDAA 3STJA 4A6LA 5FPSA 1AD8H 3P8FA 4JYTA 3EA8A 3GYLB 1OOKB 4AX9H 5DG6A 1GBHA 1MZDA 2GKVE 2TBSA 1ELFA 2J98B 3MQKC 3M5OA 1S85A 2J34A 1DWEH 1P2MA 2FODA 3RXJA 2J2UA 1TNJA 5LPEA 2C8YB 2ZHQH 1GBEA 2ODYB 4Y10E 1C1RA 1UTPA 4WVPE 6LPRA 2FTLE 1QZ8A 1GBLA 4P00A 1ZMNA 1D6RA 1DLEA 1MBMA 1S6LA 5JDUB 1TOMH 3BEUA 1PYTD 1CSOE 3UNRA 3B8JA 4JK6A 4P02A 2PKAA 2VVCA 3RXVA 5L30H 3NXPA 2XWAA 2VGCB 1GBIA 4D7GA 1C2KA 1CQQA 4H4FA 1GGDB 1P12E 1O5FH 5DKMA 3P95A 1C2DA 4RKOB 1GHAF 1DANH 1IHSH 3S7KB 1GI7B 3MYWA 1NFWA 1L4DA 3URDA 2PP6A 3V13A 3LH3A 1AFQB 2FOFA 4WH8A 1G2MA 1GG6C 1DVAH 2GV7A 4ZKNU 2NU2E 4Y6DA 1SGDE 1HAYB 4B2AA 2DE9A 2BD9A 4B73A 2FS8A 2BLOA 1INCA 1O2SA 1A0LA 2F9PA 4NWKA 4DY7B 1IQHA 1EAUA 4IS5A 1H8IH 2GGVB 4YLUA 2EY4C 2LPRA 1GI0A 2P59A 1MTUA 3RC4A 2ZFSA 2Z9JA 3M7QA 5C2ZA 4CBNA 1ZHMA 1BA8B 5GXPA 2J9NA 2PWXA 1AVGH 2KZ4A 1T4VH 3ZZ6A 1G3DA 1SHYA 3V12A 2W6ID 1K1IA 1QL9A 2CJIA 4X2XA 5C5OA 1UVTH 1GBMA 3R0FA 3TJVA 3RM2H 1P2QA 2BTCE 2XBWA 1J9CH 1Y5AT 5C5NA 2ZQ1A 2WYJA 3FN8A 5EJLA 1C4Y2 1COWD 1Y3WA 2ZWLH 2O8WA 1CT2E 3BIUH 2AGIX 1UVUH 4Z1MD 1LQEA 4X2YA 1GJAB 1C5RA 2KCAA 2YOLA 3O8RA 1WTGH 4O97A 2LELA 4WF8A 5FPTA 2XC4A 1F0TA 1C5UA 2RA3A 1O2NA 3F2FA 2ZU5A 2FDAA 3A89A 1EZQA 1H8HD 2BQWB 2FX6A 2V35A 2L74A 2CV3A 3E3TA 4AORA 1QBOA 4CH2B 4WH6A 2FYRA 3GDSA 1XXDA 5L2ZH 1WXRA 1MQ5A 4A1XA 2R2WU 1BRUP 1GBAA 1SFIA 1TNLA 1DWBH 5HKKD 5EIYA 1SMFE 2FTMA 1SQAA 1TX7A 3MO6A 1CGIE 1JWTA 3PO1B 4RT1A 1P57B 3LJJA 1DT2A 2PGBB 3OTJE 3RU4T 4AYYB 2A2XH 3NCLA 4ABAA 4LZ1H 1BTUA 2D2DA 5DP7A 1N6XA 2B5TB 3S7HB 2ZGCA 2NU1E 3UAIC 4HGCA 1UTNA 1IQNA 1WQVH 2VWLA 1SI5H 2UUKB 1GL1A 1LHCH 1BOQA 1NRQH 5EXMA 1OWDA 2KCOA 4H42U 3BTFE 1IQIA 4K2YA 1C5OH 4ZXXH 1TRYA 2HVYB 1TA6A 1O2OA 1ZGIA 1DLKB 4FUCA 2TGDA 2BDIA 2FLBH 1C5SA 2ZFRH 3F9EA 1A5GH 1EZXC 2BXUH 2ZDNA 4YM9A 1SGEE 2ZGXH 1F0RA 1O3EA 2B7DH 3GS9A 2ZP0H 3GY5A 2F9VA 1WYKA 3U28C 3RXDA 3PWCA 4ABDA 1QY6A 2Z9LA 3RXRA 3GDVA 3NZIA 2V6NA 2FWWA 2HNTE 3UOUA 1OWHA 1EAIA 4E7RG 1O3LA 1HNEE 3SHAH 1W14U 1GI4A 4YZUA 3LGUA 3FO8D 3U9AH 1GJ5H 1SB1H 1SLXB 4DJZB 5FX6A 3MH6A 3PROA 2QY0B 3SU5A 3ZZ5A 5I46H 1GMHG 1XUGA 3RLYH 2VU8E 2JH5D 1FIWA 1Q2WA 1NN6A 2P93A 2FI3E 4NCYA 2GP9B 5FBEA 3MH4A 5T6DA 2UUFB 1G3EA 4R0IA 4NA7A 1W7XH 1MKXH 3PYHA 1TA2A 1C1MA 3SV8A 4OM9A 1K1MA 1H4WA 1Z71A 1WU1A 5IK2D 1HAHH 2ZPQA 2V3HH 2NWNA 2A7HA 4X8TH 3H7OA 4BAMB 3A7ZA 2V3MA 1VITG 3BTKE 3GY4A 2KR7A 1SLWB 4CBOA 2GDDA 3M5NA 4NSYA 4DGJA 1MZAA 4NIVA 1E0FD 1FIZA 5GWZA 4DT7B 3EE7A 4INLA 1MU6B 2RG3A 2RFKC 3VB4A 1OXGA 3GCOA 2WUCA 4JYUH 4IGDA 1MTVA 4BAHB 4ISLA 4XBDA 1C4V2 2ZQ2A 1O2LA 5AVDA 2QXIA 1RJXB 5GIBA 4GLYA 3MU0A 1ANBA 4ZH8A 1HIAA 4X6OA 4OS2A 3ZVAA 1SGRE 1NFYA 1O32A 4AB8A 1IQGA 2F9OA 2VH6A 3U8TH 1T8NA 1A5HA 1FN8A 1HJ8A 4I8GA 3LGTA 5JBBS 4YXWD 1TX8A 3UTUH 4KTCA 2GVFA 1P2OA 2ZFFH 3A8AA 1DPOA 3VG8A 3ZZAA 1TNIA 3RC6A 3GCTG 4BAQB 4AG2A 1FY8E 1LVMA 2W26A 1MD7A 1BJVA 1P3CA 2GMTB 3NKKA 4WMEA 2KCYA 3PRDA 1Y59T 2G5NA 1DXPA 1ZGVA 2QF3A 2TGTA 4X6NA 1EZSC 1V2NT 3N7OA 3TPIZ 2QF0A 1Z1IA 1AQ7A 1HYLA 1HB0B 1W10U 3EDXB 1CGHA 1KSNA 1GI5A 1TPSA 3TGIE 2IOTA 1S82A 4K1EA 1ANCA 1D3PB 3ODFA 2WPHS 4FUJA 1O39A 1Q31A 5C1YA 3RXFA 4IBLH 1KXCA 1GBFA 1E35B 1KY9A 1OWKA 2H9EH 2OC8A 3RLWH 1Y3VA 1H1BA 1O3NA 1GVLA 4U2WA 2WPJS 1KLJH 1MABB 2BY7X 1HJAC 4FUEA 2OBOA 3HKIB 4RT0A 7GCHG 2QAAA 3T29A 2OTVA 1C5XB 1VR1H 2A4OA 4JZIA 1K9OE 1PFXC 3QUMP 4BTIB 4BTTB 1WAYB 1CGJE 1GJ7B 3MU4A 4LXBH 1D3QB 1GCTB 1W3CA 1MH0A 4Q7YA 4AB9A 3TLOA 4RI0A 3W94A 2HVXA 1JIMA 3SU2A 5HMAA 3F2GA 3PMBB 1ZR0A 1BBRE 4DW2U 3FANA 5BPEA 1O2YA 2GZ8A 2G81E 2GT7A 4K60A 2UUJB 1WQSA 2BD8A 3BTDE 2OD3B 1NZQH 1P11E 2OINA 5EG4A 1UTMA 2QF4A 4NZQA 4NIXA 4B6FA 3KQCA 3GISB 4BXSA 3C27B 1IQEA 4FU7A 4CREA 1ZHRA 1UO6A 3DHKH 2WPDD 3M7TA 1O3JA 2AIPA 1C5WB 3U1JB 4FUIA 5E2OA 1C4U2 1TYNA 4K69A 3AK5A 1EJAA 5DSFA 4BXWA 1O3CA 1GMHF 2FI5E 4ESTE 3MI4A 1S84A 4KTSA 2XBVA 3NPSA 2G4TA 1NRSH 1C2GA 1O5AB 3QK1A 2DE8A 2IJD1 3IWMA 3E91A 1TWXB 3QTOH 3SNBA 1A0JA 1O5CB 3PRBA 3SO3A 2A7CA 3B23B 2D8WA 4X1PU 1MTNB 2ZDLA 3BTHE 3VGCC 1RTKA 2ESTE 2L6OA 3A85A 4A5TS 2W7SA 1X7AC 1N8OB 5L2YH 2JIZD 1M9UA 2VWMA 1C5ZB 1CO7E 1UW7A 2P3TB 3P6ZB 2BHGA 1FNIA 2KAIA 4RKJB 2BLQA 4INHA 4Y79A 3UB0A 1VITF 1OX1A 5JBAS 2QA9E 3QO6A 4NGAH 1NPMA 2ZU3A 1FMGA 2V3OH 4AFUA 6CHAB 2Z9GA 4Y11E 1WBGB 2AERH 1YKTA 5A0AE 1BMFD 2VNTA 1A46H 4XBBA 1GDUA 4JZFH 3LGVA 1EB1H 3A82A 4Y0ZE 3MTYA 3ZYDA 1UHBB 1O2QA 1AB9B 1ARBA 4ABBA 2IJOB 3ZIAD 2BOHB 2EC9H 1RS0A 5B6LA 2A45B 2B8OH 1GBJA 1OP8A 4MTBA 3UIRA 2R3UA 2W6JD 2WPKS 3CENA 3G01A 3NRLA 2VJ1A 1O3AA 3PTNA 1TIOA 1A3EH 1TQ0B 3F1SB 1G36A 1SGFA 3NWUA 1BMMH 4IMQA 1EPTA 4LZ4B 1G37A 1CA8B 2PKSB 4F55A 3QLPH 1BTHH 3KL6A 4GHQA 2ZPRA 3TH4H 1CE5A 1OS8A 2D26C 3S9BA 1O2VA 1ZPBA 4TWYA 3GCTF 2VIDA 1T8MA 3GYMA 1FX0B 2SGEE 1O2MA 3HK3B 2TIOA 4IMZA 3LIWA 2WPLS 5EQQA 2SFAA 5IYTA 1GL0E 3LGYA 4UFFH 1ZTJA 1IHTH 1RIWC 2Y5HA 4X8UH 1O35A 2K8IA 1QQ4A 1LPKB 4MNXA 3ZZ7A 3O8CA 2GT8A 1S0RA 2ZFTA 1EPTC 2ZPSA 5IDKA 4ACBA 4YOIA 3PLPA 5A0BA 4MPXA 4NG9H 5TCCA 3UNSA 5ABWA 1NROH 1FPCH 2UWPA 1W0ZU 2FS9A 2QXHA 1AWFH 1MAXA 2VVUA 7GCHF 2FIRH 1O5BB 1ETRH 2VIQA 1TBZH 1JXPA 3PV5A 2LP6A 2ANMH 5E2PA 1OWIA 2Y82A 3FAOA 3TJNA 2J4IA 1DSTA 3MWIU 2FESH 5EQSA 3SU4A 3SOSA 6ESTA 2BD7A 1T32A 1KTSB 2ZCKP 2NU3E 1BTPA 1V2RT 4WWYA 4SGBE 3TNSA 3ZV9A 3FKSD 1AY6H 1HAGE 2WHXA 4ASHA 1ORFA 2CF9H 2G51A 1AWHB 4NA8A 3P8OA 2Z3EA 2QCYA 4FU8A 1F2SE 1Z6JH 1LKAA 3BTME 3VB7A 4YT6H 2Z94A 3CP7A 1OP2A 2ZTXA 1IQLA 1CA0C 1O3FA 2RA0A 4CRBA 2BVSH 4UE7H 4CRDA 3P17H 2BX4A 2TGPZ 1HUTH 3HATH 1WV7H 4LK4A 4CR9A 3SGQE 3LONA 4X6PA 1L4ZA 2AMQA 1YLNA 3BG4B 1EP5A 3ZVBA 1ELAA 3ZVGA 3A8DA 2AFQB 3BSQA 4OS6A 1V2QT 3SUGA 4A7IB 1O2GH 4ZMAH 3EGKH 1C5VA 4I86A 5F8ZA 4ABIA 2BLWA 4IC5A 4K5ZA 1G30B 3QGJA 3GOVB 3MO9A 4GAWA 1TNKA 4Y76A 1KDQA 5FAHA 1E1RD 3MO3A 1S6HA 3OY5U 4FOUC 3A83A 2Y7ZA 3PWBA 3RUOA 3DSGA 1HGTH 3QTVH 4MPUA 1BRAA 3NK8A 4AZ2B 3MU8A 1AFEH 3ZVFA 1NFXA 2ZC9H 2VGCC 2SGPE 1QTFA 2AMPA 1GGDC 2EI6A 6GCHG 1SQRA 1ZSKA 2WPIS 1XKAC 2R3YA 3T5FH 2C93B 1C2JA 1ESAA 4NIWA 2R0KA 1DICA 3UQOA 3PLBA 1FY3A 3LC3A 1SGIB 2RCEA 3M3VA 2ZA5A 5EXLA 1RGQA 1BBRH 2A0QB 4XSKU 4I8HA 2Y6TA 1FY1A 1LMWB 4A1VA 4FUGA 1KTTB 2Z6BD 2FM2A 3RXTA 1LHFH 1EAWA 1O3BA 1MD8A 4XOJA 1DFPA 1RD3B 5J4QA 4TSFD 1EXFA 2GX4A 1C1NA 1QA0A 2R9PA 3SJOA 4IN1A 1GDNA 2H1UA 1K2I1 1SKYE 2BXTH 1MU8B 1WSSH 4X8SH 1LPGB 1LQDB 1O2HA 1TABE 2BZ6H 4D9RA 5I25A 1Z6EA 1Q3XA 4ZAEA 3ZZ9A 2BB4A 1ELGA 2G5VA 1TFXA 2XNDD 2NU0E 2Y5GA 3UUZA 1GDQA 2ZF0H 3SJKA 4NWLA 8KME2 4Z0KA 4AFZA 3PV4A 4K8BA 4UEHH 3TVJB 2PKAB 3M37A 4JZ1A 2CMYA 4FUFA 3MFJA 4DIHH 1YWUA 3T26A 4WMDA 2Z9KA 1WTHD 3EE0B 1EOJA 3EAJA 1DXWA 4XDEA 3OYPA 1MKWH 1YPLH 2P94A 4ABEA 1Z8GA 4YTAA 1QJ7B 1L1JA 1GMCG 5TJXA 3SV2H 1F5KU 1O0DH 5DO4H 1VZQH 1PQAA 5GJ4B 1ELDE 4NA9H 2HLCA 1MAYA 4X0WU 3LGWA 2ZO3H 4X2WA 1VKYA 1YCPK 2W3KA 1MUEB 3GY3A 2BZAA 1FAXA 3KQDA 3OFND 1S0QA 1MTSA 4FUHA 1BMAA 4DVAU 3UOPA 1K21H 1V2LT 2EI7A 3KGPA 4Y71A 4TY6A 1O2TA 3TJUA 1W7GH 3SNEA 3ITIA 1QBVH 3MH7A 2EA3A 4Q7XA 4ABJA 1SPJA 2ZU4A 3DA9B 1PPBH 3WY8A 2CHAB 2Y81A 1O2JA 1NRRH 2GZ7A 1MKXK 3MMGA 3M7UA 2EEKA 2XC0A 1CT4E 4JCNA 2GV6A 3KQBA 2OLGA 1UTJA 3LC5A 2H5CA 2ZI2H 1FXYA 1L2EA 4K8YA 2SNWA 3K6YA 1QL8A 3JZ2B 1C1TA 4JK5A 4IW4E 3F9GA 1ZSJA 2QC2A 4MNVA 1HRTH 1GJ6A 1GVKB 3UFAA 4ABGA 3ZVDA 4Q2KA 1IQJA 2RDLA 2D1JA 1OSSA 2Q6FA 1QGFA 1YCPM 3BEFB 3PLKA 3Q3XA 1E1QD 1W12U 2ZGJA 2VIPA 1T31A 3M3SA 1ABJH 1D9IA 3A81A 3UWIA 1OP0A 1TMBH 1A4WH 1QNJA 1FI8A 5EPNA 3SQEE 2FX4A 1HV7A 3N7EA 1ZPCA 2ASUB 4U30A 3RMOH 4WJG2 1Z7KA 2QYIA 1FQ3A 3E1XB 1U6QA 2F43B 3O8BA 5CHAB 5J4SA 2QGRA 6GCHF 3SJ8A 1A0HB 5HGGA 1GI9B 2ZHFH 1JRSA 1S81A 2GCTC 1C2FA 1FY4A 5HM9A 2TRMA 3MHWU 1PPEE 3FP7E 4YO9A 1F7ZA 1GI1A 1TRNA 3SV7A 1P05A 2JETC 1QRXA 3GY7A 4Q4LA 2C3SA 4CRCA 3RXQA 4MPVA 1AUJA 2CN0H 1TALA 2GD4B 2JH0D 4FUBA 4ISNA 3IG6B 4HZHA 1GJ9B 1NBMD 5C20A 1IQFA 1VCWA 3OE7D 5DJ7A 1BRCE 1S83A 1O5DH 4MNWA 3UNQA 3PM3A 2B9LA 3GY8A 1ZMJA 3WW7A 1XMNB 1W8BH 1YPKH 3LJOA 1SG8B 1YBWA 2PTNA 5KGOA 1SQTA 3S0NA 2P95A 2G4UA 1L0ZA 5JPMH 4I8LA 2UWOA 1ANEA 1C2HA 1GPZA 1H8ED 1WDIA 3BG8A 3N99A 4Y0YE 1ETSH 4BAKB 4H6SB 5AFYH 3PMHB 2BLVA 1KIGH 4X8VH 1VITH 1NRPH 3ENSB 4HG6A 1GHYH 2YMSD 4ACAA 1FONA 2ZKSA 3A8CA 2FOBA 5FBIA 2BDHA 1YP9A 1EASA 1GBTA 4ZROA 4YOGA 1GCDA 1AE8H 1SGYE 1AO5A 2A5AA 3E6PH 4TYDA 1AU8A 1TPAE 2Z9IA 3KQEA 4KGAA 4OS1A 8LPRA 2BOKA 3RXPA 1V6DA 1C5TA 4YESB 2WYGA 3F3BA 3L3TA 3QGNB 1P10A 2J94A 1YY3A 2XBXA 1XVMA 2ZGHA 1F5RA 1MCVA 2Z3CA 3T2NA 1GMCF 4I8JA 2ALVA 3BN9A 2IPQX 3GCHB 2A4GA 2FEQH 2PGQB 1CBWC 3VFEA 1QJ6B 2VB0A 4ZXYH 3FZDA 1CU1A 3RMLH 3FP8E 3KYFA 1XX9A 1DY8A 3DSPA 1TRMA 2A2QH 1DUAA 2OUAA 5C3NA 2ZDKA 4ISIH 1AZ8A 1O2RA 2GMTC 5C0UA 4FVDA 1XUIA 2BD3A 2OC1A 2ZCHP 2WV4A 5L6NH 1Y5BT 1HXFH 4DT4A 2W5EA 1H9HE 2SGQE 1OHHD 4B2BA 2HLDD 2STBE 3LH1A 3S9CA 5GCHG 3SI3H 1C2IA 4ASUD 1EQ9A 1PYTC 2OP9A 1SGTA 3K65B 3RXHA 3MH5A 5DP9A 1IQKA 3TNTA 3BTGE 3H5CB 4MQAA 1C1QA 1UCYH 1FUJA 3F0PA 1K28D 1O38A 1O5GH 3GDUA 4CH8B 2GJGA 4MPWA 3AAUA 1V3XA 1WUNH 2AEIH 3PMJA 4TPIZ 3S69A 1ACBE 1QB1A 2P3UB 5AHGH 3MNXA 3WWFA 1DE7H 1EUFA 3STIA 1GWAA 3UWJH 1SLVB 2QF5A 2R2MB 1O2KA 1BZXE 3RDZA 2ILNA 4VGCB 1GHBG 1FJSA 1NM6A 4B74A 1P09A 4X6MA 4D8NA 4Y7BA 3TGKE 3M5LA 3LDXH 1O3DA 3DUXH 1HJAB 2G55A 3GICB 3ZV8A 2ZZUH 4AFSA 1VCQA 2VH0A 1EZUC 2O8LA 3A7WA 4GHTA 1A3BH 1CHOG 2BM2A 2VVVA 1SVPA 1A1RA 4X2VA 5FHTA 3AASA 3ATKA 2BD5A 2HNTC 4IN2A 1V2WT 2ZDMA 1MBQA 2LNCA 5EW2H 3BIVH 2P3FH 3BTWE 4AN7A 3FFGA 1SGCA 1P2IA 1D4PB 3F6UH 3I77A 5JBCS 1V2PT 2ZG0H 3A7VA 3A88A 2ZDVH 3EQ0H 3F9FA 3OSYA 1VCPA 5KECA 2YNAA 1HAXB 1TBQH 1YPHE 2BQ7B 2H9HA 3V3MA 3SU3A 1QHRB 2ZHWH 5EGMA 3ZZ8A 1P9SA 7ESTE 1NT1A 1HPGA 8GCHG 1ELCA 3UY9A 4FU9A 5C94A 1N8OC 1PJPA 4J1YA 5F8TA 4QT8C 2BVXH 1HAZB 1ZYOA 4DURA 2ZIQH 2ANWA 2BYAX 1WCZA 4ISOA 5EQRA 3EYDA 4MVNA 5EU8A 2PFEA 1FDPA 6CHAC 4B75A 2ZFPH 2BDYA 3O8DA 4UFDH 1ZMLA 1AIXH 1O3GA 2ZEBA 4J2YB 2H2ZA 1V2TT 4Z6AH 3LGIA 4JZEH 1ELEE 3OTPA 1CT0E 4PROA 1G3BA 1B7XB 1QRZA 2QE7D 1HAOH 2XXLA 3ZZ4A 3TGJE 1HAVA 4O3UA 1AKSA 3EA9A 3A84A 3EA7A 2P8OC 3SV9A 2K1QA 4BANB 4BTUB 2PKSC 3KHVA 4CR5A 1SL3A 3RXBA 3P8NA 4AOQA 5JB8S 1ARCA 3T27A 2VWNA 1L1GA 2IN2A 2M5TA 4SGAE 4ABFA 2PSYA 2J5UA 2G00A 3JZ1B 1C5QA 2ODQA 3E0PB 1DSUA 3ATLA 1TGCA 5GPIB 1J15A 3OU0A 3D62A 1VGCC 2BDGA 5EXNA 1LDTT 1THPB 1EOLA 2CF8H 3F9HA 3TH2H 1AVWA 1JIRA 1N6YA 4CRGA 4YT7H 2VBCA 2F4LA 5GCHF 3ZZDA 4JMYA 4HI3A 3SGBE 3BF6H 3ATWA 1K1PA 4CHAB 3AW1A 2EQNA 1NRNH 2BVRH 1G3CA 1FY5A 2CGAA 4I8KA 4JZDH 3BEIB 1ID5H 4Y8ZA 5LPFA 5C17A 2ZU2A 4FETA 3SQHE 4CRAA 1QCPA 3F2HA 1GI3A 5FL7D 3F0OA 3RMNH 5A8ZA 2GCHG 3FOAA 5C1UA 3T28A 1G32B 5GNDA 3QN7A 1RIWB 1K1NA 4A92A 1YYY1 2WUBA 2VINA 4NIYA 3SU0A 1BQYA 5HIZA 2F9UA 1EJMA 5T1VA 3R3GB 1EPTB 2F83A 3K9XB 5BRRE 1ZOMA 2FXRA 1SLUB 1SOZA 2THFB 2VIVA 3Q3YA 1BBRK 5A8YA 3OEED 1GHBF 2XCFA 2O9QA 3LOXA 2M2AA 3CS7A 3E0NB 1PPZA 5DP5A 1P06A 1P9UA 4O9VA 1DDJA 2A32A 2J98A 1O34A 5F03A 4NZLA 5DP4A 1H8DH 1IQMA 1C5PA 1SGNE 1XUKA 1CHOF 2BMGB 5E0JA 2YMSB 2BQ6B 4ISHH 1EATA 1JOUB 4UONA 3W1EA 3TU7H 5EJ1A 3BTTE 2XRCA 1O2XA 1TGTA 2KM0A 4D7FA 1H9LB 3CS0A 2ANKH 2A4QA 1GHWH 1GHVH 1TNGA 3KEEA 3B9FH 2GTBA 3QZQA 3DSOA
chains in the Genus database with same CATH topology
4B2CA 4K3JA 5DP6A 3T62A 1T8OA 5CMXH 4TPYA 4XBCA 2FMJA 3Q00A 1C5LH 1W0YH 3DCLA 1BHXF 1ABIH 3V7TA 7KMEH 4B6EA 8GCHF 1BCUH 1ZSLA 4Q7ZA 5DK1A 1O2IA 1UTLM 1O36A 1B5GH 3SNCA 3QZRA 1ESBA 2V0BA 3M35A 4MG3A 1O33A 1C5YB 1XXFA 1GI2A 1GVZA 4KTUA 5FCRA 1SGFG 1AHTH 2FOGA 2Y5FA 3OY6U 5C0TA 4K1TA 4RSPA 3W95A 1ZJDA 5DGJA 2Y7XA 5H4IB 1KLIH 1PPHE 2AYWA 3D49H 4ZKRU 4D9QA 2WSSD 5PTPA 4FVBA 1O2WA 4B71A 1CVWH 2FOAA 1AFQC 1HBTH 5T3HA 3DSOA 1LO6A 1C9PA 1ZHPA 1Z8RA 3NUMA 2JDID 1UTKA 1QQUA 2WINI 1DOJA 1C1VH 3RXAA 1KMHB 1BITA 2ZGBH 2WV5A 1LCYA 1FZZA 4E05H 1UCYE 1NFUA 1NTPA 2BDCA 2G8TA 1C1OA 4E06H 4A1TA 3VEQB 1TPOA 1QL7A 2W3IA 2J92A 1PQ7A 1QIXB 2G52A 2HRVA 1UJ1A 3ODDA 3VB6A 1OWEA 1KDQB 1OKXA 1NU9A 1PPCE 3HPTB 1GG6B 2BDBA 4Q63A 4ZCNA 1VJ9U 2SGAA 2GDEH 4GVUA 1QFKH 1HDTH 3E8LA 1O37A 2F3CE 2UWLA 4CRFA 1KXAA 3SZEA 1P3EA 2HNTF 3SJ9A 1Y3XA 2TGAA 2OQUA 4OS7A 3TK5A 1ZZZA 5A2MH 1O31A 1TBRH 1K1LA 5A8XA 2FO9A 1GBDA 2O8MA 1RTFB 5AFZH 9LPRA 1S5SA 4X1SU 2Q1JA 1FV9A 3TH3H 1C1WH 2TPIZ 4BNRA 1YLCA 3QWCH 2GCHF 1BTZA 1AMHA 3SYJA 1D3TB 1OWJA 1YGCH 5T6GA 2BX3A 1T7CA 1NS3A 1W13U 3LPRA 2NU4E 1LTOA 2P16A 1AN1E 2O8UA 4UD9H 2PR3A 4GUXA 2EI8A 1QR3E 4U01A 1C1UH 1ESTA 4DIIH 3BV9B 3SUEA 2CHAC 1LHDH 2V7QD 2PUQH 3U69H 1Y5UT 1CHGA 1GBKA 2A5KA 1UTOA 3RP2A 5JBTA 4HTCH 1E37B 1GI6A 1P02A 2HPPH 3PO1C 3RM0H 1GJBB 3U98H 1SOTA 3OX7U 1TGBA 1BB0B 1KXDA 3MOCA 4Y8YA 4B1TA 3P8GA 1A7SA 1PPFE 2PUXB 1O3HA 4TWWA 1ZRBA 3PV2A 2HALA 2Z3DA 1E36B 4I32A 1QB9A 4O03A 2QV1A 3M5MA 5LH8A 3M61U 3K2UA 1LPZB 5CE1A 1O2ZA 1Z8JB 2FOEA 2VIWA 3SZNA 3VPKA 1EAXA 3HGNA 3HGPA 1HLTH 3RMMH 4ZKOU 2SGDE 2ZHEH 1FAKH 2K0QA 1DM4B 1LVBA 2XTTB 3ZZ3A 1ELTA 2VWOA 2FZZA 2XW9A 4WY3A 5FX5A 1LVOA 4WXVA 3MNSA 1AGJA 3I78A 1XUHA 5CHAC 1GBCA 1TOCB 4WMFA 2KFWA 3OAAD 3E90B 1VJAU 3Q76A 3RXGA 1C2MA 5F53A 4INKA 2AS9A 1O3MA 5A09A 3RU4D 2FPZA 4ZHAA 2A31A 2I6QA 1E38B 2FP7B 3SORA 1DWCH 2QXJA 1XM1A 3A8BA 4DG4A 3SU6A 1J8AA 2HWLB 1GJDB 5T6FA 4AG1A 1SHHB 4MNYA 4B76A 2BY8X 1G2LA 3E16B 1DY9A 5G4BA 1F5LA 1GJ4H 1UCYK 5LGOA 1YCPH 3RXSA 2PHBA 3SBKA 1K1JA 1W0JD 2BD2A 2GCTB 4FXGH 1ZJKA 1O3IA 1AE5A 1V2KT 3GY6A 1C9TA 1ELVA 3KNXA 5JB9S 3M3TA 2JETB 2SGFE 3U8RH 2ZHDA 3ATIA 1SSXA 2XNIA 4OGYA 4DCDA 2BY6X 1DS2E 1EB2A 1XVOA 1YPJH 5TCAA 3I29A 2ZFQH 5E8EH 4I7YH 1HXEH 1A61H 3BTQE 3DFJA 1IOEA 4Q80A 4UFGH 3SJIA 5K7RA 1AZZA 1F0UA 1UVOA 2ZTYA 2B0FA 1J17T 3SUFA 1LKBA 1BTXA 2FOMB 1DX5M 1IAUA 3F68H 3L33A 2A1DB 1P8VC 3SN8A 2PV9B 3GCHC 3KF2A 1JRTA 1F92A 3A7YA 1L1NA 4NFFA 5FCKA 4O3TA 3SI4H 1SQOA 1AUTC 5LPRA 2F9NA 2ULLA 4OS5A 1C2EA 1NY22 3VXEH 5DP3A 3WWBA 1SGPE 1V2JT 3QX5H 3A80A 4MLFB 1EX3A 3D23A 2AGEX 5DP8A 3L6PA 1HFDA 2IPHA 3MU1A 4M7GA 3SV6A 1D6WA 4XFQA 1TAWA 5EW1H 2KCPA 1QJ1B 2JH6D 5A0CA 2YNBA 2VIOA 1MCTA 1GI8B 1HJ9A 1SC8U 2OQ5A 2QN5T 5HM2A 2BD4A 1CBWB 3RXCA 1T8LA 4AFQA 3H09A 1C2LA 3QDZB 4X1QU 5CHBA 3RU4E 3SHCH 5HYOA 3ZVCA 3H7TA 1BHXB 3RC5A 3TITA 4GCHG 2OK5A 4I33A 1LHEH 2OC7A 4U32A 1QA7A 3A7XA 2Z7FE 3LKWA 1JBUH 2ZU1A 4E7NA 1E79D 1BDAA 3PTBA 1NESE 1HIAB 1YLDA 2CK3D 2AIQA 1NBME 1O3KA 1HCGA 3VB3A 4I31A 1GCTC 1P0SH 2BY9X 1UK3A 2GZ9A 1BTWA 1UTQA 1OPHB 4D76A 5SGAE 4M9FA 2C8WB 1KXBA 1P01A 1SR5C 4VGCC 2HPQH 1V2UT 3SW2B 5F6MA 2WZQA 1Y3YA 3UR9A 1TGSZ 1BMNH 1V2ST 4OGXA 2FLRH 3VB5A 4JYVH 1O30A 1EKBB 1W2KH 2AGGX 1GHZA 3TK6A 1GMDG 2JJ1D 3P70B 1ZLRA 3GCNA 3HK6B 1KYNA 4MDSA 1LHGH 2H9TH 3ESTA 1J16A 1NU7B 2AHME 5ETXA 1WOFA 3URCA 1TLDA 1P03A 2QXGA 7LPRA 1BRBE 3ZYEA 1THRH 2I6SA 3BTEE 3C1KA 3P92A 1ZPZA 4KELA 3DD2H 5C1XA 1ELBA 5HXFA 4DOQA 1O2UA 4Y8XA 1DWDH 1NO9H 1YC0A 1P04A 2PTCE 1D3DB 2J95A 3RXOA 1UMAH 5K0HA 1LVYA 4X1NU 1YPMH 2BY5X 4YOJA 1BUIA 1OYQA 1YPGH 1UHBA 2OBQA 2H6MA 4LOYH 4WXIA 1MTNC 4X1RU 3SUDA 1C1SA 3FP6E 1SGQE 4XE4A 3RXUA 3MU5A 5B6OA 1GJ8B 1B0EA 1GHXH 1YF4A 1HAPH 3AVZA 2H5DA 4OS4A 1Y8TA 1DITH 3DT0H 1ANDA 1C5NH 5E0GA 2Q6GA 4ABHA 5JYIA 1W0KD 1PQ5A 4K1SA 1AVXA 5EPYA 2FOHA 3UPEA 1XKBC 2DUCA 1Z1JA 1UVPA 1FN6A 2ZCLP 2FI4E 4HFPB 3VGCB 1TNHA 1EJNA 1V2VT 1AB9C 3S9AA 3A7TA 2F91A 3PB1E 2FOCA 1QURH 1KLTA 1ZTKA 3TIUA 3Q3KA 2JKHA 2ODPA 3SGAE 1V2OT 4TT3D 1K1OA 3IITA 5ESBA 1E34B 2A4RA 2Y80A 2JJ2D 1TE0A 1RFNA 3ATMA 2XOKD 1BT7A 5DPAA 2AMDA 2XCNA 1RRKA 1EFRD 3D65E 1GHAG 4UDWH 1XUJA 2ZECA 3A87A 1BTYA 2XC5A 4AYVB 1GBBA 1ZTLA 3V0XA 4H6TA 3AW0A 2ZDAH 3RXIA 3GY2A 1G9IE 4GSOA 1KXFA 2AH4X 1O3OA 3SNAA 1JMOH 1THSH 2FYQA 2PSXA 1K22H 4ZUHA 2J38A 2KAIB 2P8OB 5FPYA 3RXEA 4CHAC 3LU9B 1O2PA 3K6ZA 3M36A 4NSVA 4IC6A 3KIDU 1UK2A 1DUEA 3AAVA 3FZZA 5CDFE 1QRWA 2F9BH 4R8TB 1C5MD 2XYAA 5ESTE 5EOKA 2ZTZA 4GCHF 1UVSH 1A2CH 1ZRKA 5F8XA 4TY7A 1SFQB 1Z8IB 2C8ZB 1Y3UA 1FPHH 1XUFA 1VGCB 3SNDA 1P2KA 1QBNA 1SBWA 1TQ7B 1S6FA 2C90B 1A5IA 2OCVB 2WV9A 1PPGE 3RXKA 3LT3A 8ESTE 2R0LA 1HAVB 1AKSB 4THNH 2ANYA 4ZHMU 2STAE 5EODA 1YM0A 4AGJA 5DN6D 2PW8H 1B0FA 1F0SA 2XBYA 4Y7AA 2C8XB 1J14A 3TJOA 2ALPA 3FVFB 3ELAH 1TB6H 1QB6A 3RXMA 4F4OC 2ZNKH 1O5EH 5FXLA 1BJUA 3ZZCA 3VXFH 1TONA 1AI8H 1TGNA 1V2MT 2CXVA 1YPEH 1W11U 1BIOA 1MMJN 3KCGH 4ZHLU 1P2NA 3HKJB 1TMUH 3MNCA 3UR6A 5E0HA 2PLXA 4KKDA 1ETTH 1OYTH 3SU1A 1GJCB 1GMDF 1N1LA 2YMSC 2XWBI 2A7JA 1PQ8A 3UREA 4UFEH 1C1PA 3ZZBA 3U1IB 5GDSH 3OEHD 3ZVEA 1TPPA 1TMTH 1KXEA 1UK4A 1RTLA 1TX6A 2A5IA 3TK9A 3BG4C 3KN2A 3N7DA 1RXPA 2HGTH 2UUYA 4BAOB 4XD7D 4FUDA 3RXLA 4F49A 3Q77A 3UQVA 1NC6A 3DFLA 3MNBA 9ESTA 3A86A 1H9IE 2WPMS 2OXSA 4RN6A 1HAIH 3U8OH 5AF9H 1FLEE 2W7UA 1EP6A 2HOBA 4NFEA 4AGKA 1CA0B 1MQ6A 1P2JA 1YPHC 5C67A 4GPGA 2QIQA 1MTWA 3PMAB 2SNVA 2C4FH 4YLQH 4KP0A 1MKWK 1BMLA 2OC0A 4ZKSU 2Q6DA 1O3PB 4BOHA 2O8TA 3T25A 1T4UH 2BDAA 3STJA 4A6LA 5FPSA 1AD8H 3P8FA 4JYTA 3EA8A 3GYLB 1OOKB 4AX9H 5DG6A 1GBHA 1MZDA 2GKVE 2TBSA 1ELFA 3M5OA 1S85A 2J34A 1DWEH 1P2MA 2FODA 3RXJA 2J2UA 1TNJA 5LPEA 2C8YB 2ZHQH 1GBEA 2ODYB 4Y10E 1C1RA 1UTPA 4WVPE 6LPRA 2FTLE 1GBLA 1ZMNA 1D6RA 1DLEA 1MBMA 5JDUB 1S6LA 1TOMH 3BEUA 1PYTD 1CSOE 3UNRA 3B8JA 4JK6A 2PKAA 2VVCA 3RXVA 5L30H 3NXPA 2XWAA 2VGCB 1GBIA 4D7GA 1C2KA 1CQQA 4H4FA 1GGDB 1P12E 1O5FH 5DKMA 3P95A 1C2DA 4RKOB 1GHAF 1DANH 1IHSH 3S7KB 1GI7B 3MYWA 1NFWA 1L4DA 3URDA 3V13A 3LH3A 1AFQB 2FOFA 4WH8A 1G2MA 1GG6C 1DVAH 2GV7A 4ZKNU 2NU2E 4Y6DA 1SGDE 1HAYB 4B2AA 2DE9A 2BD9A 4B73A 2FS8A 2BLOA 1INCA 1O2SA 1A0LA 2F9PA 4NWKA 4DY7B 1IQHA 1EAUA 4IS5A 1H8IH 2GGVB 4YLUA 2LPRA 1GI0A 2P59A 1MTUA 3RC4A 2ZFSA 2Z9JA 3M7QA 5C2ZA 4CBNA 1ZHMA 1BA8B 5GXPA 2J9NA 2PWXA 1AVGH 2KZ4A 1T4VH 3ZZ6A 1G3DA 1SHYA 3V12A 2W6ID 1K1IA 1QL9A 2CJIA 4X2XA 5C5OA 1UVTH 1GBMA 3R0FA 3TJVA 3RM2H 1P2QA 2BTCE 2XBWA 1J9CH 1Y5AT 5C5NA 2ZQ1A 2WYJA 3FN8A 1C4Y2 1Y3WA 1COWD 2ZWLH 2O8WA 1CT2E 3BIUH 2AGIX 1UVUH 4Z1MD 1LQEA 4X2YA 1GJAB 1C5RA 2KCAA 2YOLA 3O8RA 1WTGH 4O97A 2LELA 4WF8A 5FPTA 2XC4A 1F0TA 1C5UA 2RA3A 1O2NA 3F2FA 2ZU5A 2FDAA 3A89A 1EZQA 1H8HD 2BQWB 2FX6A 2V35A 2CV3A 3E3TA 4AORA 1QBOA 4CH2B 4WH6A 2FYRA 3GDSA 1XXDA 5L2ZH 1WXRA 1MQ5A 4A1XA 2R2WU 1BRUP 1GBAA 1SFIA 1TNLA 1DWBH 5HKKD 1SMFE 2FTMA 1SQAA 1TX7A 3MO6A 1CGIE 1JWTA 3PO1B 1P57B 3LJJA 1DT2A 2PGBB 3OTJE 3RU4T 4AYYB 2A2XH 3NCLA 4ABAA 4LZ1H 1BTUA 2D2DA 5DP7A 1N6XA 2B5TB 3S7HB 2ZGCA 2NU1E 4HGCA 1UTNA 1IQNA 1WQVH 2VWLA 1SI5H 2UUKB 1GL1A 1LHCH 1BOQA 1NRQH 5EXMA 1OWDA 2KCOA 4H42U 3BTFE 1IQIA 4K2YA 1C5OH 4ZXXH 1TRYA 1TA6A 1O2OA 1ZGIA 1DLKB 4FUCA 2TGDA 2BDIA 2FLBH 1C5SA 2ZFRH 3F9EA 1A5GH 1EZXC 2BXUH 2ZDNA 4YM9A 1SGEE 2ZGXH 1F0RA 1O3EA 2B7DH 3GS9A 2ZP0H 3GY5A 2F9VA 1WYKA 3RXDA 3PWCA 4ABDA 1QY6A 2Z9LA 3RXRA 3GDVA 3NZIA 2V6NA 2FWWA 2HNTE 3UOUA 1OWHA 1EAIA 4E7RG 1O3LA 1HNEE 3SHAH 1W14U 1GI4A 4YZUA 3LGUA 3FO8D 3U9AH 1GJ5H 1SB1H 1SLXB 4DJZB 5FX6A 3MH6A 3PROA 2QY0B 3SU5A 3ZZ5A 5I46H 1GMHG 1XUGA 3RLYH 2VU8E 2JH5D 1FIWA 1Q2WA 1NN6A 2P93A 2FI3E 4NCYA 2GP9B 5FBEA 3MH4A 5T6DA 2UUFB 1G3EA 4R0IA 4NA7A 1W7XH 1MKXH 3PYHA 1TA2A 1C1MA 3SV8A 4OM9A 1K1MA 1H4WA 1Z71A 1WU1A 5IK2D 1HAHH 2ZPQA 2V3HH 2NWNA 2A7HA 4X8TH 3H7OA 4BAMB 3A7ZA 1VITG 3BTKE 3GY4A 2KR7A 1SLWB 4CBOA 2GDDA 3M5NA 4NSYA 4DGJA