3SUFA

Crystal structure of ns3/4a protease variant d168a in complex with mk-5172
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
190
structure length
190
Chain Sequence
GSVVIVGRINLSGDTAYAQQTRGEEGCQETSQTGRDKNQVEGEVQIVSTATQTFLATSINGVLWTVYHGAGTRTIASPKGPVTQMYTNVDKDLVGWQAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVAFIPVESLETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Molecular Basis of Drug Resistance against Hepatitis C Virus NS3/4A Protease Inhibitors.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/inhibitor
molecule keywords NS3 protease, NS4A protein
total genus 36
structure length 190
sequence length 190
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sufA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3sufA01
3UPEA 3UWIA 1GG6B 1NPMA 4A1VA 1SGRE 1EAIA 1QA0A 3MWIU 4TY6A 5L2YH 2FM2A 3STJA 1SLVB 3SV2H 3VGCB 1LVYA 3SJ9A 2FI4E 2TGAA 4IMZA 3U8OH 3PWBA 1ARCA 4O9VA 3LJOA 3RXJA 1P03A 2F83A 2QXIA 3ZYDA 2V3OH 1OWJA 5L30H 2J95A 1JRTA 1W7XH 4NZQA 1EJNA 4Y11E 1GBEA 2FS8A 2CN0H 1Y5BT 5K7RA 3RXEA 4AGJA 1V2PT 1E35B 2ZU2A 2WPKS 1TBQH 3NK8A 5E2PA 1DOJA 2A5KA 5DP9A 1QL8A 3SOSA 1NU7B 1XMNB 4ABFA 1D3PB 1OWHA 2PUQH 3SU4A 3MMGA 2FXRA 2TGPZ 2A2XH 2BX3A 2BQ7B 1BTZA 1SGFG 1W0ZU 3DT0H 4U32A 1PPGE 3BEUA 1MD7A 1ANEA 1UTNA 1DUEA 2BDYA 5A2MH 3EGKH 1T4UH 7GCHG 5I25A 5HM2A 2YNBA 2KAIB 4Y8XA 2DUCA 2CGAA 1IHSH 1TIOA 3GDVA 1Z71A 3D49H 1H9HE 4GVUA 1W14U 3SNCA 4NZLA 4GCHG 4TWWA 5HM9A 1BBRK 1KXCA 5A0BA 2NU4E 5FBEA 2A0QB 1C1QA 2BDBA 1DDJA 3V13A 2BDIA 1C2MA 2BLOA 3D65E 1K9OE 2ZHEH 2JETB 1WOFA 1KXAA 2UWOA 5GPIB 4RI0A 2OBQA 5A8YA 1V2TT 1J9CH 1K22H 3RXTA 3M3TA 3S9BA 1ORFA 1WU1A 1U6QA 1FXYA 1C5RA 2Q6DA 4INHA 1NO9H 1PQAA 3UQOA 2D2DA 2PTNA 5AFZH 1NTPA 1QFKH 3F9EA 1QJ1B 2OXSA 2PGBB 1JIMA 4OS4A 1LCYA 1E34B 2A7CA 2HGTH 3RMNH 3ENSB 4RKOB 1L0ZA 2RCEA 1GJ6A 2F9BH 1AN1E 1F0SA 1ZJDA 1ZPZA 5HMAA 3TGIE 2Z7FE 2F9VA 3F9GA 5FPYA 1ZSJA 1P9SA 1O5EH 2ZFFH 2PUXB 1UHBB 2XBYA 4X2YA 1YLCA 1O33A 1LHDH 1NFXA 1NY22 2OCVB 1GMHF 2ZA5A 2WZQA 1PQ7A 1QY6A 2OQ5A 1NESE 2HPPH 3TJOA 1ZMJA 5DJ7A 1TYNA 4AFQA 2GT8A 3QUMP 1EUFA 2XWBI 1A5HA 1P04A 4LOYH 1IQGA 3VPKA 4UFDH 1GJDB 1HAIH 1OSSA 3BN9A 4Y7AA 1MBMA 3BTKE 4NA7A 2V6NA 2J94A 3F9FA 3PROA 3VB6A 3T2NA 1MZAA 1GI6A 1EX3A 3HK6B 1DLEA 3ODDA 1O3IA 2ZF0H 3S9CA 3E3TA 2RA3A 1FONA 1NRRH 1H1BA 3E6PH 1HAZB 2ALVA 4B74A 1ZRBA 4LK4A 4XSKU 1CVWH 1C5NH 2Z9IA 1KIGH 2ANYA 1IOEA 1N1LA 1O30A 2HPQH 3S0NA 1OYTH 5T3HA 3LPRA 4O3TA 8ESTE 3RU4E 2W5EA 1XUFA 3TH3H 4JCNA 1AZ8A 1THSH 2G81E 2PLXA 4JYVH 2GZ9A 1A1RA 1ZGIA 3DD2H 4THNH 4E7NA 1X7AC 2J2UA 1CT2E 2ZO3H 4I8JA 1WTHD 4XFQA 2ASUB 1TNJA 1LHEH 4ZH8A 1H8DH 2CHAB 5AVDA 1XUIA 1K21H 2A4RA 3MU1A 2HNTF 1AWHB 3LGWA 3RU4T 1W2KH 3UWJH 1GHAF 2Y7XA 3T29A 1A3BH 2C8WB 2FEQH 5ETXA 3HGNA 3PLBA 1GBMA 3HGPA 3U69H 3EA8A 1EJAA 2BD2A 3DA9B 2M5TA 1P8VC 1SQAA 1D6WA 2IN2A 4WVPE 5TCAA 5E8EH 1K1LA 1EPTC 2P59A 2EEKA 4K8YA 3RC6A 4ZHLU 4CH2B 3ZZAA 3ZZ4A 1C2KA 1UO6A 1UVOA 1T4VH 1ID5H 4ISLA 1C5LH 4AG2A 3JZ1B 4O3UA 4YLQH 1C1MA 1GCTC 1C1RA 1GBFA 2CV3A 4ABAA 4X8VH 2F4LA 4NGAH 1ZGVA 4ASHA 1EB2A 2ZEBA 1AFEH 4Y0YE 2QYIA 5ABWA 4XBDA 1OWDA 5AF9H 2G5NA 1FY5A 2FI5E 3F1SB 5GNDA 1GGDB 1UTJA 1TGSZ 1P01A 2VWLA 4MNXA 2ZI2H 3UIRA 2VWOA 5CHAB 1KTSB 2AEIH 2JH5D 3PV5A 5TCCA 1K1NA 2HRVA 1C5WB 5FCRA 1GBAA 1V2KT 3M5LA 3DFJA 3M3VA 1WSSH 1N6XA 4X6NA 1IQIA 3SO3A 1KSNA 5G4BA 1AVGH 1DANH 3MU4A 1NC6A 4AB9A 2OTVA 1LPKB 2AGIX 2PKAB 4IW4E 5GDSH 3QTVH 2H1UA 1EZQA 2OP9A 1TRMA 2PR3A 3SORA 2BVRH 4TPYA 3QWCH 2FYRA 2QXJA 3ATKA 1BQYA 1LVBA 4NFFA 1V6DA 3ZVFA 1UCYH 3STIA 1UHBA 1C2JA 4BANB 3GCTG 1MKXK 1MKXH 2ZPRA 1GMCF 1WTGH 1QTFA 1WAYB 2TRMA 1SGCA 1ANBA 4FU7A 1TBZH 1IQNA 1TNKA 1DFPA 1F7ZA 4H6SB 1AQ7A 1ZMLA 2ILNA 1ZR0A 1B5GH 1O2KA 1F0UA 2ANMH 1GDQA 1IQEA 1C1WH 2WYGA 1OKXA 1O3LA 1IHTH 1O3JA 1GBKA 1Y3YA 3TPIZ 4B1TA 2ZIQH 5T6GA 3FANA 2ZU3A 4ZKNU 1CGIE 1C2DA 2I6QA 2R9PA 4IC5A 1TNLA 2GCHF 5L6NH 1VJAU 3SZEA 3VB4A 1ELFA 5JDUB 1TRNA 2P8OB 1KLIH 1UTLM 1UTPA 1FZZA 1PQ8A 1KDQA 3EA7A 1VITG 4B2CA 2BD3A 3QTOH 1WYKA 1Z8IB 1MD8A 2SGEE 5DKMA 2BY5X 1GG6C 1A0HB 1G36A 5F8ZA 2R2WU 1J16A 1EJMA 3E0PB 1BTXA 5LPRA 1L4ZA 2VJ1A 1EOLA 4DGJA 4U2WA 2EI8A 1QBNA 2FWWA 1HRTH 1KTTB 2C8ZB 1YPMH 2Z9KA 5C5OA 4ZHMU 4INKA 3SV8A 1W3CA 3SN8A 1QJ7B 1HLTH 1RTKA 1D3TB 2UUFB 1BTPA 1P2OA 4YM9A 1Y8TA 2BZAA 2CJIA 3SV7A 1QRXA 1OPHB 2O9QA 3P6ZB 4BAKB 3M35A 1OP2A 1DICA 1ETTH 7LPRA 3OX7U 1F5RA 1YPHC 1C4V2 3GCHB 1HAYB 1G9IE 3RDZA 3EA9A 1SPJA 1DS2E 1YPJH 1O32A 4WH6A 1UTOA 3M36A 4KKDA 1FDPA 1FN8A 1QL9A 2OINA 2BB4A 1P2IA 2ZQ2A 1GJ7B 3ZZCA 3A80A 3V12A 2QA9E 5EXLA 3A8CA 4F4OC 2FLBH 4K3JA 1G3EA 2OBOA 4R8TB 2F3CE 1P05A 1AKSB 3URDA 1P0SH 3IG6B 1GCDA 1QCPA 2OUAA 2ZGCA 1V3XA 5BRRE 2WPLS 4B76A 1DM4B 2Y5HA 5A0CA 1TOMH 4HFPB 1EAUA 3K2UA 2ZFSA 1T7CA 5JBCS 3AAUA 2RG3A 5IYTA 1QGFA 2YOLA 1GJ5H 4UEHH 1DWBH 1O2PA 4I32A 2C3SA 1THRH 2ANWA 1MTVA 5F6MA 4I8GA 5EPYA 4JZIA 1GVZA 1N8OB 2AGGX 2PSXA 4A1TA 1O5AB 3MH7A 3A84A 1GDNA 2NU1E 1MAYA 4A5TS 1SVPA 3ZZ7A 1ZJKA 1JMOH 4GHTA 1ELVA 1GI5A 3ZVGA 1TNIA 2FP7B 4I33A 5GJ4B 4E05H 3MH6A 3NXPA 1AHTH 1TX7A 1VJ9U 2QCYA 3SGQE 3T25A 3GY2A 4FUBA 3PM3A 4ABGA 2XCNA 1G30B 5FPSA 5DGJA 2CF8H 1WXRA 1GI1A 1XKAC 1PPZA 2RA0A 4Y8ZA 5GIBA 3FZDA 1HAXB 2QF3A 4MVNA 2VWMA 1QNJA 4D9QA 1DVAH 1MU6B 4X8TH 3S7HB 3WY8A 3RM2H 1NRPH 3LU9B 3NCLA 1AMHA 1BMAA 2ZGBH 3BV9B 2ULLA 3R3GB 2FX6A 2A7JA 7GCHF 3RXSA 1FN6A 3P8NA 7ESTE 3KL6A 2GZ8A 2BD9A 4CHAC 1L4DA 2ZCKP 3Q76A 1GBBA 1GI2A 3LIWA 4INLA 4GCHF 1O2QA 3AAVA 2UWLA 2C93B 1SGQE 1GBCA 2EI7A 1O5DH 4NG9H 1CO7E 1QL7A 1FIWA 1BDAA 1QB6A 1VCWA 1WQVH 2GDEH 2CXVA 4B75A 2AYWA 1MU8B 8GCHG 3ZVBA 1XX9A 2WHXA 4Y10E 3KHVA 3LDXH 1E37B 4JZEH 3M5NA 1MUEB 3VB7A 1GBLA 1GJ4H 3B23B 4M9FA 1SMFE 1VCQA 4YTAA 1BUIA 5EG4A 1EB1H 2H9HA 3RXQA 1A0LA 3MFJA 2R0LA 2GV6A 3UNQA 3KIDU 4CRCA 1Z1JA 1KY9A 1EZXC 1IAUA 3BTEE 1CA0B 3PMHB 2XBWA 3RMLH 2ESTE 1XUKA 3TIUA 3O8BA 1K1OA 3KQEA 1PPFE 3FP8E 4Y8YA 3PB1E 2G4UA 2D8WA 2A4GA 3VGCC 4ZAEA 1UTMA 1O2NA 4MNWA 1ARBA 2WPHS 2OK5A 3F68H 1O5GH 4CREA 4WY3A 3SU2A 3ODFA 4AFSA 2PTCE 5EGMA 2BXUH 2QC2A 2ZFTA 4MLFB 4B2BA 1C2GA 2FDAA 1W7GH 2ZDMA 1BBRH 1S85A 1MQ6A 3T27A 1O34A 2FO9A 2ZCLP 1KXEA 3RXDA 1TWXB 2ZHDA 3V3MA 1NS3A 1S84A 3NPSA 3Q3KA 1YPGH 5EU8A 1FUJA 3VFEA 1AVXA 4B71A 1LO6A 1C1TA 1HAHH 1AUJA 3A83A 3SHCH 5I46H 1Y59T 1GHXH 2WPJS 2O8LA 3RXLA 1CT0E 2VVVA 4DVAU 2RDLA 1ZHMA 3M61U 4Y79A 5A0AE 2VGCC 3KCGH 1VCPA 5E2OA 3SJOA 3SU3A 1SB1H 4ABEA 3PLKA 1GJ8B 3ZZ9A 3BTWE 4U30A 1SL3A 3LGVA 2GD4B 2GVFA 1A7SA 1VITH 3A7TA 1FMGA 1GWAA 5DO4H 1FPCH 4AYYB 2AMDA 2QN5T 1ESTA 1YPHE 3LOXA 1HDTH 1LDTT 1AGJA 1TBRH 2TGTA 2NU0E 3QGNB 1RD3B 3BTQE 4HTCH 4FUCA 5C20A 2BDHA 3KGPA 1LHFH 2CHAC 2GDDA 2ZGXH 1LKAA 3ZZ8A 1RGQA 1BRUP 3SBKA 5FX6A 2B9LA 3UREA 1K1JA 4CR5A 1CU1A 1GPZA 3SUGA 2VIPA 2Y5FA 3QLPH 2FTMA 7KMEH 2F9UA 2UUKB 2VWNA 3TK6A 1ZHRA 2P3TB 2GTBA 2G55A 4YOJA 3EAJA 3GY7A 4DJZB 1ANCA 2W3IA 4KP0A 1V2JT 2FESH 1SQTA 3M7TA 1O0DH 2V0BA 3QGJA 3E8LA 3TNSA 1HB0B 2Q6GA 2ZHFH 2V3HH 2I6SA 4XBBA 1Y3WA 1ZPBA 5C1YA 2HLCA 1YGCH 4AOQA 3SJ8A 3LH1A 1TMBH 1TABE 1K1IA 3FAOA 3FZZA 4X2XA 3RXOA 2WV9A 1PQ5A 2P3FH 2ZFPH 3GCNA 1H4WA 1FY8E 4K1SA 2XTTB 2ALPA 4PROA 3T62A 1AWFH 4K1TA 1SFIA 1BOQA 4CR9A 5J4QA 3A87A 4O03A 1BRAA 4DY7B 3MH4A 5HYOA 2JH0D 3AASA 1C2EA 5DP8A 5EW1H 2ZDLA 1O2RA 1Y3UA 1T8NA 3A7XA 4UFFH 2ZZUH 4D7FA 3RU4D 3TK5A 1TA2A 5H4IB 4NIVA 3QK1A 4X0WU 1IQKA 2CMYA 2O8TA 1ZHPA 4HI3A 4JZ1A 1P06A 1JIRA 2B7DH 3NKKA 1J17T 2HNTC 3BTTE 5EOKA 9LPRA 1W11U 3ZVEA 2Y81A 3BTDE 1C1OA 1TGTA 2WV4A 2Z94A 1P2MA 4JK6A 2G8TA 1AI8H 1YPEH 1GGDC 3GY3A 2GCTB 1TOCB 2Z9LA 2IOTA 3TH4H 5CMXH 3H5CB 1SGFA 2YNAA 3K65B 5FHTA 3R0FA 3RXAA 1AE5A 1YYY1 2P93A 2PKSB 1C5QA 1MTSA 4NSVA 3VXEH 1KLTA 5DP3A 1DSUA 3PV2A 3N7OA 1HJAB 2QGRA 1CT4E 4Q7YA 4X1RU 3CS7A 3A86A 2WUBA 1GL0E 3PTBA 1H9IE 1P9UA 2STAE 2G00A 1HCGA 1TGCA 3TU7H 1D9IA 2TIOA 1BITA 3I77A 1V2NT 2PGQB 5EQSA 1GMDG 1QBOA 4DW2U 1HXEH 1SOTA 4ISHH 4X6OA 1XUHA 3W94A 1DLKB 5ESBA 1NFYA 1IQLA 4FXGH 5SGAE 3BF6H 3U98H 4X6MA 3SGBE 5C5NA 2OC7A 4BOHA 5JB8S 3VEQB 2DE9A 5C1UA 2BLVA 3SYJA 1YLDA 1RXPA 1RRKA 5J4SA 4X8SH 4TPIZ 1IQJA 4J1YA 1EASA 3HKJB 4I7YH 3A89A 1A2CH 5FAHA 1QB1A 1NT1A 3MNBA 4ZKOU 2GP9B 3RXMA 1G37A 5LH8A 3T5FH 1P2KA 3MU0A 1O3OA 3AK5A 1JOUB 4R0IA 1DXWA 1O3NA 1LHCH 2PW8H 1ETSH 1Q2WA 3MU5A 4MNYA 2D1JA 1O2IA 1O3PB 1G3CA 1ELAA 1TPSA 1DY9A 2A45B 2J38A 1V2MT 4ISIH 1JBUH 1G3DA 2W7SA 4UFGH 2AGEX 4CHAB 3UFAA 1ZRKA 1PYTC 4FVBA 5EQRA 4CBNA 3A8BA 1ELGA 4FUFA 5LPFA 4GHQA 5JB9S 1O39A 1QRZA 1XKBC 2FOGA 2Q1JA 3SUFA 4OS2A 3F9HA 4AGKA 4AORA 2QAAA 2ZTZA 4NWKA 4Y71A 1C5TA 4HGCA 5DPAA 3T28A 4BXWA 5F8TA 1W8BH 3ZZ3A 3GCHC 2W7UA 1DPOA 1UCYE 2AH4X 3PWCA 2ZWLH 3MO6A 1ZTKA 3ATMA 3BEIB 3K9XB 2UWPA 2R2MB 4MDSA 1DWEH 3SHAH 3LT3A 8KME2 2ZDAH 2R3YA 2B0FA 2BDAA 2C8YB 1Z8RA 3E90B 1GVLA 3RXKA 3ZVAA 1Z6EA 4MNVA 2H9EH 2C8XB 2QF0A 4Q80A 4M7GA 2ZCHP 2A4QA 2O8UA 2Y80A 1WQSA 5B6LA 4ISNA 2XYAA 3QN7A 4TYDA 3KQDA 5CE1A 4ABDA 1ETRH 1GBTA 1MAXA 4A6LA 3F6UH 2IJD1 2TPIZ 1W0YH 4OGXA 3KF2A 1C9PA 1XVOA 3TGKE 1AB9C 5BPEA 2Y82A 1GMCG 3ATWA 2VU8E 1GL1A 4KELA 4MPWA 1MQ5A 1NZQH 2VH6A 1C1NA 1TX6A 1RS0A 2BY7X 2ZTXA 1DT2A 1W12U 4BAHB 4BAQB 2H5DA 4ZXYH 3GY4A 1T8MA 3EE0B 1ZSLA 2P16A 1L1JA 1OS8A 3SI3H 2QY0B 3SQHE 3U1IB 3P8FA 3ZZBA 1TGBA 2VH0A 4BTIB 1FPHH 3TITA 3OTJE 2Y7ZA 4FU8A 2BD8A 5FBIA 3RXBA 2D26C 4U01A 3E1XB 1C1PA 1TNHA 1CA8B 1JWTA 2ZHWH 1XUGA 1CBWB 4IBLH 3MNCA 2SGAA 2R0KA 3I78A 3SV6A 2B5TB 3HATH 1G2LA 4Q2KA 1HJ9A 4X1QU 1Y3XA 1IQMA 1O2YA 4KTUA 1PPEE 1FY1A 2ZGJA 2BOHB 1N8OC 5GXPA 1MTNC 3FFGA 1DX5M 6GCHF 1FIZA 6ESTA 1AFQB 1BHXB 1OWKA 2VVCA 1O2SA 1AVWA 4DT7B 2KAIA 1BTWA 4XDEA 1O3EA 4NA9H 2JETC 3NZIA 2W3KA 3TLOA 3QO6A 2FOEA 3A88A 1ESBA 3K6YA 3UOPA 1ABIH 4BAOB 4E7RG 1O3GA 3L6PA 3C27B 4X6PA 3EQ0H 4RSPA 1QR3E 5AFYH 1UVUH 3K6ZA 1O2ZA 3SW2B 3RXFA 4TY7A 1LPZB 3S7KB 1HGTH 5E0JA 1BB0B 1EXFA 1UCYK 1C9TA 2BTCE 8GCHF 3RUOA 1DSTA 1HJAC 3LGYA 2BMGB 2XXLA 1HPGA 1S5SA 1W10U 3KQCA 2ZNKH 4IN1A 4ZKSU 2FTLE 4YLUA 3EYDA 2PKAA 3MI4A 4BTUB 2SGDE 6LPRA 4ABBA 1RTLA 2F9PA 3SI4H 2ZFQH 1VGCB 4D9RA 1BT7A 3Q3XA 1D3QB 4Z0KA 5F8XA 4J2YB 2PSYA 1C4Y2 1TONA 1QURH 2TGDA 3OSYA 2FIRH 2R3UA 4GPGA 1QA7A 4I8HA 2LPRA 1LQEA 1TPPA 3H7OA 3VB3A 1JXPA 1O3KA 1O3AA 2ZPQA 1ELCA 1C1VH 3A7VA 1HV7A 1OP8A 2A5AA 1OXGA 3ITIA 1EP6A 4AFZA 1BMNH 1F5LA 1J15A 1T8OA 1GHBG 1GBHA 2F91A 1ZYOA 1SFQB 5JBAS 1O5BB 3VXFH 1Z1IA 1O3DA 1K2I1 2WINI 3KNXA 4Y7BA 2BZ6H 3G01A 1O3MA 4XOJA 2GGVB 1TQ7B 4K5ZA 2K1QA 1CSOE 1YPKH 1TMUH 1UK2A 4RKJB 1YCPK 1INCA 1QRWA 3RC5A 3A81A 3RXHA 1GHAG 4WWYA 1O2VA 1QBVH 3LH3A 1HIAA 4XBCA 4UE7H 1O2WA 3ATIA 1VZQH 3TGJE 2UUJB 3ATLA 1GJAB 2BY8X 2Z3CA 5EQQA 1V2UT 3A8DA 3PO1B 1O3BA 4X1SU 4D76A 3BTME 1HBTH 2VIOA 4IMQA 2JKHA 3RXIA 1UTQA 2DE8A 1GHWH 2BQ6B 1TAWA 3DUXH 5JBBS 4CBOA 3B9FH 4I8KA 4BAMB 4KTCA 1SOZA 4A92A 2Z3DA 1SGDE 3RMMH 4ABIA 2FODA 3MOCA 5DG6A 1PJPA 1O31A 2GMTB 2SNVA 4ZKRU 4RN6A 1L2EA 1T32A 3PLPA 2VINA 1BHXF 2H5CA 2V35A 1MTUA 5JYIA 1C2IA 1QQ4A 2SGFE 1TB6H 3O8DA 3CP7A 2Y5GA 1NFWA 2PV9B 2AMQA 2WV5A 3MHWU 4BXSA 2FZZA 3MYWA 1P2NA 3A7WA 5CHAC 5A8ZA 1HNEE 2QIQA 1AU8A 1CBWC 1GI3A 4OS1A 1ZMNA 1EPTA 4SGBE 3BSQA 3P8GA 5DK1A 1GHYH 1ZPCA 3LGUA 1EPTB 4KGAA 4WXIA 5FCKA 1YKTA 3AVZA 3MO9A 1ESAA 1D6RA 2B8OH 1GI4A 4NIWA 1ABJH 1O2GH 3GCTF 3ZZDA 4HZHA 3RLYH 4X1NU 3LC5A 1P10A 4ZXXH 2ZPSA 3M7QA 1BMMH 1MCVA 4GAWA 1C1SA 2FPZA 3SV9A 2J92A 3GCOA 1O5FH 1O3FA 4H42U 1FQ3A 4A7IB 2A5IA 1YBWA 1C5SA 3ELAH 2A4OA 2GT7A 2A31A 1CGHA 2ZDKA 2PHBA 3GYLB 1CQQA 3P92A 4AZ2B 3W95A 1RIWC 3TJNA 1AB9B 2SNWA 2GZ7A 5E0GA 1HUTH 4NA8A 3TJUA 1UVSH 3GY8A 1L1NA 3DHKH 3SJKA 1C5VA 2PKSC 2AIPA 3LGTA 1V2ST 3M5MA 2FS9A 2O8WA 1YM0A 1IQFA 9ESTA 2Z9GA 3LJJA 1NU9A 2Y6TA 1SGEE 1OX1A 1AZZA 1F0RA 1XM1A 5A8XA 4MG3A 1HYLA 2OC8A 2O8MA 4DURA 3ZVCA 1O2XA 4DIIH 1BCUH 1GHBF 1FI8A 5GCHF 1Y3VA 1DE7H 1C2FA 3CS0A 1Z6JH 4ISOA 2BD4A 4DCDA 2XNIA 3S9AA 2BOKA 8LPRA 2P8OC 3UQVA 4MTBA 1BTUA 2AMPA 1J14A 2XBVA 3MTYA 1AE8H 3SUEA 5EXNA 1GHVH 3OU0A 4LXBH 1CA0C 1HAPH 4OGYA 1JRSA 3C1KA 3GDSA 2NWNA 3CENA 1OOKB 1A0JA 5F03A 3RXRA 3ZV8A 1SR5C 4WMFA 2J34A 1A3EH 3L33A 4IS5A 5C1XA 1GI8B 2ZFRH 2FOCA 4Y76A 1P57B 2ZU5A 1UVTH 2FMJA 4Z6AH 3OTPA 2A2QH 4TWYA 4XE4A 1TE0A 3JZ2B 1PYTD 4X2VA 1DY8A 1MCTA 2GCHG 1ZSKA 2H2ZA 2H6MA 5L2ZH 2NU2E 3HKIB 1C1UH 3RXCA 1WV7H 1P3EA 1O35A 2BHGA 1NROH 2BY9X 2BX4A 3OY6U 2GCTC 1QIXB 2G4TA 5IDKA 2OLGA 3A82A 3SNEA 5T1VA 2QXHA 2OD3B 2SGQE 3IWMA 3L3TA 3RM0H 1UTKA 3B8JA 1SHHB 3VB5A 4NWLA 2VB0A 5HXFA 4SGAE 3ZYEA 3RC4A 1DWCH 4B2AA 2FI3E 1E0FD 5AHGH 1MTWA 1YPLH 2WPMS 1FV9A 5FXLA 1HAVA 1Z7KA 1E36B 1HAGE 3MO3A 1WBGB 3PMBB 1KXBA 1CHOF 1P11E 2F9OA 2FOHA 1DUAA 4AFUA 3O8CA 1H9LB 1QJ6B 3NUMA 4BNRA 2OC1A 4GLYA 3QZQA 3A7YA 4OS7A 1FJSA 1C5XB 4Y0ZE 3MU8A 1EAXA 1YCPH 1ZOMA 2EA3A 3UNSA 4WJG2 1BZXE 1GMDF 1HFDA 3SU1A 2P95A 1HXFH 1IQHA 3PV4A 1BJUA 2ZECA 2PWXA 3AW1A 3GYMA 2Z6BD 3UTUH 1NRSH 2HWLB 2FOFA 4FVDA 3ZZ5A 2ZU1A 4A1XA 2LNCA 1C5MD 1BA8B 1V2OT 1SLUB 1TMTH 2G51A 1GJ9B 3QX5H 4CRBA 1HIAB 1NN6A 3Q3YA 1LPGB 1G2MA 3E0NB 4FUEA 2EC9H 1F5KU 1O36A 1HAOH 3FP7E 1BRBE 1Z8JB 1EQ9A 1PPBH 4K60A 3TH2H 4ESTE 2C4FH 1S82A 1TRYA 1CGJE 1BRCE 2VIWA 3U8TH 1SLWB 1V2RT 4X8UH 1VR1H 1RIWB 2BD5A 2HNTE 4YOGA 1ELTA 4AX9H 3P70B 3RXUA 3MH5A 4JYUH 1XXFA 1MBQA 2P94A 1C2HA 5E0HA 2AFQB 1SSXA 1LTOA 2HALA 1L1GA 4JZFH 4OS6A 3UNRA 1KXDA 1V2LT 3GY5A 2J4IA 2ZDVH 2VGCB 3SNAA 4YOIA 3RLWH 1E38B 4Q7ZA 3PTNA 1OYQA 1PPHE 3KN2A 4CRFA 3ZVDA 1TX8A 1AUTC 3PMJA 1GVKB 1SC8U 4UDWH 3I29A 1QHRB 1QB9A 3FVFB 1KXFA 3BTHE 2WPIS 4Y6DA 5FX5A 1O3HA 2VVUA 4O97A 1TFXA 3SQEE 2EI6A 3LONA 2A1DB 4OS5A 2WUCA 5TJXA 3UUZA 4K2YA 1MKWH 2BY6X 4NCYA 1O5CB 1P02A 2QXGA 1ZZZA 1A5IA 1SI5H 1FY4A 2BQWB 1B7XB 1MMJN 1YCPM 1SQOA 1DXPA 1SLXB 3HPTB 3QDZB 3U1JB 2VNTA 4IC6A 1GHZA 1UJ1A 3SU5A 1O38A 4CRAA 1NM6A 4KTSA 2ZKSA 1WCZA 4ZMAH 1LQDB 2C90B 4DOQA 2BVSH 2GX4A 1F92A 1C5UA 4FU9A 3GICB 3GY6A 1BIOA 4YO9A 1C5YB 4I8LA 1N6YA 1LKBA 1QQUA 2HVXA 1K28D 2AS9A 3RMOH 2AERH 1OWIA 1GMHG 3UR9A 3U8RH 3DFLA 5JPMH 1GI9B 1SGPE 1B0EA 1DWDH 2OC0A 3MNSA 4AYVB 4WXVA 3SNDA 3SGAE 4UFEH 2ZDNA 4FUGA 1FY3A 3E16B 1SBWA 4ZHAA 1AD8H 1FLEE 1AKSA 2ZHQH 1XXDA 4ZUHA 1AY6H 1CHOG 3PMAB 1ELEE 3M37A 5PTPA 2P3UB 5DP5A 2FOBA 1P09A 4VGCC 4NIYA 1V2QT 4LZ1H 4FUJA 1SG8B 2ZC9H 4LZ4B 5T6FA 4ZROA 2GKVE 4UD9H 1GBIA 3V0XA 1GBJA 3A7ZA 3BG4C 6CHAC 1P2JA 1EAWA 2IPHA 3UR6A 1V2VT 5ESTE 1DITH 3BTFE 1K1PA 2FOAA 2XRCA 4ABJA 6GCHG 1C2LA 3PYHA 1O2MA 2W26A 1G3BA 2Z3EA 3SZNA 1S81A 4IN2A 1MZDA 3QZRA 4CRGA 1A4WH 1BTHH 1S83A 3BIVH 3A8AA 1BTYA 5EW2H 2G52A 3D62A 2OQUA 1D4PB 2J9NA 1O2JA 4F49A 2FOMB 2BM2A 4D8NA 4IGDA 5EODA 1LHGH 3RP2A 1WUNH 2FLRH 2BDCA 5FPTA 1GDUA 1C4U2 4FUDA 2QV1A 4YT7H 2ZU4A 4GUXA 2Z9JA 3P17H 4YZUA 2BDGA 1TQ0B 3MNXA 5C67A 1GCTB 1TALA 5LGOA 3M5OA 4BTTB 2XC4A 1W13U 1P2QA 1PPCE 1Q31A 3FP6E 1LVMA 3GISB 2GMTC 2PFEA 2IJOB 2STBE 1S6FA 1YP9A 5B6OA 3KEEA 1TPOA 2ZP0H 1O2HA 4FUIA 5LPEA 3M3SA 3IITA 4JZDH 1YF4A 4MPVA 1SGIB 3BIUH 1O37A 1TNGA 1NFUA 3P8OA 2FYQA 2AIQA 1SGTA 1KLJH 3SUDA 2XC5A 1F0TA 5C3NA 3PO1C 1T31A 1A61H 2ANKH 1Q3XA 3T26A 3TK9A 1RTFB 3LC3A 4B73A 1GJBB 4WMDA 4ABHA 1ELBA 1VGCC 1THPB 4AB8A 1Y5AT 2UUYA 2ODPA 3D23A 1AFQC 4FUHA 4DIHH 2H9TH 2SGPE 4MPXA 2JH6D 3OYPA 1BMLA 4JYTA 1CHGA 5HGGA 4DG4A 1XUJA 2BD7A 3TVJB 3SJIA 4X2WA 4OM9A 2A7HA 1AO5A 1O2UA 3HK3B 2WYJA 2G5VA 3Q00A 3S69A 1AIXH 1TA6A 4JK5A 1P3CA 1MKWK 4WF8A 4K1EA 1Y5UT 1PFXC 1SHYA 4WH8A 4D7GA 4K8BA 5A09A 3ESTA 2BLQA 3ZV9A 5EPNA 4MPUA 2F9NA 4GSOA 1OWEA 1A5GH 1C5OH 1NRQH 2ZGHA 3O8RA 1EATA 1EZSC 4YT6H 1ANDA 1J8AA 3GOVB 4B6FA 1M9UA 1V2WT 2ZTYA 5DP4A 2SFAA 1EZUC 3LGIA 3RXPA 2ZG0H 3ZZ6A 3Q77A 3UY9A 5GCHG 5T6DA 2THFB 3TNTA 1G32B 1O2OA 4B6EA 4NFEA 2BXTH 1KYNA 4H4FA 1S6HA 1ZTJA 2VIQA 1C5PA 3BTGE 1YC0A 2NU3E 1A46H 1RFNA 4UONA 1P12E 1F2SE 1OP0A 2FX4A 1GJCB 1CE5A 3A85A 4WMEA 4JMYA 3SNBA 1MH0A 1O2LA 2ODQA 1HJ8A 3BG8A 1MTNB 2TBSA 4MQAA 1UK3A 2XW9A 5JBTA 1KDQB 1VITF 3GDUA 5DP6A 2A32A 2CF9H 4I31A 2Q6FA 4QT8C 3SU0A 4AG1A 3URCA 1BBRE 2GV7A 3LKWA 1D3DB 3AW0A 3KQBA 3H09A 3RXVA 2ZQ1A 1S0QA 1GBDA 3E91A 1UVPA 1SGNE 1EP5A 3H7TA 3M7UA 4H6TA 1FAKH 3TJVA 4E06H 5C2ZA 4CH8B 1O3CA 1NRNH 3UOUA 1ZTLA 3OY5U 1GI0A 2BVXH 1Z8GA 2XCFA 1H8IH 2ODYB 2VBCA 1ACBE 4VGCB 1ELDE 3SU6A 1B0FA 3P95A 3V7TA 1GI7B 1S0RA 2XWAA 4NIXA 4K69A 4CRDA 1BJVA 2VIDA 2XBXA 2BYAX 3BEFB 1T8LA 5EXMA 5GWZA 5K0HA 2VIVA 4YESB 1K1MA 3EDXB 1EOJA 4NSYA 1FAXA 3BG4B 6CHAB 2BLWA 1EKBB 1TPAE 2XC0A 1LVOA 3U9AH 1LMWB 1SGYE 1TLDA 1ZLRA 1UK4A 3RXGA 4Q7XA 4X1PU 1C5ZB 1UMAH 4AN7A 1O2TA 3NWUA 5DP7A 2HOBA 1RJXB 1TGNA 1XVMA 1FNIA 1HAVB
chains in the Genus database with same CATH superfamily
3UPEA 3UWIA 3KQ5A 1GG6B 1NPMA 4A1VA 1SGRE 1EAIA 1QA0A 3MWIU 2J97A 4TY6A 5L2YH 2FM2A 3STJA 1SLVB 3SV2H 3VGCB 1LVYA 3SJ9A 2FI4E 2TGAA 4IMZA 3U8OH 3PWBA 1ARCA 4O9VA 3LJOA 3RXJA 1P03A 2KCYA 1E1QD 2F83A 2QXIA 3ZYDA 2V3OH 1OWJA 5L30H 2J95A 1JRTA 1W7XH 4NZQA 1EJNA 4Y11E 1GBEA 2FS8A 2CN0H 1Y5BT 5K7RA 3RXEA 4AGJA 1V2PT 3EE7A 1E35B 2ZU2A 2WPKS 1TBQH 3NK8A 5E2PA 1DOJA 2A5KA 5DP9A 1QL8A 3SOSA 1NU7B 1XMNB 4ABFA 1D3PB 1OWHA 2HVYB 2PUQH 3SU4A 3MMGA 2FXRA 2TGPZ 2A2XH 2BX3A 2BQ7B 1BTZA 1SGFG 1W0ZU 3DT0H 4U32A 1PPGE 3BEUA 1MD7A 3WWBA 1ANEA 1UTNA 1DUEA 2BDYA 5A2MH 3EGKH 1T4UH 7GCHG 5I25A 5HM2A 2YNBA 2K0QA 2KAIB 4Y8XA 2DUCA 2KCAA 2CGAA 1IHSH 1TIOA 3GDVA 1Z71A 3D49H 5EJLA 1H9HE 3F0OA 4GVUA 1W14U 3SNCA 4NZLA 4GCHG 4TWWA 5HM9A 1BBRK 1KXCA 5A0BA 2NU4E 5EIYA 5FBEA 2A0QB 1C1QA 2BDBA 1DDJA 3V13A 2M2AA 2BDIA 1C2MA 2BLOA 3D65E 1K9OE 2ZHEH 2JETB 1WOFA 1KXAA 2UWOA 5GPIB 4RI0A 2OBQA 5A8YA 1V2TT 1J9CH 1K22H 3RXTA 3M3TA 3S9BA 1ORFA 1WU1A 1U6QA 1FXYA 1C5RA 2Q6DA 4INHA 1NO9H 1PQAA 3UQOA 3FO8D 2D2DA 2PTNA 5AFZH 1NTPA 1QFKH 3UAIC 3F9EA 1QJ1B 2OXSA 2PGBB 1JIMA 4OS4A 1LCYA 1E34B 2A7CA 2HGTH 3RMNH 3ENSB 4RKOB 1L0ZA 2RCEA 1GJ6A 2F9BH 1AN1E 1F0SA 1ZJDA 1ZPZA 5HMAA 2L6OA 3TGIE 2Z7FE 2F9VA 3F9GA 5FPYA 1ZSJA 1P9SA 1O5EH 2ZFFH 2PUXB 1UHBB 2XBYA 4X2YA 1YLCA 1O33A 1LHDH 1NFXA 1NY22 2OCVB 1GMHF 2ZA5A 2WZQA 1PQ7A 1QY6A 2LP6A 2OQ5A 1NESE 2HPPH 3TJOA 1ZMJA 3F2FA 5DJ7A 1TYNA 4AFQA 2GT8A 3QUMP 2RFKC 1EUFA 5KEDA 2XWBI 1A5HA 1P04A 4LOYH 1IQGA 3VPKA 4UFDH 1GJDB 1HAIH 1OSSA 3BN9A 4Y7AA 1MBMA 3BTKE 4NA7A 2V6NA 2J94A 3F9FA 3PROA 3VB6A 3T2NA 1MZAA 1GI6A 1EX3A 3HK6B 1DLEA 3ODDA 1O3IA 2ZF0H 3S9CA 3E3TA 2RA3A 1FONA 1NRRH 1H1BA 3E6PH 1HAZB 2ALVA 4B74A 3OEED 1ZRBA 4LK4A 4XSKU 1CVWH 1C5NH 2Z9IA 1KIGH 2ANYA 1IOEA 3DSPA 1N1LA 1O30A 2HPQH 3S0NA 1OYTH 5T3HA 3LPRA 4O3TA 8ESTE 3RU4E 2W5EA 1XUFA 3TH3H 4JCNA 1AZ8A 1THSH 2G81E 2PLXA 3DSGA 4JYVH 2GZ9A 1A1RA 1ZGIA 3DD2H 4THNH 4E7NA 1X7AC 2J2UA 1CT2E 2ZO3H 4I8JA 1WTHD 4XFQA 2ASUB 1TNJA 1LHEH 4ZH8A 1H8DH 2CHAB 5AVDA 1XUIA 1K21H 2QE7D 2A4RA 3MU1A 2HNTF 1AWHB 3LGWA 3RU4T 1W2KH 3UWJH 1GHAF 2Y7XA 3T29A 1A3BH 2C8WB 2FEQH 5ETXA 3HGNA 3PLBA 1GBMA 3HGPA 3U69H 3EA8A 1EJAA 2BD2A 3DA9B 2M5TA 1P8VC 1SQAA 1D6WA 2IN2A 4WVPE 5TCAA 5E8EH 1K1LA 1EPTC 2P59A 2EEKA 4K8YA 3RC6A 4ZHLU 4CH2B 5KGOA 3ZZAA 3ZZ4A 1C2KA 1UO6A 1UVOA 4ZCNA 1NBMD 1ID5H 1T4VH 4ISLA 1C5LH 4Q4LA 4AG2A 3JZ1B 4O3UA 4YLQH 1C1MA 1GCTC 1C1RA 1GBFA 2CV3A 4ABAA 2F4LA 4X8VH 4NGAH 1ZGVA 4ASHA 1EB2A 2ZEBA 1AFEH 4Y0YE 2QYIA 5ABWA 4XBDA 1OWDA 5AF9H 2G5NA 1FY5A 2FI5E 3F1SB 5GNDA 1GGDB 1UTJA 1TGSZ 3OAAD 1P01A 2VWLA 4MNXA 2ZI2H 3UIRA 2VWOA 5CHAB 1KTSB 2AEIH 2JH5D 3PV5A 5TCCA 1K1NA 2HRVA 1C5WB 5FCRA 1GBAA 1V2KT 2GJGA 3M5LA 3DFJA 3M3VA 1WSSH 1N6XA 4X6NA 1IQIA 3SO3A 1KSNA 5G4BA 2F43B 1AVGH 1DANH 3MU4A 1NC6A 4AB9A 2OTVA 1LPKB 2AGIX 2PKAB 4IW4E 5GDSH 3QTVH 2H1UA 1EZQA 2OP9A 1TRMA 2PR3A 2WPDD 3SORA 2BVRH 4TPYA 3QWCH 2FYRA 2QXJA 3ATKA 1BQYA 1LVBA 4NFFA 1V6DA 3ZVFA 1UCYH 3FOAA 3STIA 1UHBA 1C2JA 4BANB 3GCTG 1MKXK 1MKXH 5C17A 2ZPRA 1GMCF 1WTGH 1QTFA 1WAYB 2TRMA 1SGCA 1ANBA 4FU7A 1TBZH 1IQNA 1TNKA 1DFPA 1F7ZA 4H6SB 1AQ7A 1ZMLA 2ILNA 1ZR0A 1B5GH 2KZ4A 1O2KA 1F0UA 2ANMH 1GDQA 1IQEA 1C1WH 2WYGA 1OKXA 1O3LA 1IHTH 1O3JA 1GBKA 2J98B 1Y3YA 3TPIZ 4B1TA 2ZIQH 5T6GA 3FANA 2ZU3A 4ZKNU 1CGIE 1C2DA 2I6QA 2R9PA 4IC5A 1TNLA 2GCHF 5L6NH 1VJAU 3SZEA 3VB4A 1ELFA 5JDUB 5EJZA 1TRNA 2P8OB 1KLIH 1UTLM 1UTPA 1FZZA 1PQ8A 1KDQA 3EA7A 1VITG 4B2CA 2BD3A 3QTOH 1WYKA 1Z8IB 1MD8A 2SGEE 4F55A 5DKMA 2BY5X 1GG6C 1A0HB 1G36A 5F8ZA 2R2WU 1J16A 1MABB 1EJMA 3E0PB 1BTXA 5LPRA 1L4ZA 2VJ1A 1EOLA 4DGJA 4U2WA 2EI8A 1QBNA 2FWWA 1HRTH 1KTTB 2C8ZB 1YPMH 2Z9KA 5C5OA 4ZHMU 4INKA 3SV8A 1W3CA 3SN8A 1QJ7B 1HLTH 1RTKA 1D3TB 2UUFB 1BTPA 1P2OA 4YM9A 1Y8TA 2BZAA 2CJIA 3SV7A 1QRXA 1OPHB 3FKSD 4P02A 2O9QA 3P6ZB 4BAKB 3M35A 1OP2A 1DICA 1ETTH 7LPRA 3OX7U 1F5RA 1YPHC 1C4V2 3GCHB 1HAYB 1G9IE 3RDZA 3EA9A 1SPJA 2AHME 1DS2E 1YPJH 1O32A 4WH6A 1UTOA 3M36A 4KKDA 1FDPA 1FN8A 1QL9A 2OINA 2BB4A 1P2IA 4RT1A 2ZQ2A 1GJ7B 3KYFA 3A80A 3ZZCA 3V12A 2QA9E 5EXLA 3A8CA 4F4OC 2FLBH 4K3JA 1G3EA 2OBOA 4R8TB 2F3CE 1P05A 1AKSB 3URDA 1P0SH 3IG6B 1GCDA 1QCPA 2OUAA 2ZGCA 1V3XA 5BRRE 2WPLS 2QF5A 4B76A 1DM4B 2Y5HA 5A0CA 1TOMH 4HFPB 1EAUA 3K2UA 2ZFSA 1T7CA 5JBCS 3AAUA 2RG3A 5IYTA 1QGFA 2YOLA 1GJ5H 4UEHH 2RDEA 1DWBH 1O2PA 4I32A 2C3SA 1THRH 2ANWA 1MTVA 1VKYA 5F6MA 1COWD 4I8GA 5EPYA 4JZIA 1GVZA 1N8OB 2AGGX 2PSXA 4A1TA 1O5AB 3MH7A 3A84A 1GDNA 3OFND 2NU1E 1MAYA 4A5TS 1SVPA 3ZZ7A 1ZJKA 1JMOH 4GHTA 1ELVA 1GI5A 3ZVGA 1TNIA 2FP7B 4I33A 5GJ4B 4E05H 3MH6A 3NXPA 1K0HA 1AHTH 1TX7A 1VJ9U 2QCYA 3SGQE 3T25A 3GY2A 4FUBA 3PM3A 4ABGA 2XCNA 1G30B 5FPSA 5DGJA 2CF8H 1WXRA 5CHBA 1GI1A 1XKAC 1PPZA 2RA0A 4Y8ZA 5GIBA 3FZDA 1HAXB 2QF3A 4MVNA 2VWMA 1QNJA 4D9QA 1DVAH 1MU6B 4X8TH 3S7HB 3WY8A 3RM2H 1NRPH 3LU9B 3NCLA 1AMHA 1BMAA 2ZGBH 3BV9B 2ULLA 3R3GB 2FX6A 2A7JA 7GCHF 3RXSA 1FN6A 3P8NA 5F53A 7ESTE 3KL6A 2GZ8A 2BD9A 4CHAC 1L4DA 2ZCKP 3Q76A 1GBBA 1GI2A 3LIWA 4INLA 4GCHF 1O2QA 4Q63A 3AAVA 2UWLA 2C93B 1SGQE 5CDFE 1GBCA 2EI7A 3UB0A 2XOKD 1O5DH 4NG9H 1CO7E 1QL7A 1FIWA 1BDAA 1QB6A 1VCWA 1WQVH 2GDEH 2CXVA 4B75A 2AYWA 1MU8B 8GCHG 3ZVBA 3N99A 1XX9A 2WHXA 4Y10E 3KHVA 3LDXH 1E37B 4JZEH 3M5NA 1MUEB 5HIZA 3VB7A 1GBLA 1GJ4H 3B23B 4M9FA 1SMFE 1VCQA 4YTAA 1BUIA 5EG4A 1EB1H 2H9HA 3RXQA 1A0LA 3MFJA 2R0LA 2GV6A 3UNQA 1FX0B 3KIDU 4CRCA 2WSSD 1Z1JA 1KY9A 1EZXC 1IAUA 3N7DA 3BTEE 1CA0B 3PMHB 2XBWA 3RMLH 2JDID 2ESTE 1XUKA 3TIUA 3O8BA 1K1OA 3KQEA 1PPFE 3FP8E 4Y8YA 3PB1E 2G4UA 2D8WA 2A4GA 3VGCC 4ZAEA 1UTMA 1O2NA 4MNWA 1ARBA 2WPHS 1SQRA 3F68H 2OK5A 1O5GH 3F2HA 4CREA 4WY3A 3SU2A 3ODFA 4AFSA 2PTCE 5EGMA 2BXUH 2QC2A 2ZFTA 4MLFB 4B2BA 1C2GA 2FDAA 1W7GH 2ZDMA 1BBRH 1S85A 1MQ6A 3T27A 1O34A 2FO9A 2ZCLP 1KXEA 3RXDA 1TWXB 2ZHDA 3V3MA 1NS3A 1S84A 3NPSA 3Q3KA 1YPGH 5EU8A 1FUJA 3VFEA 5HKKD 1AVXA 4B71A 1LO6A 1C1TA 1HAHH 1AUJA 3A83A 3SHCH 5I46H 1Y59T 1GHXH 2WPJS 2O8LA 3RXLA 1CT0E 2VVVA 4DVAU 2RDLA 1ZHMA 3M61U 4Y79A 5A0AE 2VGCC 3KCGH 1VCPA 5E2OA 3SJOA 3SU3A 1SB1H 4ABEA 3PLKA 1GJ8B 3ZZ9A 3BTWE 4U30A 1SL3A 3LGVA 2GD4B 2GVFA 4RT0A 1A7SA 1KMHB 1VITH 3A7TA 1FMGA 1GWAA 5DO4H 1FPCH 4AYYB 2AMDA 2QN5T 1ESTA 1YPHE 3LOXA 1HDTH 1LDTT 1AGJA 1TBRH 2TGTA 2NU0E 3QGNB 1RD3B 3BTQE 4HTCH 4FUCA 5C20A 2BDHA 3KGPA 1LHFH 2CHAC 2GDDA 2ZGXH 1LKAA 3ZZ8A 1RGQA 1BRUP 3SBKA 5FX6A 2B9LA 2KCPA 3UREA 1K1JA 4CR5A 1CU1A 1GPZA 3SUGA 2VIPA 2Y5FA 2HLDD 3QLPH 2FTMA 7KMEH 2F9UA 2UUKB 2VWNA 3TK6A 1ZHRA 2P3TB 2GTBA 2G55A 4YOJA 3EAJA 4YXWD 3GY7A 4DJZB 1ANCA 2W3IA 2W6ID 4KP0A 1V2JT 2FESH 1SQTA 3M7TA 1O0DH 2V0BA 3QGJA 3E8LA 3TNSA 1HB0B 2QF4A 2ZHFH 2V3HH 2Q6GA 2I6SA 2JJ1D 1Y3WA 1ZPBA 4XBBA 5C1YA 5C94A 2HLCA 1YGCH 4AOQA 3SJ8A 3LH1A 1TMBH 1TABE 1K1IA 3FAOA 3FZZA 4X2XA 3RXOA 2WV9A 1PQ5A 2P3FH 2ZFPH 3GCNA 1H4WA 1FY8E 4K1SA 2XTTB 2ALPA 4PROA 3T62A 1AWFH 4K1TA 1SFIA 1BOQA 4CR9A 5J4QA 3A87A 4O03A 1BRAA 4DY7B 3MH4A 5HYOA 2JH0D 4ACAA 3AASA 1C2EA 5DP8A 5EW1H 2ZDLA 1O2RA 1Y3UA 1T8NA 3A7XA 4UFFH 2ZZUH 4D7FA 4HG6A 3RU4D 3TK5A 1TA2A 5H4IB 4NIVA 3QK1A 4X0WU 1IQKA 2CMYA 2O8TA 1ZHPA 4HI3A 4JZ1A 1P06A 1JIRA 2B7DH 3NKKA 1J17T 2HNTC 3BTTE 5EOKA 9LPRA 1W11U 3ZVEA 2Y81A 4ACBA 3BTDE 1C1OA 1TGTA 2WV4A 2Z94A 1P2MA 4JK6A 2G8TA 1AI8H 1YPEH 1GGDC 3GY3A 2GCTB 1TOCB 2Z9LA 2IOTA 5HIYA 3TH4H 5CMXH 3H5CB 1SGFA 2YNAA 3K65B 5FHTA 3R0FA 3RXAA 1AE5A 1YYY1 2P93A 2PKSB 1C5QA 1MTSA 4NSVA 3VXEH 1KLTA 5DP3A 2KCOA 1DSUA 3PV2A 3N7OA 1HJAB 2QGRA 1CT4E 5FL7D 4Q7YA 4X1RU 3CS7A 3A86A 2WUBA 1GL0E 3PTBA 1H9IE 1P9UA 2STAE 2G00A 1HCGA 1OHHD 1TGCA 3TU7H 1D9IA 3W1EA 2TIOA 1BITA 3I77A 1V2NT 2PGQB 5EQSA 1GMDG 1QBOA 4DW2U 1HXEH 1SOTA 4ISHH 4X6OA 1XUHA 3W94A 1DLKB 5ESBA 1NFYA 1IQLA 4FXGH 5SGAE 3BF6H 3U98H 4X6MA 3SGBE 5C5NA 2OC7A 4BOHA 5JB8S 3VEQB 2DE9A 5C1UA 2BLVA 3SYJA 1YLDA 1RXPA 1RRKA 5J4SA 4X8SH 4TPIZ 1IQJA 4J1YA 1EASA 3HKJB 4I7YH 3A89A 2KFWA 1A2CH 5FAHA 1QB1A 1NT1A 3MNBA 4ZKOU 2GP9B 3RXMA 1G37A 5LH8A 3T5FH 1P2KA 3MU0A 1O3OA 3AK5A 1JOUB 2YMSD 4R0IA 1DXWA 1O3NA 1LHCH 2PW8H 1ETSH 1Q2WA 3MU5A 4MNYA 2D1JA 1O2IA 1O3PB 1G3CA 1ELAA 1TPSA 1DY9A 2A45B 2J38A 1V2MT 4ISIH 1JBUH 1G3DA 2W7SA 4UFGH 2AGEX 4CHAB 3UFAA 1ZRKA 1PYTC 4FVBA 5EQRA 4CBNA 3A8BA 1ELGA 4FUFA 5LPFA 4GHQA 5JB9S 1O39A 1QRZA 1XKBC 2FOGA 2Q1JA 3SUFA 4OS2A 3F9HA 4AGKA 4AORA 2QAAA 2ZTZA 4NWKA 4Y71A 1YLNA 1C5TA 4HGCA 5DPAA 3T28A 4BXWA 5F8TA 1W8BH 3ZZ3A 3GCHC 2W7UA 1DPOA 1UCYE 2AH4X 3F0PA 3PWCA 2ZWLH 3MO6A 1ZTKA 3ATMA 3BEIB 3K9XB 2UWPA 2R2MB 4MDSA 1DWEH 5DN6D 3SHAH 3LT3A 8KME2 2ZDAH 2R3YA 2B0FA 2BDAA 2C8YB 1Z8RA 3E90B 1GVLA 3RXKA 2YMSC 3ZVAA 3PRDA 1Z6EA 4MNVA 2H9EH 2C8XB 2QF0A 4Q80A 4M7GA 2ZCHP 2A4QA 2O8UA 2Y80A 1WQSA 5B6LA 4ISNA 2XYAA 3QN7A 4TYDA 3KQDA 5CE1A 4ABDA 1ETRH 1GBTA 1MAXA 4A6LA 3F6UH 2IJD1 2TPIZ 2YMSB 1W0YH 4OGXA 3KF2A 1C9PA 1XVOA 3TGKE 1AB9C 5BPEA 2Y82A 1GMCG 3ATWA 2VU8E 1GL1A 4KELA 4MPWA 1MQ5A 1NZQH 2VH6A 1C1NA 1TX6A 4I86A 1RS0A 2BY7X 2ZTXA 1DT2A 1W12U 4BAHB 4BAQB 2H5DA 4ZXYH 3GY4A 1T8MA 3WW7A 3EE0B 1ZSLA 2P16A 1L1JA 1OS8A 3SI3H 2QY0B 3SQHE 3U1IB 3P8FA 3ZZBA 1TGBA 2VH0A 4BTIB 1FPHH 3TITA 3OTJE 2Y7ZA 4FU8A 2BD8A 5FBIA 3RXBA 2D26C 4U01A 4ASUD 3E1XB 1C1PA 1TNHA 1CA8B 1JWTA 2ZHWH 1XUGA 1CBWB 4IBLH 3MNCA 2SGAA 2R0KA 3I78A 3SV6A 2B5TB 3HATH 1G2LA 4Q2KA 1HJ9A 4X1QU 1Y3XA 1IQMA 1O2YA 4KTUA 1PPEE 1FY1A 2ZGJA 2BOHB 1N8OC 5GXPA 1MTNC 3FFGA 1DX5M 6GCHF 1FIZA 6ESTA 1AFQB 1BHXB 1OWKA 2VVCA 1O2SA 1AVWA 4DT7B 2KAIA 1BTWA 4XDEA 1O3EA 4NA9H 2JETC 2JJ2D 3NZIA 2W3KA 3TLOA 4FOUC 3QO6A 2FOEA 3A88A 1ESBA 3K6YA 3UOPA 1ABIH 4BAOB 4E7RG 1O3GA 3L6PA 3C27B 4X6PA 4TSFD 3EQ0H 4RSPA 2KM0A 1QR3E 5AFYH 1UVUH 3K6ZA 1O2ZA 3SW2B 3RXFA 4TY7A 1LPZB 3S7KB 1HGTH 5E0JA 1BB0B 1EXFA 1UCYK 1C9TA 2BTCE 8GCHF 3RUOA 1DSTA 1HJAC 3LGYA 2BMGB 2XXLA 1HPGA 1S5SA 1W10U 3KQCA 2ZNKH 4IN1A 4ZKSU 2FTLE 4YLUA 3EYDA 2K8IA 1BMFD 2PKAA 3MI4A 4BTUB 2SGDE 6LPRA 4ABBA 1RTLA 2F9PA 3SI4H 2ZFQH 5IK2D 1VGCB 4D9RA 1BT7A 3Q3XA 1D3QB 4Z0KA 5F8XA 4J2YB 2PSYA 1C4Y2 1TONA 1QURH 2TGDA 3OSYA 2FIRH 4XD7D 2R3UA 4GPGA 1QA7A 4I8HA 2LPRA 1LQEA 1TPPA 3H7OA 3VB3A 1JXPA 1O3KA 1O3AA 2ZPQA 1ELCA 1C1VH 3A7VA 1HV7A 1OP8A 2A5AA 1OXGA 3ITIA 1EP6A 4AFZA 1BMNH 1F5LA 1J15A 1T8OA 1GHBG 1GBHA 2F91A 1ZYOA 1SFQB 5JBAS 1O5BB 3VXFH 1Z1IA 1O3DA 1K2I1 2WINI 3KNXA 4Y7BA 2BZ6H 3G01A 1O3MA 4XOJA 2GGVB 1TQ7B 4K5ZA 2K1QA 1CSOE 1YPKH 1TMUH 1UK2A 4RKJB 1YCPK 3FN8A 1INCA 1QRWA 3RC5A 3A81A 3RXHA 1GHAG 4WWYA 1O2VA 1QBVH 3LH3A 1HIAA 4XBCA 4UE7H 1O2WA 3ATIA 1VZQH 3TGJE 2CK3D 2UUJB 3ATLA 1GJAB 2BY8X 2Z3CA 3N7EA 5EQQA 1V2UT 3A8DA 3PO1B 1O3BA 4X1SU 4D76A 2V3MA 3BTME 1HBTH 1QZ8A 2VIOA 4IMQA 2JKHA 3RXIA 1UTQA 2DE8A 1GHWH 2BQ6B 1TAWA 3DUXH 5JBBS 1E1RD 4CBOA 3B9FH 4I8KA 4BAMB 4KTCA 1SOZA 4A92A 2Z3DA 1SGDE 3RMMH 4ABIA 2FODA 3MOCA 5DG6A 1PJPA 1O31A 2GMTB 2SNVA 4ZKRU 4RN6A 1L2EA 1T32A 3PLPA 2VINA 1BHXF 2H5CA 2V35A 1MTUA 5JYIA 1C2IA 1QQ4A 2SGFE 5EJ1A 1TB6H 3O8DA 3OEHD 3CP7A 2Y5GA 1NFWA 2PV9B 2AMQA 2WV5A 3MHWU 4BXSA 2FZZA 3MYWA 1P2NA 3A7WA 5CHAC 5A8ZA 1HNEE 2QIQA 1AU8A 1CBWC 1GI3A 4OS1A 1ZMNA 1EPTA 4SGBE 3CNRA 3BSQA 3P8GA 5DK1A 1GHYH 1ZPCA 3LGUA 1EPTB 4KGAA 4WXIA 5FCKA 1YKTA 3AVZA 3MO9A 1ESAA 1D6RA 2B8OH 1GI4A 4NIWA 1ABJH 1O2GH 3GCTF 3ZZDA 4HZHA 3RLYH 4X1NU 3WWFA 3LC5A 1P10A 3VG8A 4ZXXH 2ZPSA 3M7QA 1BMMH 1MCVA 4GAWA 1C1SA 2FPZA 3SV9A 2J92A 1EFRD 3GCOA 1O5FH 1O3FA 4H42U 1FQ3A 4A7IB 2A5IA 2JIZD 1YBWA 1C5SA 3ELAH 2A4OA 2GT7A 2A31A 1CGHA 2ZDKA 2PHBA 3GYLB 1CQQA 3P92A 4AZ2B 3W95A 1RIWC 3TJNA 1AB9B 2SNWA 2GZ7A 5E0GA 1HUTH 4NA8A 3TJUA 1UVSH 3GY8A 1L1NA 3DHKH 3SJKA 1C5VA 2PKSC 2AIPA 3LGTA 1V2ST 3M5MA 2FS9A 2O8WA 1YM0A 1IQFA 9ESTA 2Z9GA 3LJJA 1NU9A 2Y6TA 1SGEE 1OX1A 1AZZA 1F0RA 1XM1A 5A8XA 4MG3A 1HYLA 2OC8A 2O8MA 4DURA 3ZVCA 1O2XA 4DIIH 1BCUH 1GHBF 1FI8A 5GCHF 1Y3VA 1DE7H 1C2FA 3CS0A 1Z6JH 4ISOA 2BD4A 4DCDA 2XNIA 3S9AA 2BOKA 8LPRA 2P8OC 3UQVA 4MTBA 1BTUA 2AMPA 2LELA 1J14A 2XBVA 4DT4A 3MTYA 1AE8H 3SUEA 5EXNA 1GHVH 3OU0A 4LXBH 1CA0C 1HAPH 4OGYA 1JRSA 3C1KA 3GDSA 2NWNA 3CENA 1OOKB 1A0JA 5F03A 2IPQX 3RXRA 3ZV8A 1SR5C 4WMFA 2J34A 1A3EH 3L33A 4FETA 4IS5A 5C1XA 1GI8B 2ZFRH 2FOCA 4Y76A 1P57B 2ZU5A 1UVTH 2FMJA 5C0UA 2EQNA 3OTPA 4Z6AH 2A2QH 4TWYA 4XE4A 2XNDD 1TE0A 3JZ2B 1PYTD 4X2VA 1DY8A 1MCTA 2GCHG 1ZSKA 4AC9A 2H2ZA 2H6MA 5L2ZH 2NU2E 3HKIB 1C1UH 3RXCA 1WV7H 1P3EA 1O35A 2BHGA 1NROH 2BY9X 2BX4A 3OY6U 2GCTC 1QIXB 2G4TA 5IDKA 2OLGA 3A82A 3SNEA 5T1VA 2QXHA 2OD3B 2SGQE 3IWMA 3L3TA 3RM0H 1UTKA 3B8JA 1SHHB 3VB5A 4NWLA 3ZIAD 2VB0A 5HXFA 4SGAE 3ZYEA 3RC4A 1DWCH 4B2AA 2FI3E 1E0FD 5AHGH 2KX4A 1MTWA 1YPLH 2WPMS 1FV9A 5FXLA 1HAVA 1Z7KA 1E36B 1HAGE 3MO3A 1WBGB 3PMBB 1KXBA 1CHOF 1P11E 2F9OA 2FOHA 1DUAA 4AFUA 3O8CA 1H9LB 1QJ6B 3NUMA 4BNRA 2OC1A 4GLYA 3QZQA 3A7YA 4OS7A 1FJSA 1C5XB 4Y0ZE 3MU8A 1EAXA 1YCPH 1ZOMA 2EA3A 3UNSA 4WJG2 1BZXE 1GMDF 1HFDA 3SU1A 2P95A 1HXFH 1IQHA 3PV4A 1BJUA 2ZECA 2PWXA 3AW1A 3GYMA 2Z6BD 3UTUH 1NRSH 2HWLB 2FOFA 4FVDA 3ZZ5A 2ZU1A 4A1XA 2LNCA 1C5MD 1BA8B 1V2OT 1SLUB 1TMTH 2G51A 1GJ9B 3QX5H 1W0JD 4CRBA 1HIAB 1NN6A 3Q3YA 1LPGB 1G2MA 3E0NB 4FUEA 2EC9H 1F5KU 1H8HD 1O36A 1HAOH 3FP7E 1BRBE 1Z8JB 1EQ9A 1PPBH 4K60A 3TH2H 4Z1MD 4ESTE 2C4FH 1S82A 1TRYA 1CGJE 1BRCE 2VIWA 3U8TH 1SLWB 1V2RT 4X8UH 1VR1H 1RIWB 2BD5A 2HNTE 4YOGA 1ELTA 4AX9H 3P70B 3RXUA 3MH5A 4JYUH 1XXFA 1MBQA 2P94A 2V7QD 1C2HA 5E0HA 2AFQB 1SSXA 1LTOA 3NRLA 2HALA 1L1GA 4JZFH 4OS6A 3UNRA 1KXDA 1V2LT 3GY5A 2J4IA 2ZDVH 2VGCB 3SNAA 4YOIA 3RLWH 1E38B 4Q7ZA 3PTNA 1OYQA 1PPHE 3KN2A 4CRFA 3ZVDA 1TX8A 1AUTC 3PMJA 1GVKB 1SC8U 4UDWH 3I29A 3KYGA 1QHRB 1QB9A 3FVFB 1KXFA 3BTHE 2WPIS 4Y6DA 5FX5A 1O3HA 2VVUA 4O97A 1TFXA 3SQEE 2EI6A 3LONA 2A1DB 4OS5A 2WUCA 5TJXA 3UUZA 4K2YA 1MKWH 2BY6X 4NCYA 1O5CB 1P02A 2QXGA 1ZZZA 3F3BA 1W0KD 1A5IA 1SI5H 1FY4A 2BQWB 1B7XB 1MMJN 1YCPM 1SQOA 1DXPA 1SLXB 3HPTB 3QDZB 3U1JB 2VNTA 4IC6A 1GHZA 1UJ1A 3SU5A 1O38A 4CRAA 3U28C 1NM6A 4KTSA 1WDIA 2ZKSA 1WCZA 4ZMAH 1LQDB 2C90B 4DOQA 2BVSH 2GX4A 1F92A 1C5UA 4FU9A 3GICB 3GY6A 1BIOA 4YO9A 1C5YB 4I8LA 1N6YA 1LKBA 1QQUA 2HVXA 1K28D 2PP6A 2AS9A 3RMOH 2AERH 1OWIA 1GMHG 3UR9A 3U8RH 3DFLA 5JPMH 1GI9B 1SGPE 4P00A 1B0EA 1DWDH 2OC0A 3MNSA 4AYVB 4WXVA 3SNDA 3SGAE 4UFEH 2ZDNA 4F48B 4FUGA 1FY3A 3E16B 1SBWA 4ZHAA 1AD8H 1FLEE 1AKSA 2ZHQH 1XXDA 4ZUHA 1AY6H 5DSFA 1CHOG 3PMAB 5KECA 1ELEE 3M37A 5PTPA 2P3UB 5DP5A 2FOBA 1P09A 4VGCC 4NIYA 1V2QT 4LZ1H 4FUJA 1SG8B 2ZC9H 4LZ4B 5T6FA 4ZROA 2GKVE 4UD9H 1GBIA 1YY3A 3V0XA 1GBJA 3A7ZA 3BG4C 6CHAC 1P2JA 1EAWA 2IPHA 3UR6A 2EY4C 4TT3D 1V2VT 5ESTE 1DITH 3DCLA 3BTFE 1K1PA 2FOAA 2XRCA 4ABJA 6GCHG 1C2LA 3PYHA 1O2MA 2W26A 1G3BA 2Z3EA 3SZNA 1S81A 4IN2A 1MZDA 3QZRA 4CRGA 1A4WH 1BTHH 1S83A 3BIVH 3A8AA 1BTYA 3F2GA 5EW2H 2G52A 3D62A 3DSOA 2OQUA 1D4PB 2J9NA 1O2JA 4F49A 2FOMB 2BM2A 4D8NA 4IGDA 5EODA 1LHGH 3RP2A 1WUNH 2FLRH 2BDCA 5FPTA 1GDUA 1C4U2 4FUDA 2QV1A 4YT7H 1H8ED 2ZU4A 4GUXA 2Z9JA 3P17H 4YZUA 2BDGA 1TQ0B 3MNXA 5C67A 1GCTB 1TALA 3GS9A 5LGOA 3M5OA 4BTTB 2XC4A 1W13U 1P2QA 1PPCE 1Q31A 3FP6E 1LVMA 3GISB 2GMTC 2PFEA 2IJOB 2STBE 1S6FA 1YP9A 2KR7A 5B6OA 3KEEA 1TPOA 2ZP0H 1O2HA 4FUIA 5LPEA 3M3SA 1S6LA 3IITA 4JZDH 1YF4A 4MPVA 1SGIB 3BIUH 1O37A 1TNGA 1NFUA 3P8OA 2FYQA 2AIQA 1SGTA 1KLJH 1UW7A 3SUDA 2XC5A 1F0TA 5C3NA 3MQKC 3PO1C 1T31A 1A61H 2J5UA 2ANKH 1Q3XA 2W6JD 3T26A 3TK9A 1RTFB 3LC3A 4B73A 1GJBB 4WMDA 4ABHA 1ELBA 1VGCC 1THPB 4AB8A 1Y5AT 2L74A 2UUYA 2ODPA 3D23A 1AFQC 4FUHA 4DIHH 2H9TH 3OE7D 2SGPE 4MPXA 2JH6D 3OYPA 1BMLA 4JYTA 1CHGA 5HGGA 4DG4A 1XUJA 2BD7A 3TVJB 3SJIA 4X2WA 4OM9A 2A7HA 1AO5A 1O2UA 3HK3B 2WYJA 2G5VA 3Q00A 3S69A 1AIXH 1TA6A 4JK5A 1P3CA 1MKWK 4WF8A 4K1EA 1Y5UT 1PFXC 1SHYA 4WH8A 4D7GA 4K8BA 5A09A 3ESTA 2BLQA 3ZV9A 5EPNA 4MPUA 2F9NA 4GSOA 1OWEA 1A5GH 1C5OH 1NRQH 2ZGHA 3O8RA 1EATA 1EZSC 4YT6H 1ANDA 1J8AA 3GOVB 4B6FA 1M9UA 1V2WT 2ZTYA 5DP4A 2SFAA 1EZUC 3LGIA 3RXPA 2ZG0H 3ZZ6A 3Q77A 3UY9A 5GCHG 5T6DA 2THFB 3TNTA 4XRNA 1G32B 1O2OA 4B6EA 4NFEA 1NBME 2BXTH 1KYNA 4H4FA 1S6HA 1ZTJA 2J98A 2VIQA 1C5PA 3BTGE 1YC0A 2NU3E 1A46H 1RFNA 4UONA 1P12E 1F2SE 1OP0A 2FX4A 1GJCB 1CE5A 3A85A 4WMEA 4JMYA 3SNBA 1MH0A 1O2LA 2ODQA 1HJ8A 3BG8A 1MTNB 2TBSA 3PRBA 4MQAA 1UK3A 2XW9A 5JBTA 1KDQB 1VITF 3GDUA 5DP6A 2A32A 2CF9H 1YWUA 4I31A 2Q6FA 4QT8C 3SU0A 4AG1A 3URCA 1BBRE 2GV7A 3LKWA 1D3DB 3AW0A 3H09A 3KQBA 3RXVA 2ZQ1A 1S0QA 1GBDA 3E91A 1UVPA 1SGNE 1EP5A 3H7TA 3M7UA 4H6TA 1FAKH 3TJVA 4E06H 5C2ZA 4CH8B 1O3CA 1NRNH 3UOUA 1ZTLA 3OY5U 1GI0A 2BVXH 1Z8GA 5C0TA 2XCFA 1H8IH 2ODYB 2VBCA 1ACBE 4VGCB 1ELDE 3SU6A 1B0FA 3P95A 3V7TA 1GI7B 1S0RA 2XWAA 4NIXA 4K69A 4CRDA 1BJVA 2VIDA 2XBXA 2BYAX 3BEFB 1T8LA 5EXMA 5GWZA 5K0HA 2VIVA 4YESB 1K1MA 3EDXB 1EOJA 4NSYA 1FAXA 3BG4B 6CHAB 2BLWA 1EKBB 1TPAE 2XC0A 1LVOA 3U9AH 1E79D 1LMWB 1SGYE 1SKYE 1TLDA 1ZLRA 1UK4A 3RXGA 4Q7XA 4X1PU 1C5ZB 1UMAH 4AN7A 1O2TA 3NWUA 5DP7A 2HOBA 1RJXB 1TGNA 1XVMA 1FNIA 1HAVB
chains in the Genus database with same CATH topology
3UPEA 3UWIA 1GG6B 1NPMA 4A1VA 1SGRE 1EAIA 1QA0A 3MWIU 4TY6A 5L2YH 2FM2A 3STJA 1SLVB 3SV2H 3VGCB 1LVYA 3SJ9A 2FI4E 2TGAA 4IMZA 3U8OH 3PWBA 1ARCA 4O9VA 3LJOA 3RXJA 1P03A 2KCYA 2F83A 1E1QD 2QXIA 3ZYDA 2V3OH 1OWJA 5L30H 2J95A 1JRTA 1W7XH 4NZQA 1EJNA 4Y11E 1GBEA 2FS8A 2CN0H 1Y5BT 5K7RA 3RXEA 4AGJA 1V2PT 1E35B 2ZU2A 2WPKS 1TBQH 3NK8A 5E2PA 1DOJA 2A5KA 5DP9A 1QL8A 3SOSA 1NU7B 1XMNB 4ABFA 1D3PB 1OWHA 2PUQH 3SU4A 3MMGA 2FXRA 2TGPZ 2A2XH 2BX3A 2BQ7B 1BTZA 1SGFG 1W0ZU 3DT0H 4U32A 1PPGE 3BEUA 1MD7A 3WWBA 1ANEA 1UTNA 1DUEA 2BDYA 5A2MH 3EGKH 1T4UH 7GCHG 5I25A 5HM2A 2YNBA 2K0QA 2KAIB 4Y8XA 2DUCA 2KCAA 2CGAA 1IHSH 1TIOA 3GDVA 1Z71A 3D49H 1H9HE 3F0OA 4GVUA 1W14U 3SNCA 4NZLA 4GCHG 4TWWA 5HM9A 1BBRK 1KXCA 5A0BA 2NU4E 5FBEA 2A0QB 1C1QA 2BDBA 1DDJA 3V13A 2M2AA 2BDIA 1C2MA 2BLOA 3D65E 1K9OE 2ZHEH 2JETB 1WOFA 1KXAA 2UWOA 5GPIB 4RI0A 2OBQA 5A8YA 1V2TT 1J9CH 1K22H 3RXTA 3M3TA 3S9BA 1ORFA 1WU1A 1U6QA 1FXYA 1C5RA 2Q6DA 4INHA 1NO9H 1PQAA 3UQOA 3FO8D 2D2DA 2PTNA 5AFZH 1NTPA 1QFKH 3F9EA 1QJ1B 2OXSA 2PGBB 1JIMA 4OS4A 1LCYA 1E34B 2A7CA 2HGTH 3RMNH 3ENSB 4RKOB 1L0ZA 2RCEA 1GJ6A 2F9BH 1AN1E 1F0SA 1ZJDA 1ZPZA 5HMAA 3TGIE 2L6OA 2Z7FE 2F9VA 3F9GA 5FPYA 1ZSJA 1P9SA 1O5EH 2ZFFH 2PUXB 1UHBB 2XBYA 4X2YA 1YLCA 1O33A 1LHDH 1NFXA 1NY22 2OCVB 1GMHF 2ZA5A 2WZQA 1PQ7A 1QY6A 2OQ5A 1NESE 2HPPH 3TJOA 1ZMJA 5DJ7A 3F2FA 1TYNA 4AFQA 2GT8A 3QUMP 1EUFA 2XWBI 1A5HA 1P04A 4LOYH 1IQGA 3VPKA 4UFDH 1GJDB 1HAIH 1OSSA 3BN9A 4Y7AA 1MBMA 3BTKE 4NA7A 2V6NA 2J94A 3F9FA 3PROA 3VB6A 3T2NA 1MZAA 1GI6A 1EX3A 3HK6B 1DLEA 3ODDA 1O3IA 2ZF0H 3S9CA 3E3TA 2RA3A 1FONA 1NRRH 1H1BA 3E6PH 1HAZB 2ALVA 4B74A 3OEED 1ZRBA 4LK4A 4XSKU 1CVWH 1C5NH 2Z9IA 1KIGH 2ANYA 1IOEA 3DSPA 1N1LA 1O30A 2HPQH 3S0NA 1OYTH 5T3HA 3LPRA 4O3TA 8ESTE 3RU4E 2W5EA 1XUFA 3TH3H 4JCNA 1AZ8A 1THSH 2G81E 2PLXA 4JYVH 2GZ9A 1A1RA 1ZGIA 3DD2H 4THNH 4E7NA 1X7AC 2J2UA 1CT2E 2ZO3H 4I8JA 1WTHD 4XFQA 2ASUB 1TNJA 1LHEH 4ZH8A 1H8DH 2CHAB 5AVDA 1XUIA 1K21H 2QE7D 2A4RA 3MU1A 2HNTF 1AWHB 3LGWA 3RU4T 1W2KH 3UWJH 1GHAF 2Y7XA 3T29A 1A3BH 2C8WB 2FEQH 5ETXA 3HGNA 3PLBA 1GBMA 3HGPA 3U69H 3EA8A 1EJAA 2BD2A 3DA9B 2M5TA 1P8VC 1SQAA 1D6WA 2IN2A 4WVPE 5TCAA 5E8EH 1K1LA 1EPTC 2P59A 2EEKA 4K8YA 3RC6A 4ZHLU 4CH2B 3ZZAA 3ZZ4A 1C2KA 1UO6A 1UVOA 4ZCNA 1T4VH 1ID5H 4ISLA 1NBMD 1C5LH 4Q4LA 4AG2A 3JZ1B 4O3UA 4YLQH 1C1MA 1GCTC 1C1RA 1GBFA 2CV3A 4ABAA 4X8VH 2F4LA 4NGAH 1ZGVA 4ASHA 1EB2A 2ZEBA 1AFEH 4Y0YE 2QYIA 5ABWA 4XBDA 1OWDA 5AF9H 2G5NA 1FY5A 2FI5E 3F1SB 5GNDA 1GGDB 1UTJA 1TGSZ 3OAAD 1P01A 2VWLA 4MNXA 2ZI2H 3UIRA 2VWOA 5CHAB 1KTSB 2AEIH 2JH5D 3PV5A 5TCCA 1K1NA 2HRVA 1C5WB 5FCRA 1GBAA 1V2KT 3M5LA 3DFJA 3M3VA 1WSSH 1N6XA 4X6NA 1IQIA 3SO3A 1KSNA 5G4BA 2F43B 1AVGH 1DANH 3MU4A 1NC6A 4AB9A 2OTVA 1LPKB 2AGIX 2PKAB 4IW4E 5GDSH 3QTVH 2H1UA 1EZQA 2OP9A 1TRMA 2PR3A 3SORA 2WPDD 2BVRH 4TPYA 3QWCH 2FYRA 2QXJA 3ATKA 1BQYA 1LVBA 4NFFA 1V6DA 3ZVFA 1UCYH 3FOAA 3STIA 1UHBA 1C2JA 4BANB 3GCTG 1MKXK 1MKXH 5C17A 2ZPRA 1GMCF 1WTGH 1QTFA 1WAYB 2TRMA 1SGCA 1ANBA 4FU7A 1TBZH 1IQNA 1TNKA 1DFPA 1F7ZA 4H6SB 1AQ7A 1ZMLA 2ILNA 1ZR0A 1B5GH 2KZ4A 1O2KA 1F0UA 2ANMH 1GDQA 1IQEA 1C1WH 2WYGA 1OKXA 1O3LA 1IHTH 1O3JA 1GBKA 1Y3YA 3TPIZ 4B1TA 2ZIQH 5T6GA 3FANA 2ZU3A 4ZKNU 1CGIE 1C2DA 2I6QA 2R9PA 4IC5A 1TNLA 2GCHF 5L6NH 1VJAU 3SZEA 3VB4A 1ELFA 5JDUB 1TRNA 2P8OB 1KLIH 1UTLM 1UTPA 1FZZA 1PQ8A 1KDQA 3EA7A 1VITG 4B2CA 2BD3A 3QTOH 1WYKA 1Z8IB 1MD8A 2SGEE 4F55A 5DKMA 2BY5X 1GG6C 1A0HB 1G36A 5F8ZA 2R2WU 1J16A 1MABB 1EJMA 3E0PB 1BTXA 5LPRA 1L4ZA 2VJ1A 1EOLA 4DGJA 4U2WA 2EI8A 1QBNA 2FWWA 1HRTH 1KTTB 2C8ZB 1YPMH 2Z9KA 5C5OA 4ZHMU 4INKA 3SV8A 1W3CA 3SN8A 1QJ7B 1HLTH 1RTKA 1D3TB 2UUFB 1BTPA 1P2OA 4YM9A 1Y8TA 2BZAA 2CJIA 3SV7A 1QRXA 1OPHB 3FKSD 2O9QA 3P6ZB 4BAKB 3M35A 1OP2A 1DICA 1ETTH 7LPRA 3OX7U 1F5RA 1YPHC 1C4V2 3GCHB 1HAYB 1G9IE 3RDZA 3EA9A 1SPJA 2AHME 1DS2E 1YPJH 1O32A 4WH6A 1UTOA 3M36A 4KKDA 1FDPA 1FN8A 1QL9A 2OINA 2BB4A 1P2IA 2ZQ2A 1GJ7B 3ZZCA 3A80A 3V12A 2QA9E 5EXLA 3A8CA 4F4OC 2FLBH 4K3JA 1G3EA 2OBOA 4R8TB 2F3CE 1P05A 1AKSB 3URDA 1P0SH 3IG6B 1GCDA 1QCPA 2OUAA 2ZGCA 1V3XA 5BRRE 2WPLS 4B76A 2QF5A 1DM4B 2Y5HA 5A0CA 1TOMH 4HFPB 1EAUA 3K2UA 2ZFSA 1T7CA 5JBCS 3AAUA 2RG3A 5IYTA 1QGFA 2YOLA 1GJ5H 4UEHH 1DWBH 1O2PA 4I32A 2C3SA 1THRH 2ANWA 1MTVA 5F6MA 4I8GA 5EPYA 1COWD 4JZIA 1GVZA 1N8OB 2AGGX 2PSXA 4A1TA 1O5AB 3MH7A 3A84A 1GDNA 3OFND 2NU1E 1MAYA 4A5TS 1SVPA 3ZZ7A 1ZJKA 1JMOH 4GHTA 1ELVA 1GI5A 3ZVGA 1TNIA 2FP7B 4I33A 5GJ4B 4E05H 3MH6A 3NXPA 1AHTH 1TX7A 1VJ9U 2QCYA 3SGQE 3T25A 3GY2A 4FUBA 3PM3A 4ABGA 2XCNA 1G30B 5FPSA 5DGJA 2CF8H 1WXRA 5CHBA 1GI1A 1XKAC 1PPZA 2RA0A 4Y8ZA 5GIBA 3FZDA 1HAXB 2QF3A 4MVNA 2VWMA 1QNJA 4D9QA 1DVAH 1MU6B 4X8TH 3S7HB 3WY8A 3RM2H 1NRPH 3LU9B 3NCLA 1AMHA 1BMAA 2ZGBH 3BV9B 2ULLA 3R3GB 2FX6A 2A7JA 7GCHF 3RXSA 1FN6A 3P8NA 5F53A 7ESTE 3KL6A 2GZ8A 2BD9A 4CHAC 1L4DA 2ZCKP 3Q76A 1GBBA 1GI2A 3LIWA 4INLA 4GCHF 1O2QA 4Q63A 3AAVA 2UWLA 2C93B 1SGQE 5CDFE 1GBCA 2EI7A 3UB0A 2XOKD 1O5DH 4NG9H 1CO7E 1QL7A 1FIWA 1BDAA 1QB6A 1VCWA 1WQVH 2GDEH 2CXVA 4B75A 2AYWA 1MU8B 8GCHG 3ZVBA 3N99A 1XX9A 2WHXA 4Y10E 3KHVA 3LDXH 1E37B 4JZEH 3M5NA 1MUEB 3VB7A 1GBLA 1GJ4H 3B23B 4M9FA 1SMFE 1VCQA 4YTAA 1BUIA 5EG4A 1EB1H 2H9HA 3RXQA 1A0LA 3MFJA 2R0LA 2GV6A 3UNQA 1FX0B 3KIDU 4CRCA 2WSSD 1Z1JA 1KY9A 1EZXC 1IAUA 3N7DA 3BTEE 1CA0B 3PMHB 2XBWA 3RMLH 2JDID 2ESTE 1XUKA 3TIUA 3O8BA 1K1OA 3KQEA 1PPFE 3FP8E 4Y8YA 3PB1E 2G4UA 2D8WA 2A4GA 3VGCC 4ZAEA 1UTMA 1O2NA 4MNWA 1ARBA 2WPHS 2OK5A 3F68H 1O5GH 3F2HA 4CREA 4WY3A 3SU2A 3ODFA 4AFSA 2PTCE 5EGMA 2BXUH 2QC2A 2ZFTA 4MLFB 4B2BA 1C2GA 2FDAA 1W7GH 2ZDMA 1BBRH 1S85A 1MQ6A 3T27A 1O34A 2FO9A 2ZCLP 1KXEA 3RXDA 1TWXB 2ZHDA 3V3MA 1NS3A 1S84A 3NPSA 3Q3KA 1YPGH 5EU8A 1FUJA 3VFEA 5HKKD 1AVXA 4B71A 1LO6A 1C1TA 1HAHH 1AUJA 3A83A 3SHCH 5I46H 1Y59T 1GHXH 2WPJS 2O8LA 3RXLA 1CT0E 2VVVA 4DVAU 2RDLA 1ZHMA 3M61U 4Y79A 5A0AE 2VGCC 3KCGH 1VCPA 5E2OA 3SJOA 3SU3A 1SB1H 4ABEA 3PLKA 1GJ8B 3ZZ9A 3BTWE 4U30A 1SL3A 3LGVA 2GD4B 2GVFA 1A7SA 1KMHB 1VITH 3A7TA 1FMGA 1GWAA 5DO4H 1FPCH 4AYYB 2AMDA 2QN5T 1ESTA 1YPHE 3LOXA 1HDTH 1LDTT 1AGJA 1TBRH 2TGTA 2NU0E 3QGNB 1RD3B 3BTQE 4HTCH 4FUCA 5C20A 2BDHA 3KGPA 1LHFH 2CHAC 2GDDA 2ZGXH 1LKAA 3ZZ8A 1RGQA 1BRUP 3SBKA 5FX6A 2B9LA 2KCPA 3UREA 1K1JA 4CR5A 1CU1A 1GPZA 3SUGA 2VIPA 2Y5FA 2HLDD 3QLPH 2FTMA 7KMEH 2F9UA 2UUKB 2VWNA 3TK6A 1ZHRA 2P3TB 2GTBA 2G55A 4YOJA 3EAJA 4YXWD 3GY7A 4DJZB 1ANCA 2W3IA 2W6ID 4KP0A 1V2JT 2FESH 1SQTA 3M7TA 1O0DH 2V0BA 3QGJA 3E8LA 3TNSA 1HB0B 2Q6GA 2ZHFH 2V3HH 2QF4A 2I6SA 4XBBA 1Y3WA 1ZPBA 5C1YA 2JJ1D 2HLCA 1YGCH 4AOQA 3SJ8A 3LH1A 1TMBH 1TABE 1K1IA 3FAOA 3FZZA 4X2XA 3RXOA 2WV9A 1PQ5A 2P3FH 2ZFPH 3GCNA 1H4WA 1FY8E 4K1SA 2XTTB 2ALPA 4PROA 3T62A 1AWFH 4K1TA 1SFIA 1BOQA 4CR9A 5J4QA 3A87A 4O03A 1BRAA 4DY7B 3MH4A 5HYOA 2JH0D 3AASA 1C2EA 5DP8A 5EW1H 2ZDLA 1O2RA 1Y3UA 1T8NA 3A7XA 4UFFH 2ZZUH 4D7FA 3RU4D 3TK5A 1TA2A 5H4IB 4NIVA 3QK1A 4X0WU 1IQKA 2CMYA 2O8TA 1ZHPA 4HI3A 4JZ1A 1P06A 1JIRA 2B7DH 3NKKA 1J17T 2HNTC 3BTTE 5EOKA 9LPRA 1W11U 3ZVEA 2Y81A 3BTDE 1C1OA 1TGTA 2WV4A 2Z94A 1P2MA 4JK6A 2G8TA 1AI8H 1YPEH 1GGDC 3GY3A 2GCTB 1TOCB 2Z9LA 2IOTA 3TH4H 5CMXH 3H5CB 1SGFA 2YNAA 3K65B 5FHTA 3R0FA 3RXAA 1AE5A 1YYY1 2P93A 2PKSB 1C5QA 1MTSA 4NSVA 3VXEH 1KLTA 5DP3A 2KCOA 1DSUA 3PV2A 3N7OA 1HJAB 2QGRA 1CT4E 5FL7D 4Q7YA 4X1RU 3CS7A 3A86A 2WUBA 1GL0E 3PTBA 1H9IE 1P9UA 2STAE 2G00A 1HCGA 1OHHD 1TGCA 3TU7H 1D9IA 3W1EA 2TIOA 1BITA 3I77A 1V2NT 2PGQB 5EQSA 1GMDG 1QBOA 4DW2U 1HXEH 1SOTA 4ISHH 4X6OA 1XUHA 3W94A 1DLKB 5ESBA 1NFYA 1IQLA 4FXGH 5SGAE 3BF6H 3U98H 4X6MA 3SGBE 5C5NA 2OC7A 4BOHA 5JB8S 3VEQB 2DE9A 5C1UA 2BLVA 3SYJA 1YLDA 1RXPA 1RRKA 5J4SA 4X8SH 4TPIZ 1IQJA 4J1YA 1EASA 3HKJB 4I7YH 3A89A 2KFWA 1A2CH 5FAHA 1QB1A 1NT1A 3MNBA 4ZKOU 2GP9B 3RXMA 1G37A 5LH8A 3T5FH 1P2KA 3MU0A 1O3OA 3AK5A 1JOUB 4R0IA 2YMSD 1DXWA 1O3NA 1LHCH 2PW8H 1ETSH 1Q2WA 3MU5A 4MNYA 2D1JA 1O2IA 1O3PB 1G3CA