3SUFA

Crystal structure of ns3/4a protease variant d168a in complex with mk-5172
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
190
structure length
190
Chain Sequence
GSVVIVGRINLSGDTAYAQQTRGEEGCQETSQTGRDKNQVEGEVQIVSTATQTFLATSINGVLWTVYHGAGTRTIASPKGPVTQMYTNVDKDLVGWQAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVAFIPVESLETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NS3 protease, NS4A protein
publication title The Molecular Basis of Drug Resistance against Hepatitis C Virus NS3/4A Protease Inhibitors.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/inhibitor
total genus 36
structure length 190
sequence length 190
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sufA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3sufA01
2A5KA 1GJ4H 4B2AA 2F9BH 5A0CA 4ABIA 1TBRH 3RMMH 2ZDVH 2VNTA 2FIRH 4RI0A 1K28D 3SQHE 4JYUH 2A45B 3GY3A 2M5TA 4X2VA 3M3TA 3E0NB 3SHCH 1UHBA 4Y76A 2G52A 5L2YH 2CF8H 4K8BA 4MPWA 1CBWC 3I77A 1P02A 2G5NA 2TBSA 4B6EA 1S0QA 2A32A 2WPMS 4DJZB 2TIOA 3LC5A 2QC2A 2ZFQH 2C8ZB 1SL3A 5K0HA 2SGFE 5LPRA 1CO7E 1MAYA 2H9EH 1OP2A 4DW2U 4K3JA 1O3OA 4TPIZ 1ZTKA 3KQEA 1F0SA 2FLRH 4DVAU 1TMTH 4OS5A 1MCVA 2A7HA 1S83A 4Q7XA 3EA9A 3ATWA 2A0QB 1BQYA 3ITIA 4XFQA 5E2PA 2R2WU 3A8DA 4JYVH 4OGYA 2ZNKH 1C2MA 2SNWA 2Q6DA 1V2VT 4ISNA 2OINA 4FUHA 2PKAA 1WSSH 2BLVA 3BTWE 3SU1A 1ELTA 2VVUA 3K2UA 5A0AE 2IOTA 2BVRH 1O2VA 1ZLRA 2FLBH 2NU3E 1PPHE 1UTPA 1WCZA 2Z9LA 4FUIA 1RTFB 1HAHH 4JMYA 4LOYH 1BITA 1L4ZA 1P2IA 3O8DA 2JH0D 1CGIE 3ZZDA 1C2JA 4JZDH 1ELBA 1PPGE 2XBYA 4X1RU 4UE7H 5DO4H 1GCTB 1N6YA 3TH3H 3B8JA 3E1XB 4FVDA 1PJPA 4I7YH 1O31A 1QRWA 1SPJA 2NU0E 4FUFA 1SOTA 2R0KA 2PR3A 4MNWA 2ZDLA 2F4LA 2VJ1A 1BJUA 1DY9A 2YOLA 1D9IA 1SMFE 3LGVA 1KXFA 1XUIA 5CE1A 2ANKH 2HNTC 4AB9A 1HAGE 3RM0H 1QQUA 3F9EA 2F9OA 1DWCH 3M3SA 1GHBG 4I8LA 3M7QA 4X1QU 1HAIH 1G9IE 1TGTA 3RMOH 2OBOA 2GMTB 1GL0E 3K6ZA 1W14U 1VR1H 3QGJA 1S0RA 1F5LA 4B76A 2Z6BD 2GDEH 5FXLA 3ZZ3A 2A7JA 1GHYH 1HUTH 4LZ1H 4H6SB 1KXEA 1O2KA 2PV9B 1IQHA 2UWOA 3MU8A 3VEQB 4GCHF 1MKWH 1MU8B 5JPMH 1PPZA 2WPHS 2TGAA 2Z7FE 1GVKB 2SFAA 3URDA 1AKSA 5HGGA 1UTOA 3RXJA 2Y81A 2VIOA 2ZKSA 2EI6A 4MNVA 3DHKH 3QZRA 1L1GA 1P2NA 1SG8B 1WOFA 2C4FH 1GWAA 3SU2A 4DURA 1FAKH 2BY8X 2ZGXH 1AN1E 1WUNH 2BM2A 2QXHA 2VU8E 3NXPA 1TBQH 1GVLA 1UMAH 3STJA 4ZHAA 3T28A 4IBLH 4GHQA 1JWTA 4LZ4B 3ZVCA 4AFQA 1UVPA 2H5CA 1GHZA 1VITG 1MZDA 3BEUA 4A92A 4K60A 4CR5A 3RM2H 2WZQA 3GCTG 2GCTB 2ZDMA 3ZZ7A 2BD7A 2O8WA 2WPLS 3TU7H 5B6LA 2HVXA 1C2EA 3UQVA 4ISHH 2PGBB 3M37A 1AGJA 1CVWH 1P10A 3SU0A 1GMHF 1ZPZA 3MFJA 3SNCA 1G32B 2AMPA 2P16A 2CGAA 3RXDA 1PFXC 1MAXA 3SV9A 1WXRA 4OM9A 4I8GA 1GI3A 2BLQA 1VITH 2ULLA 3UY9A 5JYIA 2HOBA 5EGMA 1NRRH 3OTPA 1WQVH 5J4QA 1DM4B 1QFKH 8GCHG 1XUFA 1GPZA 1QB6A 3A7ZA 4F4OC 2D1JA 2VIPA 3I78A 1TWXB 3VPKA 2RCEA 4X0WU 2XBWA 2Y5HA 5EU8A 1SOZA 4FUGA 2BY6X 1GMDF 2BQ7B 2ASUB 2XBVA 1ZSLA 5FCRA 1MTVA 2BYAX 2FPZA 2OBQA 5GDSH 1BTYA 3LJOA 3SNEA 4U01A 4NIWA 3LJJA 3SQEE 3UWJH 4O9VA 3LOXA 4AX9H 1CA8B 1ZHPA 5GIBA 4B2CA 4GPGA 1TABE 3PLKA 1NRQH 2UUJB 1TNKA 1V2MT 3T27A 2ZFFH 2BOHB 6CHAB 1F0TA 1P9UA 3PWBA 4HTCH 2Q6GA 2XC5A 1BRAA 1GBAA 1YPMH 3TLOA 2ZDNA 3RXMA 3RXGA 3UOUA 3PTBA 1A1RA 1HRTH 3E0PB 1VGCC 5T1VA 3A8CA 4ZH8A 3KQBA 1BCUH 3C27B 1HIAA 4KTSA 1SBWA 1ZHRA 1UTJA 3SJKA 2XXLA 1THRH 1ZTLA 3ZZBA 1O2RA 3UQOA 1K9OE 1O2MA 3RXLA 3PV5A 2ZEBA 1D3DB 5HXFA 4JZIA 4NA7A 1ELDE 1G36A 1BTHH 1V2TT 5FBIA 1AY6H 1NU7B 1LHCH 1GHVH 2GX4A 3GCHB 5J4SA 1DPOA 1TRMA 3AK5A 2BD5A 3QLPH 5L30H 4M9FA 3MNSA 1O2GH 4D7FA 2D2DA 4WH8A 2A2XH 2W26A 4HI3A 1ANDA 5I25A 5L2ZH 2H5DA 1FY8E 3M36A 2BXUH 1YCPK 3TIUA 1IHTH 1Y3XA 2FOEA 4KKDA 1JRTA 1Z8GA 4X2YA 1O3CA 4BTUB 1YPHC 1HJAC 3ZVDA 3GY4A 5JBCS 4NZQA 1O3LA 5JB9S 3M3VA 2FOBA 2BXTH 1Q31A 2AFQB 3RC6A 1O3AA 2Z3EA 3HK6B 1EP6A 3SUFA 4XOJA 3URCA 1O3NA 1ZOMA 4MVNA 2Z94A 5C5OA 3GOVB 5FBEA 2BHGA 2CN0H 3RXKA 1TE0A 2BZ6H 2VIQA 3O8RA 1J14A 2QYIA 1OWEA 1HAVB 3SV8A 2A7CA 3GY5A 3LH3A 1TGSZ 1BOQA 1NY22 3M5LA 3JZ2B 3NWUA 2GZ9A 2OXSA 1C9TA 1JIMA 1G3DA 2PW8H 4Z0KA 1RXPA 3S9AA 3BEFB 4U2WA 1MD8A 1V2WT 4BAOB 1BMNH 1BTUA 1UVUH 1YCPH 2FO9A 1OP8A 4Q2KA 1IQMA 4IGDA 2BDYA 1W7XH 5FX6A 2ZCLP 1GBHA 1E36B 1AVXA 4X8TH 4ABAA 4R8TB 4IC6A 5A0BA 1MKXK 5JBBS 2BX4A 2FMJA 3UNRA 1ZJKA 1GJCB 2YNBA 3A85A 4GVUA 7KMEH 4MLFB 1HJAB 1YBWA 2ZU5A 2PUXB 1XM1A 3EA8A 1UCYH 3BF6H 4AZ2B 2TGTA 1Y3VA 3FZZA 5C1YA 3NUMA 3ELAH 1GBFA 1W13U 3U1IB 4THNH 3A7YA 1LVYA 1N8OC 1XUJA 3QTOH 4CRBA 2A2QH 1RJXB 3MNCA 1C2IA 1ETTH 1C5XB 3ZVGA 2GT8A 2ZIQH 3SHAH 2ODYB 2Y7ZA 1ESTA 3G01A 3K65B 1QA0A 1HJ8A 1NM6A 2ZHEH 3P8GA 4GAWA 1Y5UT 1GJ9B 1BRBE 4NA9H 5K7RA 1JOUB 2BDAA 3PYHA 4ZKRU 2ZPQA 1Z1IA 3MO6A 2ZPRA 4NSVA 2FYQA 3PV4A 2J4IA 1LKAA 4NSYA 3E8LA 1CT4E 3Q3KA 4AYVB 1W10U 2W5EA 1A0LA 3PLBA 3V7TA 1DUEA 1BBRK 1TGCA 1TPPA 1D6RA 3E16B 3E3TA 2VGCC 3OY6U 4A1XA 1PPFE 1CGHA 2NU2E 4INKA 2QCYA 1XKAC 4YOIA 4ZAEA 2GT7A 5CMXH 2FOHA 3RXEA 1O3FA 1CA0B 1DLKB 4MNYA 1O2SA 1H9HE 8KME2 1N8OB 4D9QA 2VWMA 9ESTA 3S7HB 3VXEH 3RMLH 1OWDA 3HGPA 4MG3A 2WPKS 3NPSA 4NZLA 5DPAA 4FUBA 5DP4A 1SGDE 4H4FA 4X2WA 4WY3A 1VJAU 4A6LA 1KLTA 1FPCH 1ACBE 5TJXA 3KQCA 4Y8ZA 1O37A 1P09A 4YT6H 2EC9H 3QO6A 3SOSA 5HM9A 2HALA 2F9PA 2ZP0H 1F0UA 1C5NH 4KP0A 5LPFA 1BBRH 1NRSH 3AVZA 3RP2A 1FNIA 2D8WA 1G3CA 3A83A 5ABWA 5E2OA 2UWPA 1GJ6A 4AORA 1Z8JB 1HAXB 1O30A 5EPNA 3UUZA 2GP9B 1CQQA 1MTNC 1P2KA 5LGOA 1G2LA 1ABIH 3SJOA 4JZ1A 4OGXA 3VGCC 1TNHA 2OTVA 1EKBB 1GDUA 4X8VH 1P2JA 2XCNA 1Z71A 2Y7XA 2ZTYA 2Y5GA 1EPTA 4AB8A 3TK9A 2CV3A 2FX4A 3RXSA 5JBAS 1FXYA 2STBE 1T32A 3MU1A 3D65E 1GHAF 1GI8B 1O3JA 1V2PT 2IPHA 2BDHA 2PUQH 4TWWA 2OCVB 4SGAE 3SJ9A 2F91A 5DP8A 2RA3A 4DG4A 2OUAA 3RUOA 2BVSH 4A7IB 2KAIA 1O5BB 1MMJN 1L1JA 1V6DA 2FYRA 1TX8A 2IJOB 3UR9A 2WHXA 5C1UA 1KLIH 3BV9B 4ZHMU 4Z6AH 3W95A 1YF4A 1QGFA 1P57B 1GDQA 3LPRA 1J8AA 1SVPA 3TPIZ 3KNXA 1UTKA 1K1JA 1Z1JA 2A1DB 2HNTE 4MPXA 2SGQE 1NT1A 3TNSA 2QF0A 4KTCA 1C1PA 2J95A 1YC0A 2OQ5A 4J1YA 2YNAA 5GWZA 5DP6A 1MD7A 3RU4T 8ESTE 1G2MA 2B7DH 5T6GA 3VGCB 4NG9H 4R0IA 2BY7X 3EGKH 4X1NU 1RTKA 1AQ7A 4I8JA 1GBMA 3L6PA 4UFFH 5IDKA 3ODDA 1BB0B 2XWAA 1E37B 1LPGB 1YPLH 3RXCA 5T6DA 2GVFA 3PB1E 5BRRE 3TGKE 3BEIB 3P6ZB 5F8XA 4E7NA 1VITF 5FX5A 2RA0A 1ZPCA 3T2NA 3PM3A 2QAAA 2ZHFH 3GCTF 3PROA 2GZ8A 2W3KA 3V0XA 3SZEA 2VVVA 4CH8B 1O36A 2B9LA 3SYJA 1UO6A 4A5TS 3F68H 1H8DH 1VCQA 6ESTA 4B71A 3T26A 1DWEH 1P01A 2AS9A 1UVOA 2QY0B 2Z9GA 1GI1A 5EXMA 1EP5A 5DG6A 1DXWA 3GDSA 1F92A 4HZHA 3T25A 1EXFA 1NZQH 4SGBE 4AYYB 1D6WA 1D4PB 2BOKA 1CU1A 3BN9A 5GCHG 3RXFA 4UFDH 4VGCC 3Q3XA 1ANCA 5ETXA 3S69A 1ZRKA 4K69A 1ELAA 1YPGH 2AERH 7GCHF 2F9UA 4Y0YE 2ZPSA 1RFNA 3F9FA 3TGJE 3AAVA 4TY7A 4ABEA 3P8OA 1GJ8B 2PHBA 3SV2H 4KELA 1GI4A 1T4VH 1OKXA 2GV7A 3NCLA 1CBWB 1KXDA 3P92A 3PMHB 1DOJA 1MKWK 4CRAA 4DCDA 2VWNA 2AEIH 4TYDA 1QB1A 2W3IA 1LVOA 1QBOA 3PO1C 2JH5D 1DWDH 2O8LA 5E0GA 2QN5T 3CS0A 1HDTH 1PQ7A 3TH4H 1OSSA 5FPYA 1O2NA 1BTWA 4JZEH 1SLXB 2UUKB 1TOCB 5EQSA 2F9NA 3OU0A 2A4QA 3K6YA 1C4V2 2C8WB 3U9AH 2FP7B 5AHGH 4AFUA 4CR9A 1ELFA 4Y6DA 1DLEA 1DUAA 5C1XA 3SW2B 1CHOG 3DT0H 2H2ZA 2LNCA 2G00A 1PPBH 4AFSA 4AOQA 1ANEA 5A2MH 4E05H 3EYDA 4B73A 5AFYH 3RLYH 4YZUA 4K1TA 4VGCB 1GBTA 1GHWH 2XC0A 1Y5BT 4ESTE 3N7OA 4YT7H 1OWHA 1OX1A 1K1NA 2FOFA 3ZVAA 1C2DA 1AVWA 1BIOA 3K9XB 1EX3A 5PTPA 1IQFA 4M7GA 1O3BA 1K21H 1TX6A 3TH2H 4JK6A 1GBDA 1HJ9A 3SJIA 3MOCA 1O3IA 1Y3WA 3LONA 3M7TA 2Z3CA 4MPVA 4ASHA 2PKSC 3PO1B 3LU9B 1O5EH 2ZHWH 3KHVA 1THSH 5TCCA 1QRZA 3RMNH 1KDQB 1HXFH 5LPEA 1HCGA 1M9UA 4FUEA 1C5TA 6GCHF 3C1KA 5C5NA 2BMGB 2GZ7A 1KIGH 2ZZUH 3V13A 2EEKA 2QXJA 2VIWA 1TMUH 4BAQB 4Y79A 1BTZA 3RXVA 1Y3UA 2ZF0H 2KAIB 5AFZH 2GD4B 1W2KH 2AH4X 5DP5A 1XUGA 2I6QA 2DE8A 1AFEH 4ABGA 1H8IH 2Z9IA 1S5SA 4MNXA 5EQQA 2VH0A 3CS7A 3GISB 1FMGA 1NFYA 3GCNA 1YPKH 3OY5U 1C1MA 2OC1A 1ZHMA 2R2MB 3TVJB 2XNIA 3QZQA 9LPRA 3CP7A 5F8TA 4I31A 1K22H 1FN6A 2WUCA 1WV7H 4CRFA 4ZHLU 3ZV8A 3RLWH 2GKVE 1DITH 1YPHE 4B74A 3VB7A 4WXIA 1HGTH 1QJ6B 2I6SA 2V0BA 3QX5H 1DWBH 4BTTB 5ESTE 3RXHA 5T6FA 2PKSB 1YLCA 2BD8A 3EE0B 1GVZA 3M5MA 1CSOE 1EB2A 1T8OA 2FOGA 3BTFE 1DANH 2B5TB 1NROH 1K1OA 3WY8A 1SC8U 1K2I1 1UK4A 1JXPA 1DX5M 1BUIA 1FLEE 4FUDA 1JRSA 3SUDA 3UREA 2F83A 2AYWA 5FPTA 3A7VA 1V2RT 2Z9KA 1C5PA 2SGDE 2VIVA 2WINI 2ZTZA 1C5MD 2GDDA 3HPTB 1SLWB 1LHGH 2GCHG 1LHDH 5F8ZA 4B1TA 1AUJA 4RN6A 1T8NA 1NFXA 2FZZA 4Q7ZA 3P8FA 5EODA 4HGCA 3GDUA 4WMEA 1AI8H 8LPRA 2FI5E 3HATH 4YM9A 3A80A 5FAHA 1HV7A 3PV2A 1SQTA 2WPJS 5C67A 4NIVA 3L3TA 2ALVA 4LK4A 1F5RA 3LGTA 3R3GB 1SB1H 3L33A 2AGEX 1MBQA 1W0YH 4AGJA 1ZMLA 4I33A 4O3UA 3SNBA 1E38B 3BTGE 1AMHA 3PMBB 1AU8A 3JZ1B 1EUFA 1LVBA 4Y8YA 2BDCA 4D7GA 1HNEE 2CHAC 3SGBE 1GI5A 3OTJE 2J38A 3F9HA 5EXNA 1P11E 1LVMA 3SU5A 2NU1E 1EAXA 3MI4A 1C2KA 2ZC9H 5JB8S 4U30A 1FUJA 4NIYA 4WMDA 1ARBA 3ZZ4A 4NWKA 1W11U 1AO5A 1ID5H 2PFEA 3TJNA 5F03A 1FJSA 4AGKA 3S7KB 1YPJH 3ATMA 4AG2A 2EI7A 2ZI2H 1C5WB 4D76A 2EI8A 3SN8A 1ZYOA 2PTNA 3A87A 2C93B 1ZZZA 3MHWU 4CH2B 2ALPA 2Z9JA 4ABHA 1NC6A 3T29A 2ZGJA 1HAVA 1O2IA 4X1PU 1AZZA 1THPB 1Z6EA 1VGCB 2A5AA 1CHGA 2WUBA 3TK6A 1PQAA 1C5RA 1UCYK 1O2UA 1GJ5H 3MU4A 1O2YA 3BTDE 1HAZB 5EW2H 3A7XA 1FIWA 4IN2A 1PQ5A 1IHSH 1S81A 1FDPA 3P95A 2CHAB 3V12A 2ANMH 1B5GH 2V35A 3LKWA 1SLUB 3BTME 3MH7A 2A4OA 3SGQE 1OPHB 3U8TH 3UPEA 2THFB 3B23B 3KN2A 2SNVA 3SORA 5E0JA 5I46H 4WMFA 4FUJA 1GMHG 2P59A 3GY2A 1G37A 1XVOA 1O2OA 5EW1H 4ZXXH 3QUMP 2ZWLH 1NRPH 1OOKB 1TQ7B 3SU4A 1K1IA 1FQ3A 2QV1A 3LH1A 1RTLA 1EQ9A 3GICB 1X7AC 1NRNH 4ZKOU 3SNAA 3NKKA 5H4IB 1LQDB 1KTSB 4Y7BA 5CHAC 4MDSA 2CJIA 2ZA5A 5E0HA 1DE7H 3DFLA 1TGBA 1BMMH 4WH6A 1SGQE 2Y5FA 4BAHB 1FN8A 4FU8A 1P9SA 1GMDG 1C5UA 1JIRA 2R3YA 2CF9H 3TNTA 4UONA 1SFQB 1ZPBA 2AMQA 2ILNA 1ETSH 4ZXYH 5SGAE 1HLTH 3TITA 3MO9A 4ISLA 4UFEH 1XX9A 1QA7A 1C1RA 1PQ8A 4IMQA 2TGPZ 3TJUA 1C1SA 1W12U 1HAOH 1O34A 3A8BA 3SBKA 3VB4A 3NK8A 3RXQA 3MH4A 1AFQC 5L6NH 2BX3A 2G5VA 1GBKA 1SR5C 3RC4A 2FXRA 3HGNA 1TX7A 3PMAB 3ZZCA 1P3EA 3DUXH 1ANBA 1SQAA 3M5OA 3MH5A 1CGJE 2HPPH 3HKIB 1O3EA 3ATLA 3KF2A 4QT8C 2G55A 1A7SA 3TGIE 1AIXH 1E34B 3UWIA 1TBZH 3GY7A 3OX7U 3H5CB 2BB4A 2VH6A 4X1SU 3Q77A 1O2ZA 2ZHDA 1GGDC 3A88A 2QGRA 2TPIZ 1RS0A 3QK1A 1IAUA 5DP7A 1KXBA 1DT2A 3EQ0H 2AGGX 1O3DA 4CBNA 3ZVBA 1TLDA 1ZGIA 1C1WH 3LGWA 3RXIA 1ZMJA 2QA9E 1P0SH 1O32A 4IN1A 1AVGH 2OC7A 3RU4D 1QBNA 4NWLA 3MWIU 1B7XB 3W94A 1DSTA 1O3MA 1ORFA 2AIPA 5A8XA 1P2OA 4WJG2 4ZKNU 1OXGA 4U32A 4WF8A 5GCHF 1SGCA 1CT0E 1P12E 3SGAE 4UEHH 4DIHH 3AASA 2BLOA 4K1SA 4IW4E 5EG4A 2H1UA 1TIOA 1EOJA 3SI4H 4YOJA 1TNJA 2V6NA 5C20A 3BTKE 1Y5AT 1XXDA 1A2CH 1GBJA 1DDJA 2ZFTA 2ZU3A 1IQJA 1ELGA 1QCPA 3H7OA 4K2YA 3AAUA 2FESH 2VGCB 1FV9A 3GY8A 1ESBA 1GBIA 1WTGH 2FX6A 2XWBI 1SQOA 1HAPH 5DJ7A 1O38A 1TGNA 2PGQB 1EJNA 1L2EA 1GGDB 3SO3A 4E7RG 1GBLA 4BAKB 1EAIA 1IQKA 3GYMA 1QR3E 2WPIS 3O8CA 1QY6A 1J17T 1B0EA 2XTTB 1QJ7B 3KEEA 3HK3B 1WYKA 2WV5A 4Y7AA 1P8VC 1GBCA 1VCWA 3A89A 1SGFG 1HFDA 3KL6A 2XC4A 1O35A 2BY5X 2FDAA 1GHBF 4YO9A 1ESAA 2W7UA 3D49H 3MH6A 1YKTA 2GTBA 1SHHB 2C8YB 1GJBB 3SUEA 1AE8H 1C5OH 1ELVA 4H42U 3LC3A 3V3MA 2A5IA 3H09A 1DSUA 1QB9A 4CRCA 1D3TB 4YOGA 3F1SB 4OS6A 4BTIB 7ESTE 3OYPA 3OSYA 2A31A 3NZIA 1EZUC 1ETRH 3BTHE 3BTQE 4MQAA 1GMCG 1QURH 1S85A 3ODFA 2BD2A 5HM2A 3GY6A 1MTNB 1RRKA 3RXBA 1ELEE 1XXFA 1EAUA 5EQRA 2PTCE 1VJ9U 2NWNA 1LMWB 5C3NA 2UWLA 1P2MA 2ZU2A 4RSPA 1UK2A 1RIWC 1SGEE 1NU9A 2OC8A 3U98H 2J2UA 1KTTB 2ANYA 5T3HA 1NS3A 4X6PA 3AW0A 2PLXA 1A0JA 3UNQA 3A7WA 3ESTA 1YGCH 1BRUP 1W8BH 1E0FD 5G4BA 2FTMA 2BD3A 2VWLA 1MH0A 2BQ6B 5HYOA 5GNDA 1SGRE 2HWLB 3FFGA 2CMYA 4UFGH 1GCTC 1Y59T 1BHXF 1LCYA 1LQEA 6LPRA 2FODA 2G8TA 5DGJA 2JETC 4OS2A 1SGFA 1ZSKA 3F6UH 4XSKU 2BY9X 1C1UH 2Q6FA 1UHBB 2FOMB 3ZV9A 1SFIA 1FY4A 1YPEH 4JCNA 1FIZA 1N6XA 3ENSB 2OD3B 1TAWA 1PYTD 2W7SA 3RU4E 2JKHA 4CREA 8GCHF 1K1LA 1HAYB 2D26C 2ZHQH 1C1NA 2BQWB 2GMTC 2ANWA 3Q76A 1RIWB 5DKMA 5ESBA 3S9CA 3ZZAA 1C5ZB 4I8HA 1TQ0B 2H9HA 2FS9A 3RXUA 1TA2A 4YLQH 1OWKA 1XUHA 2C3SA 4XE4A 1HB0B 3ZVEA 3E91A 4RKJB 1INCA 1KSNA 1T31A 1Y8TA 1V2UT 2XW9A 4AFZA 2GCHF 2ZFRH 2PKAB 2SGEE 1P3CA 3MO3A 2HLCA 1O5CB 1V2ST 2V3HH 1SLVB 2WYJA 2VIDA 2FOCA 2UUFB 2FWWA 1FAXA 1OS8A 4Q80A 4DOQA 2C90B 4X8UH 1MZAA 2BVXH 1AWFH 1EOLA 1EZXC 1QL8A 5E8EH 2ZDKA 4GLYA 2G4UA 2JETB 3SV6A 3VFEA 4ZMAH 1PPCE 3KCGH 5IYTA 1J9CH 2H6MA 2DE9A 1T7CA 1QL9A 2O8UA 1DY8A 1ELCA 2JH6D 1GHAG 1LHFH 4E06H 1BTXA 4BOHA 1V2NT 1D3QB 1A4WH 2ZQ1A 3ZZ8A 4KTUA 1O2HA 1WBGB 3M5NA 2GCTC 3P70B 1KDQA 4YESB 1FONA 1GBBA 2VINA 1HXEH 2PSXA 2VB0A 1F7ZA 3RXAA 3BIVH 1BA8B 3A7TA 3GDVA 1G30B 1CT2E 1Q2WA 1TFXA 1O3PB 1C5LH 2P95A 2V3OH 3ZZ9A 1HYLA 3FANA 4A1VA 5A8ZA 3U8OH 5GXPA 1GI0A 3UR6A 3QGNB 3HKJB 3LIWA 1E35B 2O8TA 1C2FA 4JZFH 1NPMA 1AB9C 1O2JA 1TYNA 1YYY1 1QNJA 2OLGA 1MTWA 2AMDA 1VZQH 1P04A 1HPGA 2QXIA 1A5HA 1GBEA 3A86A 1RGQA 1OWJA 5EOKA 1MUEB 1GJDB 5A8YA 1AKSB 3T62A 4CRDA 1XUKA 2HGTH 2BZAA 3D62A 1YM0A 2RG3A 1EJAA 4AG1A 4Y0ZE 4ABJA 4O3TA 7LPRA 4DGJA 2J9NA 1KXAA 1C5YB 4O97A 1ZMNA 1V3XA 4XBCA 1YCPM 1O2PA 1W3CA 2WYGA 3U8RH 1BRCE 1V2LT 2ZG0H 6CHAC 4BXSA 1JBUH 4F49A 4CBOA 3BTTE 4YLUA 2ZECA 3LGYA 5FPSA 3ATKA 1D3PB 4BAMB 1C5QA 3GYLB 3RXOA 1O5FH 2HRVA 4DY7B 5JBTA 4NGAH 2STAE 4D8NA 1NTPA 3A84A 7GCHG 5JDUB 3STIA 1P03A 1LPKB 2O9QA 5AVDA 1AB9B 4XDEA 1TMBH 2FM2A 3BG8A 2BLWA 2P3UB 3MMGA 5EPYA 2ODPA 1MU6B 2AGIX 3RC5A 1QJ1B 4B2BA 3TK5A 1T4UH 1FI8A 3MYWA 2VVCA 1LDTT 3GCHC 4Y10E 4INLA 1B0FA 2BDBA 2R0LA 1UTQA 4ZUHA 1TONA 3DD2H 1ZGVA 4J2YB 2QXGA 4HFPB 4INHA 1AHTH 1SGPE 1FZZA 4I32A 1OWIA 1QIXB 3DFJA 1TOMH 2FTLE 2LPRA 2R9PA 4AN7A 1O5AB 4A1TA 1DS2E 3BSQA 3R0FA 1AZ8A 4X6OA 1TA6A 5EXLA 1IOEA 1JMOH 5GJ4B 1UTNA 1XVMA 2OC0A 1O2WA 2J94A 3RXTA 1GHXH 2OP9A 3LGIA 4DIIH 1S84A 1A3EH 4X8SH 5FCKA 1Z7KA 2FI3E 1FPHH 4TPYA 1ZTJA 2ZO3H 4TWYA 1MQ6A 3E6PH 1V2QT 1IQIA 1N1LA 4GCHG 1V2OT 2ZQ2A 4GHTA 1CE5A 1C1VH 1S6FA 3QN7A 5AF9H 1GL1A 1T8LA 1RD3B 2GGVB 1UCYE 1A46H 4JK5A 1HIAB 4B6FA 2WV4A 2DUCA 3VB6A 1QRXA 3KIDU 4K1EA 1LTOA 1FY1A 1BHXB 1O3GA 3U1JB 1UTLM 3UNSA 1MTSA 4B75A 3PTNA 2A4GA 1MCTA 3PLPA 1EATA 3FVFB 3S9BA 1TPAE 1OYTH 6GCHG 1TRNA 2EA3A 4ZKSU 3M7UA 1WTHD 3E90B 1WAYB 3SJ8A 2FOAA 4IC5A 5B6OA 5C2ZA 1GDNA 4ISIH 3BG4C 4IS5A 3KGPA 4YTAA 5BPEA 1MBMA 1ZSJA 1AD8H 1OYQA 3MNBA 4JYTA 3SZNA 3ZYDA 1QHRB 1PYTC 1V2KT 4NFFA 2XYAA 1UTMA 2ODQA 3VB5A 2BD4A 1C1TA 4BANB 4ISOA 1TPOA 2P8OC 3TJOA 3PMJA 3GCOA 3UFAA 1L1NA 1O5DH 1MTUA 1W7GH 3FZDA 3MNXA 2XCFA 1H9IE 2PSYA 4X6MA 5FHTA 1GG6C 3MU0A 3IITA 1AE5A 2ZFSA 1OP0A 3FP8E 3M35A 1LPZB 3ZYEA 2K1QA 2A4RA 4KGAA 1O2TA 1SSXA 1BJVA 1SI5H 3BIUH 4BXWA 2P3TB 1NO9H 3P8NA 3I29A 1J16A 3U69H 3Q00A 2AIQA 4MTBA 1T8MA 1L0ZA 3LT3A 4K5ZA 1WU1A 1C2LA 2IJD1 1EB1H 1W0ZU 4GSOA 1TNIA 4Q7YA 3SV7A 1SGTA 2ZU1A 1KYNA 3M61U 1QTFA 4Y71A 1TB6H 3UTUH 2TRMA 1NESE 1TPSA 1K1MA 1V2JT 4ABBA 1C1OA 4FXGH 2ZFPH 2F3CE 2RDLA 3Q3YA 5GPIB 3VXFH 3EDXB 3A82A 4FVBA 3BG4B 3EAJA 1BTPA 4ABFA 2O8MA 1TALA 4GUXA 2BDIA 1AWHB 2F9VA 2XRCA 5DK1A 4RKOB 1CA0C 2FS8A 1BBRE 1DXPA 2NU4E 1O3KA 2J34A 4NFEA 4ZROA 3SU6A 1J15A 1LHEH 2P8OB 4Y8XA 1ABJH 1GMCF 1O3HA 1SHYA 4CHAC 1HBTH 1P2QA 1EAWA 1UJ1A 5LH8A 2Y80A 2P94A 1GG6B 3QDZB 3IG6B 1EJMA 1S82A 1O33A 3RDZA 2P93A 5TCAA 2GV6A 2BTCE 2Q1JA 2B8OH 1EZQA 4OS1A 3TJVA 2ZDAH 3ZZ5A 2Z3DA 4WWYA 1H1BA 1LO6A 1A3BH 2OK5A 1FY5A 1C2HA 4FUCA 1IQGA 3O8BA 5CHAB 1PPEE 1MKXH 4NA8A 1GI9B 4XBDA 3RXPA 1H9LB 1C5VA 1UVSH 2ZGHA 1EZSC 4DT7B 2CXVA 3D23A 4NCYA 3A81A 2BDGA 1BDAA 2Y6TA 3SNDA 3MTYA 1TRYA 3QTVH 1Z8RA 1F0RA 2H9TH 1S6HA 1A5IA 1Z6JH 2UUYA 1K1PA 4I8KA 1F5KU 1H4WA 2BD9A 2J92A 1KXCA 3PWCA 3SU3A 2FEQH 4Y11E 4FU7A 4FU9A 4OS7A 4UD9H 3S0NA 2ZCKP 3ZVFA 2ZU4A 4OS4A 2ZGBH 4MPUA 2PWXA 1C2GA 1U6QA 2HNTF 3H7TA 3LGUA 1BMLA 2ZTXA 4UDWH 1Z8IB 2TGDA 3LDXH 1C1QA 1GCDA 3UIRA 1AFQB 4CHAB 4D9RA 2G51A 1P06A 3T5FH 1O5GH 1XMNB 3SUGA 1QBVH 1KY9A 1YLDA 3FP7E 1Q3XA 2QIQA 1FY3A 1QQ4A 1NFUA 1GJ7B 1WQSA 2R3UA 5A09A 2C8XB 1TNGA 2VBCA 4ABDA 1KLJH 1QL7A 1VCPA 1O39A 2P3FH 2ZCHP 1C4U2 1NN6A 1EPTC 5DP9A 2VWOA 3IWMA 3F9GA 1ZR0A 2FI4E 1SGIB 1MQ5A 4BNRA 1GJAB 3UOPA 1DVAH 1DFPA 1SGNE 5DP3A 1AUTC 1P05A 3A8AA 1SGYE 4XBBA 5F6MA 4NIXA 2SGAA 4O03A 1C9PA 3AW1A 3VB3A 3QWCH 3ZZ6A 1Y3YA 1TNLA 1G3EA 3KQDA 1LKBA 1BMAA 1GI7B 1CHOF 2Y82A 4TY6A 1UK3A 3EA7A 3DA9B 1BT7A 1G3BA 4CRGA 2G81E 1L4DA 1C4Y2 1ZJDA 1DICA 2ZGCA 1A5GH 1O0DH 1BZXE 4WVPE 4PROA 1XKBC 2OQUA 3FP6E 2B0FA 5HMAA 1YP9A 4LXBH 2G4TA 1O2LA 2QF3A 2SGPE 1GI2A 1F2SE 4IMZA 1ZRBA 4WXVA 1C5SA 4H6TA 1A61H 3CENA 1EPTB 1A0HB 1ARCA 1IQLA 3RXRA 1IQEA 1GI6A 2WV9A 3ATIA 1IQNA 3FAOA 3P17H 3BTEE 1O2QA 4X2XA 4X6NA 2IN2A 3MU5A 2ESTE 2XBXA 4K8YA 2HPQH 3SI3H 1UVTH 1NFWA 1O2XA 1EASA 3B9FH
chains in the Genus database with same CATH superfamily
2A5KA 1GJ4H 4B2AA 2F9BH 5A0CA 4ABIA 1TBRH 3RMMH 2ZDVH 2VNTA 2FIRH 4RI0A 1K28D 3SQHE 4JYUH 2A45B 3GY3A 2M5TA 4X2VA 2LP6A 3M3TA 3E0NB 3SHCH 1UHBA 4Y76A 2G52A 5L2YH 2CF8H 4K8BA 4MPWA 1CBWC 3I77A 1P02A 2G5NA 2TBSA 2HVYB 4B6EA 1S0QA 2A32A 2WPMS 4DJZB 2TIOA 3LC5A 2QC2A 2ZFQH 2C8ZB 1SL3A 5K0HA 2SGFE 5LPRA 1CO7E 1MAYA 2H9EH 1OP2A 4DW2U 4K3JA 1O3OA 4TPIZ 1ZTKA 3KQEA 1F0SA 2FLRH 4DVAU 1TMTH 4OS5A 2JIZD 1MCVA 2A7HA 1S83A 4Q7XA 3EA9A 3ATWA 2A0QB 1BQYA 3ITIA 4XFQA 2JJ2D 2R2WU 3A8DA 4JYVH 4OGYA 2ZNKH 1C2MA 2SNWA 5E2PA 2Q6DA 1V2VT 4ISNA 3FN8A 2OINA 4FUHA 2PKAA 1WSSH 2BLVA 3BTWE 3SU1A 1ELTA 2QF5A 2VVUA 3K2UA 5A0AE 2IOTA 2BVRH 1O2VA 1ZLRA 2FLBH 2NU3E 1PPHE 1UTPA 1WCZA 2Z9LA 4FUIA 1RTFB 1HAHH 4JMYA 4LOYH 1BITA 1L4ZA 1P2IA 3O8DA 2JH0D 3MQKC 2EQNA 1CGIE 3ZZDA 1C2JA 4JZDH 1ELBA 1PPGE 2XBYA 4X1RU 4UE7H 5DO4H 1GCTB 1N6YA 5HKKD 3TH3H 4ACAA 3B8JA 3E1XB 4FVDA 1PJPA 4I7YH 1O31A 1QRWA 1SPJA 2NU0E 4FUFA 2M2AA 1SOTA 2R0KA 2PR3A 4MNWA 2F4LA 2ZDLA 2VJ1A 1BJUA 1DY9A 2YOLA 1D9IA 1SMFE 3LGVA 1KXFA 1XUIA 2L74A 5CE1A 2ANKH 2HNTC 4AB9A 1HAGE 3RM0H 1QQUA 3F9EA 2F9OA 1DWCH 3M3SA 1GHBG 4I8LA 3M7QA 4X1QU 1HAIH 1G9IE 1TGTA 3RMOH 2OBOA 2GMTB 1GL0E 3K6ZA 1W14U 1VR1H 3QGJA 1S0RA 1F5LA 4B76A 2Z6BD 2GDEH 5FXLA 3ZZ3A 2A7JA 1GHYH 1HUTH 4LZ1H 4H6SB 1KXEA 1O2KA 2PV9B 1IQHA 2UWOA 3MU8A 3VEQB 4GCHF 1MKWH 1MU8B 5JPMH 5EJZA 1PPZA 2WPHS 2TGAA 2Z7FE 3DSGA 1GVKB 2SFAA 3URDA 1AKSA 5HGGA 1UTOA 3RXJA 2Y81A 2VIOA 2ZKSA 2EI6A 4MNVA 3DHKH 3QZRA 1L1GA 1P2NA 1SG8B 1WOFA 2C4FH 1GWAA 3SU2A 4DURA 1FAKH 2BY8X 2ZGXH 1AN1E 1WUNH 2BM2A 2QXHA 2VU8E 3NXPA 1TBQH 1GVLA 1UMAH 3STJA 4ZHAA 3T28A 4IBLH 4GHQA 1JWTA 4P02A 4LZ4B 3ZVCA 4AFQA 1UVPA 2H5CA 1GHZA 1VITG 3CNRA 3VG8A 1MZDA 3BEUA 4A92A 4K60A 4CR5A 2WZQA 3RM2H 3GCTG 2GCTB 2ZDMA 3ZZ7A 2BD7A 2O8WA 2WPLS 3TU7H 5B6LA 2HVXA 1C2EA 3UQVA 4ISHH 2PGBB 3M37A 2J98B 1AGJA 1CVWH 1P10A 3SU0A 1GMHF 1ZPZA 3MFJA 3SNCA 1G32B 2AMPA 2P16A 2CGAA 3RXDA 1PFXC 1MAXA 3SV9A 1WXRA 2KZ4A 4OM9A 4I8GA 1GI3A 2BLQA 1VITH 2ULLA 3UY9A 5JYIA 2HOBA 5EGMA 1NRRH 5FL7D 3OTPA 1WQVH 5J4QA 1DM4B 1QFKH 8GCHG 1XUFA 1GPZA 1QB6A 3A7ZA 1EFRD 4F4OC 2D1JA 2VIPA 3I78A 1TWXB 3VPKA 2RCEA 4X0WU 2XBWA 2Y5HA 5EU8A 1SOZA 4FUGA 2BY6X 1GMDF 2BQ7B 2ASUB 5IK2D 2XBVA 1ZSLA 5FCRA 1MTVA 2BYAX 2FPZA 2OBQA 5GDSH 1BTYA 3LJOA 3SNEA 4U01A 4NIWA 3LJJA 3SQEE 3UWJH 4O9VA 3LOXA 4AX9H 1CA8B 1ZHPA 5GIBA 5HIZA 4GPGA 4B2CA 1TABE 3PLKA 1NRQH 2UUJB 1TNKA 1V2MT 3T27A 2ZFFH 2BOHB 6CHAB 1F0TA 1P9UA 3PWBA 4HTCH 2Q6GA 2XC5A 1BRAA 1GBAA 1YPMH 3TLOA 2ZDNA 3RXMA 4P00A 3RXGA 3UOUA 3PTBA 1A1RA 1HRTH 3E0PB 1VGCC 5T1VA 3A8CA 4ZH8A 3KQBA 1BCUH 3C27B 5F53A 1HIAA 4KTSA 1SBWA 1ZHRA 1UTJA 3SJKA 2XXLA 1THRH 1ZTLA 3ZZBA 1O2RA 3UQOA 2KX4A 1K9OE 3OEED 1O2MA 3RXLA 3PV5A 2ZEBA 1D3DB 5HXFA 4JZIA 4NA7A 1ELDE 1G36A 5KECA 1BTHH 1V2TT 5FBIA 1AY6H 1NU7B 1LHCH 1GHVH 2GX4A 3GCHB 5J4SA 1DPOA 1TRMA 4FETA 3AK5A 2BD5A 3QLPH 2YMSC 5L30H 4M9FA 3MNSA 1FX0B 1O2GH 4D7FA 2D2DA 4WH8A 2A2XH 2W26A 2XNDD 4HI3A 1ANDA 5I25A 5L2ZH 2H5DA 1FY8E 3M36A 2BXUH 1YCPK 3TIUA 1IHTH 1Y3XA 2FOEA 4KKDA 1JRTA 1Z8GA 4X2YA 1O3CA 1MABB 1YPHC 4BTUB 1HJAC 3ZVDA 3GY4A 5JBCS 4NZQA 1O3LA 5JB9S 3M3VA 2FOBA 2BXTH 5CDFE 1Q31A 2AFQB 3RC6A 4TSFD 1O3AA 2KFWA 2Z3EA 2RDEA 3HK6B 1EP6A 3SUFA 4XOJA 1NBME 3URCA 1O3NA 1ZOMA 4MVNA 2Z94A 5C5OA 4RT0A 3GOVB 5FBEA 2BHGA 2CN0H 3FKSD 3RXKA 1TE0A 2BZ6H 2VIQA 3O8RA 1J14A 2QYIA 1OWEA 1HAVB 3SV8A 2A7CA 3GY5A 3LH3A 4DT4A 1TGSZ 1BOQA 1NY22 3M5LA 3JZ2B 3NWUA 2GZ9A 2OXSA 1C9TA 1JIMA 1G3DA 2PW8H 4Z0KA 1RXPA 3S9AA 3BEFB 4U2WA 1MD8A 1V2WT 4BAOB 1BMNH 3OE7D 1BTUA 1UVUH 1YCPH 2FO9A 1OP8A 2W6JD 4Q2KA 1IQMA 4IGDA 2BDYA 1W7XH 5FX6A 2ZCLP 1GBHA 1E36B 1AVXA 4X8TH 4ABAA 4R8TB 4IC6A 5A0BA 2EY4C 1MKXK 5JBBS 2BX4A 2FMJA 4Z1MD 3UNRA 1ZJKA 1GJCB 2YNBA 3A85A 4ASUD 4GVUA 7KMEH 4MLFB 1HJAB 1YBWA 2ZU5A 2PUXB 3F2GA 1XM1A 3EA8A 1UCYH 3BF6H 4AZ2B 2TGTA 1Y3VA 3FZZA 5C1YA 3NUMA 3ELAH 1GBFA 1W13U 3U1IB 4THNH 3A7YA 1LVYA 1N8OC 1XUJA 2JDID 3QTOH 4CRBA 2A2QH 1RJXB 3MNCA 1C2IA 1COWD 1ETTH 1C5XB 3ZVGA 2GT8A 1H8ED 2ZIQH 3SHAH 2ODYB 2Y7ZA 1ESTA 3G01A 3K65B 1QA0A 1HJ8A 1NM6A 2ZHEH 3P8GA 4GAWA 1Y5UT 1GJ9B 1BRBE 4NA9H 5K7RA 1JOUB 2BDAA 3PYHA 4ZKRU 2ZPQA 1Z1IA 3MO6A 2ZPRA 4NSVA 2FYQA 3PV4A 2J4IA 2QF4A 1LKAA 4NSYA 3E8LA 1CT4E 3Q3KA 4AYVB 1W10U 2W5EA 1A0LA 3PLBA 3V7TA 1DUEA 1BBRK 1TGCA 1TPPA 1D6RA 3E16B 3E3TA 2VGCC 3OY6U 4A1XA 1PPFE 1CGHA 2NU2E 4Q4LA 4INKA 2QCYA 1XKAC 2AHME 4YOIA 4ZAEA 2GT7A 5CMXH 2FOHA 3RXEA 1O3FA 1CA0B 1DLKB 4MNYA 1O2SA 1H9HE 8KME2 1N8OB 4D9QA 2VWMA 9ESTA 3S7HB 3VXEH 3RMLH 1OWDA 3HGPA 4MG3A 2WPKS 3NPSA 4NZLA 5DPAA 4FUBA 5DP4A 1SGDE 4H4FA 4X2WA 4WY3A 1VJAU 4A6LA 1KLTA 1FPCH 1ACBE 5TJXA 3KQCA 4Y8ZA 1O37A 1P09A 4YT6H 2KCOA 2EC9H 3QO6A 3SOSA 5HM9A 2HALA 2F9PA 2ZP0H 1F0UA 1UW7A 1C5NH 4KP0A 5LPFA 1BBRH 1NRSH 3AVZA 3RP2A 1FNIA 2D8WA 1G3CA 3A83A 5ABWA 5E2OA 2UWPA 1E1QD 1GJ6A 5C0UA 4AORA 1Z8JB 1HAXB 1O30A 5EPNA 3UUZA 2GP9B 1CQQA 1MTNC 3N99A 1P2KA 5LGOA 1G2LA 1ABIH 3SJOA 4JZ1A 4OGXA 3VGCC 1TNHA 2OTVA 1EKBB 1GDUA 4X8VH 1P2JA 2XCNA 1Z71A 2Y7XA 2ZTYA 2Y5GA 1EPTA 4AB8A 3TK9A 2CV3A 2FX4A 3RXSA 5JBAS 1FXYA 2STBE 1T32A 3MU1A 3D65E 1GHAF 1GI8B 1O3JA 1V2PT 2IPHA 2BDHA 2PUQH 4TWWA 2OCVB 4SGAE 3SJ9A 2KM0A 2F91A 5DP8A 2RA3A 2CK3D 4DG4A 2OUAA 3RUOA 2BVSH 4A7IB 2KAIA 5C17A 1O5BB 1MMJN 1L1JA 1V6DA 2FYRA 1TX8A 2IJOB 2WHXA 3UR9A 5C1UA 4RT1A 1KLIH 3BV9B 4ZHMU 4Z6AH 3W95A 1YF4A 1QGFA 1P57B 1GDQA 3LPRA 1J8AA 1SVPA 3TPIZ 3KNXA 1UTKA 1K1JA 1Z1JA 2A1DB 2HNTE 4MPXA 2SGQE 1NT1A 3TNSA 2QF0A 4KTCA 1C1PA 2J95A 1YC0A 2OQ5A 4J1YA 2YNAA 5GWZA 5DP6A 1MD7A 2LELA 3RU4T 8ESTE 1G2MA 2B7DH 5T6GA 3VGCB 4NG9H 5DSFA 4R0IA 2BY7X 3EGKH 4X1NU 1RTKA 1AQ7A 4I8JA 1GBMA 3L6PA 4UFFH 5IDKA 3ODDA 1BB0B 2XWAA 1E37B 1LPGB 1YPLH 3RXCA 5T6DA 2YMSD 2GVFA 3PB1E 5BRRE 3TGKE 3BEIB 3P6ZB 5F8XA 4E7NA 1VITF 5FX5A 2RA0A 1ZPCA 3T2NA 3PM3A 2QAAA 2ZHFH 3GCTF 3PROA 2GZ8A 2W3KA 3V0XA 3SZEA 2VVVA 4CH8B 1O36A 2B9LA 3SYJA 1UO6A 4A5TS 3F68H 1H8DH 1VCQA 6ESTA 4B71A 3T26A 1DWEH 1P01A 2AS9A 1UVOA 2QY0B 2Z9GA 1GI1A 1YY3A 5EXMA 1EP5A 5DG6A 1DXWA 3GDSA 1F92A 4HZHA 3T25A 1EXFA 1NZQH 4SGBE 3N7DA 4AYYB 1D6WA 4YXWD 3F3BA 1D4PB 2BOKA 1CU1A 3BN9A 5GCHG 3RXFA 4UFDH 4VGCC 3Q3XA 1ANCA 3WWBA 5ETXA 3S69A 1ZRKA 4K69A 1ELAA 1YPGH 2AERH 7GCHF 2F9UA 4Y0YE 2ZPSA 1RFNA 2K8IA 3F9FA 3TGJE 3AAVA 4TY7A 4ABEA 3P8OA 1GJ8B 2PHBA 3SV2H 4KELA 1GI4A 1T4VH 1OKXA 2GV7A 3NCLA 1CBWB 1KXDA 3P92A 3PMHB 1DOJA 1MKWK 4CRAA 4DCDA 2VWNA 2AEIH 4TYDA 1QB1A 2W3IA 1LVOA 1QBOA 3PO1C 3FO8D 2JH5D 1DWDH 2O8LA 5E0GA 2QN5T 3CS0A 1HDTH 1PQ7A 3TH4H 1OSSA 5KGOA 5FPYA 1O2NA 1BTWA 4JZEH 1SLXB 2UUKB 1TOCB 5EQSA 2F9NA 3OU0A 2A4QA 3K6YA 1C4V2 2C8WB 3U9AH 2FP7B 2GJGA 5AHGH 4AFUA 4CR9A 3EE7A 1ELFA 4Y6DA 1DLEA 1DUAA 5C1XA 3SW2B 1CHOG 4ZCNA 3DT0H 2V7QD 2H2ZA 2LNCA 2G00A 1PPBH 4AFSA 4AOQA 3NRLA 1ANEA 5A2MH 4E05H 3EYDA 4B73A 5AFYH 3RLYH 4YZUA 4K1TA 4VGCB 1GBTA 1GHWH 2XC0A 1Y5BT 4ESTE 3N7OA 4YT7H 1OWHA 1OX1A 3U28C 3KQ5A 1K1NA 2FOFA 3ZVAA 1C2DA 1AVWA 1BIOA 3K9XB 1EX3A 5PTPA 1IQFA 4M7GA 1O3BA 1K21H 1TX6A 3TH2H 4JK6A 1GBDA 1HJ9A 3SJIA 3MOCA 1O3IA 4I86A 1Y3WA 3LONA 3M7TA 2Z3CA 4MPVA 1H8HD 4ASHA 2PKSC 3PO1B 3LU9B 1O5EH 2ZHWH 3KHVA 1THSH 5TCCA 1QZ8A 1QRZA 3RMNH 1KDQB 1HXFH 5LPEA 1HCGA 1M9UA 4FUEA 1C5TA 6GCHF 3C1KA 5C5NA 2BMGB 2GZ7A 2J98A 1KIGH 2ZZUH 3V13A 2EEKA 2QXJA 2VIWA 3OFND 1TMUH 4BAQB 4Y79A 1BTZA 3RXVA 1Y3UA 2ZF0H 2KAIB 5AFZH 2GD4B 1W2KH 2AH4X 3PRDA 1XUGA 5DP5A 5EJLA 2I6QA 2DE8A 1AFEH 4ABGA 1H8IH 2Z9IA 1S5SA 4MNXA 5EQQA 2VH0A 3CS7A 3GISB 5C94A 1FMGA 1NFYA 3GCNA 1YPKH 3OY5U 1C1MA 2OC1A 1ZHMA 2R2MB 3TVJB 2XNIA 3QZQA 9LPRA 3CP7A 5F8TA 4I31A 1K22H 1FN6A 2WUCA 1WV7H 4CRFA 4ZHLU 3ZV8A 3RLWH 2GKVE 1DITH 1YPHE 4B74A 3VB7A 4WXIA 1SQRA 1HGTH 1QJ6B 2I6SA 2V0BA 3QX5H 1DWBH 2JJ1D 4BTTB 5ESTE 3RXHA 5T6FA 2PKSB 1YLCA 2BD8A 3EE0B 1GVZA 3M5MA 1CSOE 1EB2A 1T8OA 2FOGA 3BTFE 3PRBA 1DANH 2B5TB 5C0TA 1NROH 1K1OA 3WY8A 1SC8U 1K2I1 1UK4A 1JXPA 1DX5M 1BUIA 1FLEE 4FUDA 1JRSA 3SUDA 3UREA 2F83A 2AYWA 5FPTA 3A7VA 1V2RT 2Z9KA 1C5PA 2SGDE 2VIVA 2WINI 2ZTZA 1C5MD 2GDDA 3HPTB 1SLWB 1LHGH 2GCHG 1LHDH 5F8ZA 4B1TA 1AUJA 4RN6A 1T8NA 1NFXA 2FZZA 4Q7ZA 4HG6A 3P8FA 5EODA 4HGCA 3GDUA 4WMEA 1AI8H 8LPRA 2FI5E 3HATH 4YM9A 3A80A 5FAHA 1HV7A 3PV2A 1SQTA 2WPJS 5C67A 4NIVA 1W0JD 3L3TA 2ALVA 4LK4A 1F5RA 3LGTA 3R3GB 1SB1H 3L33A 2AGEX 1MBQA 1W0YH 4AGJA 1ZMLA 4I33A 4O3UA 3SNBA 1E38B 3BTGE 1AMHA 3PMBB 1AU8A 3JZ1B 1EUFA 1LVBA 4Y8YA 2BDCA 3WWFA 4D7GA 1HNEE 2CHAC 3SGBE 1GI5A 3OTJE 2J38A 3F9HA 5EXNA 1P11E 1LVMA 3SU5A 2NU1E 1EAXA 3MI4A 1C2KA 2HLDD 2ZC9H 5JB8S 4U30A 1FUJA 4NIYA 4WMDA 1ARBA 3ZZ4A 4NWKA 1W11U 1AO5A 1ID5H 2PFEA 3TJNA 5F03A 3N7EA 1FJSA 4AGKA 3S7KB 1YPJH 3ATMA 4AG2A 2EI7A 2J97A 2ZI2H 1C5WB 4D76A 2EI8A 3SN8A 1ZYOA 2PTNA 3A87A 2C93B 1ZZZA 3MHWU 4CH2B 2ALPA 2Z9JA 4ABHA 1NC6A 3T29A 2ZGJA 1HAVA 1O2IA 4X1PU 1AZZA 1THPB 1Z6EA 1VGCB 3OEHD 2A5AA 1CHGA 2WUBA 3TK6A 2KR7A 1PQAA 1C5RA 1UCYK 1O2UA 1GJ5H 3MU4A 1O2YA 3BTDE 1HAZB 5EW2H 3A7XA 1FIWA 4IN2A 1PQ5A 1IHSH 1S81A 1FDPA 3P95A 2CHAB 3V12A 2ANMH 1B5GH 2V35A 3LKWA 1SLUB 3BTME 3MH7A 2A4OA 3SGQE 1OPHB 3U8TH 3UPEA 2THFB 3B23B 3KN2A 2SNVA 3SORA 5E0JA 5I46H 4WMFA 4FUJA 1GMHG 2P59A 3GY2A 1G37A 1XVOA 2YMSB 1O2OA 5EW1H 4ZXXH 3QUMP 2ZWLH 1NRPH 1OOKB 1TQ7B 3SU4A 1K1IA 1FQ3A 4Q63A 1S6LA 3ZIAD 2QV1A 3LH1A 1RTLA 1EQ9A 3GICB 1X7AC 1NRNH 4ZKOU 3SNAA 3NKKA 5H4IB 1LQDB 1KTSB 4Y7BA 5CHAC 4MDSA 2CJIA 2ZA5A 5E0HA 1DE7H 3DFLA 1TGBA 1BMMH 4WH6A 1SGQE 2Y5FA 4BAHB 1FN8A 4FU8A 1P9SA 1GMDG 1C5UA 1JIRA 2R3YA 2CF9H 3TNTA 4UONA 1SFQB 1ZPBA 2AMQA 2ILNA 1ETSH 4ZXYH 5SGAE 1HLTH 3TITA 3MO9A 4ISLA 3DSOA 4UFEH 1XX9A 1QA7A 1C1RA 1PQ8A 4IMQA 2TGPZ 3TJUA 1C1SA 1W12U 1HAOH 1O34A 3A8BA 3SBKA 3VB4A 3NK8A 3RXQA 3MH4A 1AFQC 5L6NH 2BX3A 2G5VA 1GBKA 1SR5C 3RC4A 2FXRA 3HGNA 1TX7A 3PMAB 3ZZCA 1P3EA 3DUXH 1ANBA 1SQAA 3M5OA 3MH5A 4FOUC 1CGJE 2HPPH 3HKIB 1O3EA 3ATLA 3KF2A 4QT8C 2G55A 1A7SA 3TGIE 1AIXH 1E34B 3UWIA 1TBZH 3GY7A 3OX7U 3H5CB 2BB4A 2VH6A 4X1SU 3Q77A 1O2ZA 2ZHDA 1GGDC 3A88A 2QGRA 2TPIZ 1RS0A 3QK1A 1IAUA 5DP7A 1KXBA 1DT2A 3EQ0H 2AGGX 1O3DA 4CBNA 1WDIA 3ZVBA 1TLDA 1ZGIA 1C1WH 3LGWA 3RXIA 1ZMJA 2QA9E 1P0SH 1O32A 4IN1A 1AVGH 2OC7A 3RU4D 1E1RD 1QBNA 4NWLA 3MWIU 1B7XB 3W94A 1DSTA 1O3MA 1ORFA 2AIPA 3F0OA 5A8XA 1P2OA 4WJG2 4ZKNU 1OXGA 4U32A 4WF8A 5GCHF 1SGCA 1CT0E 1P12E 3SGAE 4UEHH 4DIHH 3AASA 2BLOA 4K1SA 4IW4E 5EG4A 2H1UA 2V3MA 1TIOA 1EOJA 3SI4H 4YOJA 1TNJA 2V6NA 5C20A 3BTKE 1Y5AT 1XXDA 1A2CH 1GBJA 1DDJA 2ZFTA 2ZU3A 1IQJA 1ELGA 1QCPA 3H7OA 4K2YA 3AAUA 2FESH 2VGCB 1FV9A 3GY8A 1ESBA 1GBIA 1WTGH 2FX6A 2XWBI 1SQOA 1HAPH 2F43B 2WPDD 5DJ7A 1O38A 1TGNA 2PGQB 1EJNA 1L2EA 1GGDB 3SO3A 4E7RG 1GBLA 4BAKB 1EAIA 1IQKA 3GYMA 1QR3E 2WPIS 3O8CA 1QY6A 1J17T 1B0EA 2XTTB 1QJ7B 3KEEA 3HK3B 1WYKA 2WV5A 4Y7AA 1P8VC 1GBCA 1VCWA 3A89A 1SGFG 1HFDA 3KL6A 2XC4A 2RFKC 1O35A 2BY5X 2FDAA 1GHBF 4YO9A 1ESAA 2W7UA 3D49H 2IPQX 1YKTA 3MH6A 2GTBA 1SHHB 2C8YB 1GJBB 3SUEA 3OAAD 1AE8H 1C5OH 1ELVA 3KYFA 4H42U 3LC3A 3V3MA 2A5IA 3W1EA 3H09A 1DSUA 1QB9A 4CRCA 1D3TB 4YOGA 3F1SB 4OS6A 4BTIB 7ESTE 3OYPA 3OSYA 2A31A 2KCPA 3NZIA 4F55A 1EZUC 1ETRH 3BTHE 3BTQE 4MQAA 1GMCG 1QURH 1S85A 3ODFA 2BD2A 5HM2A 3GY6A 1MTNB 2KCAA 1RRKA 3RXBA 1ELEE 1XXFA 1EAUA 5EQRA 2PTCE 1VJ9U 2NWNA 1LMWB 5C3NA 2UWLA 1P2MA 2ZU2A 4RSPA 1UK2A 1RIWC 1SGEE 1NU9A 2OC8A 3U98H 2J2UA 1KTTB 2ANYA 5T3HA 1NS3A 3UAIC 4X6PA 3AW0A 2PLXA 1A0JA 3UNQA 3A7WA 4TT3D 3ESTA 1YGCH 1BRUP 1W8BH 1E0FD 5G4BA 2FTMA 2BD3A 2VWLA 1MH0A 2BQ6B 5HYOA 5GNDA 1SGRE 2HWLB 3FFGA 2CMYA 4UFGH 1GCTC 1Y59T 2L6OA 1BHXF 1LCYA 1LQEA 6LPRA 2PP6A 2FODA 2G8TA 5DGJA 2JETC 4OS2A 1SGFA 1ZSKA 3F6UH 4XSKU 2BY9X 1C1UH 2Q6FA 1UHBB 2FOMB 3ZV9A 1SFIA 1FY4A 1YPEH 4JCNA 1FIZA 1N6XA 3ENSB 2OD3B 1TAWA 2J5UA 1PYTD 2W7SA 3RU4E 2JKHA 3WW7A 4CREA 8GCHF 1K1LA 1HAYB 2D26C 2ZHQH 1C1NA 2BQWB 2GMTC 2ANWA 3Q76A 1RIWB 5DKMA 5ESBA 3S9CA 3ZZAA 1C5ZB 4I8HA 1TQ0B 2H9HA 2FS9A 3RXUA 1TA2A 4YLQH 1OWKA 2KCYA 1XUHA 3F2FA 2C3SA 4XE4A 1HB0B 3ZVEA 3E91A 4RKJB 1INCA 1KSNA 1T31A 1Y8TA 1V2UT 2XW9A 4AFZA 2GCHF 2ZFRH 2PKAB 2SGEE 1P3CA 3MO3A 2HLCA 1O5CB 1V2ST 2V3HH 1SLVB 2WYJA 2VIDA 2FOCA 2UUFB 2FWWA 1FAXA 1OS8A 4Q80A 4DOQA 2C90B 4X8UH 1MZAA 2BVXH 1AWFH 1EOLA 1EZXC 1QL8A 5E8EH 2ZDKA 4GLYA 2G4UA 2WSSD 2JETB 3SV6A 3VFEA 4ZMAH 3KYGA 5DN6D 1PPCE 3KCGH 5IYTA 1J9CH 2H6MA 2DE9A 1T7CA 1QL9A 2O8UA 1DY8A 1ELCA 2JH6D 1GHAG 1LHFH 4E06H 1BTXA 4BOHA 1V2NT 1D3QB 1A4WH 2ZQ1A 3ZZ8A 4KTUA 1O2HA 4ACBA 1WBGB 3M5NA 2GCTC 3P70B 1KDQA 4YESB 1FONA 1GBBA 2VINA 1HXEH 2PSXA 2VB0A 1F7ZA 3RXAA 3BIVH 1BA8B 3A7TA 3GDVA 1G30B 1CT2E 1Q2WA 1TFXA 1O3PB 1C5LH 2P95A 2V3OH 3ZZ9A 1HYLA 3FANA 4A1VA 5A8ZA 3U8OH 5GXPA 1GI0A 3UR6A 3QGNB 3HKJB 3LIWA 1E35B 2O8TA 1C2FA 4JZFH 1NPMA 1AB9C 1O2JA 1TYNA 1YYY1 1QNJA 2OLGA 1MTWA 2AMDA 1VZQH 1P04A 1HPGA 2QXIA 1A5HA 1GBEA 3A86A 1BMFD 1RGQA 1OWJA 5EOKA 1MUEB 1GJDB 1NBMD 5A8YA 1AKSB 3T62A 4CRDA 1XUKA 2HGTH 4XRNA 2BZAA 3D62A 1YM0A 2RG3A 1EJAA 4AG1A 4Y0ZE 4ABJA 4O3TA 7LPRA 4DGJA 2J9NA 1KXAA 1C5YB 4O97A 1ZMNA 1V3XA 4XBCA 1YCPM 1O2PA 1W3CA 1K0HA 2WYGA 3U8RH 1BRCE 1V2LT 2ZG0H 3DCLA 6CHAC 4BXSA 1JBUH 4F49A 4CBOA 3BTTE 4YLUA 2ZECA 3LGYA 5FPSA 3ATKA 1D3PB 4BAMB 1C5QA 3GYLB 3RXOA 1O5FH 2HRVA 4DY7B 5JBTA 4NGAH 2STAE 4D8NA 1NTPA 3A84A 7GCHG 5JDUB 3STIA 1P03A 1LPKB 2O9QA 5AVDA 1AB9B 4XDEA 1TMBH 2FM2A 3BG8A 2BLWA 2P3UB 3MMGA 5EPYA 2ODPA 1MU6B 2AGIX 3RC5A 1QJ1B 4B2BA 3TK5A 1T4UH 1FI8A 3MYWA 2W6ID 2VVCA 4F48B 1LDTT 3GCHC 4Y10E 3UB0A 4INLA 1B0FA 2BDBA 2R0LA 1UTQA 2QE7D 1KMHB 4ZUHA 1TONA 3DD2H 1ZGVA 4J2YB 2QXGA 4HFPB 3GS9A 4INHA 1AHTH 1SGPE 1FZZA 4I32A 1OWIA 1QIXB 1VKYA 3DFJA 1TOMH 2FTLE 2LPRA 2R9PA 4AN7A 1O5AB 4A1TA 1DS2E 3BSQA 3R0FA 1AZ8A 4X6OA 1TA6A 5EXLA 3FOAA 1IOEA 1JMOH 5GJ4B 1UTNA 1XVMA 1O2WA 2J94A 2OC0A 3RXTA 1GHXH 2OP9A 3LGIA 4DIIH 1S84A 1A3EH 1YLNA 4X8SH 5FCKA 1Z7KA 2FI3E 1FPHH 4TPYA 1ZTJA 2ZO3H 4TWYA 1MQ6A 3E6PH 1V2QT 1IQIA 1N1LA 4GCHG 1V2OT 2ZQ2A 4GHTA 1CE5A 1C1VH 1S6FA 5EJ1A 3QN7A 5AF9H 1GL1A 1T8LA 1RD3B 2GGVB 1UCYE 1A46H 4JK5A 1HIAB 4B6FA 2WV4A 2DUCA 3VB6A 1QRXA 3KIDU 4K1EA 1LTOA 3DSPA 1FY1A 1BHXB 1O3GA 3U1JB 1UTLM 4XD7D 3UNSA 1MTSA 4B75A 3PTNA 2A4GA 1MCTA 3PLPA 1EATA 3FVFB 3S9BA 1TPAE 1OYTH 6GCHG 1TRNA 2EA3A 4ZKSU 3M7UA 1WTHD 3E90B 1WAYB 3SJ8A 2FOAA 4IC5A 5B6OA 5C2ZA 1GDNA 4ISIH 3BG4C 4IS5A 3KGPA 4YTAA 5BPEA 1MBMA 1ZSJA 1AD8H 1OYQA 3MNBA 4JYTA 3SZNA 3ZYDA 1QHRB 1PYTC 1V2KT 4NFFA 2XYAA 1UTMA 2ODQA 3VB5A 2BD4A 1C1TA 4BANB 4ISOA 1TPOA 2P8OC 3TJOA 3PMJA 3GCOA 3UFAA 1L1NA 1O5DH 1MTUA 1W7GH 3FZDA 3MNXA 2XCFA 1H9IE 2PSYA 4X6MA 5FHTA 1GG6C 3MU0A 3IITA 1AE5A 2ZFSA 1OP0A 3FP8E 3M35A 1LPZB 3ZYEA 2K1QA 2A4RA 4KGAA 1O2TA 1SSXA 1BJVA 1SI5H 5KEDA 3BIUH 4BXWA 2P3TB 1NO9H 3P8NA 3I29A 1J16A 3U69H 3Q00A 2AIQA 4MTBA 1T8MA 1L0ZA 3LT3A 4K5ZA 1WU1A 1C2LA 2IJD1 1EB1H 1E79D 1W0ZU 4GSOA 1TNIA 4Q7YA 3SV7A 1SGTA 2ZU1A 1YWUA 1KYNA 3M61U 3F0PA 1QTFA 4Y71A 1TB6H 3UTUH 2TRMA 1NESE 1TPSA 1K1MA 1V2JT 4ABBA 1C1OA 4FXGH 2ZFPH 2F3CE 2RDLA 3Q3YA 5GPIB 3VXFH 3EDXB 3A82A 4FVBA 3BG4B 3EAJA 1BTPA 4ABFA 2O8MA 1TALA 4GUXA 2BDIA 1AWHB 2F9VA 2XRCA 5DK1A 4RKOB 1CA0C 2FS8A 3F2HA 1BBRE 1DXPA 2NU4E 1O3KA 2J34A 4NFEA 4ZROA 3SU6A 1J15A 1LHEH 2P8OB 4Y8XA 1ABJH 1GMCF 1O3HA 1SHYA 4CHAC 1HBTH 1P2QA 1EAWA 1UJ1A 5LH8A 2Y80A 2P94A 1GG6B 3QDZB 3IG6B 1EJMA 1S82A 1O33A 3RDZA 2P93A 5TCAA 2GV6A 2BTCE 2Q1JA 2B8OH 1EZQA 4OS1A 3TJVA 2ZDAH 3ZZ5A 2Z3DA 4WWYA 1H1BA 1LO6A 1A3BH 2OK5A 1FY5A 1C2HA 4FUCA 1IQGA 3O8BA 5CHAB 1PPEE 1MKXH 4NA8A 2K0QA 1GI9B 4XBDA 1W0KD 3RXPA 1H9LB 1C5VA 1UVSH 2ZGHA 1EZSC 4DT7B 2CXVA 3D23A 4NCYA 3A81A 2BDGA 1BDAA 2Y6TA 3SNDA 3MTYA 1TRYA 3QTVH 1Z8RA 1F0RA 2H9TH 1S6HA 1A5IA 1Z6JH 2UUYA 1K1PA 4I8KA 1F5KU 1H4WA 2BD9A 2J92A 1KXCA 3PWCA 3SU3A 2FEQH 4Y11E 4FU7A 4FU9A 4OS7A 4UD9H 3S0NA 2ZCKP 3ZVFA 2ZU4A 4OS4A 2ZGBH 4MPUA 2PWXA 1C2GA 1U6QA 2HNTF 3H7TA 3LGUA 1BMLA 2ZTXA 4UDWH 1Z8IB 2TGDA 3LDXH 1C1QA 1GCDA 3UIRA 1AFQB 5CHBA 4CHAB 4D9RA 2G51A 1P06A 3T5FH 1O5GH 1XMNB 3SUGA 1QBVH 1KY9A 1YLDA 3FP7E 1Q3XA 2QIQA 1FY3A 1QQ4A 1NFUA 1GJ7B 1WQSA 2R3UA 5A09A 2C8XB 1TNGA 2VBCA 5EIYA 4ABDA 1KLJH 1SKYE 1QL7A 1VCPA 1O39A 2P3FH 2ZCHP 1C4U2 1NN6A 1EPTC 5DP9A 2VWOA 3IWMA 3F9GA 1ZR0A 2FI4E 1SGIB 1MQ5A 4BNRA 1GJAB 3UOPA 1DVAH 1DFPA 1SGNE 5DP3A 1AUTC 1P05A 3A8AA 1SGYE 4XBBA 2XOKD 5F6MA 4NIXA 2SGAA 4O03A 1C9PA 3AW1A 3VB3A 3QWCH 3ZZ6A 1Y3YA 1TNLA 1G3EA 3KQDA 1LKBA 1BMAA 1GI7B 1CHOF 2Y82A 4TY6A 1UK3A 3EA7A 3DA9B 1BT7A 1G3BA 5HIYA 4CRGA 2G81E 1L4DA 1C4Y2 1ZJDA 1DICA 2ZGCA 1A5GH 1O0DH 1BZXE 4WVPE 4PROA 1XKBC 2OQUA 3FP6E 2B0FA 4AC9A 5HMAA 1YP9A 4LXBH 2G4TA 1O2LA 2QF3A 2SGPE 1GI2A 1F2SE 4IMZA 1ZRBA 4WXVA 1C5SA 4H6TA 1A61H 3CENA 1EPTB 1A0HB 1ARCA 1OHHD 1IQLA 3RXRA 1IQEA 1GI6A 2WV9A 3ATIA 1IQNA 3FAOA 3P17H 3BTEE 1O2QA 4X2XA 4X6NA 2IN2A 3MU5A 2ESTE 2XBXA 4K8YA 2HPQH 3SI3H 1UVTH 1NFWA 1O2XA 1EASA 3B9FH
chains in the Genus database with same CATH topology
2A5KA 1GJ4H 4B2AA 2F9BH 5A0CA 4ABIA 1TBRH 3RMMH 2ZDVH 2VNTA 2FIRH 4RI0A 1K28D 3SQHE 4JYUH 2A45B 3GY3A 2M5TA 4X2VA 3M3TA 3E0NB 3SHCH 1UHBA 4Y76A 2G52A 5L2YH 2CF8H 4K8BA 4MPWA 1CBWC 3I77A 1P02A 2G5NA 2TBSA 4B6EA 1S0QA 2A32A 2WPMS 4DJZB 2TIOA 3LC5A 2QC2A 2ZFQH 2C8ZB 1SL3A 5K0HA 2SGFE 5LPRA 1CO7E 1MAYA 2H9EH 1OP2A 4DW2U 4K3JA 1O3OA 4TPIZ 1ZTKA 3KQEA 1F0SA 2FLRH 4DVAU 1TMTH 4OS5A 2JIZD 1MCVA 2A7HA 1S83A 4Q7XA 3EA9A 3ATWA 2A0QB 1BQYA 3ITIA 4XFQA 5E2PA 2R2WU 3A8DA 4JYVH 4OGYA 2ZNKH 1C2MA 2SNWA 2JJ2D 2Q6DA 1V2VT 4ISNA 3FN8A 2OINA 4FUHA 2PKAA 1WSSH 2BLVA 3BTWE 3SU1A 1ELTA 2QF5A 2VVUA 3K2UA 5A0AE 2IOTA 2BVRH 1O2VA 1ZLRA 2FLBH 2NU3E 1PPHE 1UTPA 1WCZA 2Z9LA 4FUIA 1RTFB 1HAHH 4JMYA 4LOYH 1BITA 1L4ZA 1P2IA 3O8DA 2JH0D 1CGIE 3ZZDA 1C2JA 4JZDH 1ELBA 1PPGE 2XBYA 4X1RU 4UE7H 5DO4H 1GCTB 1N6YA 5HKKD 3TH3H 3B8JA 3E1XB 4FVDA 1PJPA 4I7YH 1O31A 1QRWA 1SPJA 2NU0E 4FUFA 2M2AA 1SOTA 2R0KA 2PR3A 4MNWA 2ZDLA 2F4LA 2VJ1A 1BJUA 1DY9A 2YOLA 1D9IA 1SMFE 3LGVA 1KXFA 1XUIA 5CE1A 2ANKH 2HNTC 4AB9A 1HAGE 3RM0H 1QQUA 3F9EA 2F9OA 1DWCH 3M3SA 1GHBG 4I8LA 3M7QA 4X1QU 1HAIH 1G9IE 1TGTA 3RMOH 2OBOA 2GMTB 1GL0E 3K6ZA 1W14U 1VR1H 3QGJA 1S0RA 1F5LA 4B76A 2Z6BD 2GDEH 5FXLA 3ZZ3A 2A7JA 1GHYH 1HUTH 4LZ1H 4H6SB 1KXEA 1O2KA 2PV9B 1IQHA 2UWOA 3MU8A 3VEQB 4GCHF 1MKWH 1MU8B 5JPMH 1PPZA 2WPHS 2TGAA 2Z7FE 1GVKB 2SFAA 3URDA 1AKSA 5HGGA 1UTOA 3RXJA 2Y81A 2VIOA 2ZKSA 2EI6A 4MNVA 3DHKH 3QZRA 1L1GA 1P2NA 1SG8B 1WOFA 2C4FH 1GWAA 3SU2A 4DURA 1FAKH 2BY8X 2ZGXH 1AN1E 1WUNH 2BM2A 2QXHA 2VU8E 3NXPA 1TBQH 1GVLA 1UMAH 3STJA 4ZHAA 3T28A 4IBLH 4GHQA 1JWTA 4LZ4B 3ZVCA 4AFQA 1UVPA 2H5CA 1GHZA 1VITG 3VG8A 1MZDA 3BEUA 4A92A 4K60A 4CR5A 3RM2H 2WZQA 3GCTG 2GCTB 2ZDMA 3ZZ7A 2BD7A 2O8WA 2WPLS 3TU7H 5B6LA 2HVXA 1C2EA 3UQVA 4ISHH 2PGBB 3M37A 1AGJA 1CVWH 1P10A 3SU0A 1GMHF 1ZPZA 3MFJA 3SNCA 1G32B 2AMPA 2P16A 2CGAA 3RXDA 1PFXC 1MAXA 3SV9A 1WXRA 2KZ4A 4OM9A 4I8GA 1GI3A 2BLQA 1VITH 2ULLA 3UY9A 5JYIA 2HOBA 5EGMA 1NRRH 5FL7D 3OTPA 1WQVH 5J4QA 1DM4B 1QFKH 8GCHG 1XUFA 1GPZA 1QB6A 3A7ZA 1EFRD 4F4OC 2D1JA 2VIPA 3I78A 1TWXB 3VPKA 2RCEA 4X0WU 2XBWA 2Y5HA 5EU8A 1SOZA 4FUGA 2BY6X 1GMDF 2BQ7B 2ASUB 5IK2D 2XBVA 1ZSLA 5FCRA 1MTVA 2BYAX 2FPZA 2OBQA 5GDSH 1BTYA 3LJOA 3SNEA 4U01A 4NIWA 3LJJA 3SQEE 3UWJH 4O9VA 3LOXA 4AX9H 1CA8B 1ZHPA 5GIBA 4B2CA 4GPGA 1TABE 3PLKA 1NRQH 2UUJB 1TNKA 1V2MT 3T27A 2ZFFH 2BOHB 6CHAB 1F0TA 1P9UA 3PWBA 4HTCH 2Q6GA 2XC5A 1BRAA 1GBAA 1YPMH 3TLOA 2ZDNA 3RXMA 3RXGA 3UOUA 3PTBA 1A1RA 1HRTH 3E0PB 1VGCC 5T1VA 3A8CA 4ZH8A 3KQBA 1BCUH 3C27B 5F53A 1HIAA 4KTSA 1SBWA 1ZHRA 1UTJA 3SJKA 2XXLA 1THRH 1ZTLA 3ZZBA 1O2RA 3UQOA 3OEED 1K9OE 1O2MA 3RXLA 3PV5A 2ZEBA 1D3DB 5HXFA 4JZIA 4NA7A 1ELDE 1G36A 1BTHH 1V2TT 5FBIA 1AY6H 1NU7B 1LHCH 1GHVH 2GX4A 3GCHB 5J4SA 1DPOA 1TRMA 4FETA 3AK5A 2BD5A 3QLPH 2YMSC 5L30H 4M9FA 3MNSA 1FX0B 1O2GH 4D7FA 2D2DA 4WH8A 2A2XH 2W26A 2XNDD 4HI3A 1ANDA 5I25A 5L2ZH 2H5DA 1FY8E 3M36A 2BXUH 1YCPK 3TIUA 1IHTH 1Y3XA 2FOEA 4KKDA 1JRTA 1Z8GA 4X2YA 1O3CA 4BTUB 1YPHC 1MABB 1HJAC 3ZVDA 3GY4A 5JBCS 4NZQA 1O3LA 5JB9S 3M3VA 2FOBA 2BXTH 5CDFE 1Q31A 2AFQB 3RC6A 4TSFD 1O3AA 2Z3EA 2KFWA 3HK6B 1EP6A 3SUFA 4XOJA 3URCA 1NBME 1O3NA 1ZOMA 4MVNA 2Z94A 5C5OA 3GOVB 5FBEA 2BHGA 2CN0H 3RXKA 3FKSD 1TE0A 2BZ6H 2VIQA 3O8RA 1J14A 2QYIA 1OWEA 1HAVB 3SV8A 2A7CA 3GY5A 3LH3A 4DT4A 1TGSZ 1BOQA 1NY22 3M5LA 3JZ2B 3NWUA 2GZ9A 2OXSA 1C9TA 1JIMA 1G3DA 2PW8H 4Z0KA 1RXPA 3S9AA 3BEFB 4U2WA 1MD8A 1V2WT 4BAOB 1BMNH 3OE7D 1BTUA 1UVUH 1YCPH 2FO9A 1OP8A 2W6JD 4Q2KA 1IQMA 4IGDA 2BDYA 1W7XH 5FX6A 2ZCLP 1GBHA 1E36B 1AVXA 4X8TH 4ABAA 4R8TB 4IC6A 5A0BA 1MKXK 5JBBS 2BX4A 2FMJA 4Z1MD 3UNRA 1ZJKA 1GJCB 2YNBA 3A85A 4ASUD 4GVUA 7KMEH 4MLFB 1HJAB 1YBWA 2ZU5A 2PUXB 3F2GA 1XM1A 3EA8A 1UCYH 3BF6H 4AZ2B 2TGTA 1Y3VA 3FZZA 5C1YA 3NUMA 3ELAH 1GBFA 1W13U 3U1IB 4THNH 3A7YA 1LVYA 1N8OC 1XUJA 3QTOH 2JDID 4CRBA 2A2QH 1RJXB 3MNCA 1C2IA 1COWD 1ETTH 1C5XB 3ZVGA 2GT8A 1H8ED 2ZIQH 3SHAH 2ODYB 2Y7ZA 1ESTA 3G01A 3K65B 1QA0A 1HJ8A 1NM6A 2ZHEH 3P8GA 4GAWA 1Y5UT 1GJ9B 1BRBE 4NA9H 5K7RA 1JOUB 2BDAA 3PYHA 4ZKRU 2ZPQA 1Z1IA 3MO6A 2ZPRA 4NSVA 2FYQA 3PV4A 2J4IA 2QF4A 1LKAA 4NSYA 3E8LA 1CT4E 3Q3KA 4AYVB 1W10U 2W5EA 1A0LA 3PLBA 3V7TA 1DUEA 1BBRK 1TGCA 1TPPA 1D6RA 3E16B 3E3TA 2VGCC 3OY6U 4A1XA 1PPFE 1CGHA 2NU2E 4Q4LA 4INKA 2QCYA 1XKAC 4YOIA 2AHME 4ZAEA 2GT7A 5CMXH 2FOHA 3RXEA 1O3FA 1CA0B 1DLKB 4MNYA 1O2SA 1H9HE 8KME2 1N8OB 4D9QA 2VWMA 9ESTA 3S7HB 3VXEH 3RMLH 1OWDA 3HGPA 4MG3A 2WPKS 3NPSA 4NZLA 5DPAA 4FUBA 5DP4A 1SGDE 4H4FA 4X2WA 4WY3A 1VJAU 4A6LA 1KLTA 1FPCH 1ACBE 5TJXA 3KQCA 4Y8ZA 1O37A 1P09A 4YT6H 2KCOA 2EC9H 3QO6A 3SOSA 5HM9A 2HALA 2F9PA 2ZP0H 1F0UA 1C5NH 4KP0A 5LPFA 1BBRH 1NRSH 3AVZA 3RP2A 1FNIA 2D8WA 1G3CA 3A83A 5ABWA 5E2OA 2UWPA 1E1QD 1GJ6A 5C0UA 4AORA 1Z8JB 1HAXB 1O30A 5EPNA 3UUZA 2GP9B 1CQQA 1MTNC 3N99A 1P2KA 5LGOA 1G2LA 1ABIH 3SJOA 4JZ1A 4OGXA 3VGCC 1TNHA 2OTVA 1EKBB 1GDUA 4X8VH 1P2JA 2XCNA 1Z71A 2Y7XA 2ZTYA 2Y5GA 1EPTA 4AB8A 3TK9A 2CV3A 2FX4A 3RXSA 5JBAS 1FXYA 2STBE 1T32A 3MU1A 3D65E 1GHAF 1GI8B 1O3JA 1V2PT 2IPHA 2BDHA 2PUQH 4TWWA 2OCVB 4SGAE 3SJ9A 2KM0A 2F91A 5DP8A 2RA3A 2CK3D 4DG4A 2OUAA 3RUOA 2BVSH 4A7IB 2KAIA 5C17A 1O5BB 1MMJN 1L1JA 1V6DA 2FYRA 1TX8A 2IJOB 3UR9A 2WHXA 5C1UA 1KLIH 3BV9B 4ZHMU 4Z6AH 3W95A 1YF4A 1QGFA 1P57B 1GDQA 3LPRA 1J8AA 1SVPA 3TPIZ 3KNXA 1UTKA 1K1JA 1Z1JA 2A1DB 2HNTE 4MPXA 2SGQE 1NT1A 3TNSA 2QF0A 4KTCA 1C1PA 2J95A 1YC0A 2OQ5A 4J1YA 2YNAA 5GWZA 5DP6A 1MD7A 2LELA 3RU4T 8ESTE 1G2MA 2B7DH 5T6GA 3VGCB 4NG9H 5DSFA 4R0IA 2BY7X 3EGKH 4X1NU 1RTKA 1AQ7A 4I8JA 1GBMA 3L6PA 4UFFH 5IDKA 3ODDA 1BB0B 2XWAA 1E37B 1LPGB 1YPLH 3RXCA 5T6DA 2YMSD 2GVFA 3PB1E 5BRRE 3TGKE 3BEIB 3P6ZB 5F8XA 4E7NA 1VITF 5FX5A 2RA0A 1ZPCA 3T2NA 3PM3A 2QAAA 2ZHFH 3GCTF 3PROA 2GZ8A 2W3KA 3V0XA 3SZEA 2VVVA 4CH8B 1O36A 2B9LA 3SYJA 1UO6A 4A5TS 3F68H 1H8DH 1VCQA 6ESTA 4B71A 3T26A 1DWEH 1P01A 2AS9A 1UVOA 2QY0B 2Z9GA 1GI1A 5EXMA 1EP5A 5DG6A 1DXWA 3GDSA 1F92A 4HZHA 3T25A 1EXFA 1NZQH 4SGBE 4AYYB 3N7DA 1D6WA 4YXWD 3F3BA 1D4PB 2BOKA 1CU1A 3BN9A 5GCHG 3RXFA 4UFDH 4VGCC 3Q3XA 1ANCA 3WWBA 5ETXA 3S69A 1ZRKA 4K69A 1ELAA 1YPGH 2AERH 7GCHF 2F9UA 4Y0YE 2ZPSA 1RFNA 2K8IA 3F9FA 3TGJE 3AAVA 4TY7A 4ABEA 3P8OA 1GJ8B 2PHBA 3SV2H 4KELA 1GI4A 1T4VH 1OKXA 2GV7A 3NCLA 1CBWB 1KXDA 3P92A 3PMHB 1DOJA 1MKWK 4CRAA 4DCDA 2VWNA 2AEIH 4TYDA 1QB1A 2W3IA 1LVOA 1QBOA 3PO1C 3FO8D 2JH5D 1DWDH 2O8LA 5E0GA 2QN5T 3CS0A 1HDTH 1PQ7A 3TH4H 1OSSA 5FPYA 1O2NA 1BTWA 4JZEH 1SLXB 2UUKB 1TOCB 5EQSA 2F9NA 3OU0A 2A4QA 3K6YA 1C4V2 2C8WB 3U9AH 2FP7B 5AHGH 4AFUA 4CR9A 1ELFA 4Y6DA 1DLEA 1DUAA 5C1XA 3SW2B 1CHOG 4ZCNA 3DT0H 2V7QD 2H2ZA 2LNCA 2G00A 1PPBH 4AFSA 4AOQA 3NRLA 1ANEA 5A2MH 4E05H 3EYDA 4B73A 5AFYH 3RLYH 4YZUA 4K1TA 4VGCB 1GBTA 1GHWH 2XC0A 1Y5BT 4ESTE 3N7OA 4YT7H 1OWHA 1OX1A 1K1NA 2FOFA 3ZVAA 1C2DA 1AVWA 1BIOA 3K9XB 1EX3A 5PTPA 1IQFA 4M7GA 1O3BA 1K21H 1TX6A 3TH2H 4JK6A 1GBDA 1HJ9A 3SJIA 3MOCA 1O3IA 1Y3WA 3LONA 3M7TA 2Z3CA 4MPVA 1H8HD 4ASHA 2PKSC 3PO1B 3LU9B 1O5EH 2ZHWH 3KHVA 1THSH 5TCCA 1QRZA 3RMNH 1KDQB 1HXFH 5LPEA 1HCGA 1M9UA 4FUEA 1C5TA 6GCHF 3C1KA 5C5NA 2BMGB 2GZ7A 1KIGH 2ZZUH 3V13A 2EEKA 2QXJA 2VIWA 3OFND 1TMUH 4BAQB 4Y79A 1BTZA 3RXVA 1Y3UA 2ZF0H 2KAIB 5AFZH 2GD4B 1W2KH 2AH4X 5DP5A 1XUGA 3PRDA 2I6QA 2DE8A 1AFEH 4ABGA 1H8IH 2Z9IA 1S5SA 4MNXA 5EQQA 2VH0A 3CS7A 3GISB 1FMGA 1NFYA 3GCNA 1YPKH 3OY5U 1C1MA 2OC1A 1ZHMA 2R2MB 3TVJB 2XNIA 3QZQA 9LPRA 3CP7A 5F8TA 4I31A 1K22H 1FN6A 2WUCA 1WV7H 4CRFA 4ZHLU 3ZV8A 3RLWH 2GKVE 1DITH 1YPHE 4B74A 3VB7A 4WXIA 1HGTH 1QJ6B 2I6SA 2V0BA 3QX5H 1DWBH 2JJ1D 4BTTB 5ESTE 3RXHA 5T6FA 2PKSB 1YLCA 2BD8A 3EE0B 1GVZA 3M5MA 1CSOE 1EB2A 1T8OA 2FOGA 3BTFE 3PRBA 1DANH 2B5TB 5C0TA 1NROH 1K1OA 3WY8A 1SC8U 1K2I1 1UK4A 1JXPA 1DX5M 1BUIA 1FLEE 4FUDA 1JRSA 3SUDA 3UREA 2F83A 2AYWA 5FPTA 3A7VA 1V2RT 2Z9KA 1C5PA 2SGDE 2VIVA 2WINI 2ZTZA 1C5MD 2GDDA 3HPTB 1SLWB 1LHGH 2GCHG 1LHDH 5F8ZA 4B1TA 1AUJA 4RN6A