3SURA

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with nag-thiazoline.
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
519
structure length
504
Chain Sequence
HHHHSSGLVPRGSHMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-hexosaminidase
publication title Gaining insight into the inhibition of glycoside hydrolase family 20 exo-beta-N-acetylhexosaminidases using a structural approach
pubmed doi rcsb
source organism Paenibacillus
molecule tags Hydrolase
total genus 191
structure length 504
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3surA01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3surA02
1HN1A 4UNIA 4BF7A 1MVYA 1UD3A 4AZBA 2YDRA 2BHYA 4LQ1A 3W53A 2VVNA 2IXVA 4EAMA 3IJ8A 1D7FA 3AIRA 4GO8A 3WD1A 3SUSA 4U31A 3WQWA 2BHUA 3M46A 2VTFA 1XGZA 2O9PA 6A3HA 1UUQA 3WDIA 1GW1A 3MMUA 4UFKA 1VJZA 5A2CA 1JF6A 3GBDA 4W7UA 4JFWA 3F5LA 5ABHA 3GNOA 4FF5A 1DTUA 3DHUA 1EIBA 1SFSA 5D4YA 3N9KA 1BAGA 4Y7EA 2JIEA 4AD1A 2J77A 2WHKA 2CCRA 2ZUUA 5FIPA 1PAMA 4OBSA 2VCAA 3MMWA 3RIKA 3TTYA 3WUGA 2DDXA 5A8PA 2WVUA 3AHZA 4ZFMA 3G6LA 3VIIA 5JIWA 4CD6A 1E72M 1EQCA 4PMXA 3WUFA 2VCBA 4GIAA 2EJ1A 3TP4A 2DSWA 4WSJA 1E3XA 3UR8A 2NSXA 1PX4A 1E56A 4PMYA 3AICA 5HPOA 2BVDA 2BVYA 4W93A 1UD6A 5FOOA 2A3AA 1JYVA 2ZX5A 2DPEA 2J62A 2ZXBA 3KWXA 3VUPA 1CXIA 2QPUA 3NSNA 1W9XA 1LG2A 4GI8A 2AOSA 1E6XM 4MAVA 2QMJA 2ZUVA 1UWRA 2PI6A 1D3CA 1CGUA 3GNPA 1MW0A 1J0IA 1HJSA 4E2OA 1QPKA 1BSIA 1OCQA 3WELA 1BPLB 3PZQA 2YA2A 3ZSSA 2W62A 5A8NA 4L4PA 3J7HA 4A3HA 3A4WA 4PMZA 1EDTA 4M82A 3M07A 3F5KA 2WC4A 4D71A 4D6FA 3PZMA 4FMVA 6CGTA 3PZUA 3WF4A 1UWTA 1E73M 2BVTA 3K1DA 1E5NA 1W3JA 1B30A 4HOXA 2WMIA 1BVZA 2VRKA 4J3UA 3AHVA 3AXXA 3SCSA 3GNRA 1WAWA 2J4GA 1BG4A 4W5ZA 3FHAA 3U5UA 4M1RA 1H5VA 2WSKA 1KR1A 2ZICA 2ZUWA 3AS2A 2EQDA 4LYRA 4HU8A 5A94A 1W3LA 1A3HA 2BS9A 2YOCA 4U5IA 2D2OA 1OM0A 2W4XA 4TVCA 3N18A 1GZJA 3SCVA 1E0WA 3PZOA 5D8ZA 2GDVA 4J3VA 2CITA 1N82A 3L4WA 5A6JA 1XCWA 1ZBKA 1AQMA 2YDSA 1CTNA 4X9YA 4B9YA 4DWSA 1KGWA 1UD4A 2DSVA 1JDAA 1TZ7A 4F8XA 2WVSA 1UWSA 2WSPA 2EPOA 4M56A 2JF6A 4V2XA 1W91A 2ZE0A 3SCWA 4QP0A 5I79A 5LA2A 3AXHA 4W84A 1W1TA 5BRPA 3W29A 1GJWA 4HTYA 3VNZA 3VGGA 3AYRA 1Q6CA 5ABFB 4WIWA 1V0KA 3K46A 1B3YA 1UWIA 1GQIA 4OOZA 1KQYA 1KQZA 1WP6A 1UH3A 4E4PA 1UR1A 4B3KA 2FHCA 2VX4A 4PSPA 1CZ1A 4YN5A 5KEZA 3WEMA 3K8MA 3ZQ9A 2WMKA 2W5FA 3AZTA 3RDKA 3T2QA 1PIGA 3VGFA 4BQ2A 4OKDA 3IAQA 2FHFA 3WDQA 1C91A 4CU6A 2XM2A 1TMQA 2CYGA 4TXEA 1QVBA 5CQ1A 2W91A 1B0IA 5I2UA 2WWCA 1C93A 1EH9A 3QOKA 4BQ3A 4HZ7A 8CGTA 2J79A 2E9LA 5GNYA 1J0YA 2E0PA 3WD4A 1JAKA 5HBFA 1WKYA 1AMYA 3A4XA 3CMGA 3A6OA 2X0YA 4JKMA 3LPFA 2QLYA 2JALA 4PMDA 3VMOA 4WSKA 1QNPA 3DYMA 2XVNA 3GM8A 5GNXA 3BXWA 4U3AA 3ARPA 1GQJA 1LL7A 1R7AA 2E40A 3GH5A 3AIQA 1H09A 1C7SA 1FHLA 3CZEA 4MPKA 4UQBA 2PWHA 4C7FA 3W26A 3ARUA 1MQRA 2WBGA 4MDPA 1LLOA 5AYBA 4WKHA 5HXMA 4PMRA 3VPLA 3ZJ6A 3SUVA 2G3NA 1H0IA 2Z1KA 1L8NA 2CHOA 4HPGA 5CGTA 1TR1A 2WXDM 5M3WA 1LJYA 3AYSA 4M81A 1U2YA 2A3HA 1GOMA 3VMPA 4HOZA 3BAXA 3NIYA 4PMVA 3RILA 4W85A 4F9JA 3VX1A 1JIBA 1E15A 1LL6A 1GOIA 1ZJAA 1KXTA 2J7EA 5IXEA 5GQBA 1M53A 4B16A 4KMQA 1UOKA 4IPLA 1BGGA 1G01A 1EQPA 2VMFA 4HA1A 4NRSA 1BYBA 3W6LA 4D1IA 4EE9A 3CUHA 2WW5A 2WMGA 1H11A 1UKQA 3FHQA 3PHAA 3L4TA 3S6TA 1MXGA 4HZ8A 3BC9A 4GO9A 4AD3A 3VIOA 5I6SA 2GSJA 1JXJA 3WENA 4D6IA 4W89A 1JZ5A 1Q6DA 2WYSA 1XYFA 4M29A 5FL0A 3HJEA 1W9UA 1E6PA 1NARA 3W37A 1B3VA 3GTNA 2ZX6A 2ZX7A 3B9EA 3ARZA 3THCA 4W7WA 1GQLA 2D3LA 1JI2A 3K8LA 1H0GA 3CLWA 1KB3A 3L4UA 3CZKA 2OYKA 4F9DA 1WDSA 5BYWA 1VB9A 1J9YA 3AI0A 1L0PA 3TTQA 1NOUA 1CGWA 3ZMRA 1XH0A 4LPCA 2JF7A 2F61A 3OGVA 2O9TA 1WO2A 2WB5A 4CCDA 2F2HA 2O9RA 3PBGA 5A6MA 1E40A 3LMYA 1GNXA 1E3ZA 3L2LA 3NUKA 1Z32X 1EXPA 2YLAA 1YQ2A 4MNMA 2CBIA 2QPSA 1GQKA 3WH7A 1UH4A 2ZXQA 1B31A 3ZT6A 1CGVA 4P8WA 1HF6A 3WF3A 3SEPA 3MUZ1 3AMCA 2VJXA 3ARTA 1UR9A 5BXRA 3AFBA 1GJUA 3TONA 4PMQA 1HL9A 3CHFA 4PEEA 3O9NA 5ABFA 4F66A 1TUXA 1H49A 1IZKA 3OGRA 2EPMX 2XM1A 1CWYA 2XSBA 2G41A 3PZ9A 4UQDA 2C0HA 3VU2A 2Y2WA 1VF8A 5CG0A 2CBUA 3FAXA 4AIOA 3WF2A 1NWRA 3MANA 3FY1A 5M17A 1RD6A 1ZS2A 1DWIM 2CBJA 3RMEA 3W27A 3S2CA 2VX5A 3UG5A 1E4NA 2B31A 2CHNA 3NYDA 1WB0A 4B9ZA 3DC0A 1HJQA 3QOMA 2YJQA 3CTTA 3T2PA 1HJVA 1UR0A 3B9AA 2XJ7A 2XFRA 4CVUA 4LXFA 5A3HA 1VEOA 4PTXA 4JCMA 4TUFA 3CUJA 1K9DA 1B3WA 6TAAA 2YA0A 1GUVA 3ARWA 4C7GA 3EMQA 2ESCA 1GVIA 3VTRA 4AD0A 4URIA 4WK9A 1CLXA 5JUVA 4AZ7A 3UR7A 2Y5EA 3W4RA 5CSUA 2RGLA 4MNJA 4BS0A 3WNLA 1FH7A 1OD8A 2X0HA 5A69A 5IFPA 1FFRA 3WH5A 1NP0A 1LF1A 1OIMA 3AXIA 3CMJA 5I23A 2PBGA 4WF7A 3FAWA 4H41A 4AZHA 1KXVA 1H1NA 1UA3A 1VBRA 1JZ7A 4IUGA 1UA7A 3WD3A 1JFHA 4HP5A 4CUCA 1BQCA 2PC8A 3AJ7A 3TTSA 2G3MA 1TVNA 2BXZA 1NWSA 1VRXA 1I1XA 1KGXA 3RJXA 1E0XA 1ODUA 1G1YA 2PWDA 4XX6A 4GZEA 2ZOXA 1JZ6A 4CD7A 3SIMA 1PX8A 3ALGA 4MB4A 5IHSA 4CVWA 3UERA 4D6GA 1HNYA 1DWJM 1ZJBA 1EO5A 3MUY1 2WLYA 3EMZA 3WQ4A 2Y24A 4J7RA 5FL1A 1JNDA 5CLWA 4UOZA 5C71A 5I3DA 1IT0A 1OINA 1RPKA 4ATLA 2WVVB 1HKJA 2OYMA 4J27A 4J3SA 7A3HA 1JZ2A 4AEEA 4PCTA 1J0KA 1QOXA 1E6ZA 1OD0A 4HZ6A 3SCTA 2J78A 5A2AA 1CXHA 1Q6FA 1U30A 1J18A 1QW8A 3CZGA 5BXPA 4DUVA 1CGYA 1FHDA 1QHOA 1ZB5A 3CUFA 1W9PA 2IXUA 1WDPA 5CPSA 1JZ3A 1MW2A 2FGZA 3B8SA 4ACZA 4CN4A 2OWXA 1UQYA 4HA4A 1BTCA 1NOFA 2WCAA 2WPGA 2GFTA 4U33A 3W6MA 4DWSD 1JYWA 4CD5A 2WZIA 3VKKA 4AZCB 1UZ1A 4PMUA 3WUBA 2A3CA 3ZJ8A 1U33A 4AIUA 4AWEA 1VIWA 5E0FA 3I3BA 3CBWA 1E4LA 1KXQA 1PIFA 1QBAA 1XHGA 3WEZA 2DSUA 1VFFA 3PTKA 3RM8A 4W8BA 4PSRA 4MB3A 4S3KA 1BYCA 1K9TA 2JEQA 3GDBA 3GH4A 4ZENA 3AS3A 1HJWA 2VX7A 1UD2A 1UKOA 1VEMA 1HL8A 4AISA 1Q6EA 1NQ6A 4JKLA 5CPTA 3AROA 2J47A 1DEDA 2GVYA 2VZUA 3SUTA 1KWGA 4JZ5A 3EDEA 1GOWA 2ZUSA 3KEHA 4GQQA 3T2OA 2J74A 4PUDA 1BYDA 2JEPA 1XSIA 1W1PA 3T08A 1CXEA 2VRJA 3MSDA 4AXNA 1ITXA 3O6AA 1V3IA 2O9OA 3BAYA 2VCCA 3SCUA 1HT6A 3GBEA 4MNLA 1FOBA 4D1JA 3WD0A 3CUGA 2YL5A 3POHA 3CPUA 4ZXLA 3QHOA 3WDRA 4AZGA 4MB5A 4UR9A 4L4OA 4HA3A 2WLZA 1CXFA 3ZJ7A 4W5UA 4GZJA 4D6EA 3BCFA 5HPCA 5ECUA 2ZXAA 2XHYA 3WSUA 1V0LA 1XH1A 2TAAA 3CO4A 1E4IA 1O7AA 2DT2A 2VRQA 5E6YA 1IV8A 5A8QA 3GXFA 1UWUA 4W86A 2ZX8A 3GXMA 1LQ0A 2D0HA 2WC7A 4QLJA 3BCDA 5GNZA 4JFUA 2D24A 3WH6A 5HDRA 1JD9A 3MUIA 1UG6A 1E55A 1V3MA 2CXGA 3EBVA 5DF0A 1O6IA 2YL9A 2WMFA 1G94A 2VUYA 1EDQA 4YHEA 1E5JA 5M5DA 1UZ4A 1W9BM 5AC4A 1C8YA 2XYLA 2XGBA 3ZO9A 4U2YA 1QNOA 2J25A 5DMYA 5I77A 4Z2IA 2UY2A 1BGAA 1EDGA 4AD2A 2XG9A 3MKKA 2EPKX 3GZAA 2HVMA 1UKTA 3WDPP 2X05A 1TG7A 5I5RA 3IJ9A 2XUCA 3LPOA 2Q8XA 2CKSA 1MXDA 1HVXA 3U57A 3WQ6A 1HX0A 1BFNA 3QR3A 4OJYA 3SCOA 4CN6A 3T0BA 2WMJA 1A47A 5GPRA 4HPHA 1ZL1A 2V3FA 4W87A 2PWFA 1I75A 4Z2KA 1ESWA 2VVSA 1S46A 3HN3A 2OYLA 4M24A 2BY3A 3ARVA 3LPPA 5DO8A 3WD2A 2BY2A 3OZPA 3W82A 3VIMA 1QHZA 4X0VA 5A95A 1CXKA 1E1EA 4QLLA 1CGXA 3N1AA 4NRRA 1E6SM 4PTVA 3SUWA 5ABEA 2YIHA 2CIPA 3N13A 3WNMA 4WJXA 4CCCA 2DSZA 1E70M 1ITCA 3UEQA 3IK2A 3M6DA 3TTOA 4AZCA 2EBNA 3EMCA 4LGXA 4DM2A 1KWKA 2XWEA 4UQ9A 1R8LA 1XV8A 4PMNA 1K9EA 5A6BD 2VZVA 5A2BA 1CIUA 3N12A 3WFLA 5EMYA 3K4DA 3WFZA 1Q6GA 5F7UA 1HVQA 5IFTA 1B1YA 5EFFA 2VL4A 2DH3A 3G6MA 3WH8A 2YDQA 2AMGA 3A3HA 3OLIA 2CETA 2WCGA 1ODZA 1XSKA 4AIEA 2GJXB 1UYQA 3AQUA 4FK9A 1V0NA 1QBBA 2WAGA 3WY1A 1VJSA 3ALFA 3WEOA 2CPUA 3BH4A 3VIJA 1X6LA 1B2YA 1NWTA 1CNVA 3MV11 8A3HA 5E6ZA 1PZ3A 3W81A 4HMCA 2CERA 1QI0A 4UFMA 3FN9A 3N11A 1LL4A 2JIWA 3II1A 4KGJA 4JL1A 1QI5A 3EDJA 2ZWZA 5E09A 3RJYA 1OB0A 3IAPA 2UY3A 4FLOA 4Q22A 3VDCA 3PZVA 2VZSA 1J12A 5D8WA 7TAAA 4A4AA 4UQCA 2XVLA 1XYZA 1WDQA 1OGGA 3A47A 2WNWA 3WMBA 4RE3A 3EDDA 1H4PA 1OGSA 3OLEA 4PBGA 4UZSA 4Z2GA 3A4AA 2F8QA 3KL0A 3MV01 2WANA 2C8NA 1C92A 1J0JA 1WZLA 4IISA 3AOFA 1AQ0A 4KGLA 2BY0A 4S3JA 3NSXA 4JHZA 5JBEA 2WBKA 2YL8A 3AS1A 3ZOAA 4JFSA 4QCEA 3RM4A 2PB1A 4ZEPA 4CU7A 4UQEA 3VDAA 2E8YA 4UQAA 4C7DA 4P7LA 2GDUA 1KXHA 1BG9A 5BXSA 3KL5A 3TOPA 1FP8A 2J7HA 1B90A 1GHSA 3SCNA 1OGBA 1PEZA 4JFTA 3W24A 4UOQA 3WDJA 3BAKA 1V3KA 2WK2A 5A6SA 4U5KA 3SCQA 5CGMA 3UESA 3W38A 1W3KA 3D5HA 4J3TA 4CGTA 4V28A 1QW9A 4JHOA 1KCKA 1W2PA 2NT0A 5CXPA 1TVPA 4PYSA 4AMCA 4J3WA 1US3A 4UCFA 3HU7A 3L4VA 2W67A 3EDKA 2YBUA 2WZHA 3N04A 5M03A 3M7SA 3AIBA 1JF5A 1CENA 2E3ZA 1RP8A 1QI3A 2E9BA 1W32A 2RGMA 1PJ9A 3ARSA 1D2KA 5C70A 2WKGA 3WBEA 2WWDA 3UCQA 4MAZA 3AIEA 1FA2A 1XH2A 1QHPA 5DT5A 3VGEA 5HNNA 2CEQA 1K6AA 3RM9A 1CGTA 4UFLA 1WPCA 1NWUA 1SR0A 2BHZA 3SURA 1WDRA 1UKSA 1ISXA 1R85A 2WVTA 1C7TA 3CZLA 2XFYA 3VIGA 4M8UA 5CPQA 2DQXA 3WF1A 3VGDA 3I3DA 1R7OA 2VI0A 1NOWA 4QLKA 5A6AA 3AZRA 3VIHA 3W28A 3PTQA 2PWGA 1LWHA 1PPIA 2D0GA 3AMLA 2WMIB 1B9ZA 2UWFA 2XVKA 3OGSA 4Z2HA 4CKQA 2QMKA 1GOQA 1PX3A 1C90A 2J7FA 1V3JA 2W61A 2V3GA 4XB3A 4EKJA 1B3XA 2D1ZA 2VOTA 4DUWA 4YHGA 1EA9C 3WNKA 1M04A 4MJ4A 1EGZA 1CXLA 5FD0A 2YL6A 1DWFM 3QHMA 3L4XA 3VINA 1MFUA 2DT3A 2FDMA 3CZ8A 4JAWA 1SMAA 2XSAA 4PCSA 2OSYA 3WDHA 3WBAA 4DWSB 1BYAA 4TOQA 1R87A 1JGIA 2QV4A 4AZ5A 3BLPX 3APGA 1KFWA 3OLDA 1GORA 2D20A 2VNCA 4DM1A 1EOMA 4F79A 4NF7A 1EO7A 3WNPA 3AMGA 1M7XA 2MANA 2WMHA 3MMDA 1V3HA 3QGVA 4AYSA 2PF0A 4KH2A 4C91A 1PBGA 4GQRA 4MNKA 3BMVA 4XZBA 3DECA 4ZXOA 3L4YA 4AW7A 4U3CA 4XZWA 3VIPA 3WN6A 1JYNA 1V6YA 1TA3B 4H8UA 4UTFA 4CD8A 1Y7VA 3BSHA 3AISA 2X09A 3DYPA 4UZUA 2BFGA 3VD7A 3AHYA 4WKAA 3VM7A 1B3ZA 4FLQA 2G3JA 2J8GA 1XC6A 4PTMA 2V38A 2AAAA 1UWQA 1AQHA 1UQZA 1V02E 3U7BA 1HP4A 3ZT5A 3RO8A 2W92A 4QAWA 5DEZA 3VO0A 1FFQA 3F4VA 4R27A 3ARYA 3PZNA 1CEOA 2XVPA 2WC3A 1EOKA 2J75A 1HP5A 1V08A 1BLIA 4W88A 1E0VA 7CGTA 1W2VA 3GH7A 2E4TA 4OBRA 1V6WA 3CHCA 1DWHM 1DWAM 2VX6A 4MTVA 5DT7A 4GKLA 4QDMA 4GPNA 4MB1A 3N15A 1JYXA 3MUAA 2ZIDA 3WNOA 2VURA 2G4FA 4AEFA 3EDFA 1C8XA 5ABGA 2EO7A 4OOUA 5LYRA 3D3AA 1W3HA 3GXDA 5BROA 1BF2A 4RL3A 1FH9A 3BAJA 3F5JA 3ARRA 2V3DA 4D6CA 4PMOA 1F4AA 5TD4A 2BXYA 5D9NA 1JXKA 4BA0A 1VENA 3VD4A 1RH9A 1G5AA 4TX6A 4W8AA 3OG2A 4KRTA 4AZ6A 3NDZA 1J0ZA 4BCEA 3BMWA 4QFUA 4P7RA 5FKYA 5IDIA 1ZBVA 2FH8A 1GPFA 2G3IA 4AD4A 4NSBA 2YBTA 3RCNA 1X1NA 4V27A 5FCZA 2YKKA 3MS8A 4LYPA 3W25A 1E9LA 5BXTA 1WNOA 2EEXA 1OT1A 4B15A 1KBKA 4PN2A 1PZ2A 1UR8A 1MW3A 3BSGA 3EYPA 1WZKA 4ZE4A 1W9DM 4KRUA 3PTMA 5EB8A 2O92A 4ML4A 3AMDA 2EPNA 1VEPA 1J0HA 3FNDA 2ZUMA 3VDBA 4AY1A 4JL2A 4C90A 5E0CA 2X1IA 1HKIA 2EPLX 2XVGA 3VM5A 4ZE5A 5D9MA 2HISA 3UG4A 1J10A 4HU0A 2DIEA 5AYIA 2NT1A 1Q4NX 4E8CA 1LWJA 1H2JA 2D0FA 4IPNB 3L2MA 4TTGA 4DWSC 1JL8A 3RPMA 1V3LA 3VIFA 3WQ5A 3PZTA 2UY5A 5A8OA 1OT2A 1UR4A 2DT0A 4TVUA 4ACYA 1VAHA 1JZ4A 1C8QA 4A3YA 4K68A 3KE0A 5EFDA 2XFFA 2OSXA 4P7OA 3FXYA 2WHMA 2XIBA 1VFOA 1KBBA 1MW1A 1E4MM 2XWDA 1E6QM 1KR0A 2CKRA 4UFIA 4HMDA 5I78A 2FGLA 4CU8A 4J3XA 4PTWA 1EHNA 3WIJA 1KCLA 2D3NA 2W63A 1MQPA 2WVVA 2JE8A 3U7VA 4D72A 1HIZA 4U2ZA 1TA3A 4AD5A 5AC5A 5C8BB 1UD5A 1EHAA 2YLLA 4OZOA 1QI2A 1H3GA 3MU7A 3AHTA 1X6NA 4XUYA 4ATWA 3NSMA 3LPGA 2XGIA 1WZAA 1SYTA 1GHRA 4D6DA 1HXJA 3HMCA 4H8HA 3ZR6A 1V6UA 1UD8A 4HOWA 2C7FA 3WMSA 2GK1B 2IUZA 5CLTA 4JCLA 1E71M 4GI6A 3VDHA 2FHBA 1JG9A 3AHXA 3WL1A 1KGUA 3BAIA 3AIUA 3K4AA 2E8ZA 3BGAA 4RE2A 1CDGA 4RE4A 1BHGA 4AZIA 3VVGA 4OIFA 1UR2A 2DEPA 2FH6A 1CECA 4P7NA 4B3LA 1NM9A 1GCYA 4D6JA 1OIFA 4N42A 4FLSA 2V5DA 5E9AA 3T0DA 5LA0A 4E8DA 4QCFA 3VOCA 2ZX9A 3CHDA 9CGTA 2V5CA 4JKKA 3WNNA 1HJUA 1OBAA 3THDA 1ISZA 4LYQA 1RP9A 3ZR5A 3VD3A 2XTKA 1CBGA 3ECQA 5EBAA 1V6VA 2WCSA 3VGHA 1ECEA 3PN8A 4MADA 1MWOA 4CD4A 2WKLA 4UFJA 3WH9A 3VGBA 2D23A 5E70A 1ZBWA 3VX0A 2WM0A 3VD5A 1WCGA 1WZMA 3OIHA 1J11A 2EXOA 3CIVA 5HOSA 5DFAA 1QNRA 4GXPA 3KZSA 1GONA 3AIWA 2Z1SA 2VZTA 5CJ5A 1R86A 2J7GA 1HKKA 2A3EA 1K9FA 3AIVA 2V3EA 1XD0A 1XCXA 1GOOA 1E6RA 3BAWA 2WZEA 3ZT7A 1F4HA 2OWCA 1W1YA 3KL3A 3ZIZA 1V03A 4P7QA 4ATDA 1P6WA 2QHAA 3L4ZA 1G9HA 2ZUNA 5BCAA 1C3FA 2GJPA 1ZBCA 4XV0A 5LA1A 5A6KA 4P8VA 5IHRA 1V02A 1XSJA 1TE1A 2ZUTA 2BNJA 3OLGA 3MO4A 1SMDA 1H41A 2J7CA 2DT1A 3NJ3A 2Y8KA 1VFMA 1VBUA 2QF8A 3DHPA 3OB8A 2X8RA 1CPUA 2J7DA 1ISYA 1VFUA 4KWUA 4UOJA 3E1F1 4H7VA 2BV9A 1LG1A 3POCA 1JD7A 1JI1A 2VC9A 4H2CA 3VNYA 1OSEA 1W1VA 4GI9A 4BQ4A 1JDDA 2CBVA 4Z2JA 2CNCA 4ACZB 4DUXA 4TX8A 4NI3A 3VILA 1HJXA 3WL0A 4OUEA 1JDCA 1US2A 3VD9A 4H04A 1WE5A 1YHTA 2GUYA 1MFVA 3AS0A 2VO5A 2A3BA 3PZGA 3WMCA 3SCPA 1E1FA 2ZWYA 3ARQA 4W7VA 5A6BA 4Q7NA 4AC1X 4J28A 4BQ5A 5I24A 2WHJA 1HKMA 5JIPA 3WQ8A 5CZKA 3SCRA 4UFHA 3UETA 4FLRA 3ZM8A 5JBDA 2ZXDA 1DHKA 1UKPA 4D6HA 3VIKA 5KZ6A 2DIJA 3B9DA 1IZJA 4TVDA 3CH9A 3CGTA 3CHEA 1UHVA 1NH6A 1QNSA 3ZJKA 3WQVA 2XPKA 4P8XA 2VQTA 3TA9A 1E6NA 5A6LA 1JNEA 3W0KA 3U5YA 1E43A 1J01A 2OWWA 5I0DA 2DH2A 3IANA 1JZ8A 1XD1A 1OWQA 3OA5A 4X0NA 3GYCA 2NW0A 1ISVA 2VT0A 4EK7A 1ISWA 2GK1A 3CUIA 1CYGA 2G8ZA 1CLVA 2Y4SA 2WHLA 3DYOA 5CSYA 4P8UA 4CN1A 1QI4A 1DWGM 3GXIA 1M01A 3WKZA 1ZU8A 2VQUA 3PZIA 1MQQA 4JFVA 1JFXA 3O2LA 3NCOA 5D9PA 3AZSA 1FH8A 3WF0A 4EANA 1M03A 2CESA 1TFVA 2E9MA 2J7BA 1GOKA 4NZCA 4LX4A 2PBOA 2VR4A 3UG3A 4IM4A 1BVNP 2XIIA 2OSWA 4CCEA 1GVYA 3AMKA 3SUUA 3JUGA 3T0AA 4W8LA 2J8FA 3OZOA 3BLKA 3MSGA 5BRQA 4GINA 2PWEA 2GJXA 1FP9A 4N0RA 2D22A 2VR5A 3VMNA 4H8VA 3ZSTA 2Y8VA 5A1AA 4WKFA 4PUEA 5A8MA 2UY4A 1I1WA 1AVAA 3CZJA 2JFEX 1NP2A 1V6XA 3I3EA 4BZYA 1XRVA 3N17A 2VZOA 2W66A 4HMEA 4TTUA 5AY7A 3IJ7A 4JIEA 1DP0A 4M80A 5BWFA 4MDOA 1QNQA 4GZIA 2GJRA 4MJ2A 3OBAA 2X2YA 2DSKA 5JBFA 5D9OA 2OLHA 1W9VA 4Z2LA 1V0MA 3K8KA 3FW6A 1MYRA 3T09A 2DGAA 4PRWA 3NDYA 4R5EA 3WUEA 4YPJA 2YA1A 1G0CA 3QHNA 1TCMA 4WLCA 3ARXA 1JAEA 1UH2A 2BY1A
chains in the Genus database with same CATH superfamily
2YDRA 4TIMA 5HR6A 2IXVA 1J2BA 4PB3A 4JOMA 1D7FA 4GO8A 1IEWA 3WQWA 4IJRA 1GW1A 1Y8BA 1POKA 3MMUA 3NZPA 5A2CA 3GBDA 3V0SA 5LNUA 1WYIA 3GNOA 3CHVA 4JTUA 1F5ZA 2J77A 4AD1A 4OBSA 4RV3A 2I5QA 4AQLA 4ZFMA 2O55A 3G6LA 3VIIA 1TMHA 4PMXA 1TJ2A 3WUFA 2DSWA 5HNUA 2NSXA 1PX4A 1E56A 2P8BA 2EKGA 2OPJA 4GQBA 2BVYA 4W93A 1UD6A 5FOOA 5FJTA 1XI3A 2ZX5A 1W5QA 3QRHA 3KWXA 1TRDA 1I6NA 1TJRA 3EKLA 2F9RA 4MG4A 2ABAA 4I9TA 3NSNA 4ZBCA 1PL9A 4X60A 4GI8A 1OK4A 3SADA 2QMJA 6ENLA 3PWGA 3RPDA 4ENLA 3G22A 4E2OA 3H24A 1QPKA 3W86A 1K8CA 2E1DA 3QY8A 3CV1A 4WXYA 4A3HA 3HPAA 4C65A 4D6FA 4L1GA 2PDKA 2RUSA 3PZUA 3E0LA 1UWTA 1HGYA 3GXTA 4NX0A 1VP5A 4HOXA 3FVMA 4Q8UA 3GNRA 4HNTA 3A5VA 4G1KA 1PUDA 4GGHA 3WBWA 1ICSA 1AW1A 1XJBA 3P8JA 1DL3A 5F2MA 5CZSA 4JTDA 4HU8A 3BQ5A 1W3LA 3LQGA 2YOCA 4Z0JA 4BI7A 3CWOX 3LLXA 1E0WA 3DG7A 4GC3A 2YB1A 1G4PA 1GVEA 5LIXX 1XYBA 4X9YA 3GU2A 1UD4A 2DSVA 3NPXA 3KBJA 4KCTA 4V2XA 2JF6A 5CC3A 4QP0A 1X97A 3DG6A 1XQLA 1W1TA 3EA1A 1E9YB 3UXAA 4QE4A 3RG6A 3LGDA 3NL3A 4WY0B 4OOZA 1KQZA 3VA8A 4B3KA 4ICNA 3HV9A 2VX4A 3MT1A 4YN5A 3HQOA 3K8MA 3RDKA 3VGFA 1MSSA 3P81A 3IAQA 1MDRA 5G1TA 1Z3NA 3MO7A 3NQMA 1ZCCA 3NDOA 2FPVA 2DFAA 2CYGA 2W91A 2YPIA 5I2UA 2FTYA 2OVLA 2WWCA 4S3GA 1C93A 5CBBA 1EH9A 1P1XA 4BQ3A 2E9LA 3LA4A 3WD4A 3HG5A 5HBFA 1WKYA 3CMGA 1X6UA 4R33A 1VPYA 2E5BA 1I2QA 4RNFA 3VMOA 4G7EA 1QNPA 2Q01A 4NY2A 4KT2A 3NQGA 3W1QA 5GNXA 3IGHX 5AC6A 1FUYA 1LL7A 2OMAA 4PRRA 3C56A 3UWZA 4KCVA 4UQBA 1Z8AA 4RUBA 5DMMA 4PCPA 4C7FA 4MDPA 1LLOA 1KBIA 5HXMA 1TTPA 4HK5A 1TPB1 3SUVA 5HNRA 5I03A 1L8NA 3WJXA 3QQWA 4G1NA 4LAZA 4NI8A 1LJYA 2A3HA 3VNDA 1JPKA 3VMPA 4BEQA 3NG3A 4NYYA 1UUOA 2R94A 3BAXA 2HK1A 1OK6A 1RBLA 1JIBA 2Z25A 5DY2A 4RDYA 5GQBA 1F6PA 1OC6A 1XLLA 4IPLA 4BY3A 5D2WA 5I00A 2WMGA 4Z1YA 3UY8A 2YDAA 3EX6A 2NLYA 4HZ8A 4AD3A 1ZPTA 3BK0A 4L6OA 1JXJA 3W73A 1W17A 3AYTA 3SR7A 4FNTA 1VLWA 2GQ9A 2QT3A 3V5FA 3G24A 4M29A 5FL0A 4GNKB 4AAJA 1IWPA 1B3VA 3SN1A 4HNUA 4AWTA 3DGBA 4NT0A 2C79A 4C1NB 3HURA 4I8YA 1H0GA 3CLWA 5HJYA 3L4UA 5HQLA 1WDSA 1PDYA 4A3QA 2J9XA 4LC8A 3OGVA 2O9TA 2VP8A 2QJHA 4EXQA 2P0OA 1MUMA 2O9RA 3T4CA 1XYCA 4JYEA 3HG3A 3EWZA 3LMYA 4HBKA 1SO4A 1GNXA 3UU0A 2E6YA 4U4MA 4ZQNA 2QJGA 3NQEA 3M43A 1H51A 5B80A 3EA2A 3NWRA 3S6OA 1A80A 1GQKA 3PBVA 3N19B 4S3AA 3WF3A 2OZTA 3AMCA 3A4JA 1X96A 3OYXA 1ZGDA 3AFBA 2P88A 1PS9A 1FKWA 3TONA 4GVGA 2BZNA 1HL9A 1NDZA 4PE8A 1TUXA 1IZKA 2WQPA 4WY0A 5D03A 3CAQA 3GDLA 4DIAA 3CYVA 2ZA3A 3JW7A 3QKZA 1NWRA 3P5ZA 1ZAHA 3OZMA 5ENLA 4MWAE 4G7FA 3UNDA 1RBAA 2PU1A 2GWGA 2Q09A 1IYXA 4LUYA 4LVBA 3T2PA 1V51A 3K1GA 4LXFA 4I9JA 4C6NA 5A3HA 5U4NA 4ZODA 1B3WA 2YA0A 2R82A 4B5UA 3S9YA 1XGDA 5DN1A 3BURA 2Q8ZA 3SFWA 3H7RA 4ZO8A 3W4RA 2EPHA 3NQ2A 4BS0A 3WNLA 2O4QA 2GQ3A 4US5D 1FFRA 3WH5A 1XUUA 1LF1A 4J2MA 3ME3A 2CZVA 2ACSA 4LUTB 1KXVA 1UA3A 4GUHA 4PBEA 1JZ7A 3C4UA 2H9AB 4HPJA 2IW0A 3URQA 4QEHA 3RU8X 3TTSA 5T91A 4FOJA 1A5AA 4AF0A 3S2JA 1KGXA 2HVNA 4NX5A 3G0SA 1KRMA 1ODUA 4XX6A 4M3PA 3FSUA 5K7JA 2Y7DA 4XVEA 5FJUA 4NL1A 4CD7A 1A4LA 1PX8A 1BWVA 1O5QA 1PSCA 2AL2B 4D6GA 3WLPA 4K8EA 3NQBA 5M1TA 1ZJBA 4M51A 2WLYA 5I06A 2VR2A 1H7RA 2FLIA 3K30A 4J7RA 5CLWA 1IT0A 1OINA 4ATLA 1PWMA 3L5MA 4J3SA 4OGZA 4ZL1A 4UXDA 3KLKA 1YIXA 1MI3A 1SFTA 1OD0A 2P10A 4RNHA 2J78A 1AJZA 1Q6FA 4LH8A 2ZDRA 1QW8A 4PBFA 5K2ZA 1PO9A 1DVJA 4FXSA 1CGYA 4GJ1A 1QHOA 2OCZA 1W9PA 5CPSA 1O66A 1HQTA 1UMLA 1A5SA 3LXAA 1YTKA 4ACZA 2OWXA 1UQYA 2C0AA 1BTCA 2GGIA 4DI8A 2WCAA 2GFTA 2X7VA 5I7GA 4AZCB 4B3ZA 2WNNA 1UZ1A 3ISIX 3NZGA 3W1PA 1DIDA 2C13A 3P61A 4JBRA 1U33A 3P7YA 4XAPA 3SQLA 3VKBA 3SI9A 3I3BA 3VOJA 1AODA 1WDDA 2DSUA 4J3ZA 4JTFA 4GZ7A 3VI2A 3RM8A 1F9CA 4UCGA 1XLEA 4OHQA 4BKNA 4MB3A 5IBXC 1RVGA 3GAKA 3AS3A 2VELA 2NX1A 4MZ8A 3HGOA 4O8RA 5CZJA 4JKLA 3W22A 2PD5A 3RCYA 2GVYA 2VZUA 3EKZA 3EDEA 4GQQA 3UGVA 4CEXC 4O52A 1HG3A 4XZ9A 1Z7AA 2J74A 4BWLA 1ZY9A 2OO0A 1XSIA 1S5MA 4FHAA 1CXEA 3OIXA 3W2NA 3MWCA 3A23A 1A0CA 4I3GA 3O6AA 3GBEA 2X2GA 1FY6A 3LRKA 1IEIA 1VD6A 3RK8A 5HMDA 3QHOA 2OLAA 4IQLA 4UR9A 4EIVA 3QW4B 3AAMA 4JTEA 1L6FA 4W5UA 2AQVA 1LUCA 4GVFA 4A8LA 2ZXAA 3WSUA 4DBSA 1V0LA 2TAAA 1E4IA 1O7AA 1EYWA 2XN0A 1SJBA 3VNKA 3GXFA 5DCEA 2OGJA 3FEQA 2D0HA 2OB3A 3URAA 1QWKA 3NM1A 2I14A 3WH6A 3BJFA 5DMNA 1JD9A 3EBVA 3LM7A 3Q94A 5DF0A 5DLCA 2BOEX 3LXBA 1EDQA 4YHEA 1R3SA 2BSLA 2XYLA 4LF2A 2J25A 3UF9A 5I77A 4Z2IA 4QEEA 2BOFX 3Q65A 2ZADA 4GNJA 3BLDA 1XYMA 2HVMA 1UKTA 4YU1A 3WDPP 3QTGA 3LPOA 4XAGA 4F2UA 5EL1A 1BFNA 4YTRA 1KFKA 4DPQA 3T0BA 1JPHA 1A47A 2NXGA 5GPRA 4XD5A 3EB4A 4QS6A 3LSBA 4W87A 2PWFA 1I9CB 4ZB2A 1RD5A 3B9NA 1L6SA 2WV8A 1TX2A 2R9RA 3A24A 4GYPA 1QHZA 4JPGA 1H1YA 4DAFA 4RXFA 4DO4A 2GGGA 5XIAA 4WX2A 4QLLA 5TBOA 4AYGA 3N1AA 1AK5A 1X98A 3RNDA 5ABEA 4DJFD 4TU1A 4DXVA 4WJXA 4MFDA 1VRDA 4GUFA 2HCVA 2G0WA 4NJKA 1DHPA 4UTHA 3B0XA 4OWGA 4AZCA 3B8IA 4LGXA 5C2GA 1KWKA 2G37A 4S23A 3G3DA 2DVUA 2VZVA 3EWYA 3N12A 3WFLA 1NAL1 3K4DA 4IQEA 1HVQA 2BGSA 4AXKA 5CPNA 5EFFA 2CHRA 3SRFA 3VNLA 3WLHA 3WH8A 2AMXA 1Q8JA 2AMGA 4E6MA 1U22A 1XSKA 3DFYA 3ENLA 1E51A 3APTA 3WLRA 3HG2A 3AQUA 2OX1A 2WAGA 3TYDA 1DIKA 3WY1A 2BXVA 2OX4A 4I90A 3WEOA 1OF6A 2GYIA 1C9DA 3RFAA 2PGRA 1NWTA 1CNVA 2P8CA 1PZ3A 3IEBA 1XIEA 5BOFA 3T05A 4HMCA 2NQ5A 1QI0A 3OVQA 2PWUA 4YTTA 3R13A 3N11A 3II1A 3VXGA 1QMLA 3INPA 5H1WA 5TQLA 1U5HA 1DJQA 4FLOA 4DELA 4DBUA 2VZSA 2Y6ZA 1TV7A 5LIUX 3OBKA 5HMSA 4XK2A 1WDQA 3BGJA 4NZFA 1A53A 3VZZA 1AH3A 2H6RA 1ZAJA 4JNYA 1M7JA 2P50A 2PTXA 1HL2A 3P8IA 3KL0A 1YXYA 2TSYA 4D8LA 2HXUA 4IISA 4TMBA 4KGLA 4DZ5A 3NQCA 4UTTA 3ZOAA 1ONEA 4V1YA 2PB1A 1GVRA 1YADA 3VDAA 2WJZA 4UQAA 2BB0A 4DO7A 3IWPA 1KXHA 4AHPA 3V5CA 1DQUA 1UP2A 3SCNA 4EXBA 1OGBA 1XX1A 4UOQA 4WJ8A 3BAKA 1YW1A 1V3KA 4JX5A 1MEIA 5A6SA 2XSXA 2NQZA 2YR1A 2R8WA 1Y5WA 4IFKB 4GABA 4YL2A 2WSQA 6XIMA 1KCKA 1W2PA 1OC7A 4LAKA 3S5NA 3TMLA 4RNJA 2YXXA 4WXZA 4TX9A 1AH4A 1KO0A 1E1CA 1V6TA 3EDKA 5M03A 5AC8A 1QI3A 5K9DA 1UROA 1VYRA 5C70A 3NO1A 2BOGX 3TNOA 3UCQA 4LS1A 4JD4A 1IHIA 1ELSA 3G8RA 1LYXA 1XH2A 5HNNA 1K6AA 3RM9A 4PB4A 1EZ2A 4LCRA 5L9FA 1NWUA 2BHZA 3TN3A 1H7PA 3MB9A 4IGNA 3F4NA 4JQ4A 2XFYA 3R0KA 5BNKA 2PTZA 5CPQA 2QS8A 5DELA 1EEPA 2FVKA 2HJPA 3WF1A 5CZTA 2XISA 4DWDA 5A6AA 3AZRA 3VIHA 2YZ5A 1YRRA 3PBUA 1B54A 4I9MA 3PTQA 1LWHA 2ODOA 4IJBA 2WO5A 5EKYA 3SB0A 3ONBA 4L64A 2UWFA 3ZVHB 3OGSA 4CKQA 1PX3A 3GFZA 4ZQPA 2VYOA 1RCOB 2POZA 1H7OA 1CXLA 3P60A 2YL6A 4YCPA 2ACUA 1Q6QA 2XIQA 5SWUA 1SMAA 4PCSA 2OSYA 3WDHA 8RUCA 3UXLA 5F1UA 3OLDA 2D20A 1OCNA 4NF7A 5JMUA 3TW9A 5T8GA 1EO7A 3AMGA 1I0BA 2WMHA 3QGVA 4AX7A 1M68A 3H12A 3GO2A 3BL3A 4O1DA 3QFEA 4MNKA 1WXYA 4ZGYA 3BMVA 3DHDA 4Q4QA 3BG5A 4XTIA 4XZBA 4C6CA 4ZXOA 4AW7A 4U3CA 5LNVA 2QF7A 1W5MA 1TA3B 3QEZA 4C1LA 2C19A 3NEVA 1XBZA 3AISA 3BSHA 1ML1A 4ADUA 3AHYA 3GU1A 3S1XA 1XC6A 2V38A 2AAAA 2Y89A 1EJRC 3KAOA 1AQHA 2W92A 4BK9A 5G1MA 5DEZA 1EP2A 2I17A 3T0TA 3ARYA 3V5OA 1RQHA 3PZNA 2GJLA 1KBLA 2J75A 2WNQA 2PPGA 1F73A 1HP5A 1F3XA 1W37A 4PB5A 4H1ZA 4KEMA 5FA5A 3L7RA 1QU4A 1PTGA 4OBRA 1V6WA 3QPEA 2QAPA 1EF2A 2YBVA 4MTVA 5DT7A 4MB1A 4NJIA 1JUBA 1QW7A 3RO6A 3M0KA 3WNOA 3T6CA 1E9IA 5LYRA 1KFBA 3IPWA 3VCRA 3GU9A 4RL3A 1VIZA 4UR7A 3F5JA 2GWNA 3HF3A 4J1OA 3NPWA 4US5A 5D9NA 1Y5VA 1JXKA 2HQAA 4BA0A 3EPMA 1VENA 4HYWA 1UZHA 3G5EA 4Y6GA 1G4EA 4YTUA 3OG2A 4HA0A 4GXWA 5LIKX 3KVMA 1J0ZA 4BCEA 1QFEA 3BMWA 2Y5JA 5IDIA 2PTDA 3QMSA 3QVQA 2DUAA 1GGOA 1V4YA 4NSBA 5FCZA 3LHTA 3R5EA 3H6OA 3ITLA 4Y9AA 1OVDA 2XN2A 2A0NA 4DPPA 2QDGA 5BXTA 1WNOA 4ZSTA 2EEXA 4B15A 1H7XA 2BVWA 3LDVA 3MZNA 1MW3A 1XKJA 3EYPA 4HSNA 3PTMA 4MKSA 1SW0A 3M0JA 2O92A 4ML4A 5FF7A 1F3EA 2W0UA 2ZUMA 3VDBA 2IPFA 4J40A 3NL5A 4JL2A 3DENA 1HKIA 3L5LA 4ZE5A 1TPEA 1J10A 3E5PA 2C91A 1KA9F 2WSYA 1JQXA 3WJYA 2PRHA 2DJLA 2NT1A 3OVRA 2OGYA 1UP0A 4AVOA 4L6HA 3CL8A 2CLKA 1S1PA 3RPMA 3VIFA 4B91A 3GHUA 3WLJA 5C9UA 1I45A 4ZO6A 5A8OA 3RUBL 4L9YA 1UR4A 2DT0A 1JZ4A 4IIHA 4K68A 3KE0A 1CT5A 3IJ6A 2CXEA 4IIDA 4N4QA 1G7UA 4V15A 2QAFA 1VFOA 3H2FA 4LBSA 5G2WA 3LTYA 4XSMA 4PGLA 5I78A 1VBGA 2Z24A 4LVDA 4PTWA 3RX3A 2YCLB 3U4FA 2W63A 2JE8A 3F2CA 4D72A 3DFOA 3NURA 2D69A 1TA3A 4DNHA 4O4VA 4OZOA 1DJWA 1GK8A 3PFRA 4QROA 3CAVA 3FSTA 3EOSA 1WZAA 4IQDA 2YCIX 4PL2A 3ZR6A 1V6UA 3ZLGA 5CEWA 1FCBA 4JXCA 2IUZA 4JCLA 2FHBA 4W4QA 2ZQ0A 1JG9A 2C1GA 3AHXA 4A2RA 3AIUA 2VGFA 5EYWA 1RK5A 3K4AA 2OOGA 1CDGA 4JTKA 3B4UA 3NVDA 1BHGA 3VVGA 2RH9A 4OIFA 1UR2A 3LCIA 2FH6A 4C6LA 3LMZA 4D6JA 2V5DA 4UC5A 4ZCWA 5E9AA 3OOQA 3T0DA 1LDCA 4E8DA 4QCFA 4JKKA 3N2OA 3WNNA 4WDWA 3C5QA 1S1RA 3TAOA 3THDA 1MNZA 5TNVA 4QDWA 1V6VA 2PDWA 2WCSA 1ECEA 4ICCX 2INFA 3PN8A 3HA1A 4L4MA 5HJXA 4CD4A 1JDEA 1XDJA 3HTWA 2WKLA 4DZIA 4UFJA 2NV1A 3C2RA 3EWCA 5D05A 1K7EA 2D23A 7ODCA 1ZBWA 1SGJA 2WM0A 3W1TA 1VGAA 1WZMA 2PLCA 1HGWA 1Q8AA 3U8GA 4WRHA 4Z1CA 2G96A 4K3ZA 1QNRA 3L12A 3QJAA 1GONA 3AIWA 2Z1SA 3KW3A 1HKKA 1OX5A 1UB3A 3EKGA 1XD0A 2ON3A 2X30A 2B7NA 1FCVA 3MCMA 3R8HA 9XIMA 1E6RA 3BAWA 5F2GA 4GBDA 3WK1A 3ZT7A 3BLOA 4H7ZA 1DBTA 4L1WA 3ZIZA 2OQYA 4P7QA 3T42A 4ATDA 1ICPA 4B90A 1Q4WA 2GJPA 1ZBCA 2QJMA 1GG1A 5A6KA 4Q7IA 1TKKA 1SSGA 1AMKA 4P8VA 1TE1A 5LXEA 3OLGA 1A0DA 1SO3A 4JY8A 2Y8KA 3RR4A 1P6CA 1UP3A 2KAUC 2X8RA 2J7DA 1VFUA 1A5KC 4KWUA 2P5NA 4C6KA 1PWLA 2BV9A 4POCA 4GLEA 2VEMA 2VC9A 1U5JA 2GVLA 3VNYA 1VKFA 4DVOA 3D46A 1TV4A 4BQ4A 5EA9A 2UV8G 4KWVA 4Z2JA 2CNCA 3GAYA 4DJFA 1RALA 1HTIA 1XYAA 4DUOA 4JS3A 4IL2A 4OUEA 4TR9A 3F2BA 5KSWA 4PTNA 1WE5A 1MFVA 1REQB 4XZIA 2A3BA 3PZGA 3SCPA 3DKLA 1E1FA 4J28A 4BQ5A 2WHJA 3W84A 5FI8A 4UFHA 3FV9A 4R9XA 3ZM8A 4RW5A 2YCLA 1UKPA 4CQ9A 3KOXA 2DIJA 4H00A 1THFD 3CGTA 3WLIA 2Q6ZA 1FWBC 3PG9A 2PEVA 2VC7A 7REQA 3M0XA 1J01A 2FJUB 1JZ8A 1XD1A 3KZPA 1S2UA 4Q6JA 4OTKA 5KZDA 1OY0A 9RUBA 3N2MA 4DF2A 4XD3A 2VT0A 4EK7A 3SSJA 1NU5A 3CUIA 2XH4A 5CBIA 2WHLA 3O0KA 5CSYA 5EIYB 3C86A 1M01A 1ZU8A 3DZ1A 1XRFA 3G77A 3QV7A 1YBQA 3T8QA 2BGQA 4HN8A 3YPIA 3TYBA 4LV9A 3KM8A 3NQ7A 1A5LC 3QF0A 2ZTJA 3I10A 4IM4A 2PE4A 4IICA 5AFDA 3T0AA 2J8FA 3MP3A 3P80A 4DQWA 2JGQA 2I5IA 4C5ZA 1J6PA 1U83A 3W7NA 3MWAA 1UIPA 2AAMA 1TZZA 2D22A 3QKEA 1G7VA 4HPXA 4ADSA 3ZSTA 1FRBA 4C6DA 4HNVA 1GQNA 2Y8VA 1NDVA 5A1AA 5FJPA 3W1XA 3GX9A 1F3TA 5KETA 1R2RA 3EX1A 4E8GA 3A12A 1W1B1 1NP2A 4BZYA 3R10A 1BVWA 4HMEA 4TTUA 5AY7A 1H60A 3EAUA 5BWFA 1TTQA 1C29A 4RW3A 1QNQA 3S5YA 5AZ0A 2DSKA 4GA8A 2RDWA 1FWIC 1O60A 2NXHA 1I4NA 3K8KA 1YXDA 3T09A 4PRWA 3CLMA 3PAOA 1WXZA 2YW4A 1S2TA 2QIWA 1S2VA 2QCMA 3UJEA 3IVSA 1TCMA 5IRPA 1JAEA 2BY1A 1HN1A 2XH2A 1XICA 2PZNA 1UD3A 2GQ8A 2BODX 4HCHA 4LEQA 4AZBA 4I8DA 2BHYA 2VVNA 3FGCB 4A2SA 1JCMP 4ADTA 3GYEA 3AIRA 3CT2A 3WD1A 3SUSA 2JQXA 3S2NA 4EX4A 1AQFA 2BHUA 3M46A 2VTFA 1XGZA 3S83A 3SIZA 4E0CA 1BRLB 6A3HA 3SJ3A 3HQNA 3KRSA 4DAIA 4UFKA 4PULA 1TPFA 4EPKA 4JFWA 5ABHA 2O4MA 3GW3A 1SSDA 3DHUA 4IIEA 1F6YA 1SFSA 2QXWA 2WHKA 5FIPA 1PAMA 4GI4A 2VCAA 3TIMA 1JUEA 2DDXA 4UMAA 5D38A 2OODA 1NTHA 3AHZA 1ITUA 3C2EA 4IX2A 1E72M 3M41A 3GTXA 1REQA 3LRLA 4QXIA 1UBPC 3LBOA 2P3ZA 2GSHA 1QTWA 1E3XA 2NV9A 2ZRWA 3R8RA 1JYVA 2J62A 3VUPA 3T81A 1P6BA 2Y88A 1CXIA 2A5HA 3S47A 5C7HA 1LG2A 5RUBA 2VFFA 3GLCA 3I7SA 3WQCA 1FWSA 3N2CA 1UWRA 1U5VA 4BWLC 2PI6A 3URNA 1FXPA 1N7KA 1HJSA 1XKYA 1BSIA 1OCQA 3WELA 4DBEA 3PZQA 2HPMA 4GY7A 2YA2A 2GUBA 4MY1A 5A8NA 2GVJA 4PMZA 4ZB5A 3DAQA 3F5KA 3TJIA 2WC4A 4D71A 1GYMA 3VYLA 3PZMA 4FMVA 4K36A 3GR7A 3LSCA 4LW7A 5AHIA 3WF4A 3W00A 4LY8A 3MCOA 3K1DA 4O0ZA 1WKEA 1B30A 4B5WA 2VRKA 1LLWA 1TV8A 3AXXA 2X42A 4WSHA 1WAWA 4W5ZA 1ALDA 2WSKA 2ONEA 3MI2A 2ZUWA 4G5DA 3AS2A 1NVMA 2QVNA 1UPMB 2BS9A 3QV8A 4U5IA 3L65A 3L23A 2D2OA 1OM0A 2W4XA 2J9ZA 4TVCA 3SCVA 1GTHA 4OVXA 3C0LA 2CITA 2NSOA 1ZBKA 1AQMA 1BKHA 2YDSA 2PZ0A 1Q2SA 3IUHA 2Z1VA 2PODA 4A6GA 2WSPA 5DQPA 4M56A 1IXNA 3SCWA 5I79A 1TPUA 2YFNA 3LTSA 4R88A 3AXHA 4W84A 1YPFA 3H21A 4HTYA 5FEXA 2GLKA 3PR2A 4QG9A 2QKFA 1LRQA 1NELA 4N6EA 2FJKA 1KQYA 1WP6A 3FJNA 1A49A 1MDLA 3CYJA 3MP4A 3BSMA 3GFYA 3G1AA 3VUSA 1XM3A 1RBOB 3ZQ9A 2W5FA 3AZTA 2DIKA 1AD4A 4CEUC 3M47A 2P76A 1EEXA 1C91A 5EY5A 5CQ1A 1R5YA 4QM1A 4GYPC 2ZRZA 3G0XA 3QOKA 3F2DA 3CASA 3FGCA 3PUOA 3B04A 1IF2A 1AMYA 2OQHA 4WUIA 4JKMA 4IMFA 1ZJIA 2PURA 2JALA 4PMDA 4WSKA 2PU0A 3KP1A 1OC5A 3GH5A 3AIQA 2OEKA 1GEQA 1C7SA 3CZEA 4KWOA 4FNRA 4UMBA 3SAZA 3W26A 3ARUA 1MQRA 3A3XA 2GOKA 2ZVRA 4Z0SA 4GC4A 2HRWA 3DFHA 3VPLA 2GZXA 3HB9A 1R2SA 2CHOA 1N55A 1VJIA 2WXDM 3OEXA 5M3WA 3TC3A 3UYIA 2F38A 2QCDA 3NGFA 4PMVA 3DKJA 3STFA 4QSFA 4F9JA 1W5PA 1E15A 3A9BA 1LL6A 1ZJAA 3CWNA 1KXTA 4B16A 1XINA 3W1RA 2VMFA 4DJED 1EQPA 4HA1A 4NRSA 3EX2A 1BYBA 3RMJA 4FZIA 3TSMA 3W6LA 1I8JA 3IUDA 3AWOA 5AVHA 3VIOA 4IMAA 2GSJA 5I6SA 3S3GA 3LHZA 1FWHC 1JZ5A 2MNRA 1XYFA 3KDNA 4X22A 1NDWA 4M6VA 4UIOA 1KRBC 3CV2A 1UWAA 5HR7A 4QG6A 2D3LA 4MFEA 3TEVA 5LIWX 2J6XA 1XLBA 2OYKA 3CZKA 1Q3NA 1VB9A 1L0PA 1G4TA 5EJZB 1JPDX 1BKSA 2QCEA 4KESA 2JF7A 4UTTC 3N34A 3LN3A 1FKXA 1U1HA 2WB5A 3PG8A 1L6YA 4FX7A 3OZYA 4CCDA 2F2HA 3PBGA 4JIQA 5A6MA 1E40A 5FSEC 1MNSA 1A5NC 1EFZA 3HOJA 3NUKA 4FR6A 4HHMA 1Z32X 1EXPA 2YLAA 2PSNA 4MNMA 4GQGA 3WH7A 1UH4A 1XIGA 1B31A 1CGVA 3PULA 4QHRA 3MUXA 1HF6A 1VCGA 2HBVA 4N6FA 3H4XA 1PKYA 1DV7A 1GJUA 3R12A 2BLEA 4PMQA 4R85A 2QVHA 4F66A 3MJMA 2XH0A 1JCTA 4M0XA 2XM1A 2XSBA 3MMTA 2G41A 3PZ9A 4GIYA 4BR1A 2Y5SA 4GBUA 3VU2A 2Y2WA 4ROPA 2PDUA 2CBUA 3WF2A 2RKXA 3MANA 5M17A 4EWJA 3ANUA 4LU0A 1ZS2A 3F4WA 4QNEA 2VX5A 5JU6A 5I07A 2Q3OA 2B31A 3WJZA 2X40A 3TNBA 2Z7KA 4B9ZA 3RGTA 4O0QA 3N14A 3CEUA 2YJQA 5G1YA 1SJAA 2FTPA 1UR0A 1SFLA 1WV2A 1GKRA 4UTKA 4ZSUA 2XFRA 4TUFA 4I5XA 1BD0A 3ID7A 4GACA 1F8IA 4I7UA 3VTRA 1RCXB 4AD0A 2V82A 4PUKA 4WK9A 1MMFA 5CAKA 5JUVA 4AHQA 4AZ7A 4O4WA 1VBHA 2Y5EA 3AYVA 1XDMA 5CSUA 2B7QA 4GK8A 1J96A 1FH7A 5E5CA 4N2YA 2HWGA 5BZAA 3LBCA 2A4AA 2NV2A 4JQ1A 1NP0A 3AXIA 3VC6A 5I23A 2P3EA 3FAWA 3ZS4A 2VDHA 4E38A 3R7MA 1EJTC 2A2IA 1H1NA 1VBRA 4IUGA 1MRAA 2X41A 3KBNA 3DI0A 3KBSA 3PBYA 1VRXA 3PUEA 1I1XA 5CZ0A 3BG3A 2Y7GA 1YE4A 4S3BA 1AL7A 1G1YA 2OG9A 3CQHA 1Y65A 1ZHAA 3SIMA 3QY7A 1EJXC 3ALGA 1TQJA 4CVWA 3UERA 1HNYA 1X7IA 4OT7A 1EO5A 4L7ZA 1UC4A 2DORA 1JNDA 3V4BA 5C0QA 5C7VA 4HK6A 3H2AA 3RLUA 1UOZA 2WVVB 3TXZA 2JBMA 4PCTA 1J0KA 1IGWA 2A21A 1KRCC 5XIMA 1QOXA 4HZ6A 1KRAC 4PFHA 3LLDA 2FGBA 4DUVA 4N9DA 3CUFA 1PKMA 2IXUA 1WDPA 2PF8A 1JZ3A 2F6XA 1MW2A 2FGZA 3B8SA 3LM3A 1D8CA 4CN4A 4HA4A 1TRIA 1NOFA 1EPXA 2REQB 2A6NA 3DUGA 3FCPA 3GDTA 4JDBA 3UVAA 3LYEA 4S2BA 3SGGA 3B40A 4AWEA 1A5CA 2BX7A 2VEPA 4XVDA 4L65A 2TRSA 3CBWA 1E4LA 4LYKA 3WEZA 4QQUA 1UMYA 4W8BA 4GIEA 3GH4A 4ZENA 2P0IA 3DFPA 4MLJA 1BWKA 5IBXA 4NKCA 4AISA 8XIMA 1Q6EA 1NQ6A 3AROA 4HHHA 3H2NA 3BWWA 3TAKA 1DEDA 4L56A 1XQKA 3SUTA 3W7LA 3BZJA 4JZ5A 1GOWA 3W83A 3T2OA 4PUDA 2VC5A 4Z1AA 1VCFA 1BYDA 1OYBA 4H9ZA 3FK4A 3TCEA 8TIMA 3EWUA 3MSDA 4MKVA 1P0DA 2NUYA 2QDEA 2IQ0A 2YGYA 3NO5A 3FFSA 3BPWA 4MNLA 4K37A 3CL6A 3WD0A 3CUGA 2YL5A 2V68A 3CPUA 4DZAA 4AZGA 4MB5A 4L4OA 2VM8A 3VKJA 2WLZA 3B8WA 1GVFA 5LIYX 1CXFA 3ZJ7A 3V3WA 2PDBA 3BCFA 5HPCA 5ECUA 1ZAIA 1XH1A 4IPIA 1ZZMA 2J24A 3QYQA 3QGAC 1P7TB 2HSAA 5E6YA 2NQ9A 4EAYA 1IQ8A 3M7WA 3TX9A 4W86A 1F61A 1SVDA 2ZX8A 4WGHA 2WC7A 4QLJA 1A4MA 5F1VA 3HGJA 5GNZA 1LBFA 4JFUA 2BWGA 1BF6A 4CQBA 3KRUA 3ABRA 1R30A 3NQVA 3QXBA 3G1DA 2YL9A 2ACQA 2E25A 3G1XA 1G94A 1RAKA 2VUYA 3TOYA 5M5DA 3O1NA 3PTDA 4P61A 1Q6LA 1OX4B 4GYKA 3OQEA 4LUIA 2G4JA 4FXFA 3WX7A 1BGAA 2XG9A 3TN6A 1UASA 3GZAA 1F6KA 4MIMA 4EXAA 3QTPA 2CLIA 4M6UA 2FVMA 3GNNA 4YVPA 1A0EA 3IJ9A 4LUJA 2Q8XA 3IS4A 2O7QA 3TR9A 3N4EA 4QQ3A 1MXDA 3U57A 4ZO7A 5A6TC 4OJYA 3FKKA 3W7JA 3BANA 4JTRA 4BEUA 4JTCA 4HPHA 2ALDA 2V3FA 1K1DA 2VVSA 4XIAA 4H9YA 3HN3A 2OYLA 3BLEA 1TPWA 1VS1A 3JU2A 2ZTKA 3ARVA 4NHVA 4XG1A 4FSAA 4NZ4A 2BY2A 3OZPA 3GHTA 3ZXWA 4X0VA 1CXKA 4NRRA 3SUWA 4G6CA 2CIPA 3GHSA 2Y8UA 2DSZA 1ITCA 3ZR4A 3UEQA 3FJ6A 1QXLA 3M6DA 3CB8A 4BF9A 4DRSA 2OKTA 5T9BG 3CM4A 4DM2A 2XWEA 4UQ9A 2PCQA 3W7GA 3V75A 1XV8A 1DYSA 2WNZA 4X2RA 1PVNA 3FYOA 3QV6A 3RAOA 5A6BD 1T7LA 3ELFA 4N9BA 1RR2A 2PLKA 5EMYA 1S5WA 5F7UA 3I6TA 2X16A 1MO0A 2VL4A 3G6MA 5REQB 2IPJA 5C2CA 4XZNX 2GJXB 4RX0A 4FK9A 4ZZ9A 3UZXA 2YCEA 1VJSA 3ALFA 2OQLA 4KERA 2CPUA 3QR1A 3BH4A 2V9DA 1SR9A 4NU7A 5CC6A 3W81A 1GT8A 1YPXA 4R53A 4UFMA 3RLVA 3FN9A 1XISA 2NVCA 4E3VA 1LL4A 4O1EA 1HUVA 1PE1A 4JL1A 4IWWA 1QI5A 4CNSA 2HS8A 5E09A 2QJNA 3RJYA 5HNTA 1OB0A 3IAPA 2UY3A 3S1WA 4R9OA 3PZVA 3R0DA 4LRSA 4A4AA 2VDGA 1TTIA 2XVLA 4O15A 1OGGA 5GJMA 4UTJA 5F4WA 1XLAA 4RE3A 4PBGA 2WM1A 4GY1A 1QPRA 3MV01 3S5OA 2C8NA 1C92A 3WYZA 1XBXA 4EPEC 3O07A 4GNVA 3AOFA 2V63A 5G2IA 1KD0A 5AN7A 3OVPA 2BY0A 3EOOA 1C9WA 3QM3A 5JBEA 2YL8A 1Q66A 1GVQA 2R1LA 4QCEA 4ZEPA 4UQEA 1P5BA 4C6MA 5BU9A 2E8YA 1YYAA 4P7LA 4ZOAA 3RU6A 2HXTA 1BG9A 1EJ7L 6PTDA 3H8AA 2HK0A 3W76A 4UTWC 1OX4A 3GQYA 4H19A 1PEZA 1TJ0A 4LBUA 3W24A 3H2CA 4BI6A 1SZGA 3L2IA 3T78A 2CLFA 5K9XA 4XSLA 3NXLA 2WK2A 4K7VA 3HZ3A 1EP1A 3NXFA 4J3TA 3QC3A 4V28A 3VCCA 3HFYA 3K5XA 4GX9A 5CXPA 3WQEA 4PYSA 1US3A 4UCFA 3N04A 1JF5A 2QCFA 2E3ZA 4KEUA 3ARSA 3E0IA 3OW1A 4O54A 3ZYZA 4NXKA 4DJEA 1FCQA 1UBSA 3TZNA 2OZ8A 1X38A 2CEQA 1XIJA 5G4WA 1XIMA 4MPQA 3AU2A 1X39A 4WD0A 3CZLA 3E2RA 4RDWA 4M8UA 3LGEA 3UWQA 2DQXA 1YNQA 3GG7A 4KCWA 1W5NA 2Z2BA 2WPBA 2OZ0A 2FFIA 3T1GA 2TMDA 3KVKA 1OFBA 3HMJG 3S0CA 2D0GA 1IZCA 1TWSA 3AMLA 1B9ZA 3TWAA 2GVGA 2POTA 2QMKA 3UJSA 5PTDA 2J7FA 1W8SA 2V3GA 4XB3A 1RUSA 3P0WA 3REQA 4EKJA 2D1ZA 4DUWA 3N2TA 4YHGA 1T8XA 1FWDC 3L4XA 3IARA 1MFUA 5REQA 5C9WA 4JAWA 4IUOA 2R1MA 2QR6A 3IJIA 4RDVA 1IEQA 2DU2A 3EB3A 2G50A 4MJMA 1JGIA 3BLPX 3PBWA 3APGA 1KFWA 1GORA 3E38A 3CU2A 3UYCA 3L67A 1RHCA 1M7XA 4HG6B 3NL6A 5DBUA 4L9XA 5EMJA 2X7WA 4LNCA 4ROQA 2OELA 4S3DA 3WN6A 3GZ3A 1V6YA 3PJXA 1OFEA 4H8UA 4UTFA 1AL8A 2VGBA 1KLZA 4CD8A 1Y7VA 2X09A 3FX4A 4HGXA 3VD7A 3VM7A 2GOUA 3KFTA 4GUGA 4GISA 3U7BA 1HP4A 4QAWA 1JUKA 2QDHA 3F4VA 4GMEA 1PYFA 2WC3A 1SO6A 1DPMA 4CNPA 3DN5A 1A3XA 4XO7A 1BLIA 4W88A 4S38A 1E0VA 1S38A 1W2VA 5IDZA 3GH7A 1M7PA 1PZ1A 4G7EB 1DWAM 2VX6A 4QDMA 1FDZA 1JYXA 3MUAA 3QH2A 3GW0A 2VURA 4I9AA 1VFHA 5D33A 3BJTA 3GG0A 3MVIA 2FMOA 2PDGA 3S6DA 2Q02A 5FF0A 4PMOA 3MHUA 2H8ZA 1F4AA 3UXDA 4MZYA 2BXYA 3G2GA 4IMGA 3FS2A 4KRTA 2ZZ7A 1JGMA 4AZ6A 3E9AA 3BE7A 4QFUA 2ZRUA 4FIQA 5FKYA 1ZBVA 2YBTA 3BJSA 1K3UA 1QAPA 3LCFA 4WY0F 3BV7A 2PAJA 4R7OA 1XLCA 4F0LA 4Y9PA 2V5KA 1VLIA 1VC4A 4PN2A 1GEHA 1PZ2A 2ZVIA 1UR8A 3SZ8A 2Z1WA 1WZKA 5MF5A 3DU0A 6ALDA 2HE5A 3KRZA 4B5XA 4REQA 1S2CA 2FZNA 5HUOA 3LQLA 3WBYA 2VUNA 2OT0A 2ALRA 3TA6A 5E0CA 2EPLX 3O6YX 4IP4A 4LNYA 4MKNA 1ZP4A 4X2PA 2W9MA 3LGGA 3QLLA 4E8CA 1YTEA 4HJFA 1H2JA 1LOSA 2QDDA 3W72A 3PJUA 1JL8A 1V3LA 5KZMA 3P82A 3FA5A 4AC7C 3ITXA 3PZTA 2ZRVA 3LHVA 5LNRA 4OBTA 4A3YA 5CSSA 4S3EA 2XFFA 4I5UA 3AU6A 4JN6A 4HYVA 3C2OA 3RLHA 2CLHA 1KBBA 3PUGA 1P4CA 1E4MM 2XWDA 3H22A 1M1BA 4UFIA 4Z1BA 4HMDA 1EHNA 2NUXA 4E4FA 2D3NA 4F0HA 5T9CE 3U7VA 1F76A 4U2ZA 5AC5A 1V8EA 2YLLA 2QULA 1QPQA 1H3GA 2AKMA 3NSMA 3LPGA 2XGIA 2XIJA 2QCCA 5FJIA 1GHRA 3HMCA 3OP2A 4HOWA 1ME7A 1DJIA 2C7FA 3SJNA 2GK1B 3WMSA 5CLTA 5JQ9A 3T9PA 3NQDA 4GI6A 5D2VA 4L80A 3QQ0A 2EF9A 2PDNA 4FXRA 4NYUA 3BGAA 1MXSA 4RE4A 4F3HA 3ZFHA 4B5VA 1SJCA 2I5GA 4B3LA 2FFCA 4FLSA 1NIUA 4FXJA 4JN8A 1W56A 3VOCA 3UR2A 2B7PA 2V5CA 4HN4A 1FWCC 1I2OA 1HJUA 3OHMB 3HPFA 1CBGA 3VGHA 2ABBA 5CPLA 1FWWA 3LHWA 3VGBA 3VX0A 3MI6A 3EPNA 4IMCA 2VD9A 4AVNA 4O1AA 1J11A 2EXOA 4AF0B 2G97A 2AQWA 2HBXA 3CIVA 5HOSA 3OHIA 2WKJA 3KZSA 3IGUA 1WAUA 2J7GA 4LAOA 4H9VA 5D30A 3KCJA 1RZMA 1XPGA 1EUAA 5EMUA 1F4HA 1VFTA 1W1YA 4IT1A 3KL3A 2B7OA 5EGRA 1P6WA 3L4ZA 3V1PA 2E5DA 4PEKA 2PDQA 5IHRA 1V02A 4US6A 4M19A 2ZUTA 3TZFA 3B05A 1N8IA 3GC2A 1NF7A 4DB7A 2J7CA 3TW6A 3M16A 1VFMA 2OXNA 2QUVA 1VBUA 2EG6A 2QF8A 3LV6A 1LP6A 1Q85A 1OFDA 1JPMA 3FYYA 1CPUA 3EXTA 2GSEA 5I3HA 4UOJA 1DXFA 3GK0A 3E1F1 1WQ5A 4XBJA 3P67A 5DCDA 3S42A 1B3OA 3SY1A 3CUZA 3DBPA 2NXIA 2ZDSA 4GCXA 1Q7MA 4GI9A 3MKVA 3M0ZA 1JDDA 2CBVA 2FPYA 2IKGA 4ACZB 4HK7A 4DUXA 1EJVC 1IT8A 4TX8A 4NI3A 4FNSA 3VILA 3WL0A 3GNXA 5K4ZA 4YYCA 4O57A 2DJXA 1PTDA 3M0IA 3TFCA 2V0TA 1CW2A 3UWVA 4M5PA 4B5NA 4ZO9A 1YEYA 3EGJA 3GG1A 2ZZ3A 5A6BA 5BMXA 4P02B 1HKMA 5CZKA 3UETA 1FVPA 1A5OC 5JBDA 1VZWA 2ZXDA 1DHKA 4D6HA 1Q63A 1R3WA 3WK0A 4JGDA 4S39A 4ZR8A 1J79A 4S3CA 4Q8OA 3ONCA 3QYSA 1UHVA 3IIOA 3ZJKA 3WQVA 2XPKA 4UB9A 3KRBA 3P2VA 2F7FA 1E6NA 4KF1A 2GDQA 4DBWA 1JNEA 1E43A 1KKRA 2RJGA 3A64A 3OA5A 1IXQA 1ISWA 2GK1A 3F03K 1CYGA 2ADAA 5DANA 1CLVA 4Y8FA 1X1OA 1CLKA 2Y4SA 4P8UA 2WZMA 1QI4A 1DWGM 1LUCB 1KCZA 3HIJA 3NOEA 4RPPA 1WOBA 3PZIA 4GVHA 5D9PA 3AZSA 4K8GA 3H4GA 5FSDC 3EX4A 1OFPA 4NZCA 2QGHA 3E96A 2ZZ4A 4HTBA 1KFEA 2Z29A 3VFCA 4K1WA 4FR1A 2AGKA 1TJ1A 3Q37A 3KCOA 5GJNA 3SUUA 2E6DA 3JUGA 5KTLA 4R7JA 4EVZA 1BQGA 3OZOA 1K03A 3KOWA 3MSGA 2PWEA 1FP9A 3PWAA 2OKOA 3R11A 3TYAA 4KCUA 1O1HA 4RK8A 2FZDA 3UZZA 3H7VA 3LHYA 3TC6A 4ZQOA 4PUEA 2UY4A 3FEMA 1I1WA 3RHGA 1VHCA 1XIFA 2D2GA 1EIXA 4XQ6A 2AKZA 3B97A 4MJ2A 1O1ZA 1VPXA 3W1UA 2X2YA 1OFAA 5D9OA 2HDJA 3APYA 4AY8A 1MYRA 4EPDC 4IMDA 1BXNA 3FOKA 3UWWA 3O6CA 1G0CA 4ASTA 3JR2A 1ZUAX 1U1JA 4GO9A 1UH2A 4G56A 3KBWA 4PH6A 4UNIA 4LAUA 1MVYA 4BF7A 1TR9A 1Q6RA 1TWWA 3KDOA 2E28A 3CIWA 4LQ1A 2HNEA 4EAMA 3UXIA 3ZZ1A 3LENA 3UXKA 1YKWA 3TMQA 3M64A 3CIXA 4NZ3A 2O9PA 3WQPA 3WDIA 5D2YA 2WJDA 3MA8A 3LI1A 3OJGA 4UNKA 1JF6A 4JIPA 1SM9A 2PUZA 4FF5A 1DTUA 1EIBA 4O28A 1BAGA 5DXXA 4OFCA 2CCRA 1Z48A 2R1KA 3MMWA 5D2XA 3RIKA 3TTYA 3WUGA 1FWNA 4DY1A 3P84A 3G18A 5MKGA 2RAGA 1LQAA 1EQCA 2Z4GA 1M6JA 3O63A 5AC7A 4LWWA 3B0YA 4CNTA 2VCBA 2EKCA 4CQ8A 3TP4A 1RK6A 1WUEA 4M7SA 3FJ4A 2F6UA 4HSOA 4PMYA 5JH2A 5H8UA 3LUTA 1SO5A 5HPOA 1UJPA 1QK2A 2FZ9A 4MWAD 2A3AA 2DV0A 4PUUA 2ZXBA 4X63A 4P00B 3DFNA 1W9XA 3GKFA 2AOSA 5KITA 1E6XM 4MAVA 2XINA 1CGUA 3GNPA 1MW0A 4H6KA 3M0LA 2PDYA 5E1QA 4XAZA 1BPLB 4AIBA 2W62A 4IH3A 2C1IA 3B4YA 3V18A 3M07A 2CZFA 4O11A 3SQSA 1JQVA 4OV4A 2X1SA 1UUMA 3OTRA 3W1LA 3P62A 3TQ0A 3GDRA 1JCLA 1UCWA 2WMIA 1BVZA 3AHVA 4XO6A 1AG1O 4XKYB 4M1RA 1H5VA 2NQHA 4TO8A 1Y5XA 2EQDA 2XIMA 3P6LA 1O12A 3CWHA 1A3HA 2NQJA 3L0GA 1W1IE 2D2JA 3M6YA 4KQNA 3PZOA 5D8ZA 2GDVA 4J3VA 5A6JA 1XCWA 1E0TA 5CGQA 4DWSA 4HB7A 4XWUA 3RITA 1DJGA 1JDAA 1TZ7A 3Q2DA 4ICMA 2WVSA 5AYZA 1UWSA 2J27A 1W91A 1O4UA 1P0NA 3LU2A 3PSVA 1HO1A 5LA2A 4C6BA 4GUJA 3VNZA 1EGMA 2ISWA 3VGGA 5AECA 1Q6CA 4KRZA 2Z28A 3T40A 3K46A 1B3YA 1UWIA 3ATYA 4GCAA 1GQIA 7TIMA 4JQAA 1B9BA 1I2RA 4Z1DA 3I4KA 4DO5A 4E4PA 2IKJA 1GVSA 4PSPA 3SO7A 2QJJA 1E1CB 2WMKA 3W07A 3TC7A 4MZ1A 3T2QA 1PIGA 4BQ2A 4OKDA 2FHFA 4JQ3A 4FALA 3AJXA 3WDQA 4DXXA 4Y96A 5TAOA 4H9TA 4CU6A 2XM2A 1TMQA 1ZQ5A 1QVBA 1T41A 3NFUA 1B0IA 2Y70A 5B7YA 4MM1A 1MZRA 3CAWA 4GIRA 2A7PA 3HPZA 2X0YA 4K7YA 4DYJA 5HK4A 2NX3A 3R4IA 3UP8A 1KTNA 5LHEA 2OZ3A 3H26A 3ARPA 1GQJA 2E40A 1H09A 2ZYFA 4KFOA 4JYDA 5C2XA 1F05A 1N8FA 4YVVA 3GR8A 2ASHA 1OYCA 6XIAA 3MP5A 2GGEA 2WBGA 3MTWA 4E4UA 4WKHA 3H4WA 4PMRA 1XIBA 3BG9A 4FPSA 3ZJ6A 2G3NA 1H0IA 2NQLA 5HWNA 5CGTA 1KBJA 1TR1A 5HA7A 1OFQA 1WBJA 3AYSA 2PDMA 1GOMA 3A13A 1EWDA 2HNHA 4AY7A 3HQPA 3TE9A 1J93A 1GOIA 2GUUA 3KX6A 5LZLA 2J7EA 1M53A 3UCCA 2FKPA 4GG9A 1UOKA 3TUUA 3PNUA 1BGGA 2J8TA 5LNWA 2ZCGA 4D1IA 3L21A 4EE9A 2WW5A 4TV6A 3RR1A 3FHQA 3L4TA 4S3FA 4HHPA 3DHFA 1MXGA 1DORA 4PCNA 2Y0FA 4GGBA 1TWIA 1T99A 3LK6A 4Q32A 3M5YA 3SGUA 1RLDA 2ACRA 4AEOA 1SPQA 3E2VA 3TTEA 3RPTA 1XBVA 3OQ8A 3GTNA 2ZX6A 2ZX7A 8XIAA 3ARZA 3H2OA 4W7WA 3MSYA 3QQ1A 3BOLA 4I6VA 4FP1A 4F9DA 3IRDA 3EWBX 1EZWA 4DZHA 4L5ZA 4QRNA 2Z1BA 1NOUA 4JTIA 3KOZA 4XKYA 5FEWA 2F61A 3F1QA 1WO2A 3UFYA 4Q8PA 2OO6A 4MYAA 1VR6A 2HZGA 2NX9A 4HJWA 2CBIA 2QPSA 2NVDA 5F2LA 3AWNA 3FIGA 1J2WA 4P8WA 3GDKA 4C5YA 1UR9A 5HANA 1R2TA 2VEFA 4PCFA 1RA0A 3B0VC 3CHFA 3QPZA 3O9NA 3LTPA 4LUSA 3LX9A 4YMZA 3N4AA 2J66A 1SZNA 2C0HA 3N9RA 5CG0A 2ZZ1A 1EC8A 3FA3A 3N6HA 3LD5A 3FY1A 1RD6A 1DWIM 3W27A 3S2CA 3R0UA 1E4NA 4EPBC 2TYSA 1M65A 2CHNA 4DJEC 3NYDA 4AX6A 3IIPA 1W5OA 3DC0A 1HJQA 1IWBA 3SRHA 3UGRA 3C3UA 1QO2A 3E0FA 3CTTA 1HJVA 2XJ7A 3BARA 3WJWA 3LEPA 5C6MA 5C9ZA 4CVUA 1RQEA 4IFRA 2DZTA 4PTXA 3SECA 4O13A 3UCDA 3CEPA 4J2PA 3E6EA 1JULA 1KM0A 2ESCA 3N2BA 1QWGA 1J8VA 4QX4A 5FJRA 4URIA 3UR7A 5MHBA 2LLEA 1PKNA 1LRNA 3BOFA 4C6OA 2RGLA 4IL0A 4C6EA 2X0HA 5I3KA 5T26A 4XISA 5IFPA 3VKCA 4DF0A 1OIMA 3CMJA 3H2MA 3SN0A 2PBGA 4DN1A 4WF7A 1VPQA 4WOQA 3WD3A 1JFHA 4HP5A 1X8CA 4RKAA 2I9EA 3W2MA 1BQCA 3AJ7A 4WJEA 3JS3A 4F4RA 2G3MA 2BXZA 5FESA 3EOUA 3ANVA 4PZVA 2SFPA 1DKWA 1XLJA 4QJ3B 2PWDA 3E02A 3LV5A 4GZEA 1ENUA 2Y62A 3VE9A 4X9SA 1YDOA 2GGHA 4MB4A 3M0VA 3R58A 5IHSA 3DBNA 3I7QA 1DWJM 1UJQA 3OG3A 3FDKA 4ZTYA 2PWVA 4TMCA 3EMZA 3V7PA 4HZMA 3AXKA 2FZBA 3L0NA 4GY0A 1XG3A 4UOZA 1P0KA 2BG5A 5I3DA 1RPKA 3KP0A 2DZUA 1HKJA 3LB0A 4MWAB 2OYMA 1KKOA 4MY9A 1QJWA 1OHLA 1JZ2A 4AEEA 3LY0A 6TIMA 1HO4A 1H63A 3W9ZA 3WJSA 1E6ZA 3M9YA 3W7CA 3QC0A 4YWIA 2HPIA 1U30A 4Q4RA 3E3HA 1J18A 1T5AA 5BXPA 1NFGA 3CZGA 3FJLA 3C52A 3S8HA 1PYMA 3SY8A 1FHDA 1T8QA 1PXGA 5BMWA 4JTJA 1IWAA 4MGGA 4MF4A 3T44A 4A3UA 3GNDA 2XH7A 5IOBA 1JYWA 1XLKA 2WZIA 1JJKA 3VKKA 3NO3A 1XLHA 1XG4A 4G8TA 1EXBA 1LBLA 1LM1A 3WUBA 5D02A 3ZJ8A 4AIUA 1XGEA 3KWSA 1ZJHA 5JVLA 4IGMA 1UZDA 4OV9A 2CLLA 1QBAA 1VH7A 1FWFC 2VEKA 1IEVA 2OLSA 3QLDA 4IIGA 3QZ6A 1R9XA 2J6VA 3SRDA 2QCGA 1DIEA 4DNMA 2JEQA 3GDBA 3B0UX 5BRBA 1TWZA 1HJWA 2VX7A 1UD2A 2PGEA 1VEMA 1HL8A 4MJZA 2CLEA 3EB2A 3ITVA 1R46A 3CC1A 5CPTA 3N6QA 2J47A 1D3HA 3KVLA 5L6UA 3W7IA 2ZUSA 4UTMA 5I09A 2QV5A 4ERAA 2C15A 2JEPA 4JHMA 3C2FA 4S2CA 4Q8TA 3ITYA 2DZVA 3W7RA 4CNUA 2JKPA 1V3IA 2VCCA 3SCUA 4MUPA 1KLYA 1Z42A 1FOBA 4D1JA 2O0TA 1WUFA 3POHA 2F6KA 3IJDA 4ZOBA 4HA3A 4GZJA 4D6EA 3DESA 3MI3A 1GVOA 3VFLA 4FA3A 4KW2A 3U9IA 3IK4A 2VRQA 2ISSA 3B9OA 4O17A 1KFJA 1ADOA 1UWUA 2QCHA 2ZFAA 3PUDA 3GXMA 3SM0A 1EWEA 4IQJA 2D24A 4O18A 3W74A 3M0MA 4KETA 2PA6A 4MHBA 4NG3A 3MUIA 1UG6A 4QSHA 4L4LA 1E55A 3O3RA 2CXGA 3ZWTA 1QUMA 1K6WA 4Q8QA 1O6IA 3ES7A 3WMLA 2WMFA 2A1YA 1OF8A 4MSSA 3LLFA 1RLCL 1E5JA 4IG2A 2YW3A 1UZ4A 4PUNA 5AC4A 2CFFA 2I57A 4U2YA 1DJHA 2UY2A 2VWTA 2Y7EA 5I3JA 1EDGA 5LKYA 5FEZA 3MKKA 2EPKX 1CB2A 4BJHA 1TG7A 3NA8A 2XUCA 2PTWA 2CKSA 4UTIA 2GPTA 1HVXA 3PP7A 4QE1A 4O53A 5CH9A 4IX0A 3WQ6A 4JEQA 2E68A 3MW7A 1XIHA 5TF0A 1ZL1A 1I75A 4Z2KA 4A8NA 3TJXA 1S46A 1DTNA 1ADSA 1LTDA 4MWAA 4ERIA 1LOLA 2BY3A 1TREA 1MRQA 1DOSA 4LEFA 5DO8A 4Q7BA 3WD2A 2WJFA 5FJOA 3L0KA 2CLMA 7REQB 3SY5A 3WCZA 2X1UA 5A95A 4JTAA 4HD5A 3PF3A 5EMMA 1E1EA 4H9MA 3H54A 3G8EA 3M1ZA 5DXYA 1E6SM 4PTVA 4DJDC 3BW2A 4AVFA 4ZFCA 3N13A 3WNMA 3E49A 1WOAA 1H62A 2UBPC 1B5TA 1ONRA 5E93A 3ANYA 3VOHA 2PRLA 3GC5A 1S5VA 1WKDA 2PDLA 4FI4A 2DZBA 3BMXA 4U28A 4MVAA 1YBQB 4PMNA 5DCBA 2PDHA 3EOLA 3UNTA 1WBHA 2BMBA 1CIUA 3QV9A 2JKAA 3WFZA 1RA5A 6REQB 1KM4A 4WDTA 2DH3A 1FHVA 3KXQA 4NZJA 3W2UA 3A3HA 3OLIA 2WCGA 3PPHA 1ODZA 5J5RA 4AIEA 1XR2A 5K9CA 3GTFA 1XS2A 1QBBA 4LCQA 2VXNA 3VOIA 3TYZA 3VIJA 1B2YA 3M0HA 3OBEA 1D9EA 2IMRA 3MV11 3K13A 5E6ZA 1O5RA 1L2QA 2H3DA 2XDFA 1RV8A 3IUIA 2JIWA 4KGJA 2E5CA 3EDJA 2VDIA 3S9ZA 4PODA 2Y1HA 3GFXA 3VDCA 4Q22A 3HV8A 1J12A 4IP7A 1JCXA 2GGJA 3TN5A 4UQCA 5J04A 1F74A 5AYXA 3A47A 4GX8A 3WMBA 2R1PA 3EDDA 2B81A 3OLEA 4JR5A 3QBUA 2Z6IA 4UZSA 4B4FA 3SRKA 3A4AA 2X0SA 3RF9A 4LBRA 1YXCA 3C61A 3NZRA 3NPVA 4S3JA 3NSXA 1Q6OA 1PB0A 2WBKA 3QGKC 5HATA 4JFSA 1H61A 2VFIA 4C7DA 1IT7A 1RSCA 3MCNA 4A3RA 3NQ8A 3ZWSA 3KL5A 3VC5A 3TOPA 1FP8A 2J7HA 1B90A 3W7QA 4QE5A 2CLPA 3W7HA 1FDYA 4HNOA 4UTWA 2IQTA 3W7KA 1I60A 1K7XA 5AHEA 3W7MA 1TTJA 5F4SA 3H70A 3NR0A 3UESA 1VQTA 3W38A 1W3KA 2R24A 3D5HA 3G1SA 4QISA 3S9IA 4NNBA 1ITQA 4JHOA 3HPSA 1TVPA 3UD6A 3HU7A 2W67A 2A7RA 2YBUA 2WZHA 2V5BA 3S1GA 1HW6A 3M7SA 3NPUA 4JTHA 3TCSA 2NWSA 3SW6A 1CENA 1RP8A 2RGMA 2WKGA 3WBEA 2WWDA 3K2GA 3UZYA 4Q4SA 4KFNA 1GZGA 3AIEA 3D47A 4I5RA 1WX0A 3E2SA 1QHPA 5DT5A 4Q8NA 2VC6A 3VGEA 2VHLA 3W88A 1PHWA 4B92A 1YDNA 1XFCA 4BF5A 1E9ZB 1CGTA 1WPCA 1QPOA 1SR0A 2XN1A 4XUGA 3SURA 1UKSA 5CCZA 3CPRA 3CV7A 1ISXA 3R6IA 1R85A 2ZA2A 4M6QA 5GJPA 1C7TA 1POJA 5EU9A 1OZQA