3SURA

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with nag-thiazoline.
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
519
structure length
504
Chain Sequence
HHHHSSGLVPRGSHMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Gaining insight into the inhibition of glycoside hydrolase family 20 exo-beta-N-acetylhexosaminidases using a structural approach
pubmed doi rcsb
source organism Paenibacillus
molecule tags Hydrolase
molecule keywords Beta-hexosaminidase
total genus 191
structure length 504
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3surA01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3surA02
1TVNA 3W4RA 2F8QA 5E0FA 1C8QA 1E6PA 3ZJ7A 1UA7A 3T2QA 3VGBA 1UZ1A 1W1PA 4CUCA 1B2YA 1KFWA 1WKYA 3DHPA 4P8VA 2Y24A 2B31A 2J74A 3ZR5A 4HZ8A 4ACYA 1DWHM 4CCDA 4IM4A 4KWUA 2GJPA 3TOPA 3UR7A 1ECEA 4GZJA 5E6YA 2WLYA 4UFHA 4UZSA 1K6AA 1OM0A 1R7OA 3ARSA 3F5JA 2WLZA 1E56A 1KQYA 1JZ5A 2GJXB 5KEZA 2VX4A 1W1TA 1W1YA 1DP0A 4IPNB 1H0GA 3EDJA 2WC7A 3T0AA 3VD7A 1GORA 4NRRA 1E0VA 4M8UA 1ODZA 5A8MA 4PEEA 1M53A 1MXDA 1MW0A 3TONA 1WCGA 3CHCA 2VT0A 3W24A 1UWTA 4GQRA 1FFQA 1V3IA 2NW0A 1L0PA 3TA9A 1VRXA 2E4TA 4M56A 3WF1A 1J12A 1V02A 2E3ZA 3GXDA 4HZ7A 4BQ3A 1KWGA 1GVYA 4MPKA 3WY1A 1W3LA 4MB3A 3MMUA 1I1XA 5A2AA 3BMVA 3GXMA 1WZMA 3THDA 4LQ1A 3N11A 2UWFA 3VGGA 1NOUA 1DWJM 2YA2A 2ZWYA 3AIRA 1MYRA 2TAAA 2VZOA 3ARPA 1ZJBA 2E8YA 1NWUA 2F2HA 1X1NA 3GH4A 5A6BA 2VX6A 1G94A 1OB0A 3SUUA 3W81A 1XYZA 4RE2A 5I24A 2ZUWA 3AHZA 1UWQA 2PWFA 4HU8A 1EXPA 5M17A 4CVUA 3AZRA 3QR3A 1BYDA 1JZ4A 4AXNA 1DWGM 5A6LA 4R5EA 1QPKA 1KXVA 3U7BA 1PIGA 5FD0A 3O2LA 1KBBA 1Y7VA 1E6ZA 1JD7A 4D71A 1UYQA 3AI0A 3K4DA 3BC9A 1HL8A 1JZ2A 4MAVA 3CHEA 2E9MA 2YA0A 4D6JA 6CGTA 2PB1A 1I75A 2W63A 2Q8XA 1XH1A 3TP4A 2YDQA 4W84A 1GJWA 4C91A 1CXLA 3NSNA 1CECA 2CBJA 1B90A 3AXIA 3WDJA 2D3LA 5IXEA 2ZUSA 2XYLA 4CKQA 3FHQA 1C90A 5FL1A 2XIBA 1G1YA 1B3WA 3LPGA 3OZPA 3OLIA 1TZ7A 4D6GA 4M29A 1G01A 3GDBA 3AZTA 3WEOA 4CU6A 2J7CA 2FGZA 1E15A 1JNDA 3WBEA 2XWDA 4JCMA 4D6HA 2PBGA 3IAQA 1QI0A 4M81A 4A3HA 3FNDA 5A8OA 3VTRA 1W9XA 3MS8A 5JIPA 2WW5A 1BSIA 2QHAA 1KWKA 2VNCA 1SMDA 3VMPA 1VFMA 3AQUA 5JIWA 1QHOA 4MJ2A 1OWQA 4AZ6A 1E43A 4X0VA 3MKKA 2HISA 3WEMA 2D0HA 1G5AA 2XM1A 1DEDA 1KGUA 2J78A 5CGTA 1V6YA 4H2CA 4QP0A 3WL1A 3VIIA 2XVGA 3N18A 2UY4A 3MSDA 5EBAA 3GXFA 1GOKA 3VMNA 2YIHA 5CQ1A 3PTKA 2IXVA 2AMGA 3MUIA 2PBOA 4CD5A 5IHSA 3U57A 2VR4A 2ZWZA 3I3BA 4KMQA 4NRSA 4OIFA 3WD2A 4OOZA 3WIJA 3MUZ1 4FMVA 1TUXA 1H1NA 2D23A 4LYQA 4UZUA 2WHKA 1BGAA 4NZCA 3PZQA 1EQPA 2PWDA 1EIBA 5AC5A 1V6VA 1MW3A 4FLRA 1OGSA 3VM7A 3S6TA 2QPUA 3VD4A 1JNEA 5CZKA 3VKKA 4PMXA 1AQ0A 2WSKA 4LXFA 3LPOA 1MWOA 1E9LA 3UCQA 4HOZA 1EQCA 1JYWA 3PN8A 2WAGA 1W9UA 3N17A 9CGTA 1QW8A 3NIYA 2JFEX 4Q22A 1JYXA 2BY3A 1UD4A 4ACZB 1NWTA 3BLPX 2O9OA 5JBEA 2WYSA 2NT1A 4TX8A 3EDDA 1H49A 5I0DA 1K9TA 1UH4A 1WAWA 3WUBA 5ABEA 4JL1A 2O9TA 4TVUA 1MFUA 1BTCA 1JL8A 4KH2A 4Z2GA 5A69A 1YHTA 2VQUA 1MXGA 4V2XA 3FAXA 1ODUA 1BF2A 1ZBVA 3WDRA 4HMEA 1M7XA 4AZGA 1WDSA 2OSXA 2JE8A 4IUGA 3L4ZA 5IDIA 2YDSA 1J9YA 1ISXA 1NOFA 2Y8VA 1QHPA 4DUWA 4W93A 2OWXA 1JF6A 3U5UA 3L4VA 4E4PA 4PSPA 1UWRA 3WMSA 3VNYA 2WMFA 4Z2IA 1XRVA 2G41A 5E6ZA 4F8XA 3WL0A 2G3MA 4DM1A 2VRJA 3VO0A 3WELA 2XVKA 4AIOA 2ZUVA 1E3XA 1XGZA 3WQ5A 2V3EA 3CZLA 3OA5A 3PTMA 1LJYA 1G0CA 1WZKA 3WF2A 3F5KA 1G9HA 2BHZA 5FL0A 3N1AA 3BGAA 1BPLB 4PSRA 5DEZA 1J0HA 3WD1A 3PBGA 2XVNA 3WH9A 3WBAA 2WZIA 3L4UA 1M01A 2CNCA 3NUKA 2WHMA 4D6FA 2WCAA 2VURA 1W9VA 3BMWA 3GTNA 2CERA 1VF8A 2QMJA 4W8LA 1FH8A 4ZXLA 4GI6A 3AIVA 3VGDA 4XV0A 1J0JA 1W9DM 5IHRA 3VGEA 4R27A 2DT1A 1J0ZA 5EFFA 1VFFA 4BCEA 1LG2A 4CD8A 5D9NA 3UETA 3M46A 3QHNA 2VOTA 3OLGA 3WD0A 1GQJA 2EPNA 3VIHA 1UQZA 4UQCA 3RIKA 4WKAA 5E9AA 5A6SA 2J8FA 4V27A 3CPUA 3WDQA 2VJXA 1E4NA 3CZGA 3EMZA 5JBDA 4CCCA 4P7LA 4E8DA 1JF5A 2Z1SA 3G6MA 1IZJA 3SCWA 3NJ3A 2OYLA 3WH8A 3ZIZA 5LA1A 1BQCA 4PCTA 4CCEA 1UHVA 4HA1A 2YJQA 2MANA 1PEZA 3SCVA 4JFSA 4WSKA 2HVMA 5ABHA 4MDOA 1JFHA 3LPFA 2J7BA 2CCRA 1GOOA 5LA2A 2VL4A 1Q6DA 1KGWA 3AHXA 1VEPA 2EO7A 2XIIA 3WQ8A 2A3EA 1TR1A 5GNYA 3ARZA 4TVDA 4BZYA 3N13A 1HL9A 3SCNA 2WMKA 1DWIM 3NCOA 4CGTA 1JZ7A 4KRTA 3MMDA 1GQLA 3WF4A 3QHOA 2PI6A 4H04A 5GNXA 2D1ZA 2ZX5A 1E4IA 1BG4A 2DSVA 4BQ2A 4FLQA 1E5JA 2WVUA 2WSPA 3SCSA 1GPFA 2CIPA 4JFVA 5ECUA 2GDVA 3KEHA 5BROA 4B15A 3GBDA 3UG5A 2ZXDA 1KR0A 4L4PA 3AYSA 1R8LA 3VU2A 1KCLA 1OGGA 5ABGA 3AHYA 1XD1A 2ZIDA 1BGGA 4D6DA 1XSJA 3CUGA 3MSGA 2DIJA 5A1AA 1GCYA 4TOQA 4ML4A 4WSJA 1JDDA 2WZHA 2YKKA 2BV9A 2DT0A 3IJ9A 3VIJA 5BXSA 2NSXA 2XSBA 3WNNA 1E6QM 3AISA 3KL0A 1CEOA 1PX8A 3NDZA 4J7RA 1XSIA 3B8SA 2DSKA 2A3BA 2ZUNA 4J3WA 5CXPA 3WMBA 1MVYA 1JGIA 1B3YA 3GNRA 4QFUA 1FH9A 2O9PA 4U5IA 1BFNA 4A4AA 2XWEA 3W53A 3ZT6A 2BXYA 2E0PA 5D8WA 4JKMA 1MFVA 2BY1A 3WH7A 1R87A 4PMDA 1EGZA 1GHSA 1JXJA 5I6SA 4ZE5A 1VFUA 5AYIA 3E1F1 2NT0A 3T0BA 3RCNA 2EXOA 2C7FA 1R86A 1HKMA 1K9EA 2XHYA 3AHTA 4AD1A 1CNVA 4TTGA 1JZ8A 2VZUA 2XFYA 4LYRA 5F7UA 2J7EA 5HXMA 1Q4NX 3WQWA 1EH9A 4P7QA 1PIFA 2WMHA 3ZO9A 3VX1A 3GBEA 3HU7A 1XD0A 4XZWA 4UFMA 2JIEA 4UOJA 2CHOA 5I2UA 3WUFA 1PBGA 4JCLA 3HJEA 4JHZA 2OYKA 3SUWA 5CSYA 4PMVA 3FHAA 3MU7A 3NSMA 4AD3A 1HVQA 1E70M 1I1WA 1E6XM 2ZE0A 1JFXA 1GVIA 4AD0A 1US3A 2D20A 2BY0A 2DPEA 1V3KA 4PMOA 1Q6FA 4M82A 1ZBCA 3K1DA 1E6NA 2X8RA 2ZXBA 3WKZA 1V03A 3OG2A 5A6AA 2PWGA 4GIAA 4F66A 3BLKA 5CPSA 4UQ9A 3DHUA 3GNOA 3OBAA 4ATWA 1NWSA 3N04A 5HDRA 4UQEA 4XX6A 4XUYA 1GQIA 3J7HA 4YHEA 2WK2A 1DTUA 4B16A 3CO4A 3FY1A 3VOCA 1IV8A 4U3CA 3WQ6A 1HF6A 1JZ6A 1O6IA 1HJWA 1U33A 2A3CA 1AQHA 2BHYA 1QNSA 2JEPA 4CVWA 1E72M 1B9ZA 2VCAA 3AICA 2W67A 5A6BD 4KGJA 1ITCA 3FW6A 4P7RA 1EDQA 3SUSA 2DDXA 2J77A 4W7WA 3W0KA 4RL3A 3L4TA 3N12A 4QLKA 1NWRA 4F9DA 2W91A 1UA3A 1H3GA 2CPUA 1WE5A 4F9JA 3N15A 2BHUA 3CUJA 3UG3A 2PWHA 1EDGA 3T2PA 4LPCA 3ZSTA 2VCCA 4GO9A 1S46A 1RD6A 1SYTA 1LF1A 3ZT7A 4D6EA 3AS2A 1VBRA 2EQDA 3GZAA 3AIEA 3PTQA 1EDTA 4D72A 3ARQA 2OYMA 3SCQA 1UWIA 1NP0A 4J3UA 4UFJA 1NM9A 1C8YA 2JF6A 3WFZA 1Q6CA 1ZBKA 1UKQA 1UR2A 1XCXA 3AIQA 1TVPA 3VIOA 2CKSA 2CITA 4PYSA 2ZX7A 1QW9A 4HA4A 1DHKA 2BVDA 3WSUA 1O7AA 4W8BA 3W25A 2QV4A 2XVLA 1CXIA 2C0HA 1GONA 3CZJA 1UOKA 5BXRA 2CKRA 3AMDA 2D2OA 1OBAA 1ZB5A 5BWFA 3RMEA 1E5NA 3K8MA 4PRWA 5HOSA 3ZJKA 3UR8A 4CD4A 2E8ZA 1H5VA 3BSHA 3RM9A 1CGYA 1OINA 4J3TA 4LGXA 1DWFM 3EBVA 5BYWA 1LWHA 1B31A 2J79A 2ZUTA 3VDAA 4TVCA 4UQBA 4C90A 4DM2A 3M6DA 3CUIA 1W3KA 3W37A 1EOMA 5EMYA 1ISZA 3BCDA 1WO2A 1JZ3A 4HA3A 5HPOA 1R7AA 4AZCA 1HJXA 4FF5A 3S2CA 5BXPA 4AY1A 5HBFA 1ISYA 1UKOA 1UD3A 1WP6A 3PZOA 1UR4A 2DT2A 2D24A 1UD6A 4CN1A 1Q6EA 1JD9A 2PC8A 4D6CA 2XFFA 1VEMA 2G3NA 4P7OA 3WDHA 2JEQA 2V38A 3ZOAA 5M03A 5D4YA 4HOWA 2AAAA 1E3ZA 4BS0A 2CETA 4YHGA 3AS0A 3CUHA 4UNIA 1E6SM 2VMFA 2XM2A 4HPGA 2GK1B 2VQTA 1BAGA 1HNYA 4D6IA 4MNKA 4KRUA 3WDPP 1V6WA 3RJXA 2FDMA 4ZXOA 2DH2A 4XB3A 2BXZA 5I79A 2VUYA 1VB9A 2VR5A 3L2LA 3PZGA 4PUEA 4MB5A 1PZ3A 1E71M 3SEPA 1RP8A 4UOQA 2D0GA 4PTVA 2VX5A 1NARA 1GJUA 4B9YA 2ZX6A 4D1JA 2WKGA 3KL3A 4W7UA 4PTXA 3WNKA 4AZBA 4J27A 5IFTA 4V28A 2CXGA 4W7VA 1WB0A 2WNWA 2ZXQA 4L4OA 1CLVA 1H4PA 1LL7A 2WXDM 1AMYA 4JKLA 1R85A 1LG1A 2GSJA 4HOXA 1YQ2A 3WUEA 1GQKA 2WVVB 1HXJA 3PZ9A 3WN6A 4U5KA 1FOBA 2ZUMA 4W85A 5LYRA 4AZIA 2YA1A 4MTVA 5A94A 4U2ZA 5A2CA 5A3HA 3GM8A 3WNMA 1J01A 1HX0A 3A3HA 4AISA 1LQ0A 2CYGA 3N9KA 2X2YA 1QNPA 4MNLA 3OGSA 4QAWA 1U2YA 3W26A 4W8AA 1CGTA 2VI0A 3ARVA 1V3LA 2BY2A 5CJ5A 1B3ZA 4AIEA 2FH6A 3GNPA 2VVNA 4WF7A 1NP2A 2XPKA 3OLDA 5EFDA 1GW1A 5A8QA 1ITXA 1MQQA 1OD0A 3VIGA 1WDQA 3GH5A 5CGMA 3ZT5A 3HMCA 2X0YA 4TX6A 1W1VA 2XVPA 4PBGA 4WKFA 4UQAA 1RP9A 5IFPA 2XGIA 5A6MA 3EMQA 1TG7A 2CHNA 3KL5A 2GJRA 3VGFA 1XC6A 1FHLA 3K8LA 5GNZA 4S3KA 5D8ZA 1TE1A 5DMYA 1WDPA 2CBIA 1CWYA 5CLWA 1OT1A 2Y8KA 3BH4A 1Z32X 3QHMA 2VC9A 3OZOA 4W5UA 5BRQA 1W3JA 2OSWA 4H41A 4WK9A 3VGHA 1CIUA 1V6XA 8A3HA 4BF7A 1HKJA 1OSEA 4MNMA 1QI2A 3DYMA 3NYDA 1BYCA 1KGXA 3ZSSA 2FGLA 3M07A 5E0CA 3VD9A 1QVBA 4ATLA 4C7FA 2WWDA 4FLOA 4GZEA 3PZIA 1TA3B 4PTMA 5TD4A 4OKDA 1J0KA 4JL2A 3OIHA 2ZICA 4B9ZA 4OZOA 3CZEA 5A2BA 3VPLA 5DT5A 1HJUA 3W6LA 1NH6A 1C91A 4GKLA 4W5ZA 4Y7EA 2DQXA 2WMIA 4B3KA 1ISWA 2DIEA 1ZJAA 3AHVA 1V02E 8CGTA 1TFVA 3DECA 5A95A 1EO7A 1CZ1A 4GPNA 3FN9A 2F61A 4Q7NA 2YL6A 4DWSD 1J0YA 3OLEA 2O92A 2BFGA 3WD3A 1D3CA 2E40A 4HTYA 5AYBA 3CGTA 1C7SA 2J4GA 3AIWA 2G3JA 1CXEA 1UR0A 3ECQA 5BRPA 2A3AA 4B3LA 2X0HA 3AYRA 2YLAA 3VDBA 5I23A 4M80A 3LPPA 3OGVA 3BAKA 4U31A 3VIPA 4AD5A 4RE4A 2VCBA 2UY2A 1B3VA 1M04A 2WWCA 3I3DA 4ZFMA 1GUVA 2C8NA 1VJSA 3ZJ8A 4Z2JA 4EAMA 3VILA 1CBGA 2QMKA 2DT3A 1VFOA 1W2PA 1J10A 4E2OA 4AZ5A 1BHGA 2ZXAA 5JBFA 5HPCA 2DH3A 6TAAA 1E40A 1QNQA 1B0IA 2E9LA 1PX3A 1UH2A 3AS3A 3VMOA 3O9NA 3RM8A 4WKHA 4EANA 5FCZA 1UKTA 2J62A 1E6RA 1XH0A 1OCQA 1C3FA 1V3JA 3SCPA 3WDIA 1LWJA 1KBKA 1W9BM 5FIPA 1PPIA 2ESCA 4JFWA 3KWXA 4MB4A 2X1IA 2JIWA 1F4AA 3VVGA 2WHLA 3PZVA 3IANA 5C8BB 5LA0A 1OIFA 4HU0A 3MANA 3AZSA 3VIFA 1CGWA 1E4MM 4ZENA 1WDRA 2CBVA 2WKLA 1VIWA 4PMQA 3A4AA 3OGRA 2WMJA 3RJYA 4CN6A 4P8WA 3IAPA 1JAEA 4EK7A 3SCTA 1EO5A 3NDYA 2FHCA 3IK2A 1M03A 3AMCA 1K9DA 4PTWA 3BSGA 5I77A 2UY3A 2BVYA 4UFKA 5C71A 4Z2HA 1CENA 3BAWA 2VX7A 5FOOA 3PHAA 1IT0A 3F4VA 2GK1A 3D3AA 1CGUA 4DUXA 1H09A 4CN4A 5DFAA 2W4XA 3OB8A 1N82A 2X09A 1QI5A 2YLLA 5I78A 4AZHA 2VRQA 2J7DA 5HNNA 3QGVA 3UERA 2V3GA 1W2VA 1HVXA 1GOMA 1ESWA 3WH5A 4AEEA 1FH7A 1BG9A 1V0KA 2Z1KA 4PMYA 4AC1X 4JFTA 4PN2A 3GXIA 2XG9A 3W28A 4TXEA 1MQRA 1EOKA 3DYPA 1X6LA 4GINA 1BVNP 1QNOA 2D0FA 1PZ2A 4AZ7A 3WQ4A 1HJSA 4BA0A 1C8XA 5CLTA 1LL6A 2XFRA 1MW1A 1OIMA 2EEXA 2WVVA 2YOCA 2VZTA 3LMYA 4J3VA 5M5DA 3WFLA 1TMQA 1EA9C 1UH3A 1CDGA 1CPUA 5CSUA 3ARWA 4IPLA 2J7GA 3O6AA 1PAMA 4FK9A 1QBBA 2G8ZA 1OGBA 1HP5A 2WZEA 2WC4A 3G6LA 2J75A 5C70A 3L4YA 5CG0A 3AMKA 3PZTA 2IXUA 2ZX8A 1CXKA 1ZL1A 1B1YA 2EPMX 1QI3A 2YBUA 1VENA 1JIBA 2OLHA 4LYPA 3BAIA 4U2YA 4AMCA 1UD8A 1V0LA 3MV01 2GUYA 3U7VA 2Y5EA 5CPQA 4TUFA 5A6JA 4AD4A 7CGTA 1CGXA 1VEOA 3T0DA 3AJ7A 2CESA 4NF7A 3KE0A 3MMWA 2OSYA 4MADA 4HPHA 1RH9A 4QLJA 3SUVA 4ZEPA 3CLWA 2CEQA 3RDKA 3L4XA 4YPJA 2V3DA 2YBTA 1CXFA 3SIMA 1UQYA 1ZU8A 1A3HA 1JDCA 4GI8A 2CBUA 2J7HA 2UY5A 5AY7A 1CGVA 4UOZA 1AVAA 2JALA 3ZR6A 5BCAA 3RO8A 1HN1A 1QHZA 4OUEA 2BNJA 3ARXA 3TTSA 2WC3A 4DWSB 1PJ9A 3B9DA 3WNPA 4UFLA 3ZMRA 4AW7A 2QPSA 2FHBA 3W6MA 3IJ7A 3L4WA 4EKJA 2G4FA 3SURA 1JG9A 3CBWA 4HZ6A 2IUZA 1KXTA 2QLYA 4CU7A 3T08A 1E1FA 3CIVA 3WF3A 5DF0A 3UEQA 3ARTA 4PCSA 3BCFA 4BQ4A 2VRKA 2DEPA 2W5FA 4P7NA 4OBRA 1MW2A 4WIWA 4KGLA 1XYFA 1E1EA 5CPTA 4AEFA 1RPKA 1CYGA 6A3HA 3CH9A 1OD8A 1P6WA 2D3NA 1V3MA 2RGLA 4JAWA 1XV8A 2V5DA 4W87A 3D5HA 2WHJA 2ZUUA 4UR9A 3BXWA 2VO5A 2WMGA 4IISA 3ZM8A 1J0IA 3CZKA 4U33A 1E4LA 2OWCA 3PZUA 1WZLA 4H7VA 4HMDA 2XUCA 3A4WA 4J3XA 5GQBA 2D22A 3QOKA 2XTKA 3RPMA 3GYCA 4J3SA 4UTFA 1FP8A 3VIKA 2EBNA 2W61A 3TTOA 2J25A 4EE9A 3MUAA 3ZJ6A 2WB5A 4Z2LA 5ABFB 1B30A 3B9AA 3II1A 1UG6A 3SUTA 1VJZA 4MJ4A 3WD4A 3AIUA 2JF7A 1BYBA 1KXQA 2PWEA 3IJ8A 3VDHA 1H11A 2EPLX 4AZCB 2EJ1A 3A4XA 1KQZA 3WQVA 1HIZA 4DWSC 5E70A 2W92A 4D1IA 1V0MA 1B3XA 1HKIA 3VNZA 4AIUA 4CD7A 1ZS2A 2EPKX 3CUFA 1W32A 1H0IA 1UUQA 2RGMA 2W62A 4DWSA 1ZBWA 2FHFA 2OWWA 2WM0A 5DO8A 3CHFA 1QBAA 3RILA 2X05A 1QI4A 4PMNA 4K68A 1GOQA 4YN5A 1UR1A 2GVYA 2V5CA 3W38A 3WNLA 1AQMA 1HT6A 2DGAA 2ZX9A 1W91A 4OJYA 4HMCA 1QNRA 3POHA 1C93A 2GJXA 1K9FA 2GDUA 4UQDA 4X9YA 4PMZA 1X6NA 2AOSA 4JHOA 2Y2WA 3EDFA 1NQ6A 3NSXA 1PX4A 5I5RA 5EB8A 3VD3A 1A47A 1JAKA 2XSAA 4F79A 4HP5A 1UKPA 3WEZA 4JKKA 3MV11 3SCUA 2GFTA 1JI1A 4MNJA 3AROA 4E8CA 3CZ8A 4Z2KA 3POCA 3EDKA 3VD5A 1EHNA 1WZAA 1CTNA 4X0NA 1V3HA 1JDAA 4ACZA 4ZE4A 1HJQA 2ZOXA 2VTFA 4MAZA 3HN3A 4ATDA 2BS9A 2E9BA 1KCKA 1TCMA 1HP4A 3AFBA 2Y4SA 3AOFA 1UD2A 3AS1A 4QLLA 4C7DA 1GZJA 1SFSA 5GPRA 5I3DA 4S3JA 3WNOA 1E0WA 1V08A 3EMCA 3VINA 1E0XA 1UR8A 1C7TA 1JXKA 2J47A 2WCSA 3ALGA 3DYOA 4CD6A 3WMCA 3A47A 5A8PA 2VZSA 4LX4A 1SMAA 4M24A 1DWAM 4RE3A 1UWSA 1V6UA 3T09A 1UR9A 1XSKA 3W27A 2YL5A 1TA3A 3RM4A 4JFUA 2XJ7A 2V3FA 2YL9A 1U30A 3CHDA 2DSWA 1KXHA 3FAWA 2DSZA 3VUPA 1JI2A 2PF0A 4H8HA 2QF8A 3K46A 4JIEA 1LLOA 3PZNA 2YL8A 4WJXA 3KZSA 5FKYA 3BAYA 4PMRA 4JZ5A 3F5LA 2G3IA 1XHGA 5A8NA 2XGBA 1JYNA 4GO8A 3A6OA 1H41A 1ISVA 1BVZA 2VVSA 1Q6GA 2VZVA 5A6KA 2FH8A 2BVTA 1F4HA 1GOWA 3AMGA 7A3HA 2WVTA 1D2KA 3AXXA 3L2MA 1US2A 3VDCA 2WMIB 4UFIA 4OOUA 5DT7A 2WVSA 3ARRA 1WNOA 3T2OA 3WF0A 1E55A 4N42A 3MUY1 1LL4A 3UESA 2DSUA 1VBUA 3M7SA 3WENA 4H8UA 2W66A 3I3EA 4QCEA 1GNXA 3K4AA 1BYAA 4GQQA 1XCWA 3VM5A 5D9OA 3U5YA 4MDPA 1H2JA 1CXHA 3SCRA 4WLCA 3AXHA 5JUVA 3ZQ9A 4W86A 3WUGA 1E73M 3FXYA 5M3WA 1VAHA 3GH7A 2WANA 1HJVA 1UWUA 1J18A 2EPOA 4QCFA 1W3HA 5BXTA 3ARYA 1SR0A 1J11A 4OBSA 1W9PA 4PUDA 4FLSA 1KR1A 3EYPA 1NOWA 1UD5A 4DUVA 2YDRA 5E09A 3BAXA 4XZBA 4TTUA 4P8XA 3VIMA 4QDMA 3CTTA 4P8UA 3ALFA 3CMGA 2WPGA 1UZ4A 4MB1A 1JYVA 1C92A 1FP9A 4NSBA 3AIBA 1IZKA 1L8NA 4PMUA 3PZMA 2WBKA 4U3AA 4BQ5A 2A3HA 5AC4A 1WPCA 3UG4A 4W89A 5D9PA 3WH6A 1MQPA 3W29A 4GI9A 4W88A 5KZ6A 4H8VA 3VX0A 3JUGA 3TTQA 1GOIA 3MO4A 3BAJA 3CMJA 4UCFA 2WBGA 3DC0A 3APGA 2WCGA 3K8KA 4C7GA 2J7FA 1BLIA 1OT2A 4URIA 2O9RA 3AMLA 1QOXA 1V0NA 3THCA 3SCOA 1GHRA 4AD2A 1UKSA 7TAAA 4AYSA 3TTYA 1FA2A 1XH2A 2J8GA 4J28A 1KB3A 1HKKA 4AWEA 4CU8A 3ARUA 4N0RA 3B9EA 4M1RA 5ABFA 1CLXA 1D7FA 4GZIA 3QOMA 3EDEA 4GXPA 1EHAA 5D9MA 1FHDA 1FFRA 3W82A 4NI3A 4A3YA
chains in the Genus database with same CATH superfamily
3E0FA 1TVNA 3W4RA 5HR6A 3LERA 3HA1A 5E0FA 3TKFA 4H9TA 4V1XA 1UA7A 4C6QA 2HJPA 1B2YA 5CBJA 4DYKA 1WAUA 4LW7A 3PF3A 3ZWSA 4PFMA 3ZR5A 1DWHM 1YMYA 4IM4A 1G4PA 4NNBA 3UR7A 4GZJA 4QR6A 2C71A 4UFHA 1EXBA 3ARSA 3NG3A 3KS6A 5I03A 2WLZA 1E56A 1H62A 4NY2A 4MZ8A 2PCQA 3MO7A 5E93A 3W7IA 2CWNA 4IPNB 4QEHA 2FPVA 3VFCA 1H0GA 4WY0F 3WLLA 3W1QA 2YB1A 5A8MA 2FZDA 1TJ2A 2VT0A 1ZAJA 3W24A 3KDNA 1UWTA 2GGHA 1E9IA 3GVQA 1KM0A 4LYKA 4P00B 2ZQ0A 4AY7A 3WF1A 5C2XA 1KWGA 5HWMA 4N6EA 2FFIA 1I1XA 1WZMA 3THDA 3PAOA 4LQ1A 3N11A 2BOEX 2NUYA 2CXEA 3HURA 3FA4A 4L65A 3FEMA 2TAAA 2VZOA 1ZJBA 3SN0A 1NWUA 1WXZA 3GH4A 1G94A 4GRSA 1OB0A 3W81A 5I24A 1XYZA 2ZUWA 1HQTA 3UJRA 1IEVA 5M17A 4CVUA 1R30A 3QR3A 5ECVA 3O6CA 3AU2A 4IQDA 4AXNA 4CQ9A 1K8ZA 4R5EA 1IXQA 3BJTA 1KXVA 1DJNA 3SB0A 3C2FA 1V4YA 1KBBA 1OYBA 3WK0A 1XUZA 2P76A 4D71A 1K8XA 3K4DA 1JZ2A 1QASA 4D6JA 2Q8XA 3LLFA 4PBFA 1CXLA 3F03K 1CECA 1X96A 3ZYZA 2BGQA 3LENA 3ITXA 2YFNA 5IXEA 1TTIA 2XYLA 4CKQA 5FL1A 5G1YA 4B90A 3GC2A 4N4PA 4M29A 2C0AA 4LS2A 1DPMA 5LXEA 1HO4A 3VCRA 4CNUA 2J7CA 3T0TA 2FGZA 1E15A 3H12A 3WLPA 2XWDA 1QI0A 3IJIA 3QV8A 4GBDA 1ENUA 3L67A 3HB9A 5AYYA 4DLMA 2QHAA 3IUDA 2VNCA 4KFOA 1QHOA 3M0HA 4DHGA 1UBSA 3SFKA 2R1LA 3EEGA 4AZ6A 3WEMA 3P7YA 1DEDA 1KGUA 1KFBA 4PULA 1TX0A 1EWEA 3UZZA 1P4CA 2YCLB 1EJUC 4CQDA 2PBOA 1P1XA 2OU4A 4RNHA 3U57A 2XH0A 3WLIA 1TQXA 2ZWZA 4B5TA 4OIFA 4BFAA 5CPNA 3G1HA 3UD6A 2PCEA 3B9OA 3WIJA 3MUZ1 1R47A 2NQLA 1H1NA 2QCNA 4UZUA 3DBNA 2WHKA 1BGAA 1EIBA 3O07A 5AC5A 3NYZA 3A9IA 4DJDD 2QVHA 5HJYA 3P0XA 3VKKA 1YXDA 5K9XA 3RR4A 3CJPA 2XINA 2Y85A 2WSKA 4LXFA 3QH2A 1MWOA 2RH9A 3RHGA 3S2MA 1OEPA 1XIDA 1JR1A 2Q6ZA 2RUSA 4L9YA 1QW8A 5CSSA 1U1HA 1K1DA 2CLIA 4Q22A 3E96A 4NZ1A 1BWVA 2PWUA 3EKZA 1UD4A 4ACZB 3TYEA 1XPGA 4ZQRA 4TX8A 4L1WA 1UH4A 1FCBA 1W3NA 4TVUA 4CQCA 3M0JA 3MWCA 4KH2A 5A69A 1MI3A 3A22A 1F6PA 1MXGA 2VGGA 1G4TA 3FAXA 4NZJA 3W83A 1ZBVA 4QQUA 1TELA 3GVRA 1BKSA 1F3XA 2FPYA 4PL1A 2OSXA 1MSSA 2JE8A 4IUGA 5G1TA 1MNSA 4PFHA 2ZVRA 4HCDA 4WOZA 1NOFA 1WDDA 1QHPA 1EUNA 3DC8A 4BI6A 3MZNA 4W93A 2OWXA 3L4VA 3H2MA 4C6FA 3WMSA 1SSGA 2WMFA 5CGQA 2G41A 1VP5A 3STGA 4NP7A 4E4FA 2G3MA 1KRAC 2XZ9A 4ZQCA 1E3XA 3WQ5A 2V3EA 4G7EA 1QNVA 3MJMA 3MW7A 3QXBA 3CU2A 1BXNA 5FL0A 3B03A 1J0HA 2XVNA 3WH9A 2WZIA 4JTHA 1F7BA 3P82A 3CAWA 1GVQA 2WHMA 2OGYA 4ZL1A 4LUJA 2B81A 2RDXA 3Q67A 4M51A 1FH8A 3DFSA 1W17A 1MNZA 3VOGA 3CV1A 5KMYA 5E1QA 3TMLA 1W9DM 5IHRA 3GE7A 3VGEA 2WM1A 1J0ZA 1VFFA 1BD0A 4A8LA 4O28A 4CD8A 3E2QA 1R0MA 3NQCA 3M46A 5F1UA 3QHNA 4L61A 1XLBA 3WD0A 1GQJA 4QSHA 1W37A 1PV8A 3BLIA 4NJJA 4YTSA 4QX4A 3CPUA 1E4NA 1GYMA 5DXXA 2DJXA 2CLHA 3CUXA 3NJ3A 2OYLA 3ZIZA 4JQ3A 4G7EB 5KZEA 1OC6A 5G2IA 2H90A 4XBSA 1GW9A 5HUOA 2P88A 5FSDC 4JFSA 4B3ZA 5HANA 5ABHA 3C3NA 5H8UA 4MDOA 4O15A 3RX4A 3HBLA 1GOOA 1Q6DA 1KGWA 3V4BA 1H7OA 2EO7A 3OVGA 2A3EA 1TR1A 4HHLA 1EP2A 5GNYA 3CV7A 4XZ9A 4IMGA 1HL9A 1R6WA 3SCNA 3NZGA 1N8IA 1GQLA 4IFKB 5GNXA 1TPC1 4H2HA 3JZUA 1E5JA 2DP3A 1F05A 2CIPA 2Y8UA 1ZENA 4M5PA 5GVJA 3ZZ1A 2OZ0A 3IIZA 4QE5A 1U1JA 2I5IA 1AH3A 2OPJA 3AXKA 1R8LA 2QULA 2VFGA 3UVIA 1GPWA 1XD1A 1Q6OA 5MHBA 1UR3M 4AYGA 2C91A 1SJBA 3AU6A 4AWSA 2GYIA 3CUGA 2V69A 3UA4A 3L5LA 1KFLA 4GCAA 3QV7A 1D3HA 3PUGA 1IZCA 3R0KA 2YKKA 2Y5SA 2GQ3A 2ZC8A 2Q01A 4WDTA 3KL0A 1CEOA 4E8GA 2YGYA 3R12A 2A3BA 5CXPA 3WMBA 1B54A 2HQAA 3GDTA 1CT5A 2PDMA 4HCLA 3W1PA 1Z48A 2O9PA 4A4AA 1PZ1A 1XLJA 1GEQA 1EUAA 4LEQA 4QJ1A 4GXWA 1C9WA 3WH7A 3FK4A 3LRKA 4MFEA 4PMDA 3U48A 1YPIA 3DFOA 1O4UA 2NT0A 4DQWA 3PP7A 3FFSA 1LBFA 1R86A 3QF0A 2Q3OA 1SO4A 3W71A 1SJCA 3AHTA 2QAFA 4YL2A 4AVNA 1VHCA 5F7UA 3WQWA 1EH9A 4JGDA 3VUSA 1S5VA 1XD0A 4XZWA 2JIEA 4UOJA 4AC7C 4IPPA 1AW5A 3NM3A 2CHOA 3A3WA 3M6YA 3WUFA 1W8GA 4JHZA 2XN0A 2OYKA 3NTYA 3FHAA 3NSMA 2RDWA 3OBKA 1IEIA 5DX7A 5DLCA 1JFXA 3GDMA 2BY0A 5CCZA 4HSHA 1V3KA 4PMOA 1Q6FA 3K1DA 1V03A 5A6AA 4F66A 3BLKA 3UNDA 3MTWA 1DIDA 1SUXA 3S5YA 1F2JA 3GNOA 1POJA 4FHAA 3A5VA 1M65A 3DAQA 2AL2B 1NWSA 3N04A 4Y9PA 4GXMA 2WK2A 1EX5A 1I2QA 1NU5A 3FY1A 2ACRA 2EGZA 1HF6A 1JUKA 1P48A 4QISA 1QNSA 4UNLA 1E72M 3EWWA 3L5AA 1KBIA 2A7NA 2H9AB 2A6NA 2CLPA 3SRHA 3TYBA 4LUTA 4XBJA 1RBOB 4WDXA 4PUUA 3U2EA 4IFRA 1H7RA 2J77A 5REQB 1LRNA 4RL3A 4Y9AA 1NWRA 1ZP3A 3LA4A 2W91A 1UA3A 3H8AA 1WE5A 1VYPX 3N15A 2PWHA 3BANA 4LPCA 2VCCA 3W7GA 2ZA2A 1S46A 3MPGA 1LF1A 3MCNA 2NQ5A 1MEWA 4RX0A 3WZ0E 2I9EA 4D6EA 1ME7A 3AS2A 3CV2A 1THFD 1K6WA 1QOQA 1DTNA 2QUTA 3UZ5A 3AIEA 1EDTA 1OFRA 1UW9A 1OYAA 1EPVA 2QUVA 4LC8A 4NIRA 1XGEA 1NM9A 4F0KA 3NQMA 1R9YA 2QDHA 1Q6CA 1HKVA 4NJGA 3G3MA 3TCSA 1JRBA 1ZZMA 2AL1A 3VIOA 4PB4A 2ZX7A 1DHKA 1QCWA 3HG3A 4W8BA 3W25A 2QV4A 6XIAA 4WRHA 1AK5A 1RD5A 1GONA 3CZJA 2CKRA 3FYPA 3KLLA 1E5NA 3K8MA 3W9ZA 2GDQA 3R6IA 5FEPA 1PCKA 4N9EA 4NX0A 4Q8TA 2E68A 1AJ2A 1XR2A 1DWFM 3TLQA 4QE1A 5G2HA 3TZFA 2PDLA 3FSTA 1IEXA 5BYWA 1B31A 1AFSA 3QSTA 2HXTA 4GJJA 4O8RA 1ZY9A 2FVMA 4HNLA 1EOMA 5AHNA 5EMYA 4GNJA 1WO2A 1JZ3A 4IGNA 1F73A 5LGXA 4DWDA 1HJXA 3WBWA 4R3UA 3M47A 4KWWA 3VOJA 5BXPA 2Y62A 1ISYA 1UKOA 1UD3A 3AWNA 5CPLA 2P5NA 1UR4A 3OEXA 4FPSA 4Q4OA 4E4UA 1EJVC 4J1OA 4WR3A 4AH7A 5G1MA 5DCDA 4TQTA 1J93A 4HOWA 4GUHA 3LGDA 3EKGA 1XDLA 4YHGA 3LM7A 5I09A 1GJPA 1YW1A 3NL5A 4S38A 4UNIA 3BDKA 1RBLA 3MP3A 4KERA 6ENLA 4HPGA 4U10A 4AIBA 2WJZA 1B5TA 3B8WA 4MNKA 2NZLA 1DVJA 4KRUA 3WDPP 2VDHA 2FDMA 1EC7A 3THAA 4XB3A 3L21A 3MKCA 3U6WA 4ADTA 3P8IA 2XDFA 3RPTA 4MB5A 1PZ3A 2F9RA 3TNBA 1RP8A 1TV8A 4FR1A 2VX5A 4PTVA 1GJUA 1TV3A 4D1JA 2WKGA 4W7UA 2E6DA 4AZBA 1WB0A 3VOIA 2OEJA 4O50A 3U8GA 1CLVA 4LBRA 1RHCA 4L5ZA 3TR9A 2NWRA 4S1FA 4UTHA 1X1ZA 4YVVA 3KOWA 3BOFA 3WN6A 4U5KA 5MKGB 4G1NA 3DFPA 2H6RA 3RU8X 5HQEA 3KRUA 3PBYA 2L5HA 5A94A 4LF1A 4U2ZA 1V5XA 5A3HA 3MC5A 1J2WA 1XM3A 3LTSA 4YXGA 2PDCA 4AISA 1QNPA 3ONBA 2GGEA 1IYXA 4QAWA 1U2YA 1VFLA 1CGTA 3XISA 2BY2A 3MVTA 1IT8A 3PBMA 4LUTB 1B3ZA 4AIEA 1YDNA 4MWAB 2FB3A 3T78A 2PLJA 4S3CA 4HHMA 3OLDA 4XVEA 2WSQA 2G0WA 1OD0A 2QJNA 3VIGA 3R79A 3GH5A 3NQ6A 3HMCA 2X0YA 1IWPA 1OQFA 3NOYA 1L6YA 3R1ZA 4UQAA 4XD3A 2AL2A 4N9CA 5IFPA 3TDFA 2XGIA 4HNCA 1FKWA 1S2TA 4PTNA 4WEVX 3R4IA 3RR1A 1EZ2A 4DYJA 1FHLA 4POCA 5KTLA 3QMRA 3K8LA 1A3WA 4O19A 1TE1A 2PDJA 1WDPA 2CBIA 1CWYA 1JVNA 2DFAA 1OT1A 4LUSA 2OZ3A 3WQFA 2OSWA 1EJWC 3VGHA 1HKJA 2VM8A 1VIZA 4JTKA 3UYCA 5CAKA 5E0CA 4C7FA 1XIMA 4H83A 1H7NA 2J8TA 4PTMA 3DFYA 4OKDA 4XZMX 3UR2A 3OIHA 2OB3A 2KAUC 5HJXA 3QZEA 2VEMA 1IXOA 3E3HA 1NH6A 4B5SA 2DQXA 6REQA 4MGGA 1ISWA 2XH2A 2DORA 4Q8VA 1EO7A 2FMNA 3PK7A 4OE7A 3EA1A 4DWSD 2FJUB 3SIZA 2BFGA 2P0IA 3W1AA 1PKMA 4C1NA 3CGTA 3DGRA 2QQ6A 1LQ2A 4JY9A 2INZA 3AIWA 2G3JA 5I3FA 1JCNA 1HFBA 2PUZA 2E28A 1FWJC 3DX5A 1S2CA 5BWAA 3T81A 1KO0A 6REQB 3LLXA 5I23A 1LCOA 3OGVA 4IICA 3VIPA 3GXTA 1AA1B 2J66A 2J6XA 2UY2A 2QT3A 3REQB 1XFBA 2WWCA 4MUZA 4ZFMA 3I7QA 1VJSA 3GTHA 4EAMA 4QGCA 3HPXA 4NUWA 3G0XA 2DT3A 4GNVA 4Z08A 1QDSA 2ZXAA 5CZSA 1GTEA 1QNQA 4H3DA 1B0IA 4Y9OA 1UH2A 3Q58A 2JGYA 1DJYA 5EMKA 3RM8A 2WO5A 1FY6A 3V0UA 2V9DA 1E6RA 1IWAA 1PVNA 4GY7A 1LWJA 3G3DA 4LV9A 5FIPA 4ZQOA 2ABAA 4MHBA 3N19B 2WHLA 1XIFA 4C1KA 1I2PA 3L66A 3IIVA 3AZSA 4PBEA 2D2JA 4AUBA 1E4MM 1B57A 1WDRA 2CBVA 2WKLA 1KBLA 4S3BA 3RJYA 4CN6A 4P8WA 4OU1A 4HYWA 9XIAA 2OELA 1W6TA 2ZA1A 4LY4A 1OG0A 4KCVA 3NL6A 4PR4A 3N25A 4XAFA 4C6EA 3BSGA 3HGSA 4GFSA 4H9XA 4XD4A 1QXLA 3HV9A 1US0A 3ITLA 3PPGA 1CENA 1F76A 4JYEA 4NNCA 4IP5A 1XF0A 4DUXA 1KCZA 5DFAA 4QDWA 2C13A 2X09A 4PUJA 2YLLA 2DJLA 4ZOAA 4R33A 1ICSA 4MOZA 5I78A 5LSMA 1YDOA 4XKMA 3FKKA 1W2VA 3V0TA 3F2BA 3TJIA 3WH5A 4C6MA 4M6VA 8TIMA 3PULA 5DRCA 3ES7A 4MLRA 4DZAA 2BOGX 1TKKA 3WLQA 3L65A 4WGXA 2EG8A 1LL6A 5EKYA 3KP1A 1OIMA 4GC4A 2YOCA 4QAIA 4J3VA 5M5DA 1YRRA 1CPUA 4S2BA 3O6AA 1QBBA 1J8VA 4YCPA 4ZA0A 5HNRA 3URQA 2J9XA 2UZ9A 1YPFA 2WC4A 3ABRA 3USBA 4X3ZA 4US5A 3NQFA 1KM3A 2DVXA 1QAPA 3O63A 4ZO6A 1QUMA 4MJZA 2GGIA 3OU8A 1VENA 4KWOA 4LYPA 4AHOA 3BAIA 4U2YA 4F0LA 4TR9A 5E5CA 3PBVA 3T0DA 1PUDA 3TJXA 3BJSA 4HPHA 3CLWA 1KD0A 3IGSA 1RA5A 2PDUA 2QS8A 3QFWA 2GGJA 3S2LA 3DESA 1UQYA 4GVFA 4HGXA 5H6HA 2UY5A 4UOZA 1AVAA 3ISIX 3ZR6A 2PURA 3TTSA 1RCOB 2C15A 1QWKA 1SO6A 1GWJA 1RA0A 1RJPA 3SW6A 4AW7A 2QPSA 2FHBA 3HQNA 3IJ7A 1CW2A 3M0IA 3G5EA 3SURA 3WK1A 3CBWA 4OHQA 2F2KA 2YCKX 1KXTA 4OUIA 3T08A 1E1FA 3W2UA 3WF3A 3GKAA 3UEQA 1R3SA 3MI3A 4Q8QA 5AC7A 2DEPA 1MW2A 3GU1A 3PVFA 5ENLA 5LKYA 1XYFA 1A4MA 4AEFA 3H2OA 1RPKA 6A3HA 4P02B 1P6WA 3GW0A 2IKJA 1XV8A 2V5DA 2YCLA 1WV2A 5E0KA 4IFOA 1J0IA 1QW7A 2YCEA 3CZKA 1E4LA 2OWCA 1QO5A 5HNUA 1KNWA 1WZLA 3M5ZA 1QU4A 4C6PA 5RUBA 3N9RA 2UBPC 4L9XA 1FQ0A 3ZS4A 3EOSA 3N2XA 4J3XA 5GQBA 2HK1A 4JHMA 2D22A 4XZIA 4K3ZA 2H9AA 3TXZA 3TTOA 1KM1A 1QPRA 1NDVA 5ABFB 3B9AA 3WO8A 1OY0A 1SW0A 2CWXA 4O16A 1QR7A 1BYBA 3E74A 1JCXA 1H11A 2XIOA 2BOFX 3WQVA 1HIZA 4DWSC 5LHFA 1VPXA 5E70A 1DQXA 4DIAA 1FWIC 1VBJA 1B3XA 4PH6A 1J6OA 2Y89A 3N34A 2R94A 2OWWA 3KWSA 2WM0A 2H3DA 3W01A 3WQDA 3CHFA 1QBAA 3RILA 1NTHA 4F3HA 4K68A 3WNLA 3NZRA 3QJAA 4HMCA 3POHA 3S0CA 3SM0A 3VDGA 4PMZA 4OECA 2AOSA 2Y2WA 4I5XA 3EDFA 1NQ6A 3NSXA 1K4GA 3PPHA 4KWSA 3TW6A 1EP1A 1A0DA 3ITGA 1A47A 4F79A 4HP5A 3WEZA 1NSJA 5AC6A 3SCUA 2GFTA 2QCCA 1JI1A 5PTDA 4MNJA 2RJHA 2YW4A 4Q8WA 3AROA 4LBSA 4E8CA 3B0YA 3EDKA 3VD5A 4MY9A 2FLIA 2R14A 1V3HA 4EVZA 4WVXA 4ACZA 4DXKA 2QGHA 1S1RA 5LIXX 2GWGA 5EMMA 4O53A 1YDYA 5C0QA 4GYFA 1H7WA 1KCKA 4NASA 2QCLA 1UD2A 4C7DA 4QLLA 5D2VA 1GZJA 1SFSA 3VNMA 2BLEA 2Y61A 3TQ0A 3P61A 4IGMA 4IG2A 4E2VA 5I3DA 4HVXA 4YCOA 1H7PA 4PRRA 1E0WA 2IKHA 3GX9A 4O1CA 1E0XA 1UR8A 1JXKA 4LU0A 4CD6A 3IRSA 4H6RA 4LX4A 1JDFA 1DWAM 1V6UA 1H51A 1XSKA 2PZ0A 3OVQA 4B2DA 3RM4A 4RXGA 2IW0A 2V3FA 4B5VA 4XO7A 2Z27A 1U30A 4BJHA 3D0CA 3RF9A 3CHDA 1WOAA 3RLHA 4HPXA 3L9CA 1LRTA 3FAWA 4IQJA 2Q09A 2OO6A 3QY8A 2QF8A 4WJXA 4O0KA 3TNOA 5FKYA 2WNZA 1QWGA 3CMFA 5AVHA 1HZYA 2AKMA 1JYNA 4HPJA 1OFOA 3N4AA 3NGJA 1FCQA 4FSAA 2VZVA 1OX6A 2V30A 3OZMA 3ORWA 2ISWA 2P3EA 3TN5A 3VDCA 3CH0A 4EXAA 5C6MA 2QDGA 2PGEA 4ADSA 1FCUA 3UXAA 1T7LA 3NM1A 3W1UA 2DSUA 2G97A 3GIYA 4G6CA 3VKDA 1OFBA 3IPWA 4GQQA 1XCWA 4B5UA 5D9OA 3U5YA 1CXHA 1LT7A 3EX6A 2JKPA 4K39A 4WLCA 3OTRA 3FXYA 5M3WA 1VAHA 4C6JA 1J18A 4P5UA 2EPOA 3SJ3A 3O0KA 4O0QA 1SR0A 4XVDA 2VFIA 1XYBA 4H9UA 1A49A 4JTAA 3SBFA 4EXBA 3TOYA 3A23A 4ICMA 3G8RA 5CPOA 2XIMA 3BAXA 3PB0A 1PTDA 4GACA 3TSDA 4P8UA 3CMGA 4DUOA 5EU9A 3UU0A 3QQWA 3LB0A 4MB1A 1KKOA 1JYVA 3MYOA 4K1WA 1YADA 3TSMA 1EC9A 1IZKA 3N29A 4IX0A 3THUA 4BQ5A 2A3HA 5AC4A 1WPCA 3S5ZA 2QUNA 5FEZA 3LHUA 3NL2A 3V5OA 3W29A 4GI9A 2PC4A 2Y70A 1XW8A 9RUBA 3JUGA 3PY2A 5D2WA 2ODOA 3H53A 1FVPA 3OA3A 1PKLA 4C60A 2WCGA 3KBNA 4DNHA 1TREA 1KC7A 1EB3A 1AH4A 1BRLA 5K2ZA 5I07A 3BV7A 3AMLA 1PO9A 3FGCB 1TVLA 1GHRA 1UKSA 4AYSA 3QLDA 4DRSA 3UP8A 4QG8A 2J8GA 1M1BA 3C2RA 3ZLFA 4UTJA 5MF5A 1KA9F 2G37A 4CU8A 1PYFA 1OZMA 3S5NA 3NFUA 3QOMA 3C2OA 1EHAA 1FFRA 1LOLA 3WJWA 3P84A 4NI3A 4DF2A 1OFDA 2F8QA 3IV3A 3KUMA 1C8QA 1TUFA 1ZAIA 4CUCA 4AX6A 3JS3A 7ODCA 4X22A 1VRDA 4ACYA 2BSLA 1UC4A 4CCDA 2GJPA 1N8FA 2VEFA 5AFDA 2CZEA 4UZSA 1K6AA 1OM0A 2O7QA 3GXNA 4LV4A 4XO6A 1OF8A 2R1KA 2VX4A 4PL2A 2Z2BA 1W1TA 4A8NA 1PIIA 1DP0A 2NQJA 2Z24A 1YDVA 1FRBA 1QT1A 2CZ5A 1WKDA 3LM3A 4K7YA 1ODZA 3SJNA 3A4JA 3LHVA 1OFAA 1M53A 1TWZA 2HBVA 5A6TC 3UGVA 1MW0A 1WCGA 3CHCA 1K8YA 2RAGA 1FWHC 3MKVA 3NQ7A 4GQRA 4DVOA 1UZHA 4RUBA 3IIOA 4J35A 5I3GA 4A2SA 3T42A 1V3IA 2NW0A 1L0PA 3KCJA 4HZMA 1N7KA 4I9AA 4IIGA 2PDNA 1OCNA 4QXIA 4MB3A 1XBYA 1YNQA 4UTTC 3RCYA 3GG1A 4K1GA 3WBYA 3NO3A 2PDBA 1Y0EA 3VGGA 3VKCA 2Z4GA 3DG7A 3AIRA 4I5RA 1OABA 3ARPA 1TPWA 2VC7A 3UPMA 1JPDX 2F2HA 2IMRA 1SJAA 1VBHA 4RE2A 1PYMA 3JRKA 4GVIA 2PODA 1O1ZA 3PAJA 2BDQA 3QY7A 2OLSA 2B4GA 1V51A 6XIMA 4C1NB 4ICCX 4HU4A 4AVOA 1ICPA 2V2CA 3LCHA 1SZEA 1TJPA 2PDIA 5LNRA 1QPKA 1W1ZA 3BZJA 4LSBA 3IJQA 3ITCA 2ZRYA 1UYQA 3BC9A 4MAVA 2E9MA 1J6PA 2PB1A 4NNAA 5AYXA 2NV1A 2YDQA 1RY0A 1RY8A 3T4CA 1GJWA 1I8JA 3NSNA 1XGDA 2HE5A 3BPWA 4A22A 3TC3A 2ZRXA 3V35A 1C90A 2XIBA 1XLKA 2PU1A 1F8IA 3OLIA 3S1XA 1DJWA 3WEOA 1JNDA 4QJ5B 1A5MC 3EWDA 3WBEA 1F3WA 1KKRA 3HPFA 1YBQB 3P6LA 4LS0A 4PUMA 4M81A 4D6HA 3VNKA 2OEMA 1KWKA 1Q85A 2JQXA 3VMPA 1XLGA 2ZZ1A 4MSSA 1E43A 5T8GA 3MKKA 5CGTA 3F4WA 3WL1A 3VIIA 3N18A 4CQ8A 5D2YA 3MSDA 1P0KA 3NQ8A 3GXFA 4DJEA 4CNOA 4QNWA 4NI8A 4YVXA 5HQLA 2AMGA 3MUIA 4NJKA 4CD5A 4ZQNA 5DCEA 1H7XA 5EGRA 4JQ1A 3RG6A 3I3BA 3LQLA 2PE4A 1P0DA 3E0WA 3IVSA 4FMVA 3S3GA 1AD4A 3SSJA 4NZCA 3PZQA 1EQPA 1W56A 3KHDA 3MZ2A 1OGSA 3VM7A 4Z0JA 1JNEA 5CZKA 1AQ0A 4GGBA 4A3RA 4FXSA 4MWAD 1EQCA 1XIBA 3R8GA 3PN8A 3N17A 3P2VA 4RW5A 9CGTA 3FIGA 2JFEX 5C55A 2BY3A 5LNWA 1YTEA 1NWTA 2RJGA 2WYSA 1U1UA 2NT1A 1H49A 3EA3A 1K9TA 1WAWA 2QCEA 4ZQMA 3WUBA 2NX9A 4JNZA 4DZIA 3U4AA 3O05A 3K13A 4NL1A 3W85A 1UJPA 2VUNA 2VQUA 1E0UA 1ODUA 1L8PA 1FDJA 4WQ6A 5I06A 2NV2A 1OK4A 1M7XA 3PJXA 3INPA 3G2GA 2JK2A 3L4ZA 4XIMA 5IDIA 1QPOA 2YDSA 1ISXA 4PGLA 1GKPA 3DI0A 2JBMA 4KKXA 3NQDA 3STFA 4ZB5A 3MHUA 5AYZA 3SQSA 5HK4A 5D04C 4BK9A 1IF2A 4BI5A 3BW3A 3HQPA 2PF8A 3UZWA 2VDGA 3BJFA 3S5OA 1TWIA 1XGZA 5I3IA 4BWLA 1LQAA 1LJYA 1KV5A 4GCXA 4KIEA 1WZKA 1VLIA 3N1AA 4FOUA 4PC8A 1J96A 1M01A 3NUKA 3C4UA 4INFA 4FNRA 3BW4A 5EIYB 5F2GA 2VURA 3F2CA 2EKGA 1XLAA 3HIJA 2QMJA 4ZXLA 3AIVA 3DBPA 4Q4SA 3SADA 4R27A 2DT1A 2E6YA 4OWGA 2OVLA 2A0NA 4LALA 2VOTA 4GX8A 2EPNA 3E38A 3OPSA 5DRIA 4MY8A 4UQCA 3RIKA 2J8FA 4V27A 3VKBA 3VNDA 1JF5A 4LAKA 2VC6A 4NZ3A 3N2BA 3VK5A 5LA1A 1FWNA 2A79A 3NOEA 2YJQA 2PRHA 3SCVA 2ZBTA 4QG6A 3QW3A 3CL8A 1JFHA 3LPFA 3OOQA 3K30A 1TYGA 2CCRA 4GOAA 4IJRA 2VL4A 5C2CA 1VEPA 3R7MA 1KFEA 3WQ8A 4AY8A 1L9WA 2X41A 1XBXA 3N13A 1DWIM 4JTFA 3OBEA 2D1ZA 3OIXA 5ABTA 4BEQA 4FLQA 2OZ8A 2FIQA 2WSPA 3SCSA 1GPFA 4QNEA 3H7VA 5FJIA 1R2SA 2GDVA 3KEHA 3T07A 4RZBA 5BROA 4B15A 1K3UA 3UG5A 4PCPA 3MHGA 1JPKA 3E9AA 1KR0A 1B4EA 1HKWA 3AYSA 4UR7A 1DJHA 4Q32A 5F2LA 4E6MA 5CBBA 4ADUA 4D6DA 3G1FA 4EP8C 1DORA 4OT7A 5D2TA 4ML4A 5C7VA 4B92A 2WNQA 5HINA 5CC5A 3TAKA 2BV9A 2DT0A 2A85A 3FJ6A 2GOKA 3IJ9A 3FOKA 4N6FA 4CQBA 3ZR4A 4F4RA 1XSIA 3CO8A 4J3ZA 2DSKA 2ZUNA 3GTFA 1MUWA 1XG4A 3GNRA 1A5CA 3VCCA 4U5IA 3LV6A 3G1YA 1BFNA 3SY8A 2XWEA 3W53A 4NZFA 5D8WA 5FF3A 3TYAA 1G6CA 1TSIA 3APTA 3I10A 1GHSA 4QM1A 1BKHA 4ZE5A 1VFUA 4GUIA 5AYIA 5JMUA 8XIMA 1D9EA 3E1F1 3T0BA 2EXOA 2C7FA 5KINA 3H23A 3KCLA 2PDGA 2XHYA 4AD1A 1DOSA 2Z29A 4HU3A 5TQLA 1W1B1 2XFYA 3LNMA 4LYRA 2J7EA 4Q4PA 2CFFA 4P7QA 4DBDA 2WMHA 3TU9A 3A21A 3HU7A 2A3LA 4UFMA 2AAMA 4F0HA 5F2IA 2QUUA 2W6RA 1H50A 3NEHA 3IGXA 4MF4A 3PBWA 5CSYA 3SUWA 4GVHA 1OCBA 1BWKA 4AD3A 1F6KA 4A35A 4BF5A 1E70M 3SGUA 1I1WA 1E6XM 4FXRA 2ZE0A 3UR5A 2J9ZA 3CAVA 4AD0A 1ZBCA 3P14A 4Q8MA 1E6NA 2X8RA 5J8LA 2VFDA 3P80A 3LBMA 4GIAA 1OFEA 3M4HA 2WOQA 1MMFA 3STEA 3ABZA 3OBAA 4IIBA 4ATWA 5HDRA 5BNKA 1K7FA 4XUYA 1GQIA 5DXYA 3J7HA 3S1GA 3ABQA 3PNZA 2V5KA 4HJFA 4ZBCA 1PXGA 4LC6A 5EL1A 4R88A 3GYEA 1JZ6A 3CEUA 2FTPA 1AQHA 4OBTA 2JEPA 4GG9A 3AWOA 4O18A 5FEWA 3M44A 2J13A 3AICA 3IEBA 1FTXA 6ALDA 3VNJA 1XJBA 4DYEA 5A6BD 3GNXA 1PTAA 1ICQA 1Q7MA 3UJEA 3OODA 1V77A 2CLLA 3PJTA 3FW6A 4P7RA 2X1RA 3SUSA 3CLMA 1UROA 2DDXA 3CIWA 4W7WA 3B8DA 3PM6A 1RK6A 4IGHA 1WQ5A 3W0KA 4Z1YA 4F9DA 4S3FA 1M3UA 4F9JA 2BHUA 3ZSTA 4REQA 3GAYA 5G4WA 2Y7EA 5CJMA 3LI0A 3MMTA 4GO9A 5JH1A 1RBAA 3QPYA 3SY5A 1QRQA 1S39A 3S2NA 2EQDA 4KRZA 4MKNA 4C6KA 3TMQA 4XISA 1WA3A 5FA5A 4WGHA 4D72A 3SECA 1UWIA 4UFJA 3NZPA 2Y0FA 3SN1A 4H9YA 3GNNA 3AALA 3HG5A 3OG3A 4MJMA 4JX6A 1BRLB 5CEWA 4DN1A 1UKQA 3FDKA 1QFEA 2W0UA 1TR9A 4ZO9A 3M64A 1J5TA 4HA4A 4JNMA 1H1YA 1CXIA 3P5ZA 3C8FA 1TPUA 3DEQA 1P1MA 3LI1A 1OBAA 1ZB5A 1Q65A 1EYWA 5BWFA 1ZCCA 1A5BA 5HOSA 4JN6A 1PHQA 2E8ZA 2FVLA 4DJEC 1H5VA 1OINA 3K4WA 1O1HA 1Z41A 2J79A 1BWLA 2B7QA 4UQBA 4MWAA 5T26A 5H2ZA 1SFJA 4DM2A 2CZFA 5FJRA 3M6DA 4GA8A 3CUIA 1W3KA 3W37A 4PZVA 3NDOA 3LHWA 3BCDA 4JTEA 4M6UA 4EPBC 4FF5A 1TJ1A 4AY1A 5HBFA 3TW9A 1WP6A 3PZOA 3P5YA 4H6KA 5F1VA 1Q7ZA 2D24A 1UD6A 3OQEA 3E6EA 2PC8A 1VEMA 4P7OA 1TMLA 2OOFA 3WDHA 1YBQA 3B0XA 5LIWX 3W1XA 3RFAA 4DEFA 3ZOAA 1WDWA 3SGGA 2CETA 3AS0A 3LX9A 4KIRA 4UTWA 3TVAA 1E6SM 2I56A 1H63A 3KVMA 3UY8A 2X0SA 2VQTA 1HNYA 4D8LA 4Q6XA 4YTQA 4DPPA 1V6WA 1TPFA 5LNVA 1DIEA 4Q6JA 1XUUA 1JJKA 2X7WA 3C0QA 3EPMA 1Q2SA 1VB9A 4PUEA 3MI6A 3VXGA 4LFYA 4B9YA 5DMMA 5AHLA 3LDVA 1XG3A 4ERGA 3TA6A 3CQJA 2YB4A 4R53A 1PDYA 3GVVA 2QUMA 2WNWA 2ZXQA 4L4OA 3H2FA 4E3VA 1BVWA 5FF4A 4HHHA 4K8GA 4KEVA 4LY8A 2A2IA 3E5PA 3ONCA 1AMYA 1ZP4A 2AGKA 4IQLA 4JKLA 1R85A 3Q45A 1YQ2A 2GQ8A 3D46A 2XIJA 3PZ9A 3MBFA 1FOBA 2CU0A 4EWND 3SRDA 3H54A 2R24A 3PTDA 4W85A 4JTDA 3MUXA 4MTVA 2FFCA 1VQTA 2BGSA 3TLLA 3ZWTA 1FUYA 4Q4QA 4H01A 2VXNA 1LQ0A 2X2YA 3GVWA 3O8AA 5TNVA 1MDLA 3T40A 4AU0A 4G1KA 1EZWA 4LCRA 1XLFA 2ACUA 2VVNA 3IARA 3UZXA 3EEZA 1NP2A 1F74A 1XXXA 3BLEA 4YIWA 5EFDA 2WQDA 1GG1A 1GW1A 5A8QA 1A5LC 5CH9A 1MQQA 2PGRA 4F0RA 1UMLA 5CGMA 5D03A 1M6JA 4TX6A 1W1VA 4TU1A 2XVPA 4LUYA 3W7RA 1K70A 1TJ0A 4WKFA 3PG9A 5A6MA 3EMQA 1TG7A 1ONWA 1SW3A 2CHNA 2PDYA 2QNEA 2PDFA 4LB3A 3VGFA 1XC6A 2ISDA 1FHVA 5GNZA 1QOPA 5D8ZA 3B8IA 3QHMA 2VC9A 4Z17A 1GYLA 5BRQA 3CQ0A 4CNPA 4G5DA 8A3HA 1R3QA 4FIRA 3FCPA 2BWGA 3NYDA 3ZSSA 2FGLA 2AKZA 2E77A 4NZ5A 4FLOA 2WJEA 4NILA 2X40A 3N4FA 5G5IA 2R9RA 4Q8UA 3BUVA 2OOGA 4OZOA 3P8JA 3CZEA 4IF2A 4GKLA 4Y7EA 4B3KA 5I00A 4MVAA 1N8WA 2QYGA 4PA8A 5A95A 1IR2A 3CS2A 2QCDB 2Y1HA 3TUUA 3M5YA 1W1IE 3OYZA 5FESA 1J0YA 3OLEA 2BBFA 2O92A 3WD3A 2E40A 3H2CA 2Z0IA 3QEZA 4L4LA 1C7SA 2J4GA 2R82A 1X7FA 2WJFA 4LVGA 4R85A 3WLMA 4B4HA 1FBAA 3ECQA 3CT7A 2Y7DA 2C1HA 4B3LA 3CL6A 3AYRA 4B5WA 2HRWA 1OJXA 1TE6A 1OG6A 3DN5A 3N2TA 4HK6A 1GEHA 3QC3A 2QCDA 5DBUA 1X6UA 5K9DA 3VILA 4FIQA 4EXQA 3AXMA 3C6CA 3BLDA 2ZVIA 3TN6A 4DBWA 2V6AA 1W2PA 1ZJHA 3GC4A 1PDZA 5HPCA 1VFHA 1SJDA 4UBPC 3U9IA 1R3RA 2E9LA 4ZSTA 1PX3A 4R9XA 1AL7A 3AS3A 3VMOA 4X60A 2R8WA 2E5DA 3B05A 2EF9A 4EANA 1TPEA 3NGFA 5FCZA 2Q8ZA 1W54A 3PWAA 2RKXA 1SFTA 3CXOA 1C3FA 1V3JA 3WDIA 3ERPA 2NXGA 3MI2A 5EYWA 4FR6A 1KBKA 3DG3A 1PPIA 2ESCA 4JFWA 2QPXA 3WJZA 3TN4A 4ML9A 3W2NA 3QVQA 2X1IA 3VVGA 3BMXA 5C8BB 1OIFA 4HU0A 5AHFA 1D8CA 2REQB 3MANA 3CPGA 3T4WA 3V18A 6PTDA 1CGWA 4ZENA 1VIWA 3VC5A 4BKNA 3M1ZA 3IJ6A 1JAEA 3V16A 4O1AA 3MHFA 4Q7IA 4EK7A 3D3FA 3NDYA 3ITYA 3N2CA 3I6RA 3UGRA 1M03A 3GO2A 2NQZA 3E02A 4PTWA 2PPGA 2HDJA 4AG0A 4I90A 4QEEA 2IPGA 5I77A 2UY3A 1UIPA 2BVYA 4DXXA 1Z44A 3BAWA 2VX7A 5FOOA 2FTYA 3A12A 3WQCA 3D3AA 3OW1A 4RZ6A 1H09A 1M7JA 3CTLA 3QZ6A 4GISA 3EAUA 3WJYA 5HNNA 4Z1BA 2NV9A 3UERA 4G8TA 4NVTA 2I14A 1HVXA 2X2GA 1GOMA 4K7VA 1FH7A 4WUIA 2Z1KA 4PMYA 4JFTA 3W28A 3EB4A 3TFCA 3CC1A 1EOKA 3R8HA 2FTWA 3UA3A 2D0FA 1PZ2A 4AZ7A 4UTMA 1HJSA 6TIMA 3VNLA 5CLTA 1XYLA 2OR2A 2X1TA 5HJLA 3NPUA 2EEXA 1WYIA 3G22A 4I6KA 3WFLA 5D2XA 3E2SA 1UH3A 3TK7A 3GG7A 3VE9A 1CDGA 2TODA 4E38A 5CSUA 1JCYA 4K36A 1OGBA 1HP5A 5DY2A 4LB4A 3CWOX 4XSLA 3LGEA 4HCHA 3IUHA 3L4YA 3W7MA 3BG3A 5FACA 1J79A 2Y63A 3IV8A 2IXUA 3QQ0A 3G0UA 2ZX8A 3CWNA 1B1YA 2EPMX 4JR5A 1QI3A 2PLMA 2ZDSA 4AMCA 3MV01 4LAUA 3O6DA 4AD4A 7CGTA 2YFOA 3AJ7A 4DLFA 3T44A 3MMWA 2OSYA 2ZCGA 2ZZ4A 1V79A 3GIQA 4ZEPA 1RR2A 4MMWA 1PWMA 3RYSA 3APYA 3GU9A 2OLAA 4FO4A 2Y6ZA 5TAOA 3PWGA 2V3DA 4GIYA 1UZDA 1EBHA 3SIMA 3UJSA 4LWWA 2H8XA 3GHTA 4GI8A 2CBUA 5AY7A 2JALA 3L12A 1QHZA 3L23A 2C18A 4OUEA 3RX2A 1T0OA 3ARXA 1XWYA 3CQKA 1PJ9A 1ELSA 1XBZA 3TWAA 4M19A 1IXPA 1WUEA 3GHSA 3PB2A 4DX3A 1JG9A 4UC5A 3C0JA 3OZYA 5C7HA 4K8HA 5KITA 2IUZA 1SM9A 4JNYA 4F0MA 3BCFA 2PGFA 4BQ4A 2VRKA 4P7NA 1ZALA 2ISSA 1RK5A 1E1EA 1XIJA 5CPTA 4ZOBA 1CYGA 1OD8A 2RGLA 4C6OA 1V3MA 4UIOA 4JAWA 1VLWA 3B8VA 2ZUUA 3BGGA 3R2GA 4RZ5A 2WMGA 3ZM8A 3N73A 3EXTA 4U33A 3LN3A 4XAGA 3PZUA 4KESA 3MWAA 3CT2A 5D33A 1VR6A 4R7JA 3LZ3A 2XUCA 3U4FA 1IIHA 4I7VA 4JIQA 4J3SA 1FP8A 3KVJA 1A5OC 2W61A 4AEOA 1H61A 3T05A 1XQLA 2HS6A 4O17A 3UPBA 4DELA 4RW3A 1FWGC 3M7WA 1D8WA 3WD4A 2DZAA 2Y7FA 4KCUA 1T99A 3IJ8A 3GTIA 2EPLX 2EJ1A 3A4XA 2HPIA 2ADAA 3W3OA 2ZFAA 2H8ZA 1SSDA 4D1IA 1HKIA 4CD7A 5XIAA 2GLKA 4PMJA 2EPKX 4GNKB 1W32A 1UUQA 1MZRA 4KETA 3KXQA 3DGBA 2AQVA 3G1RA 3C0LA 4TIMA 1JEZA 5L9FA 1JCMP 1QI4A 1UC5A 3UF9A 1MRAA 3N2MA 1GOQA 3LV5A 1P0EA 5K3VA 2HCVA 1UP0A 4KW2A 2DGAA 2ZX9A 1RQHA 1QNRA 2HPMA 1IGSA 2GJXA 1ADOA 3CHVA 4UQDA 4JX5A 1XFCA 1G67A 1P5BA 1X6NA 2QJJA 3S83A 4L1XA 5G2WA 1PX4A 4GQBA 3G8EA 5EB8A 2FKPA 4JDBA 1TV7A 4LCQA 3MV11 2P50A 2XGZA 2VR2A 3LBOA 4RCXA 3CZ8A 5AVNA 2C19A 2FVKA 1KFKA 5K4XA 3O1NA 4MIMA 1VD6A 2ATSA 2E25A 1QO2A 1HJQA 2VTFA 1SPQA 4ATDA 3IK4A 2J9YA 4Q8NA 5D05A 1I2OA 1TCMA 3AS1A 1U22A 3UJ2A 1ADDA 3NQVA 3I6TA 3SQLA 3VINA 1GVOA 1Q2RA 4XZHA 3ALGA 4A05A 1ZGDA 3A47A 3M5VA 2I17A 1UWSA 4YTTA 4OV4A 3EWBX 3W27A 1TA3A 3XINA 2FMOA 4JFUA 3UWUA 3KRZA 2DZUA 4DJFC 2EAWA 4IMCA 1TPDA 5J04A 3H26A 3W22A 2DSWA 4GQGA 2DSZA 5U7SA 2W9MA 2I1OA 3L2IA 3NA8A 4JIEA 3PZNA 1AJZA 1A5AA 4S3EA 2GZXA 3PPFA 1PWLA 3GKFA 3BARA 4E2BA 1WXYA 3URBA 1DXFA 2HEJA 4JZ5A 4IZGA 5D30A 5A8NA 2NXIA 1RUSA 3FLUA 5JQ9A 3R25A 1YTKA 4GO8A 1FXQA 3A6OA 4DF1A 1CI1A 1EJRC 1REQA 4QS5A 2HTMA 5A6KA 2FH8A 2BVTA 5CC7A 1F4HA 5BMXA 3LUTA 3AMGA 1QMLA 4QROA 7A3HA 2VC5A 1AH0A 4MWAC 2NWSA 2GQAA 4OOUA 3C0SA 3FJLA 3SQMA 3BOLA 2TRSA 2G95A 1WNOA 1FWDC 3T2OA 4JYFA 1E55A 4CEUC 1EEXA 4EACA 3MUY1 2P1FA 3CV6A 1VBUA 3M7SA 3WENA 2W66A 3OO2A 2ACSA 4QCEA 1GNXA 4HJWA 3VM5A 4MDPA 1H2JA 1JQXA 1OF6A 4GY0A 2CLKA 2CHRA 4Y6GA 4W86A 3GDKA 1PKYA 1HJVA 3TW7A 5BU6A 1J11A 2VWTA 4OBSA 5FEXA 4AVFA 1GG0A 2I57A 3EWUA 1NIUA 1KR1A 1NOWA 5D37A 1UD5A 4DB7A 4RNFA 4RNIA 2YDRA 4I8DA 5E09A 5E9XA 4LT9A 3UQNA 2XFWA 3QYSA 4XZBA 4TTUA 4P8XA 3T55A 3VIMA 3HMJG 4A6GA 3VNIA 1UZ4A 3M0VA 4XAYA 1C92A 1BF6A 1R9ZA 4N9DA 3UG4A 1CCWB 5D9PA 3WH6A 4YTUA 3EX4A 4H8VA 3VX0A 4H6EA 4YTRA 4JDYA 3MO4A 3BAJA 1XLMA 3W1NA 3CMJA 5I7GA 1VC4A 3UT0A 5AOUA 4F2BA 2C1GA 3EXRA 1BLIA 5I3JA 4MFDA 3M43A 4LAZA 4URIA 3CK5A 2LLEA 3VFLA 1O5XA 1IE7C 2FZNA 2XH7A 1F6YA 2E1WA 3THCA 3TTYA 4UMCA 4IUOA 1FA2A 1XH2A 5BMWA 4C65A 3W76A 1GVSA 3UNTA 1UIOA 4N0RA 3B9EA 5C54A 1CLXA 1D7FA 3VKAA 1WXJA 2VD8A 4HPNA 1Q8AA 2Y88A 4I7WA 2VDIA 3W1RA 1VKFA 4AWTA 1E6PA 5DELA 1CB7B 3ZJ7A 1ONRA 2PP0A 3W7QA 3DFHA 1W1PA 2ZC1A 1H1ZA 4I9JA 3TH6A 3DHPA 4P8VA 1H60A 2Y24A 5BZAA 4LTSA 1VS1A 2HNEA 1XC4A 5GJPA 3ZFHA 3NPWA 2O4QA 3W74A 3TOPA 1GVRA 2A1YA 4IIFA 1HL2A 2WLYA 4FNPA 1R7OA 3WK3A 1JZ5A 2AGTA 3BOXA 2X7VA 4XG1A 2GJXB 2GVJA 1RXOB 1W1YA 2W27A 3Q37A 3I7RA 4Q33A 3IACA 4HSOA 5D38A 4MWAE 3WLOA 3VD7A 3T0AA 3ZXWA 3EB2A 3O6YX 4XAPA 3H4XA 3IGHX 4MY1A 3QTPA 3TONA 3UVAA 1D3GA 1LROA 5C5YA 3BZGA 5LNSA 4MG4A 3TA9A 4JTRA 1XKYA 4QIUA 1VFSA 1FWTA 3I68A 2E4TA 2E3ZA 1GVYA 1U5HA 3WY1A 1W3LA 3MMUA 5A2AA 5JXQA 3GXMA 4RDVA 2P8CA 4V15A 3S1VA 4IWWA 5A5WA 1Q4WA 2V68A 2YA2A 1ZSXA 3C56A 4GYJA 1MYRA 5EMLA 1MO0A 1EEPA 1LP6A 2E8YA 1X1NA 4A2RA 4FF7A 3SUUA 4XSMA 1XLHA 2OTDA 1UWQA 2PWFA 1EXPA 1A0EA 1GGOA 3AZRA 2EKCA 1BYDA 3L0NA 1VYSX 5A6LA 3LYEA 5FSEC 1EC8A 3N4EA 4L6OA 1PIGA 5BOEA 5CC3A 2HS8A 5FD0A 3O2LA 3ATZA 4ERIA 3RLGA 1TPB1 1EF3A 1JD7A 5K4ZA 1CLKA 3PC0A 1QTWA 3W7CA 2C6QA 3CHEA 6CGTA 3KVKA 1EFZA 5LIUX 2W63A 1A4LA 3EXSA 3TP4A 4FS9A 4C91A 4IXXA 2CBJA 2ISFA 1AW2A 1B90A 3AXIA 1UB3A 2ZUSA 2INFA 1G69A 3FHQA 1QATA 3KHJA 3LPGA 1ECQA 3OZPA 3RLUA 3NXFA 1F3EA 3GDBA 4O1DA 1L2QA 2BP1A 3L0GA 2X1UA 3O3RA 1G4EA 3W7KA 4ZQPA 2DU2A 4JCMA 1ZCOA 4A3HA 2PRLA 1M5WA 5JU6A 3VTRA 1W9XA 3UXLA 1BSIA 4RLIA 1VFMA 1OWQA 3E0LA 2ZE3A 4X0VA 2D0HA 1G5AA 1Y5XA 2J78A 4O13A 4H2CA 4I9TA 4QP0A 3B04A 4M7TA 2UY4A 2DIKA 5EBAA 4JIHA 2A21A 1AJ0A 1R3VA 1GOKA 2YIHA 5CQ1A 3F1QA 2IXVA 4EF8A 3UXDA 2VR4A 4GJ1A 9XIMA 2R1MA 1GZ1A 1K02A 2P0OA 4KMQA 4NRSA 3W2KA 3WD2A 2Z1VA 4OOZA 3TTEA 4MLJA 4H6QA 2D23A 4ZO7A 3PSWA 1NAL1 2PLKA 4LH8A 3CB3A 4UCGA 2PWDA 4HMNA 1V6VA 3T0CA 2WKJA 2NUWA 2QPUA 1KFCA 2CLFA 3NPVA 3R89A 4NT0A 5EY5A 1R3YA 3IUIA 5FJTA 3DHDA 4PMXA 4UR8A 1E9LA 3UCQA 4HOZA 2WAGA 1W9UA 1F9CA 5HWNA 1LOSA 4BY3A 5CSRA 2V2DA 4NQ1A 2DZWA 1NF0A 3FYYA 2O9OA 5HMFA 5I0DA 1HTIA 4JTCA 4JL1A 4L9ZA 5FJOA 4L7ZA 4NU7A 2POTA 4PTDA 1BTCA 1JL8A 4Z2GA 1GVFA 4V2XA 1JRCA 2RFGA 1RVGA 1JDEA 4FALA 2IQTA 3WDRA 2QCHA 4HMEA 3RRXA 1Z89A 4ZODA 4O57A 3PR2A 4NXSA 1J9YA 2CLEA 1W8SA 3TYZA 3F4CA 2Y8VA 2P3ZA 4O52A 4ZOCA 3C2EA 5FI8A 4E4PA 1EF2A 4PSPA 3LD5A 1UWRA 4Z1CA 3VNYA 3ABSA 4Z2IA 5E6ZA 1O95A 4F8XA 4OFCA 4D8ZA 1DJQA 1SQ7A 3GUWA 3FJ4A 4QHRA 2VRJA 3VO0A 3KBJA 4MYAA 3WELA 4R9OA 1S2WA 2ZUVA 3M0KA 2BX7A 3SO7A 1G7VA 3NL3A 4K2SA 3CZLA 3OA5A 3WF2A 3F5KA 3STPA 2BHZA 4DO6A 4LCSA 1RVKA 1BPLB 2OCZA 4PSRA 5DEZA 3HZ3A 3WD1A 3PBGA 2F6XA 4HNUA 2CNCA 5LNUA 2C14A 4D6FA 2QJIA 2OT1A 2WCAA 4GX9A 4DI9A 1DJXA 3BMWA 3GTNA 4W8LA 1O12A 1VF8A 2OX4A 3U0HA 4GI6A 1FWFC 3O15A 4K8EA 3EX3A 3ES8A 7PTDA 2CLMA 3OLGA 3QW4B 1ZUAX 4L6HA 1X98A 1R5YA 4ECLA 5E9AA 3SR7A 1MXSA 3W7PA 1XRTA 3WDQA 2VJXA 2V5LA 1EJSC 5JBDA 4CCCA 1DXEA 4E8DA 3G6MA 1IZJA 3SCWA 5I3HA 3WH8A 1TPVA 4EOUA 1BQCA 4PCTA 1UHVA 4ZCWA 3CL7A 1PEZA 4KBXA 2IS7A 2OQLA 3QMSA 3WCZA 3PJWA 4LNCA 4Y8EA 3LU2A 4KWVA 3GC5A 5LA2A 3BO9A 4P61A 3E2VA 1TB3A 1NDYA 2G4JA 3TAOA 3ARZA 1WKFA 3GTXA 3FDGA 1X39A 1FWWA 3QHOA 5J5RA 4V33A 1RV8A 1E4IA 4HYVA 3A9BA 1BG4A 4O1BA 3JW7A 4BQ2A 1F3TA 4D2JA 2OQYA 2WVUA 1LUCB 3QR0A 5ECUA 1UJQA 4A8IA 2ZXDA 3RITA 4L4PA 3ZLGA 1KCLA 1OGGA 5ABGA 2WPBA 4FA3A 3DH7A 2ZIDA 1BGGA 1YNYA 3KZPA 4JTIA 5H91A 1HGYA 2DIJA 1TV4A 1KCXA 4UTUA 1GCYA 3RU6A 4TOQA 3O0FA 1JDDA 3LRMA 3TXVA 3W7JA 2WZHA 2NQ9A 1YKWA 3FVMA 3L68A 5BXSA 2XSBA 2PDPA 3SRFA 3LOTA 3P60A 1PX8A 4FOJA 4J7RA 2GWNA 3TCEA 2PS2A 4DF0A 4HT3A 3M0ZA 1MVYA 1PE1A 3KOFA 3O16A 1JGIA 1B3YA 1KTBA 3UCCA 4WY0B 1FH9A 1XS2A 1XLIA 4UUIA 1ZJIA 1K7EA 1FWBC 1R87A 5I6SA 3N14A 1Y65A 7REQA 3SGZA 3WX7A 3RCNA 3FX4A 1HKMA 1DYSA 3HG4A 1KLYA 3QLLA 3TZNA 1KM5A 2E09A 2XIQA 2J88A 1CNVA 1F8MA 1JZ8A 4ICNA 4NAEA 3USZA 3OP2A 2VHLA 1YXCA 5HXMA 1I6NA 1Q4NX 1A53A 3WQGA 2P10A 4KPLA 3ZO9A 3VX1A 3GBEA 3P0WA 1S5WA 1TZ9A 4E0CA 5I2UA 1PBGA 1UCWA 3ANUA 4ZR8A 4PMVA 1OZQA 3MU7A 2YSWA 3G1AA 3TSBA 3GRIA 1U5VA 2HVNA 3MY9A 5IM51 3WYZA 1GT8A 4P2VA 2ZXBA 3WKZA 2FPTA 3OG2A 2PWGA 3NVTA 1FCVA 2AMXA 4PB3A 4EAYA 4CNSA 1O68A 1JULA 3KAOA 3GVGA 4AF0B 2E6AA 3GDLA 2GVEA 5H1WA 3QYQA 4RK8A 4YHEA 1TTPA 1DTUA 1PHWA 3B9NA 3CO4A 3R10A 1IV8A 1O6IA 1HJWA 4DJED 3HG2A 4CVWA 2VCAA 1SU5A 2W67A 1EA0A 1ITCA 1P6BA 2EG7A 5IBXC 5AZ1A 1EDQA 3NQAA 4GK8A 5EMJA 3EWCA 1RSCA 1RQBA 1T6MA 3N12A 4QLKA 4AHQA 1UOZA 1H3GA 1XKJA 2B7OA 2VEIA 4M0XA 3CUJA 3UG3A 4XIAA 1POKA 1AZ1A 3V75A 1W5NA 3LTYA 2O56A 3CAKA 3M0MA 3FSUA 2HK0A 3C2VA 5HA7A 3TC7A 2IQDA 5AC8A 3PTQA 1W3IA 1Q63A 4QE4A 4Q8PA 4G9PA 3CQHA 3ARQA 3QKZA 4J3UA 1C8YA 1P43A 1DL3A 2QW5A 3S47A 3W2MA 1XINA 4GH3A 3AIQA 3V3WA 2CKSA 4PYSA 2MNRA 1QW9A 1SZGA 3WSUA 4N9BA 1O7AA 1NF7A 2C0HA 3CPRA 1LOQA 1UOKA 5BXRA 4AMAA 1XYCA 1S2UA 3RMEA 2FYMA 3W1TA 2HXUA 3BG5A 4A3UA 4Q4MA 3W87A 3LZ5A 3EBVA 3KBVA 2XISA 2QR6A 2ZUTA 1EL3A 5HMSA 4IH3A 4ENLA 4C90A 1O5RA 3W88A 3HO8A 5HR7A 5HPOA 2JKEA 3S2CA 3ID7A 3C61A 4LF2A 4WHBA 4WY0A 2DT2A 3G1VA 4CN1A 4LNYA 4Y90A 1Q6EA 1JD9A 2E7FA 3LMZA 2J24A 4GUJA 4KF1A 2XN1A 4XAZA 4ORIA 3IJLA 4IL2A 2JEQA 5FAJA 2PWVA 4JIRA 4IJCA 1T96A 5M03A 1EIXA 2XH4A 2PTYA 4TV5A 5D4YA 1X8CA 3FVDA 1SFLA 4BS0A 3KTXA 2EHHA 3VI2A 2XM2A 2VMFA 5IOBA 3W7EA 1W0MA 1BAGA 4D6IA 1VYRA 3RJXA 1PZ0A 4S3GA 4ZXOA 3LXAA 2DH2A 2POZA 2BXZA 1C29A 2VUYA 4YJ5A 3EX1A 1A80A 3L2LA 3QRHA 1E71M 1S38A 4UOQA 2D0GA 1XDMA 4US5D 5HNTA 2ZX6A 3KL3A 3WNKA 4KFPA 4PTXA 4HSNA 4YYFA 5IFTA 2XU2A 3S42A 4V28A 5AECA 1Z9AA 4IMDA 3GU2A 2BZNA 1H4PA 2R1PA 3UFYA 2ZDRA 2KX9A 3T8LA 2GSJA 3D6NA 3WLRA 3CUZA 1GQKA 3WMLA 1HXJA 4Y8FA 1S1PA 5JVLA 1XRSA 2VEPA 2NLYA 2ZUMA 5LYRA 1R9XA 4AZIA 2YA1A 3LRLA 4XD5A 2IQ0A 5A2CA 1N2VA 1FDYA 3WNMA 3U3HA 1J01A 3RXZA 1XLDA 1GKQA 1AQFA 5DN1A 3N9KA 1VGAA 1EP3A 4R7OA 3T7VA 3OGSA 3W26A 2VI0A 1ZHAA 4R7WA 3RGTA 1I9CB 2FB2A 3S6OA 4WF7A 1NDZA 4KCTA 2XPKA 2QZRA 4E3TA 3QPEA 3W7NA 1ITXA 4A21A 1OCJA 3GG8A 2YYUA 2VFFA 3ZT5A 3CQIA 3W75A 4ES4A 4PBGA 1QJWA 2RHGA 1TTQA 3C2YA 1ML1A 1RP9A 3MDWA 4GUG