3SURA

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with nag-thiazoline.
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
519
structure length
504
Chain Sequence
HHHHSSGLVPRGSHMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Gaining insight into the inhibition of glycoside hydrolase family 20 exo-beta-N-acetylhexosaminidases using a structural approach
pubmed doi rcsb
source organism Paenibacillus
molecule tags Hydrolase
molecule keywords Beta-hexosaminidase
total genus 191
structure length 504
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3surA01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3surA02
1ZBWA 1D7FA 1HKIA 6A3HA 1EHNA 3VGDA 1GJWA 2J7FA 1E4IA 3N1AA 3T0BA 2WVUA 1NH6A 3JUGA 3TA9A 4H7VA 4PN2A 1LWJA 2VC9A 3MUZ1 4A3YA 1FHLA 1BPLB 1TVPA 1JI1A 5D8WA 3VMOA 1V3KA 1JAKA 1W3KA 1W9PA 4YHEA 4KRUA 2WWDA 1JYWA 2BY2A 2GJXA 1E4MM 1E55A 3WNOA 5JIPA 3UETA 4JKKA 4JKLA 3AHVA 2QLYA 1BFNA 2YBTA 4BQ3A 3BLPX 2YL8A 1LL7A 1DWGM 1XCWA 3AS3A 4WKAA 1LQ0A 4JL1A 3WDIA 3W6LA 1V08A 1G5AA 2GSJA 4M80A 4ATLA 4P8UA 3ARUA 3B9AA 2WANA 2XSBA 1KBBA 4RE4A 1XSJA 4UR9A 4PMQA 5HPOA 1GONA 3AI0A 3WH7A 5HDRA 2J7HA 2WMIA 2QMKA 2WHJA 5JBDA 2DDXA 1SR0A 4IPNB 5D4YA 5CZKA 1JGIA 4XV0A 4UOZA 3CMJA 4D6FA 1OB0A 3VKKA 2IXUA 2VX6A 5CSUA 3II1A 1DEDA 3WNNA 4D6GA 4W5UA 4MJ2A 5CXPA 3FNDA 1MQQA 1OGGA 4W8BA 1OD8A 1KXVA 4HA3A 4AD2A 1B3YA 2EPLX 3BAIA 3KWXA 3MMDA 4WJXA 4URIA 4E2OA 3ARYA 3PZGA 4AZ5A 4J28A 2V3DA 3NSXA 5CLWA 1BYAA 4ML4A 1QI0A 5HNNA 3SCVA 1CBGA 2YL6A 5A6AA 8A3HA 4MB5A 3G6LA 3UG4A 3QR3A 2VRKA 3NSMA 3MSDA 1QW9A 4W88A 4ACYA 3UR8A 1UWTA 4C7DA 1G94A 3W82A 2WKGA 2XVNA 4QLKA 3D5HA 5DFAA 4Q7NA 5EBAA 3VOCA 1V6WA 4CD7A 4EK7A 1NARA 1H2JA 3A4AA 2D23A 1UWSA 1H0IA 3B8SA 4M56A 2AAAA 1UD4A 4FF5A 4OKDA 1ZBVA 3W29A 5A2BA 1EOMA 2HVMA 2XG9A 3OLDA 5FL0A 2ZICA 1I1XA 1GZJA 4PCTA 5BROA 2QV4A 1J0HA 3L4VA 1HL8A 3WUEA 1KGUA 2JALA 4FLQA 1E6XM 4GI8A 3WMCA 4ACZB 1CZ1A 5I79A 1KWKA 5BXSA 1H1NA 4AIEA 4PMOA 4JHOA 2ZXDA 2BY3A 2NW0A 1WCGA 2WHLA 1V3MA 3WDJA 1QBBA 2YKKA 1UQYA 3QHOA 4Z2LA 2BXYA 2W92A 1KBKA 1FP8A 3OLGA 4EE9A 1RPKA 1WZLA 2ZX7A 3VINA 4WKHA 3W53A 2J7EA 1SMAA 4GKLA 4JFWA 1CNVA 1FH9A 4OIFA 1B1YA 1UUQA 4QAWA 3W4RA 4PTXA 3CZKA 3ARXA 3UESA 3VD4A 4LQ1A 3L4ZA 5ABEA 1HT6A 1TZ7A 2JIEA 3MU7A 3KEHA 1W3LA 3GNPA 4QFUA 1V3JA 5IHRA 3VD5A 2CBJA 4D6HA 2GDUA 4C7GA 3N15A 3BC9A 5CSYA 4P7LA 1FH7A 3ARQA 4TXEA 4CU8A 1IV8A 1VEOA 3MV11 1XYFA 1MXDA 1W32A 2WMHA 4UTFA 5A69A 4AZIA 1E56A 3WDQA 2RGMA 5JBFA 3VTRA 1GOMA 3CIVA 5C71A 5A8NA 1CXFA 5A6BD 3GYCA 2DSZA 3TTYA 4M8UA 1WE5A 2E9MA 1QNPA 3ARWA 3MUY1 1E15A 1UH2A 1QNSA 3CZLA 3VNYA 2ZWYA 4KH2A 1OGBA 3PZMA 4HMDA 1E6SM 1W9UA 4Q22A 2JEPA 1BG4A 2WVVA 3GNOA 2XM2A 4MNMA 1J0ZA 3QHMA 3W38A 3SCUA 1JDAA 1K9DA 3CLWA 4CCDA 4AC1X 1W3HA 3VGBA 1HIZA 1UG6A 1KXHA 1V6VA 2BS9A 5AC4A 1MFVA 5ABHA 1TA3B 3ALFA 2YL9A 4H2CA 4OJYA 4LX4A 4J3XA 2A3EA 4NI3A 3VM5A 4NF7A 3U5UA 3T0DA 3SURA 1C8XA 5I23A 1B3VA 4PTWA 3MANA 2VO5A 3DHPA 2CERA 2XVGA 2V3FA 4B16A 3RDKA 5LA0A 1HL9A 1DWHM 4WF7A 1UKPA 2CHNA 3IJ7A 1RH9A 3SUSA 4QLLA 4B9ZA 4F9JA 1TFVA 2WVTA 3VDAA 3CUIA 3AHXA 4D6JA 1WDRA 3WKZA 3BXWA 4J3UA 2G8ZA 1PEZA 6TAAA 2CETA 1CTNA 1US3A 3WEZA 2YIHA 3LPOA 4ATWA 1MYRA 1BQCA 5AY7A 1C3FA 3WUGA 1B9ZA 3UR7A 3VVGA 2YJQA 2ZUVA 4GQRA 3VD9A 1VBRA 1JNDA 4ACZA 3AJ7A 4CU6A 1C92A 3VIOA 4PMXA 1VB9A 4S3JA 4W7VA 3WMSA 2CYGA 2GJPA 3U7VA 3AICA 4U31A 4CUCA 2VCBA 1PX8A 1R7OA 3SCQA 5CLTA 3ZOAA 3N18A 1AVAA 1G1YA 1WDPA 1UH4A 4HMEA 3GH7A 1I75A 4HU8A 2JE8A 4GXPA 1EH9A 1NOWA 3NDYA 2ZUSA 3CZEA 4FK9A 1VENA 1W9XA 4HZ7A 1LLOA 1KR1A 4AZ6A 4TVCA 4D6IA 5EFFA 2OYMA 5CPSA 4JCLA 3S2CA 2O9RA 3UG3A 1E4NA 3N11A 3TTOA 4AD4A 3VDHA 4OUEA 5HPCA 1IZJA 2G3MA 4MDPA 1KXQA 4DM1A 3N13A 1JFXA 4AZCB 1JI2A 1DWIM 3GH4A 4R5EA 3WQ5A 5GNXA 4HU0A 1VFOA 4D6EA 3WL0A 5BYWA 1WZMA 1J12A 4PMZA 3ZSTA 1TUXA 3L4YA 3CHDA 4PMDA 1NOUA 1HJWA 2A3AA 3L4XA 1WKYA 1TG7A 3SCPA 4AIOA 1EXPA 1WDSA 4MNLA 1JF6A 1PBGA 2XVLA 1JNEA 1GVIA 1UR0A 1C7SA 3L4TA 2E8ZA 3EBVA 4U2YA 1G01A 3M07A 1QHPA 2PWGA 1QI4A 2WLZA 4GZEA 5TD4A 1UQZA 3VU2A 3WUFA 1CGWA 4FLRA 1KB3A 4TOQA 3RPMA 3WBAA 1SFSA 2CNCA 2O9PA 2XVKA 4W84A 2WB5A 3OGVA 4JFVA 3A4WA 4GI9A 2PWEA 1J11A 2FHFA 1BG9A 1XD1A 2CITA 5KZ6A 3DYPA 3M6DA 2UY4A 3E1F1 3VIGA 3WEMA 2CBIA 3L4UA 3TOPA 5DT5A 5IDIA 1VAHA 2J78A 1NWSA 1UKQA 2FH8A 3W28A 1V3LA 3N9KA 3CUGA 1XRVA 2BY1A 2YLLA 3RILA 2WSKA 3L2MA 1V0LA 4MB3A 4WSJA 3OGSA 4B15A 3K8LA 2WHKA 1TCMA 1C91A 3WQ6A 2WSPA 3RIKA 4TTGA 4UQ9A 3F4VA 3OIHA 5BRQA 2G4FA 1KQZA 3PZVA 5BXPA 2VJXA 3BLKA 2PWFA 5GPRA 1W9DM 3WD3A 2C7FA 3A47A 3WQWA 1C93A 1E6NA 4GPNA 1PJ9A 2BXZA 3WIJA 3AISA 4MADA 3WDHA 2W66A 4YN5A 1ZL1A 3RMEA 3UCQA 1W1YA 4M29A 1CGUA 1PPIA 3F5JA 4F8XA 3EYPA 1UKSA 2O9TA 1VF8A 4PMNA 2Z1SA 1OCQA 1FP9A 3N17A 1LF1A 2UY3A 3PTKA 1BAGA 2VZSA 3FHAA 5D8ZA 2E0PA 1WAWA 4H8HA 1JAEA 1PIGA 2V3GA 2VCCA 4ZFMA 4AYSA 1ODUA 3TTQA 1GOOA 1J18A 2CESA 4AZCA 2WW5A 4WIWA 3W26A 1NM9A 2E4TA 3GXFA 5DF0A 2CBVA 1GVYA 3VX0A 1OD0A 5EMYA 4AISA 1LWHA 5CPQA 5A95A 2G3NA 3FAXA 2V5DA 1UR2A 3A6OA 4U5KA 1ZB5A 1E6PA 2ZXAA 4P8VA 4PRWA 2GK1B 3WF2A 3W24A 3K4AA 5E0FA 3T09A 4E4PA 5A6JA 2QPSA 5FIPA 1BHGA 3BAXA 3MSGA 1JXJA 4N42A 4UQCA 4X0NA 2XM1A 1JZ4A 3AIEA 2UY5A 2ZUUA 2XGIA 5CPTA 2OSWA 4AEFA 4FMVA 3OZPA 2QF8A 4XZWA 2EO7A 1EQCA 2VX7A 1HX0A 1M04A 2FGLA 3HJEA 4H41A 2PI6A 4PCSA 3IANA 3FAWA 1QI5A 2VRJA 4CN4A 1FH8A 3EMZA 1B3XA 3CPUA 1SYTA 5DEZA 1AMYA 3AZTA 4IPLA 4QDMA 3POCA 4W5ZA 1ZU8A 2RGLA 3UG5A 1KQYA 3AIWA 2W5FA 3SUTA 3THCA 1JZ7A 4EANA 3WD2A 3BAKA 1HVXA 3VUPA 3SUUA 4PYSA 3WBEA 2A3CA 3I3DA 3WNLA 3BSHA 3OZOA 1QOXA 1ZBCA 1V6YA 2DSVA 3AXIA 1HXJA 2BVYA 2EEXA 3EDKA 5HBFA 3BCDA 2Y5EA 1UR1A 4CD4A 2CHOA 4HA4A 4B3KA 1CLXA 1CIUA 4H8UA 1O7AA 4Z2HA 4U2ZA 1XGZA 3WF1A 3VMPA 1BSIA 4HZ6A 2WMFA 3IAQA 5E09A 3WMBA 1TR1A 2EQDA 2NSXA 1W1TA 4HOZA 2OYKA 4AMCA 1ISXA 7CGTA 3D3AA 3ZIZA 4HPGA 2EPKX 4PEEA 2IUZA 5D9NA 2WLYA 1E71M 1IZKA 3GBEA 5A8QA 1V03A 3PZTA 3AS1A 4ZE4A 2A3BA 1GORA 1GQJA 4BZYA 4CN1A 3F5LA 1QW8A 2WZHA 2J7GA 4X9YA 3LPGA 1H0GA 1IT0A 1V0MA 3WEOA 3BGAA 3WUBA 2J74A 1XHGA 5AYIA 5M03A 2J8GA 2FH6A 1XCXA 4MJ4A 3NCOA 2E9LA 3ZMRA 2DT1A 3CBWA 3A4XA 2XWEA 3VDCA 2ZXBA 2ESCA 3OG2A 1CGTA 3A3HA 5HOSA 4MB1A 3K8MA 4GO8A 3W0KA 4C91A 4W7WA 1BTCA 1K6AA 2D22A 3SIMA 2E3ZA 5I77A 3DECA 2OYLA 3VIFA 2JF7A 3MKKA 1CXHA 3BAYA 1UKOA 1HF6A 2BNJA 4EAMA 1E3ZA 4P7OA 1JDDA 1NWRA 3MMUA 1WB0A 1WZAA 1C7TA 3FW6A 5I78A 5A94A 2WZIA 1HN1A 5GQBA 3W6MA 3WY1A 2OLHA 1MFUA 4PUEA 1HKJA 2F2HA 3LMYA 2W4XA 4B9YA 3NJ3A 3ZM8A 1Q6CA 2ZXQA 3ALGA 2WVVB 2PC8A 1BLIA 1MW0A 3MS8A 4QLJA 2D20A 4W8AA 2XVPA 2CKSA 5D9PA 2CIPA 3VIPA 1X6LA 1BGAA 1UD5A 2DGAA 2WK2A 3ARVA 3ZT6A 3N04A 3CHCA 4H04A 3WD0A 2J62A 4KMQA 2CKRA 2GJXB 1ISWA 1KXTA 4PMUA 2XHYA 3AYSA 2F61A 4YHGA 4YPJA 1EDQA 3ZR5A 7A3HA 3WN6A 3T0AA 4D6CA 1OT1A 3VIJA 1W9BM 2BVTA 5IXEA 3AHZA 1B2YA 2J8FA 2VVNA 3PZUA 4JIEA 1G0CA 4NRSA 4W7UA 3EMQA 3PZOA 1M53A 1TMQA 2W63A 3T2QA 5BXRA 3AIQA 5D9OA 4MAVA 2YL5A 2VZTA 3AIRA 5I5RA 1DWAM 3ARRA 3DYMA 2JFEX 2NT0A 5I3DA 2D0FA 1UD8A 3SCTA 2DEPA 1E6RA 2EPNA 3WH6A 3AYRA 2WVSA 1UR4A 3WNPA 1XD0A 2X2YA 4DWSC 1HP5A 3QOMA 3GXIA 1ZJAA 3VO0A 4MPKA 2VTFA 3AHTA 3W25A 1EO7A 2DPEA 1E73M 4CKQA 4W93A 2VZOA 5CGMA 1UWRA 3FHQA 3VD7A 1ISZA 3PZQA 3WENA 2J7CA 1F4HA 3B9DA 4UFMA 3POHA 4F66A 3I3BA 3BH4A 4BQ2A 2JF6A 5LA1A 3UERA 2E40A 3WDRA 4GO9A 4CVWA 2BV9A 1BVZA 1Y7VA 1F4AA 1DWFM 2DIEA 2XGBA 4JHZA 5GNYA 2J4GA 3MV01 4PSRA 3CO4A 4QCEA 2WCGA 3WH5A 1GNXA 1PX3A 2CPUA 3KE0A 1NP0A 2DQXA 4AZGA 2DSKA 1DTUA 3AMLA 1QPKA 3GH5A 3K46A 3OLEA 3U7BA 3T2OA 4QP0A 1E70M 4WLCA 5I2UA 3ZJ6A 1D2KA 1L0PA 1UWUA 2O9OA 4XUYA 4MTVA 1E72M 1X1NA 4GI6A 2ZX5A 1JD9A 1J0YA 4AZ7A 4BCEA 4L4OA 1W1PA 2XIIA 2X8RA 4UQEA 2VX4A 1CXLA 1QI2A 3VD3A 4RE3A 1CLVA 2WCSA 3WQ8A 4FLOA 2EXOA 4NSBA 4D1JA 2WZEA 3WDPP 3B9EA 1KCLA 1JF5A 4AZBA 4Z2KA 3ZO9A 4TX6A 3OGRA 5F7UA 2J79A 3AS0A 2YLAA 1XV8A 2CBUA 3W81A 2VOTA 3AMKA 5C8BB 1JIBA 4LYRA 1LL4A 1EQPA 4QCFA 5BWFA 2BHUA 1TA3A 4BA0A 3ZT7A 2GUYA 5A3HA 3IAPA 2WKLA 1EHAA 2WBGA 5HXMA 3CZGA 4LYQA 5ABGA 4TVDA 2VT0A 1LJYA 5A8PA 1V02E 4PMVA 3RCNA 5E0CA 5ABFA 4Y7EA 3T08A 1OINA 1ESWA 1CEOA 3IJ9A 3VGEA 2YOCA 3IJ8A 4IISA 1UZ1A 2DSWA 2F8QA 1UD6A 4DUWA 1OBAA 1AQHA 3SCNA 4OZOA 2VCAA 3S6TA 3GNRA 2WMIB 3GBDA 2NT1A 1CDGA 3VPLA 2PBOA 1UD3A 5ABFB 1ZJBA 2WC4A 2ZUNA 2GVYA 4KWUA 2C8NA 3WELA 2W91A 2AOSA 3N12A 1M01A 1NOFA 1FFRA 1Q6GA 1HJVA 1UHVA 1VJSA 4GZJA 3QOKA 4W85A 4JFUA 2ZWZA 1V3HA 4KRTA 4OOUA 1J01A 1JXKA 4BQ5A 5C70A 4U5IA 2ZX6A 1EDGA 3NSNA 1E3XA 1B3ZA 3PHAA 4GZIA 1W1VA 3VGGA 1MWOA 4MAZA 2X09A 4N0RA 4JCMA 2D1ZA 3G6MA 1BYCA 3GM8A 3EDEA 4J3SA 2JEQA 1A3HA 1Z32X 3EDJA 1MQPA 3BMVA 1GQIA 2WCAA 2E9BA 2V5CA 4AWEA 2V3EA 3AQUA 2D24A 1EOKA 1KGXA 2XSAA 3BAJA 3VIHA 4PTMA 1KGWA 2YA1A 1W2VA 4BQ4A 5JUVA 2CXGA 2JIWA 3VMNA 3WD4A 2UY2A 5LYRA 1US2A 1QNRA 4MDOA 3ZQ9A 1XYZA 3NYDA 2WMJA 1UYQA 1NWTA 4JFSA 2XTKA 4CCCA 4UFLA 2DH3A 5M5DA 4TX8A 5A6BA 1DHKA 4M82A 2XWDA 3VM7A 4P8XA 1B3WA 1YQ2A 1O6IA 3U5YA 1Q6FA 4AEEA 5A6SA 2YDSA 1ZBKA 1SMDA 1U30A 3VGHA 1FFQA 1UWIA 1E43A 3K4DA 3O2LA 3VILA 2A3HA 1QHZA 1BGGA 9CGTA 2WC7A 4PMRA 3LPPA 2WNWA 4L4PA 5A8MA 4UOQA 1GOQA 2ZIDA 3CZ8A 5D9MA 4U3CA 1WO2A 2G41A 3AFBA 1UA7A 5FD0A 2YDQA 2OWCA 4BS0A 1GQLA 4JZ5A 4UFHA 4P7NA 5A6LA 1JL8A 5E70A 2VI0A 4DUXA 2ZE0A 3NDZA 4TVUA 1B0IA 4MNJA 5DMYA 2WAGA 5JBEA 1EIBA 4WSKA 4ZXLA 1JZ2A 2ZUTA 1GCYA 4CU7A 3ZR6A 3NIYA 2GJRA 4A3HA 5E6YA 3MO4A 3ARPA 1CPUA 1H41A 4AD1A 3AMCA 4W89A 4P7QA 4TTUA 3AOFA 1JD7A 2Q8XA 1VJZA 4UFIA 2XFRA 3KL3A 2VMFA 4E8CA 1W3JA 2EPMX 5I6SA 3KL5A 1PX4A 4WK9A 4V2XA 2ZX9A 4B3LA 4CVUA 4MB4A 1B30A 4C90A 1EO5A 4GQQA 1U2YA 2VZUA 4W87A 1GOIA 4UZUA 2PF0A 5AC5A 2C0HA 1E0XA 3DYOA 1V6XA 2GK1A 3K1DA 1OIFA 3F5KA 4LXFA 3AROA 2YA2A 3PN8A 4HOXA 4CD6A 1JFHA 4AY1A 2Y8KA 2OWXA 2WYSA 2WC3A 4DWSD 1E9LA 1W91A 2OWWA 1R8LA 3WF4A 2VR4A 2J75A 5EFDA 1DWJM 3ARSA 1MW1A 2QHAA 1E4LA 2VQUA 1H09A 4W86A 1E5NA 4PTVA 2X0HA 1R7AA 1KWGA 2BY0A 1J0KA 1HKKA 2EPOA 7TAAA 4CCEA 1OIMA 4Z2GA 1UOKA 1AQ0A 2QPUA 3L2LA 1XH2A 3AIUA 3SCOA 4Z2IA 4UFJA 2VVSA 2VNCA 3WF0A 3MMWA 3PZ9A 2WXDM 5CGTA 2D0GA 2GFTA 4DWSA 4IUGA 5EB8A 3RO8A 5FOOA 1XH0A 1EA9C 3SCRA 1YHTA 3WSUA 1V3IA 1UZ4A 2DT3A 3VDBA 3VNZA 1GOKA 4KGJA 1KFWA 1JYNA 2EBNA 2WMGA 3VIKA 3O6AA 1DP0A 3FN9A 2VX5A 1KR0A 2GDVA 4BF7A 1MVYA 1VFUA 3WFLA 5BCAA 1U33A 4P7RA 1CXEA 3KZSA 1S46A 2EJ1A 3WH8A 5M3WA 3THDA 3VX1A 1GW1A 1VIWA 1JZ3A 1TE1A 1PZ3A 1OGSA 4W8LA 1FHDA 1HVQA 3CZJA 3EMCA 3J7HA 3GZAA 6CGTA 3OA5A 1KCKA 1CWYA 1JG9A 1OWQA 1XSIA 4Z2JA 2PBGA 2CEQA 2ZUWA 1W2PA 3ZT5A 1HJUA 1E5JA 3CHEA 2Z1KA 4RL3A 4UQBA 1CXIA 1H5VA 5AYBA 1CXKA 4F9DA 4TUFA 1XH1A 3SEPA 4UNIA 5E9AA 4GINA 2XYLA 4NRRA 3GXMA 3WH9A 3PTQA 3BMWA 4J3TA 4J3VA 2DT2A 3TP4A 2VUYA 4HZ8A 1GQKA 4AIUA 2X05A 2TAAA 4V27A 1G9HA 2ZOXA 3DC0A 1BF2A 3WFZA 4AXNA 1NP2A 2FDMA 5FKYA 2PWHA 5I24A 1C8YA 3MUAA 1GUVA 2FGZA 1HP4A 3VIIA 2DIJA 3TONA 1L8NA 4U33A 3MUIA 1WP6A 4FLSA 1K9EA 3SUWA 4KGLA 2W61A 1I1WA 1UKTA 4CGTA 3OBAA 4R27A 3LPFA 4OBSA 3I3EA 4LGXA 1H3GA 1MXGA 2Y24A 1WPCA 4JL2A 1QNOA 2B31A 3SCWA 4UFKA 3K8KA 1E0VA 3FXYA 4WKFA 1NQ6A 4XX6A 4M24A 4PBGA 2AMGA 1QHOA 3CGTA 3ARZA 1QNQA 5KEZA 1E1EA 1RD6A 2VRQA 1ITXA 2E8YA 1VBUA 2FHCA 3BCFA 3VIMA 5A2AA 1K9TA 4UZSA 2D2OA 1D3CA 1HJXA 3AXHA 5CQ1A 1VRXA 3GTNA 4PUDA 3WF3A 2XJ7A 4HTYA 2CCRA 1BYBA 1E40A 1Q6EA 1CGVA 2IXVA 4V28A 1HJSA 1GHSA 1E6ZA 1MQRA 5A6KA 2D3LA 2VZVA 3U57A 3ECQA 1E0WA 1N82A 4ZE5A 4H8VA 4ZENA 5FL1A 1UA3A 5M17A 1M7XA 2DH2A 1CECA 4D71A 4X0VA 4JAWA 4EKJA 1FA2A 1XC6A 2V38A 3O9NA 1QVBA 1LL6A 1V02A 2J7BA 3HMCA 1JZ8A 1V0KA 4MNKA 3CHFA 3CMGA 1R87A 2VR5A 4ATDA 1ISYA 1MW2A 3L4WA 3AMDA 4M1RA 1XSKA 3WNMA 2WHMA 4C7FA 4NZCA 4E8DA 3WNKA 5I0DA 2WBKA 3RM4A 2W62A 3BAWA 3SUVA 4HOWA 1QBAA 2YDRA 3ZJKA 1PAMA 5IFPA 3CUFA 2VQTA 3SCSA 2DT0A 1UR8A 4OBRA 3M46A 4AZHA 3OLIA 2X0YA 1ISVA 2Y8VA 2J47A 2X1IA 4JKMA 1ITCA 5GNZA 4XZBA 3QGVA 1PZ2A 2WWCA 3CH9A 4IM4A 4RE2A 1QI3A 1EGZA 5JIWA 1VFFA 2ZX8A 3AMGA 2XIBA 1X6NA 4AW7A 2YBUA 5A6MA 4HP5A 3WL1A 4K68A 5LA2A 2WMKA 2Y4SA 4UQDA 4M81A 2VL4A 1FOBA 1R85A 3ZSSA 5A2CA 4DUVA 5FCZA 4AD5A 1CGYA 2J25A 3ZJ8A 2BVDA 1HJQA 3AZRA 3AIVA 3W27A 2G3JA 1J9YA 4AD0A 3W37A 1GJUA 4UQAA 3RM8A 5BXTA 4ZEPA 1JZ5A 2PWDA 5BRPA 5DO8A 1PIFA 1OM0A 1OSEA 1ZS2A 3IK2A 3RM9A 1HNYA 2XUCA 2HISA 2FHBA 3DHUA 3OB8A 1ODZA 2DSUA 2MANA 3HN3A 1CENA 4GIAA 4A4AA 3RJXA 3WD1A 3M7SA 3ZJ7A 4UCFA 2ZUMA 2XPKA 3EDDA 1Q6DA 1H49A 1BVNP 1GHRA 4OOZA 3CUHA 3PZNA 4XB3A 1ECEA 1K9FA 2OSYA 3CUJA 1BYDA 4PSPA 3NUKA 4LYPA 1W9VA 1VFMA 4J7RA 1WZKA 4CN6A 3AHYA 3AIBA 3HU7A 4HPHA 3KL0A 1JZ6A 1CGXA 4U3AA 2BFGA 4ZXOA 2J7DA 4J3WA 3AS2A 4AD3A 3BSGA 1V6UA 1MW3A 5DT7A 1LG1A 5CG0A 4PMYA 1UD2A 1JDCA 1J0IA 1H11A 1JYVA 1E1FA 4JFTA 8CGTA 1VEMA 3T2PA 1E6QM 4S3KA 2D3NA 2WPGA 1R86A 1C90A 2QMJA 2O92A 1B31A 5ECUA 1RP8A 1UH3A 1CYGA 4UOJA 1J0JA 2PB1A 3GXDA 5CJ5A 3UEQA 1GPFA 2WM0A 1TVNA 1M03A 4DWSB 3APGA 1RP9A 2OSXA 2VURA 2Y2WA 1V0NA 4D1IA 5E6ZA 4HA1A 3WQVA 1GOWA 2YA0A 2XFFA 3GDBA 5A1AA 4DM2A 1LG2A 3CTTA 3FY1A 2BHZA 1EDTA 2XFYA 1AQMA 1WNOA 4CD8A 1Q4NX 4P8WA 3TTSA 1OT2A 4CD5A 1A47A 1NWUA 5A8OA 4HMCA 1H4PA 3VGFA 3EDFA 3PZIA 4D72A 3QHNA 2D0HA 1J10A 1WDQA 5IHSA 4D6DA 2G3IA 4LPCA 1P6WA 1HKMA 3WQ4A 4J27A 1UR9A 2BHYA 4F79A 3RJYA 1C8QA 1VEPA 1UWQA 1JYXA 2UWFA 1B90A 5IFTA 3PBGA 3PTMA 3ARTA 2W67A 3AZSA 2J77A 3AXXA
chains in the Genus database with same CATH superfamily
1ZBWA 5EL1A 1HKIA 5K4XA 2Q01A 1EHNA 3TCEA 3MBDA 4ZOEA 2R1LA 5TAOA 3T0BA 1EJWC 4GXWA 1Y5XA 4FX7A 1TTIA 3BPWA 4K39A 3VOGA 1JPHA 1K4HA 2GGJA 1JI1A 5D8WA 1YDNA 3BG3A 3N25A 4H4IA 4BKNA 2VGBA 3V18A 1W3KA 3TYEA 3NO5A 1W9PA 3MKCA 4KRUA 4XVEA 5AB3A 1XX1A 3EWDA 1E4MM 3O0KA 3KS6A 1O12A 3UETA 3WNOA 2VWSA 3AHVA 3W23A 5CZSA 2YL8A 3OODA 4WKAA 5LNRA 3OJGA 1V08A 4DX3A 2GSJA 2PCQA 3W84A 1WYIA 2HPMA 4PZVA 2BOGX 1MSSA 1TV7A 2XSBA 4UR9A 5E9XA 1SZNA 4KFPA 2NUYA 3WH7A 5HDRA 5LIWX 7ENLA 3PWAA 4IPNB 4H00A 4EACA 2YXOA 5LSMA 1JGIA 4XV0A 4UOZA 4GY0A 1OB0A 1JEZA 1FWTA 5I06A 4C1NB 2IXUA 2DZPA 5CSUA 1CI1A 2ZADA 4DLFA 4UTWA 4YJ5A 8RUCA 4NZ4A 1XIGA 4W5UA 3FNDA 3B97A 4W8BA 1XKYA 1KXVA 4MZ1A 1M41A 1IEQA 1UW9A 2Y5SA 3BAIA 4F0RA 3P8JA 4URIA 2PGEA 1XBZA 4B2DD 5KITA 5CH9A 2JBMA 1YBQB 1F73A 2GZXA 4J28A 1FWCC 3EZ4A 3TYBA 3B8WA 2OKOA 1CBGA 2YL6A 2BZNA 4NUWA 2QCNA 8A3HA 1OX4A 3G6LA 5CC3A 3G0SA 3QR3A 3U2OA 1XG4A 5LZLA 3KFTA 3UQNA 3MSDA 1TE6A 2DZXA 4GUIA 3LHYA 4J4KA 2Z00A 2HNEA 1Q7QA 2DZUA 2UBPC 4AF0B 3UWEA 4QHRA 3UF9A 4A3RA 4EAYA 4EK7A 3FDGA 1ICPA 4P02B 3LHWA 1H2JA 2I7GA 2NX1A 3A4AA 3S6OA 2AL1A 1UWSA 4UMCA 2AAAA 1UD4A 5A2BA 3C2YA 4DXKA 2VFDA 1RY8A 3OLDA 3QTPA 1I1XA 2X2GA 1GZJA 5BROA 4MIMA 4GJIA 3NVTA 3L4VA 3WUEA 4GI8A 3HZ3A 3OQ8A 1KWKA 2GUBA 5BXSA 3UPMA 5F2LA 4B5UA 4AIEA 4JHOA 4IIGA 2NW0A 4Q8TA 1EUNA 2WHLA 1WUEA 1A53A 1QBBA 1UQYA 4Z2LA 4YIWA 4LAKA 2W92A 3G0UA 4L1GA 3S0CA 3E0IA 4YYCA 4AWUA 4PRRA 1SM9A 3N2TA 1JCTA 1SMAA 3W4RA 5A8GA 3UESA 2PU1A 3B4UA 3KRSA 1HT6A 3UZXA 2JIEA 1W3LA 4YYFA 1HKVA 4DJDA 2GDUA 4FSAA 4I90A 4R85A 3MP4A 1EYWA 2NQZA 3GHRA 2A7NA 5D04C 2XN2A 3N2MA 3URAA 3MV11 1XYFA 3CIWA 2J88A 1MXDA 1F07A 2BOEX 4L9XA 3WDQA 3U6WA 3UGVA 4TMCA 3DFQA 1DORA 3EOSA 3LCGA 5AC6A 4Y96A 5SWUA 3P5YA 4Y9AA 1KV8A 3TNBA 1RK6A 3OEXA 2G50A 1QNPA 4DF1A 5C9ZA 1E15A 3KP0A 2NUWA 4O1AA 1JDEA 4Q33A 4HMDA 2O55A 1E6SM 3TYDA 3L7RA 2WZTA 3LCXA 1BG4A 1U5HA 3OZYA 1DKWA 3ZVHA 1G7UA 4JTLA 3W38A 2R6OA 1JDAA 3VGBA 1V6VA 1KXHA 2BS9A 4Q4MA 3STFA 5H8UA 5ABHA 1TA3B 3TLQA 2DZAA 1S2CA 1XLJA 2A3LA 4H2CA 3B40A 1ZZMA 4J3XA 1VP5A 3LYEA 1BRLA 4L61A 1FWDC 3SURA 2FFIA 3MUXA 5I23A 2ZDRA 5AC7A 3W86A 3VOJA 2XVGA 4MMWA 4B16A 5I07A 4C6QA 2LLEA 4S38A 1HL9A 3ABOA 4QSHA 3VKAA 4WF7A 3S3GA 1VH7A 2CHNA 4Q3MA 1XLCA 3IJ7A 4D9PA 3VDAA 3GYEA 3IWPA 1U5VA 3H2AA 4WQ6A 1MXSA 1R3QA 3WKZA 3BXWA 4J5NA 4J3UA 1O94A 5IM51 1A5KC 5FF2A 4H83A 4Q4RA 1IE7C 5AN7A 1XIHA 4PR4A 2QULA 3KRZA 5HWMA 5B80A 1QOQA 4GQRA 1VBRA 3RO6A 3AO0A 4NYUA 1HW6A 2DU2A 4EXBA 1XPGA 1C92A 1KRBC 3K13A 1VB9A 3MYOA 1TQXA 4S3JA 5G1TA 2GJPA 3FSTA 2VCBA 1PX8A 1PTAA 3N18A 3L66A 1AVAA 1G1YA 5FI8A 2I14A 4HMEA 4O8AA 4DF0A 1NOWA 1KLYA 2ZUSA 3EWYA 1VENA 3GKAA 3L23A 1W5NA 1LLOA 4AZ6A 3BJTA 4EWJA 5CPSA 4LUSA 3UG3A 1KKOA 4Z1DA 3TTOA 1A5UA 3HG2A 3L68A 4ASTA 1C8VA 1KXQA 4A3UA 3BGJA 4R5EA 3MT1A 1VS1A 5GVJA 3T9PA 1TWIA 3ANUA 4QNEA 1T8QA 3WL0A 5BYWA 1WZMA 1J12A 2HE5A 5C2XA 3ZSTA 1QW7A 5EMJA 3L4YA 3CHDA 4PMDA 1UJQA 1HJWA 3L4XA 3W7MA 2EGZA 1TG7A 3QMTA 3G1DA 1X39A 1GVIA 3L65A 4KWWA 1UR0A 5MF5A 4GE8A 1G01A 4JTJA 3M07A 4PH6A 3R1ZA 1QHPA 3V3WA 2PWGA 1QI4A 4J40A 1P1XA 4AX7A 2WLZA 2EG8A 5TD4A 4XVDA 3VU2A 3WUFA 3WJXA 1KB3A 3IV8A 3W2NA 2FMNA 1TWDA 3KOYA 1H51A 2HROA 4GI9A 3EA2A 4O1CA 4B5VA 4JTQA 4XZNX 3DYPA 4L6OA 3E1F1 3VIGA 3TOPA 5IDIA 1S1RA 1NWSA 3HQNA 1XLIA 1UKQA 2FH8A 3W28A 4K1GA 3E2SA 4QG6A 4IP7A 3CUGA 4GJ1A 3O6YX 1SO4A 1XRVA 4C6PA 2ACRA 3CC1A 3BW3A 4JPGA 1E51A 3BQ5A 4TTGA 5G4HC 1DE5A 3F4VA 3D0CA 1KQZA 3PZVA 5BXPA 8XIMA 1Z9AA 4Y90A 2C7FA 4ADTA 1C93A 3WIJA 3AISA 2GVEA 4HYRA 2YW4A 3RMEA 5AHLA 5XIMA 3BURA 2JGQA 3WQFA 3BZJA 3L5AA 1W56A 4GACA 1UKSA 4AUBA 1CCWB 1VF8A 2VKZG 4TQTA 1ONRA 4FXRA 1U1JA 1IXOA 2FTPA 1W1IE 3QFEA 4IIHA 5EJZB 4NVTA 3VNIA 3ABSA 3UR5A 3DG3A 2VGIA 1ONEA 4FP1A 1OEPA 1KCXA 2VCCA 1XW8A 3ZWTA 2PTZA 4GUGA 3IPWA 2HVNA 3VZYA 4YTTA 3ELFA 5C7HA 1QAPA 3GXFA 3PR2A 3VNDA 4WOZA 3VX0A 4LS0A 2FDSA 1LWHA 3RLHA 2DV0A 1N8FA 4DBDA 4Q7BA 1GVEA 5ENLA 3NTYA 1NVMA 1C29A 3ORWA 3W24A 1W3IA 4ZQMA 4LH8A 2QPSA 1BHGA 3OZMA 1S2AA 1DVJA 5HNUA 1JZ4A 3NM3A 3QQWA 2I9EA 4QNWA 2W3ZA 5CPTA 4FMVA 4Q8NA 5HANA 2QGYA 1DTNA 4XZWA 1QUMA 2EO7A 3NZPA 3HJEA 4H41A 2PI6A 5DN1A 2JKPA 4HNNA 3FAWA 1QI5A 5AYYA 2C1IA 2VENA 3EMZA 4MY1A 1DJIA 1J93A 3B0YA 2AKMA 4NU7A 1K70A 3TQPA 1FWSA 1POKA 3UWYA 4EANA 4O52A 2X1TA 3WD2A 1PZ1A 1RQBA 1G4PA 1TR9A 3BSHA 3OZOA 1QOXA 1LUCB 2DSVA 3AXIA 1L6YA 3TJ4A 2EEXA 2Z26A 3EDKA 3PBVA 4CD4A 1QXLA 3GTHA 4HA4A 5BMWA 4O0ZA 1WXJA 3VMPA 1TR1A 2EQDA 2VDHA 1V7YA 2Z28A 2C1GA 4AVOA 4CNSA 1EJSC 4AMCA 1ISXA 5K9XA 3ZIZA 4HPGA 1XBXA 2EPKX 4O18A 3OHMB 2NXGA 1LP6A 3BMXA 1IZKA 3BANA 5A8QA 3AS1A 4E4UA 4ZE4A 1GQJA 4BZYA 4CN1A 3AALA 1QW8A 1H0GA 1IT0A 5CSSA 1QOPA 2ZZ7A 3WEOA 3BGAA 4ZR8A 4CLMA 1PS9A 5M03A 1VBGA 3M5VA 1YPIA 4G1KA 5LGXA 4MJ4A 3SJ3A 2E9LA 4AVFA 1WOBA 3R4IA 2FMOA 3A4XA 3VDCA 2FTWA 1F2JA 2PU0A 3A3HA 2QCFA 4MB1A 3GAYA 4W7WA 1I0BA 1KFBA 1KTCA 2RDUA 3BAYA 2BNJA 3EWCA 1JDDA 3CAWA 3P81A 2R1MA 3G1VA 4KCWA 3FW6A 5I78A 5A94A 1JPDX 3DFTA 5GQBA 2E5BA 3W6MA 2Y88A 3LMYA 1CT5A 2J8TA 4B9YA 4OU1A 1YKWA 3CB3A 4BI7A 3DUGA 4UNKA 2XINA 4Z1BA 1W8SA 3MS8A 4QLJA 4WGHA 2C14A 1X6LA 4DVOA 1DBTA 2ONEA 5I09A 3UVAA 3ZT6A 3RPTA 2PA6A 2GJXB 1IEXA 1ISWA 1WUFA 1MDLA 3LS9A 4PMUA 1WBJA 5D32A 4ERAA 1N55A 4IL2A 1EDQA 3A24A 3VXGA 4D6CA 5BWAA 1O68A 3RN6A 1I0DA 3UXAA 1M1BA 2OEJA 4AXKA 4MLJA 2CZFA 4JIEA 2XH2A 2R8WA 3W1QA 2FYMA 5FF4A 3OPSA 1ME7A 2C71A 4ERIA 1RD5A 3AIQA 4WZHA 5D9OA 4PUWA 1IXNA 3AIRA 3WBWA 1EC7A 4HGXA 3ARRA 3GDLA 3DYMA 2NV9A 1P0DA 1EYEA 3SN1A 1UD8A 3SCTA 4TMBA 4DN1A 3QSTA 3AYRA 1K77A 2X2YA 4DWSC 1UROA 4UTTA 3GXIA 4EF8A 2VTFA 4TV5A 3VUSA 4AEOA 4KEVA 3KWSA 1F3TA 2NZLA 3VD7A 3IJ6A 4LT9A 1TTPA 3GAKA 2J7CA 1F4HA 3POHA 4M0XA 3SM0A 2BV9A 4NNBA 1BVZA 1H5YA 4ONVA 1BF6A 4Y2WA 3KVJA 2QVNA 1I2QA 4PL1A 5IDZA 2WCGA 1VYSX 1BSLA 2HZGA 1ADSA 4O4WA 1JCNA 2JGYA 5D2VA 4AZGA 1FWBC 1RJQA 4RXGA 1QPKA 4QJ3B 3GH5A 4JQ3A 3LSCA 3H6OA 4WLCA 1TZ9A 3ZJ6A 1IWPA 3QV9A 1E72M 2OVLA 1DJZA 4AZ7A 4OT7A 3IVSA 3URBA 4QR6A 3BWWA 5BW6A 3AWNA 4RE3A 1CLVA 2WCSA 1P7TB 1F05A 2EXOA 4L7ZA 1AFSA 1KD0A 1P4CA 1W5PA 3WDPP 4Q8PA 4IMCA 3S1XA 4HNTA 3L0NA 1A5LC 4IG2A 4K37A 4TX6A 3C4UA 1TRIA 4ZQOA 3SBFA 3UJEA 3AMKA 3QN3A 5BWFA 3LLXA 1TA3A 2OEMA 3BUVA 4LYKA 3CM4A 3PUEA 3SO7A 3CZGA 2DZBA 3GZ3A 2VM8A 4CQBA 5ABFA 2JQXA 3T08A 1ESWA 2E1WA 4YCOA 3DGRA 3IJDA 4PCFA 4IISA 5C54A 2EG7A 3LMZA 5C55A 1ME8A 1AQHA 2VCAA 3GNRA 2WMIB 1T8XA 2NT1A 1LRTA 5I3GA 3VPLA 1OHLA 3EEZA 3G0XA 2R94A 3NURA 1UD3A 4XZ9A 5ABFB 4ZL1A 2ZUNA 4ZFCA 2QJHA 1ICSA 2CW6A 1WXZA 2PPGA 5AKQA 3N73A 4H2HA 3FJLA 4N9EA 4H01A 1V3HA 4OOUA 4IHCA 1KA9F 3VA8A 3Q67A 3DI1A 4U5IA 2DJLA 3PHAA 1T0OA 3V1HA 4X2PA 4Y9PA 2PDUA 2XU2A 3M47A 3W85A 5JXQA 4JCMA 3FVDA 4J3SA 1U1HA 1PSCA 2WJEA 5BU6A 1EEPA 5K3VA 2V5CA 4DZHA 4M7TA 3KHJA 2HTMA 2XIQA 2A6LA 4JD4A 5CJNA 5F2GA 3VIHA 4PTMA 2Y7FA 1W2VA 1XIMA 4XKYA 4HVXA 3OVRA 4OECA 1OK6A 3GHSA 3WMLA 3NYDA 4ROPA 1K8YA 4JFSA 2XTKA 4O16A 1EPXA 4YLWA 4UFLA 2BG5A 4YTSA 2HV5A 4TX8A 1DHKA 1N7KA 2FJUB 1W0MA 1YQ2A 3H4WA 4K3ZA 4RNIA 3QQ1A 1ZBKA 4JBRA 4TR9A 1PKMA 3I7SA 3ITCA 1KFKA 1SO6A 3SW6A 1BGGA 3UT0A 3AUJA 5TBOA 2WNWA 3QW3A 5A8MA 2B0MA 5T9BG 3DERA 3RRXA 3KRUA 3KVLA 1GOQA 4US6A 3CZ8A 2ZKMX 2AMXA 1IIGA 4GYPA 3EB4A 4WJ8A 1TPEA 3USZA 4JIPA 1UJPA 1OCNA 4UFHA 4DNMA 3MDUA 3VOHA 3T05A 2P5NA 3R0DA 4WX2A 1AL7A 2VI0A 3BLFA 4DUXA 2ZE0A 4OGZA 4TVUA 1B0IA 3TW9A 3NO1A 1F74A 3TZFA 4LBSA 3BGGA 1EIBA 3M41A 5C9RA 3MZNA 1JZ2A 3I4KA 2ZUTA 1DJYA 1GCYA 3UVIA 2YPIA 1MRAA 2FB3A 2PCEA 4XISA 3CK5A 4A3HA 5E6YA 4GLEA 5TIMA 2YFOA 4ZOCA 3PP7A 3AMCA 3QFWA 2POZA 2Q8XA 1VJZA 2WSQA 2VMFA 1LWIA 2XH4A 4MB4A 4C90A 4EPBC 1EO5A 3W3OA 3XISA 1U2YA 2VZUA 5E1QA 1IHIA 2GSEA 3A64A 3MHUA 2Y62A 1XRTA 4I9JA 3R8RA 2C0HA 5F1VA 1D7KA 1K8CA 4I9TA 4HOXA 1JFHA 1RA5A 2OWXA 4DWSD 3VABA 2RUSA 2G4JA 1DWJM 3ARSA 5KZMA 2QHAA 5FEZA 1AZ1A 3W02A 4GABA 5ECVA 1XDJA 1E5NA 3N2OA 2BY0A 3EX6A 3BLIA 1J0KA 1O1ZA 3M0XA 3B0PA 2EPOA 1PDYA 4OHQA 2QUNA 1E9IA 4RCXA 4QISA 3D6NA 2VVSA 3HV8A 3WF0A 4FNRA 1Z48A 4LS2A 2GFTA 4ICMA 3W71A 2FJKA 4LS1A 4B5XA 5HATA 1JCYA 1A0DA 1JVNA 2QGHA 3WSUA 3UXIA 2V2HA 3GNXA 4RZ6A 4UMAA 3CWHA 3JR2A 1KFWA 3LHTA 2WMGA 1TV3A 1DP0A 4GNKB 2Q02A 8XIAA 3WFLA 1M6JA 4P7RA 3FA4A 3VKDA 1WDDA 3RLVA 3TU9A 3W01A 3WH8A 3CQKA 4O28A 3CIXA 3TOYA 1SJBA 5K9DA 1RK5A 1HVQA 4LTSA 3J7HA 3GZAA 3WJZA 2A85A 3TC7A 4I6VA 1XFCA 3ME3A 1XSIA 2PBGA 2CEQA 3ZT5A 1OFPA 3CTLA 3CHEA 4R53A 2Z1KA 4UQBA 4LSBA 1Q4WA 1XGEA 1W1ZA 2E09A 2TSYA 1XH1A 4GINA 4NRRA 4LCRA 4HJFA 4DLMA 3EKGA 4AIUA 1TPVA 3DC0A 3WFZA 4AXNA 5FKYA 4DXVA 1C8YA 1EX5A 2FGZA 1HP4A 3LGGA 2DIJA 1RR2A 5HQLA 1K7FA 4CGTA 1VRDA 4R27A 1NY1A 2I16A 1F8IA 2DW7A 4HNOA 4Y6GA 4LUIA 2B31A 2ANUA 4GGHA 1AK5A 3HPZA 4E6MA 3FXYA 4WKFA 1NQ6A 3PUGA 3XINA 2AKZA 2IPWA 4AIBA 5DXYA 2REQB 3UXKA 1QHOA 3G18A 3W7OA 3VE7A 2B81A 3LN3A 5REQA 2E8YA 1VBUA 3VIMA 5A2AA 1K9TA 4UZSA 4H19A 4S39A 1ZENA 1TTQA 5REQB 4HTYA 4YTRA 3IIPA 2CCRA 4G56A 3R79A 5G2HA 1CGVA 1LBLA 2IXVA 5D09A 2ABAA 1F76A 3UY8A 1WKFA 1MQRA 2QUVA 2ZZ6A 1E0WA 2D73A 2BODX 3ZXWA 4O0KA 4HT3A 3S2JA 1GK8A 1LCOA 1ONXA 4EKJA 1FA2A 1XC6A 1KRMA 1T40A 1LL6A 3CHFA 2ALRA 2OX4A 1ZLPA 3LEPA 1ISYA 1FWFC 1XSKA 4KETA 3WNMA 4C7FA 3SQSA 1S2TA 2AL2A 5HJYA 3SRFA 2W62A 2Z2UA 3BAWA 3SUVA 4HOWA 3QBUA 1QBAA 1GT8A 3CUFA 5DY2A 2VQTA 3PNUA 2DT0A 3DH7A 4NHVA 3M46A 3BARA 1XBVA 4Q4SA 1SFJA 1FWWA 2F9RA 4R88A 2PDKA 2Y8UA 4GOAA 4XZBA 5CCZA 1PZ2A 3H7VA 3C2VA 1QI3A 5JIWA 3P7YA 1XBYA 1X6NA 1MRQA 4AW7A 3WL1A 3I7RA 2E77A 5C9UA 4YWSA 4AYGA 1MEIA 1E0TA 1EC9A 4DUVA 6ALDA 1KKRA 4NZJA 3MQTA 1PTGA 3VE9A 2BVDA 1G7VA 3ITXA 1XLFA 3AIVA 2HS8A 4XTDA 4PUKA 3HGOA 4ZEPA 2P0IA 5BRPA 4IQEA 1HNYA 4YNGA 2XUCA 2HISA 2FHBA 4EVZA 3SAZA 4RDYA 2XIMA 4TX9A 2CZDA 3HN3A 2GUUA 5FF0A 4GVIA 2DJXA 3RJXA 2C16A 3TW6A 4UWMA 3ZJ7A 4L9YA 3SIZA 3N4FA 4JTAA 1XWYA 1TV8A 1BVNP 1L2UA 6ENLA 4REQB 3ABQA 4IH3A 4OOZA 3H4XA 1DXEA 3CUHA 3PZNA 4XB3A 4LV4A 2O56A 1FWHC 1K9FA 2I5GA 2OSYA 2P50A 1BYDA 3CUJA 3PB0A 4QQUA 4NAFB 1AJZA 4LRSA 3PVFA 3TFXA 1VFMA 3LCWA 1VFTA 4PCPA 1IQ8A 4G6CA 4G5DA 4ZXOA 3M4HA 4NJKA 3AS2A 2NQLA 3M5XA 3RYSA 3IVTA 4AD3A 4IMGA 3TWBA 5C6MA 4PMYA 1UD2A 1JDCA 1J0IA 1OYCA 1U83A 4LUTA 2I1OA 3LCHA 4OQVA 4S3KA 1XS2A 2A7PA 5I3KA 2BLEA 3WCZA 1RP8A 1UH3A 2V67A 4UOJA 3W7RA 3QKZA 1LZOA 2J9XA 4DPPA 1M03A 4K8EA 1V79A 3DI0A 5MKGB 1OG0A 1CLKA 3GHTA 4HA1A 2F84A 3WQVA 1GOWA 4CQ9A 4GCAA 5A1AA 5LIKX 4FALA 3CTTA 3FY1A 2UZ9A 3QEZA 2PTDA 2XFYA 1Q4NX 5AVHA 2OOGA 4CD5A 3UZJA 3SB0A 4HMCA 3VGFA 3PZIA 4D72A 2IKJA 2G3IA 1EP2A 1TJ2A 4LPCA 1P6WA 2W0UA 3GG0A 1SU5A 3CL6A 2Z29A 1ADOA 4NXSA 4I3GA 3RJYA 1UWQA 1B90A 5IFTA 3EOOA 1XP3A 1QJWA 4GVGA 3VGDA 1Q6OA 4O13A 2J7FA 3RX2A 4O1EA 3EWBX 3N1AA 4F0LA 2WSRA 5JVLA 2WVUA 2A1YA 2VD8A 3JUGA 3BV4A 3H2FA 4XZLX 1EWEA 2VEFA 2WM1A 4PN2A 6REQB 2VC9A 3KW3A 3TJIA 4BJHA 2WO5A 1M3UA 3WQPA 3ENLA 3TFCA 1JAKA 2D2GA 4GQGA 4JX5A 3B06A 2BY2A 2DZWA 1CB2A 2GJXA 4O57A 3GU1A 3EAUA 2YBTA 4BQ3A 3A9BA 3BLPX 4HTBA 1XCWA 4HU4A 1AD1A 3EEGA 3LRMA 1LQ0A 3W7QA 1SZEA 2V68A 4N6FA 3HB9A 3WDIA 5FSEC 3GVGA 4WJEA 2YBVA 4ATLA 1JUBA 2WNNA 1GVQA 1AG1O 3ARUA 3B9AA 1KBBA 4C1LA 4PMQA 1GONA 1G4SA 4XZIA 1JR1A 2DDXA 1SR0A 5CZKA 4QAIA 3CMJA 2BB0A 4H7ZA 3B4YA 3CYVA 4M7SA 3S6DA 2QIIA 4KKXA 3II1A 4Y9MA 3QH2A 4RKAA 4MJ2A 5CXPA 1MQQA 5FJOA 1OD8A 4PUJA 4HA3A 4IFRA 1B3YA 4S3GA 3QC0A 1FX6A 4H9UA 4JXCA 1PYMA 2RAGA 2GWGA 3MMDA 3OYZA 4A8NA 4MSSA 4QEEA 2HMCA 3PZGA 1RQEA 3NSXA 1XICA 1FXQA 3GIQA 5A6AA 1BRLB 4E2BA 1KCZA 4EPEC 4MZ8A 4MB5A 4NNCA 4KBXA 3DHFA 3NSMA 3F2BA 3TXZA 4U28A 1U22A 1DV7A 4QROA 3SY1A 5U4NA 2HVOA 4QJ4B 3P82A 1JDFA 1G94A 2FTYA 3VOIA 2WKGA 4E3TA 1Y0EA 3D5HA 4QG8A 3Q45A 4L6DA 2J66A 4Q7NA 1NARA 4LVDA 3GU2A 1Y5VA 3H8AA 2FVKA 4FF5A 4OKDA 5LNVA 1WKDA 4AU0A 3F1QA 4DY1A 1S38A 4PCTA 1QRQA 1ZCOA 2CLFA 1HL8A 3PPHA 4C6NA 4FLQA 3WMCA 1AZ2A 2FLIA 4ACZB 1UMLA 2DZVA 1EEXA 1M7JA 1TWWA 2GQAA 1H1NA 5C2CA 2BY3A 1WCGA 2AGTA 1V3MA 2ZTKA 3STGA 1S5NA 3M0VA 4ICCX 1FP8A 5TNVA 2ZX7A 4PMJA 3HIJA 3TVAA 1SSDA 1D8CA 2J7EA 4JFWA 1A0EA 4PTXA 3CZKA 1ICQA 1LBFA 1N2VA 4LQ1A 3VCCA 4GG9A 5E0KA 3AAMA 4HJWA 3GNPA 2H8ZA 1H60A 1V3JA 4GBUA 3H2OA 3H7RA 1FQ0A 3N2BA 3U3HA 4E2DA 3LGEA 1FH7A 1GJPA 3ARQA 4J35A 4CU8A 1KM4A 3MJMA 1XDLA 4ZSTA 3QY8A 1FUYA 2PDJA 4BHYA 3E5PA 2Y70A 2PMQA 2WMHA 2GGEA 3WBYA 4UTFA 5A69A 3PS7A 3MVIA 3V0TA 3HPAA 4DYEA 1WA3A 5A8NA 1CXFA 5A6BD 1XIIA 3GYCA 3KTCA 4HYWA 4FNPA 1WE5A 3DFYA 4GUHA 4AH7A 4DI8A 3ARWA 1QNSA 3VNYA 2MNRA 2ZWYA 4IG2B 1OGBA 4FXSA 3TUUA 1W9UA 4HHHA 3O6DA 3KOWA 3LCFA 1TMLA 4NJIA 4C6IA 4XBJA 3T8LA 3GNOA 1W5OA 4H6RA 1J0ZA 3QHMA 2QV5A 3CLWA 1BWLA 1W3HA 3FX4A 5TF0A 4DBWA 1MFVA 2GWNA 2SFPA 2QDEA 3SI9A 4ZTXA 3ALFA 1PB0A 3CV6A 3AJXA 4DJFD 1NU5A 3CWOX 4LX4A 3N4AA 3NQAA 4LWWA 3T0DA 1OC7A 2PGRA 2RH9A 1LRQA 1ENUA 2VO5A 1K8ZA 3DHPA 3RDKA 5LA0A 1DWHM 3M44A 1UP0A 1RJRA 4UTJA 4H1ZA 4QLLA 4B9ZA 3UD6A 3IGHX 3RX3A 4O1BA 3Q2DA 4O10A 4KCUA 1J8VA 3W1LA 3SJNA 1RHCA 3A5VA 4HCLA 3PTDA 2G8ZA 2AQWA 4RUBA 1PEZA 2ZRZA 2CETA 4DBSA 1US3A 3FLUA 5CSRA 3LPOA 5CC5A 3M0ZA 1C3FA 3WUGA 1B9ZA 5D02A 2ZUVA 3P8IA 3VD9A 3M0YA 5FSDC 2IQDA 4QE4A 2XSXA 3AYTA 1EC8A 3NQEA 3G3MA 3WMSA 3U7VA 3AICA 4U31A 1KRAC 3SCQA 3ZOAA 1WDPA 3GLCA 3G1HA 1UH4A 2H9AB 2A79A 4IF2A 1I75A 4HU8A 1DJNA 4GXPA 1EH9A 4R9XA 3H22A 3RNDA 3E02A 1W17A 1Z69A 5DX7A 1KC7A 1XC4A 1Q8AA 4TVCA 5EFFA 2OCZA 4NI8A 4JCLA 3S2CA 1E4NA 2FZNA 2ZDSA 4OUEA 3OBEA 5HPCA 2G3MA 4MDPA 3QLLA 4BWLC 3WQ5A 2C6QA 2VC7A 2BXVA 4HU0A 1VFOA 5DCBA 3I6RA 4RR4A 1L2QA 1R5YA 2XIOA 2GLKA 2NXIA 3RFAA 3VAVA 2A3AA 1IT8A 1WKYA 4AIOA 3NQ6A 1FKXA 3LA4A 4MNLA 1J2WA 1PBGA 3LQGA 1C7SA 2E8ZA 4J2PA 1UCWA 1UQZA 3CEPA 3Q4DA 4XIMA 5HWJA 1RY0A 1TMHA 4FLRA 3RPMA 2XVKA 4W84A 2WB5A 3OGVA 4J9JA 3A4WA 4MM1A 4KFNA 1XD1A 2CITA 3GXTA 3M6DA 5DT5A 4ZB0A 1PKYA 2P8CA 2ISSA 3KUMA 4LUYA 4N9BA 4UCGA 4GD0A 3MYPA 4AF0A 3H2MA 2BY1A 3RILA 1DPMA 2WSKA 2Z0IA 4LAOA 4WSJA 3O7UA 5LNWA 3K8LA 2YSWA 4ILSA 1TCMA 3BLLA 4O19A 1QK2A 3RIKA 4UQ9A 3HQPA 4LBRA 3C0JA 2VJXA 3BLKA 3V5FA 2PRLA 4LBUA 2MUCA 3MI6A 2YZRA 1W9DM 1TVLA 3WQWA 3DENA 3WK2A 1HO1A 4GPNA 4D2JA 2BXZA 4P61A 1WX0A 5AZ1A 1W1YA 1AODA 4S3BA 5HJLA 4M29A 1PPIA 3F5JA 4CEXC 4F8XA 3EYPA 2PGWA 2WJDA 4PMNA 2YXGA 2Z1SA 1OCQA 4I6KA 5JQ9A 1ZAJA 2UY3A 3PTKA 3NPVA 4H9TA 5D8ZA 4H8HA 1JAEA 1AH3A 3M0KA 3BOLA 4C1KA 3B8DA 4G7EB 5D2YA 4ZFMA 3TTQA 2VGGA 1GOOA 2ZZ5A 3DBNA 2EKCA 4EX4A 2HBVA 5CBIA 3SSJA 4HIBA 1X38A 1GVYA 3W9ZA 1V8EA 5EMYA 4AISA 5JH1A 1K02A 3QVQA 1H1YA 4DYJA 4UR7A 2YCKX 2DUAA 3QY7A 4XQ6A 2G3NA 1Q63A 2OMAA 2JKEA 4U5KA 9XIMA 1ZB5A 4J2MA 2ZXAA 1Q7ZA 4PBFA 3R8HA 2PP3A 3M9YA 4UNLA 1JUKA 4WR3A 2XFWA 4YVXA 1GZGA 5E0FA 2DQWA 5A6JA 3C2FA 4UQCA 4X0NA 4AX6A 4HZMA 5HAOA 1XFBA 2UY5A 3T42A 2D2HA 2Y7GA 4YU1A 4L1XA 3RK8A 3VC6A 2OSWA 3OZPA 3HBLA 2QF8A 5EMKA 1D3GA 4GIEA 2VX7A 1RXOB 1KM6A 4PCSA 1NFBA 4L4MA 4GFIA 3QRHA 3EXSA 4DO6A 3S1GA 3IANA 4DNHA 5EIYB 4CN4A 1EJRC 3NOEA 3E96A 4YCPA 1SYTA 4JTGA 5DEZA 4IPLA 4QDMA 2X42A 1MNSA 3POCA 4W5ZA 1HKWA 4DELA 3B8IA 4PFMA 3AIWA 2W5FA 1JZ7A 3B0VC 4F40A 4MGGA 4FR1A 3SGGA 3IIVA 3WLHA 4A2RA 1HVXA 4PYSA 3WBEA 1BTMA 3WNLA 4JTKA 3W7GA 3VNLA 3BLOA 5HR7A 3IUDA 4JNMA 2VOMA 3RR1A 5HBFA 2Y5EA 3TDFA 1OC6A 1CLXA 1EL3A 2XH0A 4H8UA 4Z2HA 2ALDA 1XGZA 3WF1A 5E09A 1MUCA 3IIZA 3R25A 5K4ZA 3F4NA 2Y6ZA 1W1TA 4HOZA 1RLDA 2OYKA 2E7FA 3U4AA 2PGFA 4PEEA 5J5DA 1Q2SA 3EX3A 4JN7A 5D9NA 2NSOA 2OOFA 1ADDA 1P6BA 2NLIA 1A0CA 3WLOA 3PZTA 2BASA 2Y7EA 2P1FA 2A3BA 1GORA 4IP4A 1EGMA 1YMYA 3GC2A 3SGUA 1V0MA 3RXZA 1YW1A 1XHGA 1ZAHA 4H9ZA 4GYPC 3BG9A 5G4WA 4IQJA 1J6OA 1DL3A 3NCOA 5FACA 3ZMRA 2DT1A 1YNQA 2XWEA 3UCCA 3H26A 4B5SA 3UG8A 3VYLA 2ESCA 3M0JA 3W0KA 4IIDA 4BK9A 1E1CA 3BZGA 3RR4A 3SIMA 5I77A 1P7TA 2OYLA 2JF7A 3LXBA 4EPDC 3VCRA 1UKOA 3K1GA 3NPUA 4EAMA 1E3ZA 4P7OA 4DZ5A 5JU6A 1YNPA 3GFZA 1PUDA 1WZAA 3G1AA 3A5FA 2GQ8A 4Q4PA 2VUNA 3WLMA 1HN1A 2Z24A 2OLHA 4S3CA 1MFUA 3LHVA 1ALDA 4PUEA 3NJ3A 3ZVHB 3GDMA 2OGJA 4KIRA 1MW0A 1ZHAA 3ZZ1A 1R3RA 4FB7A 3E3HA 2D20A 2XVPA 3VIPA 2ODOA 4C6JA 1UIPA 1IXQA 1TWZA 2WK2A 4I9MA 4MJMA 3CHCA 4H04A 3TLLA 2A0NA 3MWCA 2W9MA 1R38A 1KXTA 2DIKA 3VFLA 3ZR5A 7A3HA 3UXDA 4Q6XA 3C2RA 3T0AA 3VIJA 4XTIA 4MY8A 2BVTA 3EOUA 1B2YA 2VVNA 3PZUA 5CC6A 4WY0B 1KTBA 2ACQA 4NRSA 4W7UA 3EMQA 2QIWA 3T2QA 2QCMA 5EPDA 4F0KA 1SVDA 2VZTA 4LNCA 1T5AA 1VLIA 1DWAM 3HGJA 4MKNA 3H2EA 1F6KA 3TYCA 2FVLA 2WVSA 3TWAA 3WNPA 4W4QA 1HP5A 4E4FA 3M0HA 4MPKA 3AHTA 4PODA 1EO7A 2ATMA 4WSHA 4ZO8A 4W93A 1MDRA 3IIOA 5CGMA 4PRTA 3EPOA 3WENA 1NDWA 2WPBA 4UFMA 3I3BA 2JF6A 2OQYA 5LA1A 5CJMA 4H8NA 4GO9A 2AAMA 2Q6ZA 1X98A 2DIEA 1EJXC 4JHZA 1REQA 5C5YA 3V7PA 4PSRA 1TUFA 4QCEA 1PX3A 1HTIA 3KE0A 4YTQA 3CQJA 2E5CA 4LALA 1DTUA 1XDMA 3OLEA 2VFIA 4HSHA 3QZEA 5I2UA 3PBUA 4JIQA 3SY8A 1L0PA 4IGMA 1UBPC 3V35A 4XUYA 4G8TA 4AY8A 1OZQA 2PDCA 2ZX5A 3OW1A 2GL5A 3L5LA 3BW2A 4AVNA 4L4OA 4DI9A 4UQEA 1QI2A 3VD3A 2HBXA 3LG3A 4FLOA 2PTWA 4WUIA 1SJDA 4NSBA 3QSRA 3LV5A 3M5ZA 4Y9NA 4F3HA 4HNVA 3ZO9A 4F4RA 3OGRA 2J79A 4NZ1A 1H7PA 3LCIA 3UR2A 3AS0A 5D05A 2CFFA 2YLAA 1IZCA 4B90A 5A5WA 4DB7A 3S1WA 1JIBA 4NZ3A 1A5SA 1EQPA 4QCFA 5I3FA 4ENLA 3DG6A 2GUYA 3RHGA 4UTUA 2Y7DA 5HXMA 1Q85A 5ABGA 4C60A 1W54A 1V02E 3RCNA 5E0CA 4Y7EA 4QJ1A 1WXYA 3IJ9A 2C19A 2BTMA 2YOCA 3IJ8A 2J27A 1QFEA 2DSWA 3S46A 4DUWA 1OBAA 3GBDA 9XIAA 2D2JA 3MCOA 3P80A 4ZTYA 3S9IA 2GVYA 4KWUA 4IGSA 5D30A 2AOSA 1M01A 1NOFA 3BSMA 4H7CA 4KPLA 4GZJA 3QOKA 4W85A 1IEVA 4JFUA 2ZWZA 1P48A 3C61A 1GG1A 5C70A 3NQ2A 3NSNA 1D3HA 1W1VA 4HHLA 3W74A 4H9XA 4N0RA 2D1ZA 3BTNA 1BYCA 3GM8A 3FGCB 3EDEA 2JEQA 1A3HA 3GR4A 3O1NA 1UUOA 3EDJA 4HHPA 3W2KA 1GQIA 1A5BA 3QF0A 1JCXA 3KAOA 4AWEA 2D24A 1EOKA 4X9SA 1TPWA 3GIPA 4GFSA 2XSAA 3UGRA 4ZO7A 5H2ZA 2JIWA 1PCWA 3VMNA 3WD4A 2UY2A 3ZQ9A 2IS7A 3NXLA 1DQXA 1W5QA 3E0FA 2OLAA 1OFAA 3C2OA 2XWDA 1EJVC 2GDQA 1B3WA 4IMDA 3M16A 3U5YA 4N4PA 4RV8A 4AEEA 5A6SA 2YDSA 2V30A 4FX8A 4JTUA 1UWIA 5CZJA 3K4DA 3GXNA 4LY8A 3DFOA 2Y0FA 4YXGA 3NVDA 3MTWA 5GJNA 1QHZA 5GJMA 4YS1A 1AW1A 1R9XA 3B9NA 3UFYA 2CWXA 3F4WA 4X3ZA 1RCOB 4ZB2A 2Q71A 2I57A 4U3CA 4Z17A 2G41A 4G2DA 3AXKA 1UA7A 5FD0A 3ITOA 3TYAA 3CUXA 3C5QA 5CEWA 4B91A 2CZVA 4P7NA 4PL2A 1VLWA 2JKAA 4MHBA 1GKQA 4DUOA 2AQVA 5DMYA 3LTPA 3VDGA 1XYMA 2B7OA 4EOUA 1WOAA 4CU7A 2GJNA 1VPXA 2OT1A 2QJGA 2GJRA 1OFBA 3N2XA 1CPUA 1H41A 3VFCA 4A05A 3ABRA 4P7QA 4POCA 4UFIA 2OJPA 1PCKA 1W3JA 2EPMX 1WV2A 5F4XA 4DWDA 3M0MA 3KL5A 3CQ0A 3W7IA 2QR6A 1NFPA 3HO8A 1QWKA 1OYAA 4JQAA 4ALDA 4GQQA 1GW9A 2G3FA 1ZPTA 1SPQA 1X7FA 2PF0A 3EKLA 4XD5A 2YXXA 3DYOA 2GK1A 2INEA 2EPHA 2YB1A 3M0IA 2YA2A 1SO3A 5EGRA 2Y8KA 4V1XA 2ZE3A 1LT8A 2TMDA 4XKMA 4NAEA 3WF4A 2OB3A 5EFDA 5DRIA 4GMEA 2E5DA 2VQUA 4FOUA 5EBUA 4PTVA 1VPYA 4TIMA 2X0HA 1R7AA 1H61A 2B4GA 1L9WA 5BNKA 1ZTVA 2ISWA 2OGYA 1KTNA 1OIMA 3PY2A 1KM2A 3NZQA 3AIUA 3K30A 2VNCA 3TEVA 2WXDM 2D0GA 4DWSA 4IUGA 3A22A 5EB8A 1SZRA 5FOOA 3CEUA 4C6FA 1EA9C 1VYRA 3ID7A 3SCRA 4ZQCA 3W6YA 1V3IA 2DT3A 1LLZA 3OHIA 1VIZA 1NDVA 2EBNA 2ZVRA 3VIKA 3O6AA 3FN9A 4NJHA 1KR0A 1FWIC 2GDVA 3NGJA 4JDBA 4HB7A 4KF1A 5BCAA 3GSMA 5M2FX 1EGVA 1X7IA 4LOCA 1S46A 3FVMA 2PDFA 4DBUA 4JOMA 1Z89A 4WEVX 3THDA 3VX1A 3FGCA 1GW1A 1VIWA 1JZ3A 1TE1A 3G1YA 1PZ3A 4W8LA 1FHDA 4XBKA 5AHEA 3GO2A 3C8FA 3OA5A 5HQMA 1KCKA 1CWYA 4O0QA 1JG9A 4Z2JA 3GX9A 3WJYA 1HJUA 3T78A 4OV9A 2PDWA 4RL3A 1QO2A 4L1WA 5AYBA 1CXKA 3FK4A 1W3TA 1BQGA 3E49A 4UNIA 5E9AA 1JUEA 4X60A 4S2CA 1FWGC 1O4UA 2XYLA 3PTQA 2Z4GA 1GQKA 3APYA 3OOQA 2Z1VA 4JHMA 1E0UA 3STCA 5BOOA 2PWHA 3BICA 3M7WA 3MUAA 1GUVA 1L8NA 3MUIA 3C0QA 4KGLA 1I1WA 4IIFA 1UKTA 4IX2A 3T7VA 4ADSA 4HMNA 1MXGA 3RLGA 2Z2BA 4Q4OA 1QNOA 3SCWA 2CU0A 4IFOA 2PZNA 2FZDA 3C3NA 3M64A 4XIAA 3PAJA 4BF5A 4M24A 4H6QA 1YRRA 3LXAA 1RBOB 3QLDA 5KEZA 1RD6A 1ITXA 2G95A 4FNSA 2YYTA 1EIXA 1KM1A 3IJIA 5FJIA 2QW5A 1HJXA 3QV6A 2QDHA 2NWRA 5CQ1A 3ZLGA 1VRXA 3GTNA 3GR7A 4PUDA 3WF3A 4DRSA 3SECA 3TCSA 2PDQA 3GD6A 3A13A 3WLIA 1GHSA 2E25A 1E6ZA 4CNOA 5A6KA 7REQA 2VZVA 5FA5A 3T0TA 3U57A 1UBSA 3ECQA 3CHVA 1N82A 3W00A 1NF0A 3U9IA 1EJ7L 4NY2A 5D2TA 1PHQA 1YADA 4ZENA 5E93A 5FL1A 3QC3A 1UIOA 4O1DA 2HJPA 4JAWA 3BCJA 3O9NA 3QYQA 4QDPA 1V02A 2J7BA 1V0KA 3CMGA 4ATDA 4M1RA 1VCVA 4E8DA 3A3WA 1H7NA 5I0DA 2ZRXA 4D8ZA 2Q8LA 1XIJA 2YDRA 1PAMA 3CAVA 1WKEA 1DYSA 4AZHA 4KESA 1FWNA 3OLIA 1ZP4A 2DVUA 3S5YA 2Z6JA 4GISA 4JKMA 1FWAC 5C0QA 4RE2A 3NQDA 3NFUA 1EGZA 3AMGA 2XIBA 1YX1A 5KZDA 3IVUA 1ZNNA 3KTSA 4K68A 3OO2A 3DX5A 4LY4A 1MEHA 4Q6JA 4PUMA 4UQDA 4M81A 2VYOA 4F2UA 2Z1BA 5F2IA 1JQVA 2NX3A 5A2CA 1CGYA 1SJCA 2J25A 1HJQA 4XD4A 1I2NA 2PLCA 5FAGA 1OYBA 5BXTA 2PWDA 4HSOA 5DO8A 1OM0A 4MZYA 3DHUA 4MKVA 4NKCA 4R34A 2DSUA 2NQ5A 2DVTA 6PTDA 5C7VA 3W7CA 4GGBA 1OY0A 2XISA 3FFSA 4XAGA 3LZ3A 2QDGA 2XPKA 1W3NA 3EDDA 1A4MA 2IPFA 2VXNA 3ZYZA 1RPXA 3U0HA 3GC4A 4BI5A 4PSPA 4IGHA 3T1GA 1JCLA 3NUKA 1UR3M 1W9VA 4UC5A 4G7EA 3RF9A 4N6EA 4J7RA 4LV9A 4Z1CA 3AHYA 1QPQA 4S3EA 2QCDB 3V0SA 1JZ6A 3N6QA 3ANVA 3W1PA 2GQ9A 1V6UA 4LCQA 1XM3A 4ZGYA 1JYVA 1X1OA 8CGTA 2D3NA 2GVJA 1R86A 2QMJA 1GQNA 4GY7A 5J8LA 4RW3A 3LCLA 4AY7A 1J0JA 1K8XA 5CJ5A 3UEQA 4IMEA 2P0OA 4C5ZA 2I9UA 4OUIA 2WM0A 2YB4A 5JMUA 1H62A 1ZJHA 3APGA 2VURA 2Y2WA 4E38A 1DJQA 4D1IA 2NQJA 2R82A 1H7XA 2CLLA 5MHBA 3KP1A 1G4TA 2XFFA 2QVHA 4J1OA 4DM2A 2ACSA 2BHZA 3KBMA 4A6GA 3HFTA 4P8WA 4HD5A 4FNUA 5CAHA 4H9YA 1Z41A 5I3JA 3W7JA 3DDMA 5HINA 2D0HA 1J10A 1WDQA 3VZXA 5IHSA 2FZ9A 1UR9A 2GVLA 1S5VA 1JYXA 2UWFA 3STPA 3PBGA 4UTWC 3L5MA 2W67A 2FGBA 4KWOA 3KBSA 4O17A 1I2PA 3AXXA 3KCOA 3DHDA 4BEUA 1GJWA 2VDGA 4MF4A 2PDBA 3TN4A 1LYXA 3B04A 1NH6A 3TA9A 2PC4A 1WDWA 4Q8UA 4H7VA 3E9AA 3FKKA 1LWJA 3MUZ1 1MUMA 4GUJA 1VYPX 3V5CA 3NQMA 1BPLB 4KFOA 3KZPA 3PBYA 1M7PA 5D03A 3UYCA 1RVGA 1QATA 2BDQA 4GK8A 2Q09A 2PDLA 4ZQNA 1NFGA 2WWDA 1JYWA 1R3YA 1GEHA 3H24A 4RZBA 4GY1A 3L9CA 4ROQA 2QAPA 4JKLA 1BFNA 2QEZA 1DWGM 1SGJA 2HS6A 3W6LA 2QCEA 4M80A 1TJRA 3DKLA 1YTKA 1XSJA 3AI0A 3WZ0E 2J7HA 4LRTA 2WMIA 5JBDA 3EX4A 5D4YA 4IIEA 1TB3A 3M0LA 1R3VA 3O07A 3W1XA 3VKKA 2Y63A 1NSJA 2VX6A 3NGFA 1BWKA 1P0NA 1DEDA 2UV8G 4NYYA 1SR9A 3ATZA 2ZRUA 2V5LA 2HK1A 2EPLX 3S9ZA 4WJXA 3WLLA 2DFAA 3ARYA 2EAWA 2V3DA 5CLWA 3H55A 2HEJA 1QI0A 5LXEA 4Q8QA 3SCVA 1A3WA 4S23A 1B4KA 1DJGA 1US0A 3QJAA 1B57A 3TA6A 3IS4A 1I2OA 4FHAA 1QNVA 2BGSA 3E38A 4AWTA 2W6RA 3B05A 3W7NA 4C6LA 3RITA 4NX5A 4NZ5A 4WY0A 1T99A 5D2WA 4CD7A 1V6WA 1AJ0A 2PEVA 2D23A 4GYJA 1H0IA 4ZOAA 3P67A 4AHQA 3PANA 1O66A 1EOMA 2HVMA 3P61A 5FL0A 2ZICA 2QV4A 1J0HA 4PBEA 3LLFA 2PODA 1Q45A 1KGUA 1RAKA 3T4CA 2JALA 1E6XM 1EF2A 2C13A 1QASA 3H53A 5ABTA 1VHNA 3NYZA 1P43A 2ZXDA 1GWJA 2DORA 1G4EA 2OQHA 3A23A 4ZMGA 3WDJA 4JNZA 3L21A 4K38A 2YKKA 3QHOA 1AQFA 2BXYA 1KBKA 4EE9A 3T40A 2Z7GA 3GKFA 1LM1A 4KCTA 5EA9A 3VINA 4WKHA 4IPPA 4IJRA 3DC8A 1FH9A 2QUTA 4L9ZA 1B1YA 4QAWA 3ARXA 5K7JA 3L4ZA 1TZ7A 3W1UA 2CLMA 4JGDA 1XJBA 2CBJA 3CASA 4I7WA 4C7GA 3W7PA 4GYKA 1Z6KA 1GZ1A 3BC9A 1X97A 4JNYA 4P7LA 2PE4A 1OADA 2INFA 1IV8A 3MPGA 4HCHA 1OQFA 1TO3A 1TX0A 1YTEA 3DG7A 1VFSA 3GNNA 4AZIA 1E56A 5JBFA 1HO4A 3C52A 4HPXA 1GOMA 1FCVA 5C71A 5LIYX 4M8UA 3PM6A 3BL3A 4H6KA 3MUY1 4FS9A 1UH2A 2NVDA 4KH2A 5FJUA 1ZFJA 4Q22A 3FYPA 4MFEA 1XL9A 2BX7A 3DBPA 2WVVA 8TIMA 2VFGA 3LHUA 2XM2A 4XG1A 5LNSA 1TSIA 4QS6A 1H50A 2OPJA 2I17A 1K9DA 4AC1X 2AGKA 3GNDA 4LVBA 1G69A 1NIUA 2CHRA 1XKJA 4U4MA 1XLGA 3LUTA 1U1UA 1OX4B 4US5D 3VM5A 3U5UA 3H7UA 1C8XA 3CPGA 4PTWA 1HGYA 1YDYA 4JTEA 1OFQA 5CBBA 3NL2A 5BOEA 4BEQA 1RH9A 3SUSA 4LF2A 4F9JA 1TFVA 3E74A 1LORA 1XLKA 4FOJA 2WJZA 3AHXA 4D6JA 3PPGA 1PO9A 3NZGA 3TTEA 4X2RA 1FWRA 3V0UA 4KT2A 4DIAA 3INPA 4B5NA 6TAAA 1U5JA 1CTNA 4JX4A 3WEZA 1FDYA 3NEVA 4ATWA 1BQCA 4RZ5A 3IGSA 3UR7A 4QQ3A 4CU6A 2BMBA 2RJHA 1KFEA 4F0HA 3VIOA 3NQ7A 4FIQA 4W7VA 1PV8A 3GIYA 2Z2AA 4CUCA 2X0SA 2H3BA 1R7OA 3FXGA 1EZ2A 1DHPA 4PTDA 1JRBA 4OWGA 1H7WA 2JE8A 3KCLA 3YPIA 1W37A 2DUXA 5DY3A 3NDYA 3W07A 3CZEA 4FK9A 1W9XA 4HZ7A 1KR1A 4JR5A 3TN6A 3A4JA 2C0AA 5FEWA 2OYMA 3H2NA 4WXZA 3TAOA 2WOQA 2O9RA 4FZIA 1R9YA 1THFD 4HK7A 2R24A 4B4HA 4AD4A 3CMFA 2FPYA 4EIVA 5J04A 3NZRA 1I8JA 1JFXA 1JI2A 1GPWA 4FX6M 3P3BA 3GH4A 5GNXA 5DCEA 1YEYA 3W2MA 4ZA0A 4D6EA 1IGSA 4AG0A 2YCEA 4PMZA 2FZ8A 3N3MA 4V33A 3LERA 4TU1A 4JICA 1NOUA 3Q58A 3ATYA 1PTDA 3SCPA 1JRCA 1WDSA 3ZWSA 2A21A 3BDKA 1CB7B 4HKPA 1FVPA 1JPMA 3GUGA 3L4TA 4CQ8A 1DIDA 4U2YA 3CH0A 4N02A 1Z8AA 1OX6A 4O53A 3GG1A 2O4MA 1BD0A 1FWEC 3OIXA 3WBAA 1SFSA 1MZHA 3TXVA 4EWND 4JFVA 2VHLA 4PE8A 2H6RA 3LB0A 2PWEA 2FHFA 3M1ZA 4BI6A 2QPXA 5KZ6A 1LLWA 3WEMA 3BV7A 2CBIA 1VAHA 4JTCA 4EF9A 3CL8A 3FA3A 3TKFA 2PFHA 1PWMA 3CV7A 3L2MA 1V0LA 1VPQA 2HE8A 2QCDA 2ZRWA 2WHKA 3WQ6A 3BE7A 3R6IA 3KM8A 4U10A 2GGGA 5CPNA 1PWLA 1Q8JA 2KAUC 1MI3A 2PWFA 3ITLA 1LOLA 4L6HA 5GPRA 4I5UA 3FA5A 3A47A 4LW7A 1ZSXA 2QF7A 1MEWA 4MADA 3HJZA 3WDHA 3UCQA 4LB3A 3UZYA 4B2DA 4INFA 1XXXA 1J5TA 5I02A 2J24A 4H6EA 2O9TA 3N3TA 4N9CA 1FP9A 3IEBA 3N17A 3BOFA 1LF1A 3WLSA 1BAGA 3TAKA 1E9ZB 1WAWA 3KBNA 3ABXA 3USBA 3S47A 1ML1A 3P0WA 3W7LA 4AYSA 1LQ2A 4QIUA 5EY5A 4LVFA 2CESA 4AZCA 2G96A 4NZFA 1V4YA 2WW5A 5BRBA 3W26A 2E4TA 1VR6A 2ZCGA 4CNUA 3TNOA 5CPQA 4JEQA 1NTHA 2ZZ2A 5A95A 3FAXA 2V5DA 4C5YA 3T8QA 3A6OA 4RXFA 4JQ1A 3IIXA 4HNLA 5CC7A 2VEGA 3T6CA 2BBFA 1YNYA 1YXCA 4REQA 3MMTA 3WF2A 1S5MA 3K4AA 3QV7A 1XQKA 1N8WA 1LUCA 3G2GA 3UJ2A 4GIRA 2QUMA 5FIPA 4RPQA 1R30A 3MSGA 1JXJA 4HBKA 4WGXA 1ZALA 3R11A 3PPFA 4GA8A 3AIEA 4NIRA 2PDMA 4XBSA 3B8VA 2ZUUA 1DJXA 1QDSA 3QY6A 5LIUX 4Z08A 4HU3A 2ASHA 2YCLA 1HX0A 3RLUA 3WYZA 3EWWA 4OE7A 4OTKA 4RZ4A 4YMZA 3S5ZA 2CC0A 4A8IA 3GS6A 3JVAA 2VRJA 1FH8A 1B3XA 4RDWA 1DE6A 4Q8MA 1AMYA 1Q66A 2IKIA 2PDIA 1KQYA 2QJMA 3SUTA 2E6YA 4JTTA 3IJLA 4M6PA 4NXKA 3SRHA 3GG8A 2KZHA 4AB4A 3R5EA 3D46A 3VUPA 3PBWA 3NEHA 1FHVA 3I3DA 4N9DA 3LNPA 2PURA 2QCCA 4B92A 1V6YA 4ZVJA 4UUIA 3I4EA 3GFYA 2BVYA 1OCBA 4QJ5B 4IJCA 1VQTA 1M5WA 3F4DA 1SW3A 4XUGA 1BSIA 1H7RA 2WMFA 3IAQA 4O8RA 4FOKA 2NSXA 3H23A 7CGTA 1F7BA 3D3AA 3A9IA 3EOEA 1KV5A 2IUZA 3P60A 3ES8A 1E71M 3BW4A 5I3HA 3W1MA 1GEQA 1V03A 3W87A 1TJ1A 2I56A 3EWUA 4QE1A 1A5AA 1AD4A 1YTDA 3MDWA 3UWVA 2P76A 2WNZA 1DXFA 2CZEA 3NWRA 3QPYA 2R9RA 3WUBA 2XN0A 2BGNE 2G5WA 4E3VA 3H4GA 5CPOA 3UZZA 3LDVA 1XCXA 3HV9A 4L5ZA 4LCSA 3CBWA 2ZA1A 4RE0A 1IWAA 1MUWA 3OG2A 3QV8A 4LUSB 3R0KA 4G1NA 3LGDA 4GO8A 4RPPA 4C91A 3VZZA 1BTCA 3WK3A 2D22A 2HRWA 2E3ZA 2PLMA 2J9ZA 2VFFA 1NWRA 5AHIA 3F03K 1A5OC 1A49A 1WB0A 1M68A 1VGAA 1S1PA 1B9BA 2A2IA 1C7TA 3HFYA 1Z42A 1O5KA 7XIMA 1XYAA 3WY1A 2EKGA 5T9CE 1HKJA 2INZA 3B8TA 2F2HA 2W4XA 3N6JA 4PFHA 3VNJA 5IRPA 4LAUA 3S2NA 2ZXQA 3ALGA 2WVVB 4MUPA 1SW7A 4W8AA 2BVWA 2CKSA 3NO3A 2CIPA 1KFLA 3Q94A 1BGAA 1RA0A 1UD5A 4ES4A 4HA0A 1W31A 3UWUA 6TIMA 3WD0A 2NWSA 4E8GA 4QRNA 5G2WA 4BWLA 1DXIA 4FR6A 2ZA2A 1QCWA 2F61A 4HK6A 4YHGA 4A35A 3UP8A 5KMYA 5DELA 1YLVA 4C6KA 1ZJIA 5IXEA 3SADA 1TIMA 3T4WA 2YR1A 2J8FA 1RV8A 2L5HA 2NQ9A 2ICSA 3DOPA 3I6TA 4JIRA 1KM3A 3OTRA 2YFNA 4MUZA 5HQEA 3PNZA 1TMQA 4UR8A 2D69A 5BXRA 1TV2A 1YXYA 4A8RA 1HG3A 2F7FA 3ITGA 1AMKA 4QDWA 1R2TA 4NP7A 3KLKA 4Q7IA 4DBEA 1RBLA 5I3DA 2DEPA 3NQGA 1E6RA 1J5SA 2EPNA 3W1TA 4OFCA 2I5IA 3QOMA 3VO0A 3O05A 1E73M 1RALA 2P3EA 1ELSA 2ZZ1A 4BQ2A 3DU0A 3UERA 3CJPA 2E40A 4JQ4A 1EZWA 1TYGA 1OCJA 3KVMA 4K36A 4QX4A 4XD3A 2IW0A 5GNYA 2J4GA 3MV01 3PJTA 1DIEA 3U2ZA 4DO4A 3CO4A 4LC6A 1IEIA 2CPUA 2DQXA 3AMLA 3K46A 4HHMA 4QP0A 1D2KA 3C86A 3UNTA 4MTVA 4DJEC 3CLMA 4GI6A 5L9FA 1JD9A 2O0TA 4JTHA 4A21A 4BCEA 3CNYA 2X1RA 1OJXA 2V8ZA 3KX6A 3V1PA 1NF7A 1KO0A 1JCJA 1FTXA 2X1UA 4D1JA 1LQAA 5FAJA 1X8CA 4L80A 3UWZA 2REQA 1KCLA 2F38A 3MCMA 1JF5A 4R33A 2WV8A 3GVQA 2DY3A 5CAKA 5FF3A 2WQPA 1XRFA 4C6OA 1VC4A 3ERPA 2VOTA 1IIHA 3R58A 2C3ZA 4IJBA 2FZBA 1LL4A 1TPB1 3ZT7A 1NJJA 5CKSA 4IPJA 4NJGA 3REQA 3LZ5A 5A3HA 3IAPA 2WKLA 1QR7A 4X61A 1EPVA 2C15A 3BVJA 4LYQA 4F0SA 1ZAIA 2PF8A 4TVDA 3SGZA 1LJYA 4NASA 3DZ1A 1GKPA 1Q65A 5JH2A 1OINA 4ZB5A 2GOUA 2GYIA 2F8QA 5IOBA 3SCNA 3ZFH