3SVDA

Engineered medium-affinity halide-binding protein derived from yfp: bromide complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
230
structure length
229
Chain Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVTCFARYPDHMRQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Determination of engineered chloride-binding site structures in fluorescent proteins reveals principles of halide recognition
rcsb
source organism Aequorea victoria
molecule tags Halide binding protein
total genus 57
structure length 229
sequence length 230
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3svdA00
4EMQA 4L13A 3UFZA 1GGXA 1XMZA 4KF4A 4R6BA 3O77A 1QYFA 1W7SA 2H8QA 3ZUJA 2QLEA 2WSNA 3CD9A 4LJDA 3RWAA 1W7TA 5EXBA 3I19A 5HW9A 4BDUA 3DQ7A 2H5OA 2OJKA 3DQ8A 3TMRA 4IK4A 3ST4A 2GW3A 3DQFA 5DTYA 3SG7A 1XAEA 2VVIA 4JFGA 3SSLA 2WHTA 2HQKA 4W6TA 5H89A 3S05A 3LF3A 4JGEA 5FHVA 4KPIA 3ZTFA 2GW4B 1RMMA 2JADA 3VHTB 4H3NA 1EMMA 1GL4A 4Q9WA 5LK4A 4ZFSA 3DQCA 3DQ5A 5FVGA 3W1CA 4DXQA 4Q7RA 4RYWA 3BXCA 2A46A 4R6DA 5EHUA 2DDCA 2VZXA 4W6OA 3DQHA 2VVJA 3H1RA 2HPWA 4Q9XA 2GX2A 4IK9A 3OSQA 5LTPA 5LTRA 5H87A 2OTBA 2QLIA 3PIBA 4ZBLA 1F0BA 2VAEA 3DQUA 4I2YA 3U8CA 2DUEA 4W69A 2HQZA 4DXMA 2AWKA 2YE1A 4W7CA 1Q4DA 3BXBA 4W6GA 4W7AA 4GF6B 1YHIA 3CGLA 4KAGA 2Z1OA 2PXSA 3SSTA 5DRGA 2YDZA 2WSOA 1JBYA 1JC0A 1QY3A 4KEXA 4KGEA 1H4UA 4TZGA 3DQKA 2QLGA 1OXDA 2AHAA 4ZF3A 5DU0A 2ARLA 3SVCA 5KTGA 2WHSA 4AS8A 2WHUA 2H9WA 3ADFA 4ZF5A 5BT0A 3U0NA 3WLCA 2AWJA 3LVDA 4HQCA 1YZWA 2QRFA 2OTEA 3DQ3A 4W76A 2QLHA 4OY4A 3SG3A 3NF0A 3SRYA 3EVUA 3SSKA 2DUHA 4AR7A 5DPIA 5H88A 2DUFA 3DQOA 1QXTA 3ED8A 4W7EA 3LVAA 4NWSA 3ZULA 5DPJA 3GJ1A 3K1KA 1EMFA 3DQ6A 3SSPA 3SVRA 4JC2A 1XA9A 2POXA 3SVOA 4P1QA 3PJBA 2HGDA 3KCTA 4W6PA 1EMBA 2G2SB 4J89A 4H47A 1ZGPA 2IB6A 3SVUA 3DQNA 4IZNA 4Z4KA 2G6YA 5EXCI 3DQ2A 4Z4MA 2HGYA 4B5YA 4L1IA 4W6RA 4OGSA 1YFPA 1H6RA 2AH8A 3CFHA 4IK8A 4EULA 2G16B 1QYOA 1S6ZA 3AI5A 2FZUA 5J2OA 3EK7A 2A53B 2IB5A 5DQBA 2HRSA 4B30B 3U8AA 3OGOA 2OGRA 2ZMWA 1YHHA 1RRXA 1MOVA 1EMGA 4HQ9A 1MOUA 5DRFA 4DXPA 2YE0A 3E5TA 4DKNA 3SVDA 2IOVA 3SG4A 5DPHA 1EMKA 2A47A 1ZGOA 2A50B 3EVRA 4Q7TA 2WURA 3TMTA 3NT3A 2B3PA 4PPJA 4KW4A 3LS3A 2VVHA 3SSHA 3SVNA 3DQ4A 3DQMA 3CD1A 1CV7A 2BTJA 4W7DA 3CFFA 3SG5A 2HFCA 4W6AA 4XL5A 3VHTA 4ZF4A 3DQ1A 5HZSA 2EMOA 4W6MA 2DD9A 5EXUA 3V3DA 1JBZA 2YFPA 4W6CA 2B3QA 2O29A 3KCSA 4KF5C 1MYWA 4JEOA 2G3OA 3DQAA 2PXWA 4W77A 1EMEA 1YJ2A 3ST3A 5FVFA 2AWMA 2EMDA 1XSSA 4W6NA 4W6HA 2OKYA 2G3DB 3VICA 1EMCA 4W7XA 5F9GA 2Y0GA 3GB3A 3M22A 4IK3A 5DTLA 1Q4BA 2Z6ZA 3DPZA 4W6LA 3UG0A 5BTTB 4EDOA 1C4FA 1KYPA 1G7KA 3NEZA 1KP5A 2V4EB 3MGFA 4OJ0A 4W6BA 3CB9A 3H1OA 4HQ8A 1UISA 2DDDA 4W6IA 4ANJA 5EBJA 4IK1A 1Q4EA 2G6XA 4DXIA 2A48A 3CBEA 3RWTA 2AWLA 3U0MA 3OSRA 2FWQA 1F09A 3SSVA 3PJ5A 2QZ0A 1RM9A 2QU1A 4JF9A 4W6KA 3LF4B 4IK5A 4OHSA 4DXNA 2G6EA 4XVPA 1B9CA 1ZUXA 4ZIOA 5EJUA 3AI4A 2VADA 2H6VA 4KF5A 4W6UA 4H48A 3DQDA 3ST0A 3LVCA 4H3LA 3LA1A 3A8SA 5DTXA 4ZB1A 3EKJA 4DXOA 3DPWA 5HGEA 2A52B 1OXFA 2C9JA 2EMNA 4PPLA 3WLDA 5DPGA 3DQEA 4N3DA 4EDSA 2QT2A 3GEXA 3BX9A 3NT9A 4W6FA 3P8UA 5HZTA 3LSAA 3SVSA 1HCJA 4TZAA 5DTZA 5EB7A 3EVVA 3CFAA 3W1DA 4HVFA 5DQMA 5BQLA 4W75A 4W7RA 3DQLA 3M24A 1YHGA 4RYSA 3SSYA 3EK4A 4XGYA 4J88A 4W73A 1ZGQA 3IP2A 2C9IA 3DQIA 5LTQA 4KW8A 1W7UA 3O78A 3SG2A 1RMOA 4W74A 2P4MA 4UTSA 4ORNA 4PFEA 1OXEA 4J8AA 2RH7A 2ZO7A 3SV5A 3GJ2A 4OQWA 5HZUA 3E5VA 3BXAA 4B30A 1Q4CA 3E5WA 3GL4A 3PJ7A 2G5ZB 4L12A 4W7FA 5EB6A 5HZOA 3EVPA 2DD7A 2H5PA 2WIQA 3WCKA 2Q57A 2V4EC 4LJBA 2ZMUA 1QYQA 2QLGB 4GOBA 4DKMA 4RTCA 3U0KA 1EMLA 2DUGA 4KW9A 1KYRA 4W72A 4LJCA 4HE4A 1Z1PA 2HJOA 4H3MA 2DUIA 2A54B 2Z6XA 3DPXA 2GX0A 1Z1QA 2HCGA 5T3IA 1XQMA 4LQTA 1Q73A 4W6SA 4P76A 1YJFA 3SS0A 4JRBA 4PPKA 3SVBA 4LJDC 4W6DA 4GESB 3EK8A 2Q6PA 3DQ9A 5AQBB 2A56B 3P28A 3VK1A 4KGFA 4W6JA 4LQUA 3ST2A 3IR8A 3U8PA 3G9AA 1RMPA 1Q4AA 2O24A 1HUYA 1KYSA 4XOVA 3ZUFA 3NEDA 4LW5A 4Q7UA 2ZO6A 5DY6A 4ZINA 5BTTA 2IE2A 5HBDA 1BFPA 4KA9A 1EMAA 1JC1A 2V4EA 4U2VA 2H5RA 3AKOA 2O2BA 2Z6YA 2ICRA 2FL1A 2OKWA 2H5QA 3SG6A 3U0LA 5FVIA 3EKHA 4XOWA 1GFLA 3SVEA 3DQJA 4EN1A 2WISA
chains in the Genus database with same CATH superfamily
4EMQA 4L13A 3UFZA 1GGXA 1XMZA 4KF4A 4R6BA 3O77A 1QYFA 1W7SA 2H8QA 3ZUJA 2QLEA 2WSNA 3CD9A 4LJDA 3RWAA 1W7TA 5EXBA 3I19A 5HW9A 4BDUA 3DQ7A 2H5OA 2OJKA 3DQ8A 3TMRA 4IK4A 3ST4A 2GW3A 3DQFA 5DTYA 3SG7A 1XAEA 2VVIA 4JFGA 3SSLA 2WHTA 2HQKA 4W6TA 5H89A 3S05A 3LF3A 4JGEA 5FHVA 4KPIA 3ZTFA 2GW4B 1RMMA 2JADA 3VHTB 4H3NA 1EMMA 1GL4A 4Q9WA 5LK4A 4ZFSA 3DQCA 3DQ5A 5FVGA 3W1CA 4DXQA 4Q7RA 4RYWA 3BXCA 2A46A 4R6DA 5EHUA 2DDCA 2VZXA 4W6OA 3DQHA 2VVJA 3H1RA 2HPWA 4Q9XA 2GX2A 4IK9A 3OSQA 5LTPA 5LTRA 5H87A 2OTBA 2QLIA 3PIBA 4ZBLA 1F0BA 2VAEA 3DQUA 4I2YA 3U8CA 2DUEA 4W69A 2HQZA 4DXMA 2AWKA 2YE1A 4W7CA 1Q4DA 3BXBA 4W6GA 4W7AA 4GF6B 1YHIA 3CGLA 4KAGA 2Z1OA 2PXSA 3SSTA 5DRGA 2YDZA 2WSOA 1JBYA 1JC0A 1QY3A 4KEXA 4KGEA 1H4UA 4TZGA 3DQKA 2QLGA 1OXDA 2AHAA 4ZF3A 5DU0A 2ARLA 3SVCA 5KTGA 2WHSA 4AS8A 2WHUA 2H9WA 3ADFA 4ZF5A 5BT0A 3U0NA 3WLCA 2AWJA 3LVDA 4HQCA 1YZWA 2QRFA 2OTEA 3DQ3A 4W76A 2QLHA 4OY4A 3SG3A 3NF0A 3SRYA 3EVUA 3SSKA 2DUHA 4AR7A 5DPIA 5H88A 2DUFA 3DQOA 1QXTA 3ED8A 4W7EA 3LVAA 4NWSA 3ZULA 5DPJA 3GJ1A 3K1KA 1EMFA 3DQ6A 3SSPA 3SVRA 4JC2A 1XA9A 2POXA 3SVOA 4P1QA 3PJBA 2HGDA 3KCTA 4W6PA 1EMBA 2G2SB 4J89A 4H47A 1ZGPA 2IB6A 3SVUA 3DQNA 4IZNA 4Z4KA 2G6YA 5EXCI 3DQ2A 4Z4MA 2HGYA 4B5YA 4L1IA 4W6RA 4OGSA 1YFPA 1H6RA 2AH8A 3CFHA 4IK8A 4EULA 2G16B 1QYOA 1S6ZA 3AI5A 2FZUA 5J2OA 3EK7A 2A53B 2IB5A 5DQBA 2HRSA 4B30B 3U8AA 3OGOA 2OGRA 2ZMWA 1YHHA 1RRXA 1MOVA 1EMGA 4HQ9A 1MOUA 5DRFA 4DXPA 2YE0A 3E5TA 4DKNA 3SVDA 2IOVA 3SG4A 5DPHA 1EMKA 2A47A 1ZGOA 2A50B 3EVRA 4Q7TA 2WURA 3TMTA 3NT3A 2B3PA 4PPJA 4KW4A 3LS3A 2VVHA 3SSHA 3SVNA 3DQ4A 3DQMA 3CD1A 1CV7A 2BTJA 4W7DA 3CFFA 3SG5A 2HFCA 4W6AA 4XL5A 3VHTA 4ZF4A 3DQ1A 5HZSA 2EMOA 4W6MA 2DD9A 5EXUA 3V3DA 1JBZA 2YFPA 4W6CA 2B3QA 2O29A 3KCSA 4KF5C 1MYWA 4JEOA 2G3OA 3DQAA 2PXWA 4W77A 1EMEA 1YJ2A 3ST3A 5FVFA 2AWMA 2EMDA 1XSSA 4W6NA 4W6HA 2OKYA 2G3DB 3VICA 1EMCA 4W7XA 5F9GA 2Y0GA 3GB3A 3M22A 4IK3A 5DTLA 1Q4BA 2Z6ZA 3DPZA 4W6LA 3UG0A 5BTTB 4EDOA 1C4FA 1KYPA 1G7KA 3NEZA 1KP5A 2V4EB 3MGFA 4OJ0A 4W6BA 3CB9A 3H1OA 4HQ8A 1UISA 2DDDA 4W6IA 4ANJA 5EBJA 4IK1A 1Q4EA 2G6XA 4DXIA 2A48A 3CBEA 3RWTA 2AWLA 3U0MA 3OSRA 2FWQA 1F09A 3SSVA 3PJ5A 2QZ0A 1RM9A 2QU1A 4JF9A 4W6KA 3LF4B 4IK5A 4OHSA 4DXNA 2G6EA 4XVPA 1B9CA 1ZUXA 4ZIOA 5EJUA 3AI4A 2VADA 2H6VA 4KF5A 4W6UA 4H48A 3DQDA 3ST0A 3LVCA 4H3LA 3LA1A 3A8SA 5DTXA 4ZB1A 3EKJA 4DXOA 3DPWA 5HGEA 2A52B 1OXFA 2C9JA 2EMNA 4PPLA 3WLDA 5DPGA 3DQEA 4N3DA 4EDSA 2QT2A 3GEXA 3BX9A 3NT9A 4W6FA 3P8UA 5HZTA 3LSAA 3SVSA 1HCJA 4TZAA 5DTZA 5EB7A 3EVVA 3CFAA 3W1DA 4HVFA 5DQMA 5BQLA 4W75A 4W7RA 3DQLA 3M24A 1YHGA 4RYSA 3SSYA 3EK4A 4XGYA 4J88A 4W73A 1ZGQA 3IP2A 2C9IA 3DQIA 5LTQA 4KW8A 1W7UA 3O78A 3SG2A 1RMOA 4W74A 2P4MA 4UTSA 4ORNA 4PFEA 1OXEA 4J8AA 2RH7A 2ZO7A 3SV5A 3GJ2A 4OQWA 5HZUA 3E5VA 3BXAA 4B30A 1Q4CA 3E5WA 3GL4A 3PJ7A 2G5ZB 4L12A 4W7FA 5EB6A 5HZOA 3EVPA 2DD7A 2H5PA 2WIQA 3WCKA 2Q57A 2V4EC 4LJBA 2ZMUA 1QYQA 2QLGB 4GOBA 4DKMA 4RTCA 3U0KA 1EMLA 2DUGA 4KW9A 1KYRA 4W72A 4LJCA 4HE4A 1Z1PA 2HJOA 4H3MA 2DUIA 2A54B 2Z6XA 3DPXA 2GX0A 1Z1QA 2HCGA 5T3IA 1XQMA 4LQTA 1Q73A 4W6SA 4P76A 1YJFA 3SS0A 4JRBA 4PPKA 3SVBA 4LJDC 4W6DA 4GESB 3EK8A 2Q6PA 3DQ9A 5AQBB 2A56B 3P28A 3VK1A 4KGFA 4W6JA 4LQUA 3ST2A 3IR8A 3U8PA 3G9AA 1RMPA 1Q4AA 2O24A 1HUYA 1KYSA 4XOVA 3ZUFA 3NEDA 4LW5A 4Q7UA 2ZO6A 5DY6A 4ZINA 5BTTA 2IE2A 5HBDA 1BFPA 4KA9A 1EMAA 1JC1A 2V4EA 4U2VA 2H5RA 3AKOA 2O2BA 2Z6YA 2ICRA 2FL1A 2OKWA 2H5QA 3SG6A 3U0LA 5FVIA 3EKHA 4XOWA 1GFLA 3SVEA 3DQJA 4EN1A 2WISA
chains in the Genus database with same CATH topology
4EMQA 4L13A 3UFZA 1GGXA 1XMZA 4KF4A 4R6BA 3O77A 1QYFA 1W7SA 2H8QA 3ZUJA 2QLEA 2WSNA 3CD9A 4LJDA 3RWAA 1W7TA 5EXBA 3I19A 5HW9A 4BDUA 3DQ7A 2H5OA 2OJKA 3DQ8A 3TMRA 4IK4A 3ST4A 2GW3A 3DQFA 5DTYA 3SG7A 1XAEA 2VVIA 4JFGA 3SSLA 2WHTA 2HQKA 4W6TA 5H89A 3S05A 3LF3A 4JGEA 5FHVA 4KPIA 3ZTFA 2GW4B 1RMMA 2JADA 3VHTB 4H3NA 1EMMA 1GL4A 4Q9WA 5LK4A 4ZFSA 3DQCA 3DQ5A 5FVGA 3W1CA 4DXQA 4Q7RA 4RYWA 3BXCA 2A46A 4R6DA 5EHUA 2DDCA 2VZXA 4W6OA 3DQHA 2VVJA 3H1RA 2HPWA 4Q9XA 2GX2A 4IK9A 3OSQA 5LTPA 5LTRA 5H87A 2OTBA 2QLIA 3PIBA 4ZBLA 1F0BA 2VAEA 3DQUA 4I2YA 3U8CA 2DUEA 4W69A 2HQZA 4DXMA 2AWKA 2YE1A 4W7CA 1Q4DA 3BXBA 4W6GA 4W7AA 4GF6B 1YHIA 3CGLA 4KAGA 2Z1OA 2PXSA 3SSTA 5DRGA 2YDZA 2WSOA 1JBYA 1JC0A 1QY3A 4KEXA 4KGEA 1H4UA 4TZGA 3DQKA 2QLGA 1OXDA 2AHAA 4ZF3A 5DU0A 2ARLA 3SVCA 5KTGA 2WHSA 4AS8A 2WHUA 2H9WA 3ADFA 4ZF5A 5BT0A 3U0NA 3WLCA 2AWJA 3LVDA 4HQCA 1YZWA 2QRFA 2OTEA 3DQ3A 4W76A 2QLHA 4OY4A 3SG3A 3NF0A 3SRYA 3EVUA 3SSKA 2DUHA 4AR7A 5DPIA 5H88A 2DUFA 3DQOA 1QXTA 3ED8A 4W7EA 3LVAA 4NWSA 3ZULA 5DPJA 3GJ1A 3K1KA 1EMFA 3DQ6A 3SSPA 3SVRA 4JC2A 1XA9A 2POXA 3SVOA 4P1QA 3PJBA 2HGDA 3KCTA 4W6PA 1EMBA 2G2SB 4J89A 4H47A 1ZGPA 2IB6A 3SVUA 3DQNA 4IZNA 4Z4KA 2G6YA 5EXCI 3DQ2A 4Z4MA 2HGYA 4B5YA 4L1IA 4W6RA 4OGSA 1YFPA 1H6RA 2AH8A 3CFHA 4IK8A 4EULA 2G16B 1QYOA 1S6ZA 3AI5A 2FZUA 5J2OA 3EK7A 2A53B 2IB5A 5DQBA 2HRSA 4B30B 3U8AA 3OGOA 2OGRA 2ZMWA 1YHHA 1RRXA 1MOVA 1EMGA 4HQ9A 1MOUA 5DRFA 4DXPA 2YE0A 3E5TA 4DKNA 3SVDA 2IOVA 3SG4A 5DPHA 1EMKA 2A47A 1ZGOA 2A50B 3EVRA 4Q7TA 2WURA 3TMTA 3NT3A 2B3PA 4PPJA 4KW4A 3LS3A 2VVHA 3SSHA 3SVNA 3DQ4A 3DQMA 3CD1A 1CV7A 2BTJA 4W7DA 3CFFA 3SG5A 2HFCA 4W6AA 4XL5A 3VHTA 4ZF4A 3DQ1A 5HZSA 2EMOA 4W6MA 2DD9A 5EXUA 3V3DA 1JBZA 2YFPA 4W6CA 2B3QA 2O29A 3KCSA 4KF5C 1MYWA 4JEOA 2G3OA 3DQAA 2PXWA 4W77A 1EMEA 1YJ2A 3ST3A 5FVFA 2AWMA 2EMDA 1XSSA 4W6NA 4W6HA 2OKYA 2G3DB 3VICA 1EMCA 4W7XA 5F9GA 2Y0GA 3GB3A 3M22A 4IK3A 5DTLA 1Q4BA 2Z6ZA 3DPZA 4W6LA 3UG0A 5BTTB 4EDOA 1C4FA 1KYPA 1G7KA 3NEZA 1KP5A 2V4EB 3MGFA 4OJ0A 4W6BA 3CB9A 3H1OA 4HQ8A 1UISA 2DDDA 4W6IA 4ANJA 5EBJA 4IK1A 1Q4EA 2G6XA 4DXIA 2A48A 3CBEA 3RWTA 2AWLA 3U0MA 3OSRA 2FWQA 1F09A 3SSVA 3PJ5A 2QZ0A 1RM9A 2QU1A 4JF9A 4W6KA 3LF4B 4IK5A 4OHSA 4DXNA 2G6EA 4XVPA 1B9CA 1ZUXA 4ZIOA 5EJUA 3AI4A 2VADA 2H6VA 4KF5A 4W6UA 4H48A 3DQDA 3ST0A 3LVCA 4H3LA 3LA1A 3A8SA 5DTXA 4ZB1A 3EKJA 4DXOA 3DPWA 5HGEA 2A52B 1OXFA 2C9JA 2EMNA 4PPLA 3WLDA 5DPGA 3DQEA 4N3DA 4EDSA 2QT2A 3GEXA 3BX9A 3NT9A 4W6FA 3P8UA 5HZTA 3LSAA 3SVSA 1HCJA 4TZAA 5DTZA 5EB7A 3EVVA 3CFAA 3W1DA 4HVFA 5DQMA 5BQLA 4W75A 4W7RA 3DQLA 3M24A 1YHGA 4RYSA 3SSYA 3EK4A 4XGYA 4J88A 4W73A 1ZGQA 3IP2A 2C9IA 3DQIA 5LTQA 4KW8A 1W7UA 3O78A 3SG2A 1RMOA 4W74A 2P4MA 4UTSA 4ORNA 4PFEA 1OXEA 4J8AA 2RH7A 2ZO7A 3SV5A 3GJ2A 4OQWA 5HZUA 3E5VA 3BXAA 4B30A 1Q4CA 3E5WA 3GL4A 3PJ7A 2G5ZB 4L12A 4W7FA 5EB6A 5HZOA 3EVPA 2DD7A 2H5PA 2WIQA 3WCKA 2Q57A 2V4EC 4LJBA 2ZMUA 1QYQA 2QLGB 4GOBA 4DKMA 4RTCA 3U0KA 1EMLA 2DUGA 4KW9A 1KYRA 4W72A 4LJCA 4HE4A 1Z1PA 2HJOA 4H3MA 2DUIA 2A54B 2Z6XA 3DPXA 2GX0A 1Z1QA 2HCGA 5T3IA 1XQMA 4LQTA 1Q73A 4W6SA 4P76A 1YJFA 3SS0A 4JRBA 4PPKA 3SVBA 4LJDC 4W6DA 4GESB 3EK8A 2Q6PA 3DQ9A 5AQBB 2A56B 3P28A 3VK1A 4KGFA 4W6JA 4LQUA 3ST2A 3IR8A 3U8PA 3G9AA 1RMPA 1Q4AA 2O24A 1HUYA 1KYSA 4XOVA 3ZUFA 3NEDA 4LW5A 4Q7UA 2ZO6A 5DY6A 4ZINA 5BTTA 2IE2A 5HBDA 1BFPA 4KA9A 1EMAA 1JC1A 2V4EA 4U2VA 2H5RA 3AKOA 2O2BA 2Z6YA 2ICRA 2FL1A 2OKWA 2H5QA 3SG6A 3U0LA 5FVIA 3EKHA 4XOWA 1GFLA 3SVEA 3DQJA 4EN1A 2WISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMQ A;  4L13 A;  3UFZ A;  1GGX A;  1XMZ A;  4KF4 A;  4R6B A;  3O77 A;  1QYF A;  1W7S A;  2H8Q A;  3ZUJ A;  2QLE A;  2WSN A;  3CD9 A;  4LJD A;  3RWA A;  1W7T A;  5EXB A;  3I19 A;  5HW9 A;  4BDU A;  3DQ7 A;  2H5O A;  2OJK A;  3DQ8 A;  3TMR A;  4IK4 A;  3ST4 A;  2GW3 A;  3DQF A;  5DTY A;  3SG7 A;  1XAE A;  2VVI A;  4JFG A;  3SSL A;  2WHT A;  2HQK A;  4W6T A;  5H89 A;  3S05 A;  3LF3 A;  4JGE A;  5FHV A;  4KPI A;  3ZTF A;  2GW4 B;  1RMM A;  2JAD A;  3VHT B;  4H3N A;  1EMM A;  1GL4 A;  4Q9W A;  5LK4 A;  4ZFS A;  3DQC A;  3DQ5 A;  5FVG A;  3W1C A;  4DXQ A;  4Q7R A;  4RYW A;  3BXC A;  2A46 A;  4R6D A;  5EHU A;  2DDC A;  2VZX A;  4W6O A;  3DQH A;  2VVJ A;  3H1R A;  2HPW A;  4Q9X A;  2GX2 A;  4IK9 A;  3OSQ A;  5LTP A;  5LTR A;  5H87 A;  2OTB A;  2QLI A;  3PIB A;  4ZBL A;  1F0B A;  2VAE A;  3DQU A;  4I2Y A;  3U8C A;  2DUE A;  4W69 A;  2HQZ A;  4DXM A;  2AWK A;  2YE1 A;  4W7C A;  1Q4D A;  3BXB A;  4W6G A;  4W7A A;  4GF6 B;  1YHI A;  3CGL A;  4KAG A;  2Z1O A;  2PXS A;  3SST A;  5DRG A;  2YDZ A;  2WSO A;  1JBY A;  1JC0 A;  1QY3 A;  4KEX A;  4KGE A;  1H4U A;  4TZG A;  3DQK A;  2QLG A;  1OXD A;  2AHA A;  4ZF3 A;  5DU0 A;  2ARL A;  3SVC A;  5KTG A;  2WHS A;  4AS8 A;  2WHU A;  2H9W A;  3ADF A;  4ZF5 A;  5BT0 A;  3U0N A;  3WLC A;  2AWJ A;  3LVD A;  4HQC A;  1YZW A;  2QRF A;  2OTE A;  3DQ3 A;  4W76 A;  2QLH A;  4OY4 A;  3SG3 A;  3NF0 A;  3SRY A;  3EVU A;  3SSK A;  2DUH A;  4AR7 A;  5DPI A;  5H88 A;  2DUF A;  3DQO A;  1QXT A;  3ED8 A;  4W7E A;  3LVA A;  4NWS A;  3ZUL A;  5DPJ A;  3GJ1 A;  3K1K A;  1EMF A;  3DQ6 A;  3SSP A;  3SVR A;  4JC2 A;  1XA9 A;  2POX A;  3SVO A;  4P1Q A;  3PJB A;  2HGD A;  3KCT A;  4W6P A;  1EMB A;  2G2S B;  4J89 A;  4H47 A;  1ZGP A;  2IB6 A;  3SVU A;  3DQN A;  4IZN A;  4Z4K A;  2G6Y A;  5EXC I;  3DQ2 A;  4Z4M A;  2HGY A;  4B5Y A;  4L1I A;  4W6R A;  4OGS A;  1YFP A;  1H6R A;  2AH8 A;  3CFH A;  4IK8 A;  4EUL A;  2G16 B;  1QYO A;  1S6Z A;  3AI5 A;  2FZU A;  5J2O A;  3EK7 A;  2A53 B;  2IB5 A;  5DQB A;  2HRS A;  4B30 B;  3U8A A;  3OGO A;  2OGR A;  2ZMW A;  1YHH A;  1RRX A;  1MOV A;  1EMG A;  4HQ9 A;  1MOU A;  5DRF A;  4DXP A;  2YE0 A;  3E5T A;  4DKN A;  3SVD A;  2IOV A;  3SG4 A;  5DPH A;  1EMK A;  2A47 A;  1ZGO A;  2A50 B;  3EVR A;  4Q7T A;  2WUR A;  3TMT A;  3NT3 A;  2B3P A;  4PPJ A;  4KW4 A;  3LS3 A;  2VVH A;  3SSH A;  3SVN A;  3DQ4 A;  3DQM A;  3CD1 A;  1CV7 A;  2BTJ A;  4W7D A;  3CFF A;  3SG5 A;  2HFC A;  4W6A A;  4XL5 A;  3VHT A;  4ZF4 A;  3DQ1 A;  5HZS A;  2EMO A;  4W6M A;  2DD9 A;  5EXU A;  3V3D A;  1JBZ A;  2YFP A;  4W6C A;  2B3Q A;  2O29 A;  3KCS A;  4KF5 C;  1MYW A;  4JEO A;  2G3O A;  3DQA A;  2PXW A;  4W77 A;  1EME A;  1YJ2 A;  3ST3 A;  5FVF A;  2AWM A;  2EMD A;  1XSS A;  4W6N A;  4W6H A;  2OKY A;  2G3D B;  3VIC A;  1EMC A;  4W7X A;  5F9G A;  2Y0G A;  3GB3 A;  3M22 A;  4IK3 A;  5DTL A;  1Q4B A;  2Z6Z A;  3DPZ A;  4W6L A;  3UG0 A;  5BTT B;  4EDO A;  1C4F A;  1KYP A;  1G7K A;  3NEZ A;  1KP5 A;  2V4E B;  3MGF A;  4OJ0 A;  4W6B A;  3CB9 A;  3H1O A;  4HQ8 A;  1UIS A;  2DDD A;  4W6I A;  4ANJ A;  5EBJ A;  4IK1 A;  1Q4E A;  2G6X A;  4DXI A;  2A48 A;  3CBE A;  3RWT A;  2AWL A;  3U0M A;  3OSR A;  2FWQ A;  1F09 A;  3SSV A;  3PJ5 A;  2QZ0 A;  1RM9 A;  2QU1 A;  4JF9 A;  4W6K A;  3LF4 B;  4IK5 A;  4OHS A;  4DXN A;  2G6E A;  4XVP A;  1B9C A;  1ZUX A;  4ZIO A;  5EJU A;  3AI4 A;  2VAD A;  2H6V A;  4KF5 A;  4W6U A;  4H48 A;  3DQD A;  3ST0 A;  3LVC A;  4H3L A;  3LA1 A;  3A8S A;  5DTX A;  4ZB1 A;  3EKJ A;  4DXO A;  3DPW A;  5HGE A;  2A52 B;  1OXF A;  2C9J A;  2EMN A;  4PPL A;  3WLD A;  5DPG A;  3DQE A;  4N3D A;  4EDS A;  2QT2 A;  3GEX A;  3BX9 A;  3NT9 A;  4W6F A;  3P8U A;  5HZT A;  3LSA A;  3SVS A;  1HCJ A;  4TZA A;  5DTZ A;  5EB7 A;  3EVV A;  3CFA A;  3W1D A;  4HVF A;  5DQM A;  5BQL A;  4W75 A;  4W7R A;  3DQL A;  3M24 A;  1YHG A;  4RYS A;  3SSY A;  3EK4 A;  4XGY A;  4J88 A;  4W73 A;  1ZGQ A;  3IP2 A;  2C9I A;  3DQI A;  5LTQ A;  4KW8 A;  1W7U A;  3O78 A;  3SG2 A;  1RMO A;  4W74 A;  2P4M A;  4UTS A;  4ORN A;  4PFE A;  1OXE A;  4J8A A;  2RH7 A;  2ZO7 A;  3SV5 A;  3GJ2 A;  4OQW A;  5HZU A;  3E5V A;  3BXA A;  4B30 A;  1Q4C A;  3E5W A;  3GL4 A;  3PJ7 A;  2G5Z B;  4L12 A;  4W7F A;  5EB6 A;  5HZO A;  3EVP A;  2DD7 A;  2H5P A;  2WIQ A;  3WCK A;  2Q57 A;  2V4E C;  4LJB A;  2ZMU A;  1QYQ A;  2QLG B;  4GOB A;  4DKM A;  4RTC A;  3U0K A;  1EML A;  2DUG A;  4KW9 A;  1KYR A;  4W72 A;  4LJC A;  4HE4 A;  1Z1P A;  2HJO A;  4H3M A;  2DUI A;  2A54 B;  2Z6X A;  3DPX A;  2GX0 A;  1Z1Q A;  2HCG A;  5T3I A;  1XQM A;  4LQT A;  1Q73 A;  4W6S A;  4P76 A;  1YJF A;  3SS0 A;  4JRB A;  4PPK A;  3SVB A;  4LJD C;  4W6D A;  4GES B;  3EK8 A;  2Q6P A;  3DQ9 A;  5AQB B;  2A56 B;  3P28 A;  3VK1 A;  4KGF A;  4W6J A;  4LQU A;  3ST2 A;  3IR8 A;  3U8P A;  3G9A A;  1RMP A;  1Q4A A;  2O24 A;  1HUY A;  1KYS A;  4XOV A;  3ZUF A;  3NED A;  4LW5 A;  4Q7U A;  2ZO6 A;  5DY6 A;  4ZIN A;  5BTT A;  2IE2 A;  5HBD A;  1BFP A;  4KA9 A;  1EMA A;  1JC1 A;  2V4E A;  4U2V A;  2H5R A;  3AKO A;  2O2B A;  2Z6Y A;  2ICR A;  2FL1 A;  2OKW A;  2H5Q A;  3SG6 A;  3U0L A;  5FVI A;  3EKH A;  4XOW A;  1GFL A;  3SVE A;  3DQJ A;  4EN1 A;  2WIS A; 
#chains in the Genus database with same CATH topology
 4EMQ A;  4L13 A;  3UFZ A;  1GGX A;  1XMZ A;  4KF4 A;  4R6B A;  3O77 A;  1QYF A;  1W7S A;  2H8Q A;  3ZUJ A;  2QLE A;  2WSN A;  3CD9 A;  4LJD A;  3RWA A;  1W7T A;  5EXB A;  3I19 A;  5HW9 A;  4BDU A;  3DQ7 A;  2H5O A;  2OJK A;  3DQ8 A;  3TMR A;  4IK4 A;  3ST4 A;  2GW3 A;  3DQF A;  5DTY A;  3SG7 A;  1XAE A;  2VVI A;  4JFG A;  3SSL A;  2WHT A;  2HQK A;  4W6T A;  5H89 A;  3S05 A;  3LF3 A;  4JGE A;  5FHV A;  4KPI A;  3ZTF A;  2GW4 B;  1RMM A;  2JAD A;  3VHT B;  4H3N A;  1EMM A;  1GL4 A;  4Q9W A;  5LK4 A;  4ZFS A;  3DQC A;  3DQ5 A;  5FVG A;  3W1C A;  4DXQ A;  4Q7R A;  4RYW A;  3BXC A;  2A46 A;  4R6D A;  5EHU A;  2DDC A;  2VZX A;  4W6O A;  3DQH A;  2VVJ A;  3H1R A;  2HPW A;  4Q9X A;  2GX2 A;  4IK9 A;  3OSQ A;  5LTP A;  5LTR A;  5H87 A;  2OTB A;  2QLI A;  3PIB A;  4ZBL A;  1F0B A;  2VAE A;  3DQU A;  4I2Y A;  3U8C A;  2DUE A;  4W69 A;  2HQZ A;  4DXM A;  2AWK A;  2YE1 A;  4W7C A;  1Q4D A;  3BXB A;  4W6G A;  4W7A A;  4GF6 B;  1YHI A;  3CGL A;  4KAG A;  2Z1O A;  2PXS A;  3SST A;  5DRG A;  2YDZ A;  2WSO A;  1JBY A;  1JC0 A;  1QY3 A;  4KEX A;  4KGE A;  1H4U A;  4TZG A;  3DQK A;  2QLG A;  1OXD A;  2AHA A;  4ZF3 A;  5DU0 A;  2ARL A;  3SVC A;  5KTG A;  2WHS A;  4AS8 A;  2WHU A;  2H9W A;  3ADF A;  4ZF5 A;  5BT0 A;  3U0N A;  3WLC A;  2AWJ A;  3LVD A;  4HQC A;  1YZW A;  2QRF A;  2OTE A;  3DQ3 A;  4W76 A;  2QLH A;  4OY4 A;  3SG3 A;  3NF0 A;  3SRY A;  3EVU A;  3SSK A;  2DUH A;  4AR7 A;  5DPI A;  5H88 A;  2DUF A;  3DQO A;  1QXT A;  3ED8 A;  4W7E A;  3LVA A;  4NWS A;  3ZUL A;  5DPJ A;  3GJ1 A;  3K1K A;  1EMF A;  3DQ6 A;  3SSP A;  3SVR A;  4JC2 A;  1XA9 A;  2POX A;  3SVO A;  4P1Q A;  3PJB A;  2HGD A;  3KCT A;  4W6P A;  1EMB A;  2G2S B;  4J89 A;  4H47 A;  1ZGP A;  2IB6 A;  3SVU A;  3DQN A;  4IZN A;  4Z4K A;  2G6Y A;  5EXC I;  3DQ2 A;  4Z4M A;  2HGY A;  4B5Y A;  4L1I A;  4W6R A;  4OGS A;  1YFP A;  1H6R A;  2AH8 A;  3CFH A;  4IK8 A;  4EUL A;  2G16 B;  1QYO A;  1S6Z A;  3AI5 A;  2FZU A;  5J2O A;  3EK7 A;  2A53 B;  2IB5 A;  5DQB A;  2HRS A;  4B30 B;  3U8A A;  3OGO A;  2OGR A;  2ZMW A;  1YHH A;  1RRX A;  1MOV A;  1EMG A;  4HQ9 A;  1MOU A;  5DRF A;  4DXP A;  2YE0 A;  3E5T A;  4DKN A;  3SVD A;  2IOV A;  3SG4 A;  5DPH A;  1EMK A;  2A47 A;  1ZGO A;  2A50 B;  3EVR A;  4Q7T A;  2WUR A;  3TMT A;  3NT3 A;  2B3P A;  4PPJ A;  4KW4 A;  3LS3 A;  2VVH A;  3SSH A;  3SVN A;  3DQ4 A;  3DQM A;  3CD1 A;  1CV7 A;  2BTJ A;  4W7D A;  3CFF A;  3SG5 A;  2HFC A;  4W6A A;  4XL5 A;  3VHT A;  4ZF4 A;  3DQ1 A;  5HZS A;  2EMO A;  4W6M A;  2DD9 A;  5EXU A;  3V3D A;  1JBZ A;  2YFP A;  4W6C A;  2B3Q A;  2O29 A;  3KCS A;  4KF5 C;  1MYW A;  4JEO A;  2G3O A;  3DQA A;  2PXW A;  4W77 A;  1EME A;  1YJ2 A;  3ST3 A;  5FVF A;  2AWM A;  2EMD A;  1XSS A;  4W6N A;  4W6H A;  2OKY A;  2G3D B;  3VIC A;  1EMC A;  4W7X A;  5F9G A;  2Y0G A;  3GB3 A;  3M22 A;  4IK3 A;  5DTL A;  1Q4B A;  2Z6Z A;  3DPZ A;  4W6L A;  3UG0 A;  5BTT B;  4EDO A;  1C4F A;  1KYP A;  1G7K A;  3NEZ A;  1KP5 A;  2V4E B;  3MGF A;  4OJ0 A;  4W6B A;  3CB9 A;  3H1O A;  4HQ8 A;  1UIS A;  2DDD A;  4W6I A;  4ANJ A;  5EBJ A;  4IK1 A;  1Q4E A;  2G6X A;  4DXI A;  2A48 A;  3CBE A;  3RWT A;  2AWL A;  3U0M A;  3OSR A;  2FWQ A;  1F09 A;  3SSV A;  3PJ5 A;  2QZ0 A;  1RM9 A;  2QU1 A;  4JF9 A;  4W6K A;  3LF4 B;  4IK5 A;  4OHS A;  4DXN A;  2G6E A;  4XVP A;  1B9C A;  1ZUX A;  4ZIO A;  5EJU A;  3AI4 A;  2VAD A;  2H6V A;  4KF5 A;  4W6U A;  4H48 A;  3DQD A;  3ST0 A;  3LVC A;  4H3L A;  3LA1 A;  3A8S A;  5DTX A;  4ZB1 A;  3EKJ A;  4DXO A;  3DPW A;  5HGE A;  2A52 B;  1OXF A;  2C9J A;  2EMN A;  4PPL A;  3WLD A;  5DPG A;  3DQE A;  4N3D A;  4EDS A;  2QT2 A;  3GEX A;  3BX9 A;  3NT9 A;  4W6F A;  3P8U A;  5HZT A;  3LSA A;  3SVS A;  1HCJ A;  4TZA A;  5DTZ A;  5EB7 A;  3EVV A;  3CFA A;  3W1D A;  4HVF A;  5DQM A;  5BQL A;  4W75 A;  4W7R A;  3DQL A;  3M24 A;  1YHG A;  4RYS A;  3SSY A;  3EK4 A;  4XGY A;  4J88 A;  4W73 A;  1ZGQ A;  3IP2 A;  2C9I A;  3DQI A;  5LTQ A;  4KW8 A;  1W7U A;  3O78 A;  3SG2 A;  1RMO A;  4W74 A;  2P4M A;  4UTS A;  4ORN A;  4PFE A;  1OXE A;  4J8A A;  2RH7 A;  2ZO7 A;  3SV5 A;  3GJ2 A;  4OQW A;  5HZU A;  3E5V A;  3BXA A;  4B30 A;  1Q4C A;  3E5W A;  3GL4 A;  3PJ7 A;  2G5Z B;  4L12 A;  4W7F A;  5EB6 A;  5HZO A;  3EVP A;  2DD7 A;  2H5P A;  2WIQ A;  3WCK A;  2Q57 A;  2V4E C;  4LJB A;  2ZMU A;  1QYQ A;  2QLG B;  4GOB A;  4DKM A;  4RTC A;  3U0K A;  1EML A;  2DUG A;  4KW9 A;  1KYR A;  4W72 A;  4LJC A;  4HE4 A;  1Z1P A;  2HJO A;  4H3M A;  2DUI A;  2A54 B;  2Z6X A;  3DPX A;  2GX0 A;  1Z1Q A;  2HCG A;  5T3I A;  1XQM A;  4LQT A;  1Q73 A;  4W6S A;  4P76 A;  1YJF A;  3SS0 A;  4JRB A;  4PPK A;  3SVB A;  4LJD C;  4W6D A;  4GES B;  3EK8 A;  2Q6P A;  3DQ9 A;  5AQB B;  2A56 B;  3P28 A;  3VK1 A;  4KGF A;  4W6J A;  4LQU A;  3ST2 A;  3IR8 A;  3U8P A;  3G9A A;  1RMP A;  1Q4A A;  2O24 A;  1HUY A;  1KYS A;  4XOV A;  3ZUF A;  3NED A;  4LW5 A;  4Q7U A;  2ZO6 A;  5DY6 A;  4ZIN A;  5BTT A;  2IE2 A;  5HBD A;  1BFP A;  4KA9 A;  1EMA A;  1JC1 A;  2V4E A;  4U2V A;  2H5R A;  3AKO A;  2O2B A;  2Z6Y A;  2ICR A;  2FL1 A;  2OKW A;  2H5Q A;  3SG6 A;  3U0L A;  5FVI A;  3EKH A;  4XOW A;  1GFL A;  3SVE A;  3DQJ A;  4EN1 A;  2WIS A; 
#chains in the Genus database with same CATH homology
 4EMQ A;  4L13 A;  3UFZ A;  1GGX A;  1XMZ A;  4KF4 A;  4R6B A;  3O77 A;  1QYF A;  1W7S A;  2H8Q A;  3ZUJ A;  2QLE A;  2WSN A;  3CD9 A;  4LJD A;  3RWA A;  1W7T A;  5EXB A;  3I19 A;  5HW9 A;  4BDU A;  3DQ7 A;  2H5O A;  2OJK A;  3DQ8 A;  3TMR A;  4IK4 A;  3ST4 A;  2GW3 A;  3DQF A;  5DTY A;  3SG7 A;  1XAE A;  2VVI A;  4JFG A;  3SSL A;  2WHT A;  2HQK A;  4W6T A;  5H89 A;  3S05 A;  3LF3 A;  4JGE A;  5FHV A;  4KPI A;  3ZTF A;  2GW4 B;  1RMM A;  2JAD A;  3VHT B;  4H3N A;  1EMM A;  1GL4 A;  4Q9W A;  5LK4 A;  4ZFS A;  3DQC A;  3DQ5 A;  5FVG A;  3W1C A;  4DXQ A;  4Q7R A;  4RYW A;  3BXC A;  2A46 A;  4R6D A;  5EHU A;  2DDC A;  2VZX A;  4W6O A;  3DQH A;  2VVJ A;  3H1R A;  2HPW A;  4Q9X A;  2GX2 A;  4IK9 A;  3OSQ A;  5LTP A;  5LTR A;  5H87 A;  2OTB A;  2QLI A;  3PIB A;  4ZBL A;  1F0B A;  2VAE A;  3DQU A;  4I2Y A;  3U8C A;  2DUE A;  4W69 A;  2HQZ A;  4DXM A;  2AWK A;  2YE1 A;  4W7C A;  1Q4D A;  3BXB A;  4W6G A;  4W7A A;  4GF6 B;  1YHI A;  3CGL A;  4KAG A;  2Z1O A;  2PXS A;  3SST A;  5DRG A;  2YDZ A;  2WSO A;  1JBY A;  1JC0 A;  1QY3 A;  4KEX A;  4KGE A;  1H4U A;  4TZG A;  3DQK A;  2QLG A;  1OXD A;  2AHA A;  4ZF3 A;  5DU0 A;  2ARL A;  3SVC A;  5KTG A;  2WHS A;  4AS8 A;  2WHU A;  2H9W A;  3ADF A;  4ZF5 A;  5BT0 A;  3U0N A;  3WLC A;  2AWJ A;  3LVD A;  4HQC A;  1YZW A;  2QRF A;  2OTE A;  3DQ3 A;  4W76 A;  2QLH A;  4OY4 A;  3SG3 A;  3NF0 A;  3SRY A;  3EVU A;  3SSK A;  2DUH A;  4AR7 A;  5DPI A;  5H88 A;  2DUF A;  3DQO A;  1QXT A;  3ED8 A;  4W7E A;  3LVA A;  4NWS A;  3ZUL A;  5DPJ A;  3GJ1 A;  3K1K A;  1EMF A;  3DQ6 A;  3SSP A;  3SVR A;  4JC2 A;  1XA9 A;  2POX A;  3SVO A;  4P1Q A;  3PJB A;  2HGD A;  3KCT A;  4W6P A;  1EMB A;  2G2S B;  4J89 A;  4H47 A;  1ZGP A;  2IB6 A;  3SVU A;  3DQN A;  4IZN A;  4Z4K A;  2G6Y A;  5EXC I;  3DQ2 A;  4Z4M A;  2HGY A;  4B5Y A;  4L1I A;  4W6R A;  4OGS A;  1YFP A;  1H6R A;  2AH8 A;  3CFH A;  4IK8 A;  4EUL A;  2G16 B;  1QYO A;  1S6Z A;  3AI5 A;  2FZU A;  5J2O A;  3EK7 A;  2A53 B;  2IB5 A;  5DQB A;  2HRS A;  4B30 B;  3U8A A;  3OGO A;  2OGR A;  2ZMW A;  1YHH A;  1RRX A;  1MOV A;  1EMG A;  4HQ9 A;  1MOU A;  5DRF A;  4DXP A;  2YE0 A;  3E5T A;  4DKN A;  3SVD A;  2IOV A;  3SG4 A;  5DPH A;  1EMK A;  2A47 A;  1ZGO A;  2A50 B;  3EVR A;  4Q7T A;  2WUR A;  3TMT A;  3NT3 A;  2B3P A;  4PPJ A;  4KW4 A;  3LS3 A;  2VVH A;  3SSH A;  3SVN A;  3DQ4 A;  3DQM A;  3CD1 A;  1CV7 A;  2BTJ A;  4W7D A;  3CFF A;  3SG5 A;  2HFC A;  4W6A A;  4XL5 A;  3VHT A;  4ZF4 A;  3DQ1 A;  5HZS A;  2EMO A;  4W6M A;  2DD9 A;  5EXU A;  3V3D A;  1JBZ A;  2YFP A;  4W6C A;  2B3Q A;  2O29 A;  3KCS A;  4KF5 C;  1MYW A;  4JEO A;  2G3O A;  3DQA A;  2PXW A;  4W77 A;  1EME A;  1YJ2 A;  3ST3 A;  5FVF A;  2AWM A;  2EMD A;  1XSS A;  4W6N A;  4W6H A;  2OKY A;  2G3D B;  3VIC A;  1EMC A;  4W7X A;  5F9G A;  2Y0G A;  3GB3 A;  3M22 A;  4IK3 A;  5DTL A;  1Q4B A;  2Z6Z A;  3DPZ A;  4W6L A;  3UG0 A;  5BTT B;  4EDO A;  1C4F A;  1KYP A;  1G7K A;  3NEZ A;  1KP5 A;  2V4E B;  3MGF A;  4OJ0 A;  4W6B A;  3CB9 A;  3H1O A;  4HQ8 A;  1UIS A;  2DDD A;  4W6I A;  4ANJ A;  5EBJ A;  4IK1 A;  1Q4E A;  2G6X A;  4DXI A;  2A48 A;  3CBE A;  3RWT A;  2AWL A;  3U0M A;  3OSR A;  2FWQ A;  1F09 A;  3SSV A;  3PJ5 A;  2QZ0 A;  1RM9 A;  2QU1 A;  4JF9 A;  4W6K A;  3LF4 B;  4IK5 A;  4OHS A;  4DXN A;  2G6E A;  4XVP A;  1B9C A;  1ZUX A;  4ZIO A;  5EJU A;  3AI4 A;  2VAD A;  2H6V A;  4KF5 A;  4W6U A;  4H48 A;  3DQD A;  3ST0 A;  3LVC A;  4H3L A;  3LA1 A;  3A8S A;  5DTX A;  4ZB1 A;  3EKJ A;  4DXO A;  3DPW A;  5HGE A;  2A52 B;  1OXF A;  2C9J A;  2EMN A;  4PPL A;  3WLD A;  5DPG A;  3DQE A;  4N3D A;  4EDS A;  2QT2 A;  3GEX A;  3BX9 A;  3NT9 A;  4W6F A;  3P8U A;  5HZT A;  3LSA A;  3SVS A;  1HCJ A;  4TZA A;  5DTZ A;  5EB7 A;  3EVV A;  3CFA A;  3W1D A;  4HVF A;  5DQM A;  5BQL A;  4W75 A;  4W7R A;  3DQL A;  3M24 A;  1YHG A;  4RYS A;  3SSY A;  3EK4 A;  4XGY A;  4J88 A;  4W73 A;  1ZGQ A;  3IP2 A;  2C9I A;  3DQI A;  5LTQ A;  4KW8 A;  1W7U A;  3O78 A;  3SG2 A;  1RMO A;  4W74 A;  2P4M A;  4UTS A;  4ORN A;  4PFE A;  1OXE A;  4J8A A;  2RH7 A;  2ZO7 A;  3SV5 A;  3GJ2 A;  4OQW A;  5HZU A;  3E5V A;  3BXA A;  4B30 A;  1Q4C A;  3E5W A;  3GL4 A;  3PJ7 A;  2G5Z B;  4L12 A;  4W7F A;  5EB6 A;  5HZO A;  3EVP A;  2DD7 A;  2H5P A;  2WIQ A;  3WCK A;  2Q57 A;  2V4E C;  4LJB A;  2ZMU A;  1QYQ A;  2QLG B;  4GOB A;  4DKM A;  4RTC A;  3U0K A;  1EML A;  2DUG A;  4KW9 A;  1KYR A;  4W72 A;  4LJC A;  4HE4 A;  1Z1P A;  2HJO A;  4H3M A;  2DUI A;  2A54 B;  2Z6X A;  3DPX A;  2GX0 A;  1Z1Q A;  2HCG A;  5T3I A;  1XQM A;  4LQT A;  1Q73 A;  4W6S A;  4P76 A;  1YJF A;  3SS0 A;  4JRB A;  4PPK A;  3SVB A;  4LJD C;  4W6D A;  4GES B;  3EK8 A;  2Q6P A;  3DQ9 A;  5AQB B;  2A56 B;  3P28 A;  3VK1 A;  4KGF A;  4W6J A;  4LQU A;  3ST2 A;  3IR8 A;  3U8P A;  3G9A A;  1RMP A;  1Q4A A;  2O24 A;  1HUY A;  1KYS A;  4XOV A;  3ZUF A;  3NED A;  4LW5 A;  4Q7U A;  2ZO6 A;  5DY6 A;  4ZIN A;  5BTT A;  2IE2 A;  5HBD A;  1BFP A;  4KA9 A;  1EMA A;  1JC1 A;  2V4E A;  4U2V A;  2H5R A;  3AKO A;  2O2B A;  2Z6Y A;  2ICR A;  2FL1 A;  2OKW A;  2H5Q A;  3SG6 A;  3U0L A;  5FVI A;  3EKH A;  4XOW A;  1GFL A;  3SVE A;  3DQJ A;  4EN1 A;  2WIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...