3SVIA

Structure of the pto-binding domain of hoppmal generated by limited thermolysin digestion
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
YTGAVPRANRIVQQLVEAGADLANIRTMFRNMLRGEEMILSRAEQNVFLQHFPDMLPCGIDRNSELAIALREALRRADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Type III effector HopAB2
publication title Structural Analysis of HopPmaL Reveals the Presence of a Second Adaptor Domain Common to the HopAB Family of Pseudomonas syringae Type III Effectors.
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Signaling protein
total genus 25
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2011-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.110 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3sviA00
3HGKE 3SVIA 3TJYA 3HGLA
chains in the Genus database with same CATH superfamily
5IREA 1MTYG 3SQ4A 4M3TA 4DU3A 3SUOA 2JHCA 2QXFA 3SPYA 2P1OB 3QETA 5H37A 3QEWA 1XMHE 4J2DA 3SUNA 3CFOA 3NHGA 1Q9YA 2H4TA 3C6OB 3L2OB 4KHQA 4FK0A 4FK2A 4ADOA 1FZ4E 4AI6A 5IZ7A 1FS1A 1WAFA 3SNNA 2OZMA 1XU3E 4AKGA 2JH9A 2RCUA 1FZ8E 3LZIA 3RMAA 4QNCA 3OGKB 3N1BA 3CFRA 3QNNA 1FZ1E 2DEBA 3NE6A 4AKHA 4DTNA 2B7MA 4I9QA 1FZIE 2VJ4A 4AKIA 4KHUA 1FXXA 3J2PA 4KHSA 1XVBE 1FZ6E 2DTUA 1Q9XA 3RMDA 3UO2A 2K5SA 3QEXA 4X5NA 3TAGA 3RWUA 3C6NB 1NEXB 4QNDA 2HD0A 3TABA 3SQ0A 4M3UA 4DTRA 4JS5A 3QEPA 3C6PB 3KD5E 4GAMC 4M3ZA 1XVGE 3BVOA 3OGLB 4DTXA 4M42A 3L1NA 2LF6A 3QEVA 3SQ1A 3QNOA 4FK4A 4J2AA 3HGLA 1FYZE 1FZHE 3SUQA 4FJ5A 2DY4A 4RL5A 2VIXA 3SPZA 4FJ8A 1FZ2E 4B08A 4EP9A 4KHYA 3LDBA 3TJYA 4RG8A 4FJLA 2E31A 1XMFE 1XVEE 3QESA 3TAFA 1P22A 3TAEA 4ADNA 2B8IA 4X5MA 4DTJA 1XU5E 3C94A 1MHZG 2FW3A 1FZ3E 2P1NB 2P1PB 4FJNA 4FVMA 4JRPA 3RMCA 2P5OA 3J27A 4M3RA 2JH8A 4FJ7A 2OVPB 4FJ9A 3NDKA 4J2BA 1N1CA 1WAJA 1CLQA 4EPHA 4EYWA 1FZ9E 3SUPA 3UIQA 4DTSA 3SI6A 1LDKE 3WSOA 2VJ5A 2P1QB 2LF3A 1XMGE 3LDSA 3RMBA 3L8BA 3LD8A 2ATQA 1XL3C 1XVDE 3MKSB 4J2EA 2MMBA 2OVQB 4DU1A 4DTPA 3SQ2A 4JRQA 3CFPA 3C95A 4DTUA 3NGIA 4KHNA 4RNGA 4FJJA 4KI6A 4M41A 2JHPA 4FJIA 1FZ7E 2MZWB 1MHYG 3NCIA 4JS4A 1IG9A 2OZSA 4E4BA 4M45A 2MW2A 3QEIA 3KD1E 3UO3A 4E3SA 4FJMA 4FJXA 4FJGA 2P5GA 1IH7A 1XVFE 1FZ0E 1JW2A 3E4WA 2PFTA 1FZ5E 3NAEA 4I6JB 5IBKB 3SCXA 3SJJA 3HL8A 4DTMA 3CQ8A 1XVCE 2B1EA 2RKHA 3E4YA 3N1EA 4FJHA 4HCBA 2OVRB 3OGMB 3S9HA 2FYOA 2JQTA 4I9LA 2JHAA 2P1MB 4DU4A 2OYQA 2YB5A 4ICGC 2E32A 4DTOA 3K2OA 1FPOA 4FJKA 3SVIA 4KI4A 4M3XA 2JPNA 4KHWA 2PFVA 4HCCA 3QERA 4M3YA 1MMOG 3HP9A 3L0MA 4IT5A 3LZJA 3V7DB 3HGKE 3TL8B 4M3WA
chains in the Genus database with same CATH topology
5IREA 1MTYG 3SQ4A 4M3TA 4DU3A 3SUOA 2JHCA 2QXFA 3SPYA 2P1OB 3QETA 5H37A 3QEWA 1XMHE 4J2DA 3SUNA 3CFOA 3NHGA 1Q9YA 2H4TA 3C6OB 3L2OB 4KHQA 4FK0A 4FK2A 4ADOA 1FZ4E 4AI6A 5IZ7A 1FS1A 1WAFA 3SNNA 2OZMA 1XU3E 4AKGA 2JH9A 2RCUA 1FZ8E 3LZIA 3RMAA 4QNCA 3OGKB 3N1BA 3CFRA 3QNNA 1FZ1E 2DEBA 3NE6A 4AKHA 4DTNA 2B7MA 4I9QA 1FZIE 2VJ4A 4AKIA 4KHUA 1FXXA 3J2PA 4KHSA 1XVBE 1FZ6E 2DTUA 1Q9XA 3RMDA 3QEXA 4X5NA 3TAGA 3RWUA 3C6NB 1NEXB 4QNDA 2HD0A 3TABA 3SQ0A 4M3UA 4DTRA 4JS5A 3QEPA 3C6PB 3KD5E 4GAMC 4M3ZA 1XVGE 3OGLB 4DTXA 4M42A 3L1NA 2LF6A 3QEVA 3SQ1A 3QNOA 4FK4A 4J2AA 3HGLA 1FYZE 1FZHE 3SUQA 4FJ5A 2DY4A 4RL5A 2VIXA 3SPZA 4FJ8A 1FZ2E 4B08A 4EP9A 4KHYA 3LDBA 3TJYA 4RG8A 4FJLA 2E31A 1XMFE 1XVEE 3QESA 3TAFA 1P22A 3TAEA 4ADNA 2B8IA 4X5MA 4DTJA 1XU5E 3C94A 1MHZG 2FW3A 1FZ3E 2P1NB 2P1PB 4FJNA 4FVMA 4JRPA 3RMCA 2P5OA 3J27A 4M3RA 2JH8A 4FJ7A 2OVPB 4FJ9A 3NDKA 4J2BA 1WAJA 1CLQA 4EPHA 4EYWA 1FZ9E 3SUPA 3UIQA 4DTSA 3SI6A 1LDKE 3WSOA 2VJ5A 2P1QB 2LF3A 1XMGE 3LDSA 3RMBA 3L8BA 3LD8A 2ATQA 1XL3C 1XVDE 3MKSB 4J2EA 2MMBA 2OVQB 4DU1A 4DTPA 3SQ2A 4JRQA 3CFPA 3C95A 4DTUA 3NGIA 4KHNA 4RNGA 4FJJA 4KI6A 4M41A 2JHPA 4FJIA 1FZ7E 2MZWB 1MHYG 3NCIA 4JS4A 1IG9A 2OZSA 4E4BA 4M45A 3QEIA 3KD1E 4FJXA 4E3SA 4FJMA 4FJGA 2P5GA 1IH7A 1XVFE 1FZ0E 3E4WA 2PFTA 1FZ5E 3NAEA 4I6JB 5IBKB 3SCXA 3SJJA 3HL8A 4DTMA 3CQ8A 1XVCE 2B1EA 3E4YA 3N1EA 4FJHA 4HCBA 2OVRB 3OGMB 3S9HA 2FYOA 4I9LA 2JHAA 2P1MB 4DU4A 2OYQA 2YB5A 2E32A 4DTOA 3K2OA 4KI4A 4FJKA 3SVIA 4M3XA 2JPNA 4KHWA 2PFVA 4HCCA 3QERA 4M3YA 1MMOG 3HP9A 3L0MA 3LZJA 3V7DB 3HGKE 3TL8B 4M3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HGK E;  3SVI A;  3TJY A;  3HGL A; 
#chains in the Genus database with same CATH topology
 5IRE A;  1MTY G;  3SQ4 A;  4M3T A;  4DU3 A;  3SUO A;  2JHC A;  2QXF A;  3SPY A;  2P1O B;  3QET A;  5H37 A;  3QEW A;  1XMH E;  4J2D A;  3SUN A;  3CFO A;  3NHG A;  1Q9Y A;  2H4T A;  3C6O B;  3L2O B;  4KHQ A;  4FK0 A;  4FK2 A;  4ADO A;  1FZ4 E;  4AI6 A;  5IZ7 A;  1FS1 A;  1WAF A;  3SNN A;  2OZM A;  1XU3 E;  4AKG A;  2JH9 A;  2RCU A;  1FZ8 E;  3LZI A;  3RMA A;  4QNC A;  3OGK B;  3N1B A;  3CFR A;  3QNN A;  1FZ1 E;  2DEB A;  3NE6 A;  4AKH A;  4DTN A;  2B7M A;  4I9Q A;  1FZI E;  2VJ4 A;  4AKI A;  4KHU A;  1FXX A;  3J2P A;  4KHS A;  1XVB E;  1FZ6 E;  2DTU A;  1Q9X A;  3RMD A;  3UO2 A;  2K5S A;  3QEX A;  4X5N A;  3TAG A;  3RWU A;  3C6N B;  1NEX B;  4QND A;  2HD0 A;  3TAB A;  3SQ0 A;  4M3U A;  4DTR A;  4JS5 A;  3QEP A;  3C6P B;  3KD5 E;  4GAM C;  4M3Z A;  1XVG E;  3BVO A;  3OGL B;  4DTX A;  4M42 A;  3L1N A;  2LF6 A;  3QEV A;  3SQ1 A;  3QNO A;  4FK4 A;  4J2A A;  3HGL A;  1FYZ E;  1FZH E;  3SUQ A;  4FJ5 A;  2DY4 A;  4RL5 A;  2VIX A;  3SPZ A;  4FJ8 A;  1FZ2 E;  4B08 A;  4EP9 A;  4KHY A;  3LDB A;  3TJY A;  4RG8 A;  4FJL A;  2E31 A;  1XMF E;  1XVE E;  3QES A;  3TAF A;  1P22 A;  3TAE A;  4ADN A;  2B8I A;  4X5M A;  4DTJ A;  1XU5 E;  3C94 A;  1MHZ G;  2FW3 A;  1FZ3 E;  2P1N B;  2P1P B;  4FJN A;  4FVM A;  4JRP A;  3RMC A;  2P5O A;  3J27 A;  4M3R A;  2JH8 A;  4FJ7 A;  2OVP B;  4FJ9 A;  3NDK A;  4J2B A;  1N1C A;  1WAJ A;  1CLQ A;  4EPH A;  4EYW A;  1FZ9 E;  3SUP A;  3UIQ A;  4DTS A;  3SI6 A;  1LDK E;  3WSO A;  2VJ5 A;  2P1Q B;  2LF3 A;  1XMG E;  3LDS A;  3RMB A;  3L8B A;  3LD8 A;  2ATQ A;  1XL3 C;  1XVD E;  3MKS B;  4J2E A;  2MMB A;  2OVQ B;  4DU1 A;  4DTP A;  3SQ2 A;  4JRQ A;  3CFP A;  3C95 A;  4DTU A;  3NGI A;  4KHN A;  4RNG A;  4FJJ A;  4KI6 A;  4M41 A;  2JHP A;  4FJI A;  1FZ7 E;  2MZW B;  1MHY G;  3NCI A;  4JS4 A;  1IG9 A;  2OZS A;  4E4B A;  4M45 A;  2MW2 A;  3QEI A;  3KD1 E;  3UO3 A;  4E3S A;  4FJM A;  4FJX A;  4FJG A;  2P5G A;  1IH7 A;  1XVF E;  1FZ0 E;  1JW2 A;  3E4W A;  2PFT A;  1FZ5 E;  3NAE A;  4I6J B;  5IBK B;  3SCX A;  3SJJ A;  3HL8 A;  4DTM A;  3CQ8 A;  1XVC E;  2B1E A;  2RKH A;  3E4Y A;  3N1E A;  4FJH A;  4HCB A;  2OVR B;  3OGM B;  3S9H A;  2FYO A;  2JQT A;  4I9L A;  2JHA A;  2P1M B;  4DU4 A;  2OYQ A;  2YB5 A;  4ICG C;  2E32 A;  4DTO A;  3K2O A;  1FPO A;  4FJK A;  3SVI A;  4KI4 A;  4M3X A;  2JPN A;  4KHW A;  2PFV A;  4HCC A;  3QER A;  4M3Y A;  1MMO G;  3HP9 A;  3L0M A;  4IT5 A;  3LZJ A;  3V7D B;  3HGK E;  3TL8 B;  4M3W A; 
#chains in the Genus database with same CATH homology
 5IRE A;  1MTY G;  3SQ4 A;  4M3T A;  4DU3 A;  3SUO A;  2JHC A;  2QXF A;  3SPY A;  2P1O B;  3QET A;  5H37 A;  3QEW A;  1XMH E;  4J2D A;  3SUN A;  3CFO A;  3NHG A;  1Q9Y A;  2H4T A;  3C6O B;  3L2O B;  4KHQ A;  4FK0 A;  4FK2 A;  4ADO A;  1FZ4 E;  4AI6 A;  5IZ7 A;  1FS1 A;  1WAF A;  3SNN A;  2OZM A;  1XU3 E;  4AKG A;  2JH9 A;  2RCU A;  1FZ8 E;  3LZI A;  3RMA A;  4QNC A;  3OGK B;  3N1B A;  3CFR A;  3QNN A;  1FZ1 E;  2DEB A;  3NE6 A;  4AKH A;  4DTN A;  2B7M A;  4I9Q A;  1FZI E;  2VJ4 A;  4AKI A;  4KHU A;  1FXX A;  3J2P A;  4KHS A;  1XVB E;  1FZ6 E;  2DTU A;  1Q9X A;  3RMD A;  3QEX A;  4X5N A;  3TAG A;  3RWU A;  3C6N B;  1NEX B;  4QND A;  2HD0 A;  3TAB A;  3SQ0 A;  4M3U A;  4DTR A;  4JS5 A;  3QEP A;  3C6P B;  3KD5 E;  4GAM C;  4M3Z A;  1XVG E;  3OGL B;  4DTX A;  4M42 A;  3L1N A;  2LF6 A;  3QEV A;  3SQ1 A;  3QNO A;  4FK4 A;  4J2A A;  3HGL A;  1FYZ E;  1FZH E;  3SUQ A;  4FJ5 A;  2DY4 A;  4RL5 A;  2VIX A;  3SPZ A;  4FJ8 A;  1FZ2 E;  4B08 A;  4EP9 A;  4KHY A;  3LDB A;  3TJY A;  4RG8 A;  4FJL A;  2E31 A;  1XMF E;  1XVE E;  3QES A;  3TAF A;  1P22 A;  3TAE A;  4ADN A;  2B8I A;  4X5M A;  4DTJ A;  1XU5 E;  3C94 A;  1MHZ G;  2FW3 A;  1FZ3 E;  2P1N B;  2P1P B;  4FJN A;  4FVM A;  4JRP A;  3RMC A;  2P5O A;  3J27 A;  4M3R A;  2JH8 A;  4FJ7 A;  2OVP B;  4FJ9 A;  3NDK A;  4J2B A;  1WAJ A;  1CLQ A;  4EPH A;  4EYW A;  1FZ9 E;  3SUP A;  3UIQ A;  4DTS A;  3SI6 A;  1LDK E;  3WSO A;  2VJ5 A;  2P1Q B;  2LF3 A;  1XMG E;  3LDS A;  3RMB A;  3L8B A;  3LD8 A;  2ATQ A;  1XL3 C;  1XVD E;  3MKS B;  4J2E A;  2MMB A;  2OVQ B;  4DU1 A;  4DTP A;  3SQ2 A;  4JRQ A;  3CFP A;  3C95 A;  4DTU A;  3NGI A;  4KHN A;  4RNG A;  4FJJ A;  4KI6 A;  4M41 A;  2JHP A;  4FJI A;  1FZ7 E;  2MZW B;  1MHY G;  3NCI A;  4JS4 A;  1IG9 A;  2OZS A;  4E4B A;  4M45 A;  3QEI A;  3KD1 E;  4FJX A;  4E3S A;  4FJM A;  4FJG A;  2P5G A;  1IH7 A;  1XVF E;  1FZ0 E;  3E4W A;  2PFT A;  1FZ5 E;  3NAE A;  4I6J B;  5IBK B;  3SCX A;  3SJJ A;  3HL8 A;  4DTM A;  3CQ8 A;  1XVC E;  2B1E A;  3E4Y A;  3N1E A;  4FJH A;  4HCB A;  2OVR B;  3OGM B;  3S9H A;  2FYO A;  4I9L A;  2JHA A;  2P1M B;  4DU4 A;  2OYQ A;  2YB5 A;  2E32 A;  4DTO A;  3K2O A;  4KI4 A;  4FJK A;  3SVI A;  4M3X A;  2JPN A;  4KHW A;  2PFV A;  4HCC A;  3QER A;  4M3Y A;  1MMO G;  3HP9 A;  3L0M A;  3LZJ A;  3V7D B;  3HGK E;  3TL8 B;  4M3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...