3SW0X

Structure of the c-terminal region (modules 18-20) of complement regulator factor h
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
186
structure length
186
Chain Sequence
b'GTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement factor H
publication title Structural Analysis of the C-Terminal Region (Modules 18-20) of Complement Regulator Factor H (FH).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3sw0X01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3sw0X02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3sw0X03
2XRDA 2V8EA 2RLPA 4C16A 2W80A 1HFHA 2A55A 3INBC 1U5MA 4LOSA 5I0QB 2KMSA 1E8BA 3KXVA 3ZD2A 2XRBA 4WJG2 1FBRA 5HYUB 4AYIA 4YNXA 3RJ3D 4MUCA 4AYMA 1H2QP 1GHQB 4FXGG 1Z92B 1GKNA 2IZ3A 2EC3A 2CG7A 4J38B 2WIIC 2JGXA 2JRAA 3OEDC 3L89M 1OK1A 1QUBA 2QY0A 1SRZA 1ELVA 2RKZA 1OK3A 1G4FA 2EHFA 1TPMA 1GKGA 4ONTD 5HYPA 2KRIA 4JHSA 3OP8A 1MD7A 2LOJA 3CALA 3ZRZA 3OXUD 4KKDA 2CKUA 3GXEA 3SW0X 1HCCA 1H04P 2ERJA 2O39C 2IZ4A 5HZPB 4B2RA 2JGWA 1CKLA 4B2SA 2XWJI 1E88A 1O9AA 4A5WB 3R62A 3GOVA 4CSYA 4AYDA 4K12A 1UOTP 4ZH1D 1OK9A 4F4OC 1H2PP 3ERBA 2MCZA 2RLQA 1OJVA 2RL0A 2UWNA 1TPGA 1E5GA 3O8EB 2G7IA 1Q3XA 5JPMG 1C1ZA 1TPNA 1OJYA 2MCYA 2CG6A 3MQLA 1PPQA 3EJHA 1HFIA 1H03P 1OJWA 4AYEA 2W81A 1G4GA 1OK2A 5FO8C 3IX0A 3T5OA 2XWBF 4DJZA 2YRAA 3TVJA 3NFPI 1NWVA 1GPZA 5HYTB 3KZJA 4IGDA 3M7PA 1QO6A 1MD8A 1ZJKA 1SS2A 4LOTA 1QGBA 4PZ5A 3IU3I 2BZMA 2B5ID 2XQWC 1VVDA 1VVCA 3ZD1A 2RKYA 1LY2A 2YBYA
chains in the Genus database with same CATH superfamily
2XRDA 2ZYCA 2V8EA 2RLPA 2Y8SA 4C16A 2W80A 1HFHA 2A55A 3INBC 4YIZA 1U5MA 4LOSA 5I0QB 2KMSA 1E8BA 3KXVA 3ZD2A 2XRBA 2Y8TA 4WJG2 1FBRA 5HYUB 4AYIA 2I2LA 3K3TA 4YNXA 3ZLEA 3RJ3D 4MUCA 3ZLDA 4AYMA 1H2QP 1GHQB 4FXGG 1Z92B 1GKNA 2IZ3A 2EC3A 2CG7A 4J38B 3WSXA 2WIIC 2JGXA 2JRAA 3OEDC 3L89M 1OK1A 1QUBA 5DN5A 2QY0A 3VWOA 1SRZA 1ELVA 4N7EA 2RKZA 1OK3A 1G4FA 4MSLA 2EHFA 1TPMA 1GKGA 4ONTD 5HYPA 2KRIA 4JHSA 3OP8A 1MD7A 2LOJA 3CALA 3ZRZA 3FGRA 3OXUD 4KKDA 2CKUA 2Y8RA 3GXEA 1HCCA 3SW0X 1H04P 2ERJA 2O39C 2IZ4A 4APLA 5HZPB 4B2RA 2JGWA 1CKLA 4B2SA 2XWJI 1E88A 1O9AA 4A5WB 3R62A 3GOVA 4CSYA 4PO7A 4BWCA 3NJAA 4AYDA 4K12A 1UOTP 3WSYA 4ZH1D 1OK9A 4F4OC 3FGTA 1H2PP 3ERBA 3F6KA 2MCZA 2RLQA 1OJVA 2RL0A 2UWNA 1TPGA 5DN4A 1E5GA 3O8EB 1RLHA 2G7IA 1Q3XA 5JPMG 1C1ZA 1TPNA 1OJYA 2MCYA 2CG6A 3MQLA 1PPQA 3EJHA 1HFIA 1H03P 1OJWA 4AYEA 2W81A 1G4GA 1OK2A 5FO8C 3IX0A 3T5OA 2XWBF 4DJZA 2YRAA 3TVJA 3NFPI 1NWVA 1GPZA 5HYTB 3KZJA 4IGDA 3M7PA 1QO6A 1MD8A 1ZJKA 1SS2A 2X2ZA 4LOTA 1QGBA 4PZ5A 3IU3I 2BZMA 3CI0J 2B5ID 2XQWC 1VVDA 1VVCA 3ZD1A 2RKYA 1LY2A 2YBYA
chains in the Genus database with same CATH topology
2XRDA 2V8EA 2RLPA 4C16A 2W80A 1HFHA 2A55A 3INBC 1U5MA 4LOSA 5I0QB 2KMSA 1E8BA 3KXVA 3ZD2A 2XRBA 4WJG2 1FBRA 5HYUB 4AYIA 4YNXA 3RJ3D 4MUCA 4AYMA 1H2QP 1GHQB 4FXGG 1Z92B 1GKNA 2IZ3A 2EC3A 2CG7A 4J38B 2WIIC 2JGXA 2JRAA 3OEDC 3L89M 1OK1A 1QUBA 2QY0A 1SRZA 1ELVA 2RKZA 1OK3A 1G4FA 2EHFA 1TPMA 1GKGA 4ONTD 5HYPA 2KRIA 4JHSA 3OP8A 1MD7A 2LOJA 3CALA 3ZRZA 3OXUD 4KKDA 2CKUA 3GXEA 3SW0X 1HCCA 1H04P 2ERJA 2O39C 2IZ4A 5HZPB 4B2RA 2JGWA 1CKLA 4B2SA 2XWJI 1E88A 1O9AA 4A5WB 3R62A 3GOVA 4CSYA 4AYDA 4K12A 1UOTP 4ZH1D 1OK9A 4F4OC 1H2PP 3ERBA 2MCZA 2RLQA 1OJVA 2RL0A 2UWNA 1TPGA 1E5GA 3O8EB 2G7IA 1Q3XA 5JPMG 1C1ZA 1TPNA 1OJYA 2MCYA 2CG6A 3MQLA 1PPQA 3EJHA 1HFIA 1H03P 1OJWA 4AYEA 2W81A 1G4GA 1OK2A 5FO8C 3IX0A 3T5OA 2XWBF 4DJZA 2YRAA 3TVJA 3NFPI 1NWVA 1GPZA 5HYTB 3KZJA 4IGDA 3M7PA 1QO6A 1MD8A 1ZJKA 1SS2A 4LOTA 1QGBA 4PZ5A 3IU3I 2BZMA 2B5ID 2XQWC 1VVDA 1VVCA 3ZD1A 2RKYA 1LY2A 2YBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRD A;  2V8E A;  2RLP A;  4C16 A;  2W80 A;  1HFH A;  2A55 A;  3INB C;  1U5M A;  4LOS A;  5I0Q B;  2KMS A;  1E8B A;  3KXV A;  3ZD2 A;  2XRB A;  4WJG 2;  1FBR A;  5HYU B;  4AYI A;  4YNX A;  3RJ3 D;  4MUC A;  4AYM A;  1H2Q P;  1GHQ B;  4FXG G;  1Z92 B;  1GKN A;  2IZ3 A;  2EC3 A;  2CG7 A;  4J38 B;  2WII C;  2JGX A;  2JRA A;  3OED C;  3L89 M;  1OK1 A;  1QUB A;  2QY0 A;  1SRZ A;  1ELV A;  2RKZ A;  1OK3 A;  1G4F A;  2EHF A;  1TPM A;  1GKG A;  4ONT D;  5HYP A;  2KRI A;  4JHS A;  3OP8 A;  1MD7 A;  2LOJ A;  3CAL A;  3ZRZ A;  3OXU D;  4KKD A;  2CKU A;  3GXE A;  3SW0 X;  1HCC A;  1H04 P;  2ERJ A;  2O39 C;  2IZ4 A;  5HZP B;  4B2R A;  2JGW A;  1CKL A;  4B2S A;  2XWJ I;  1E88 A;  1O9A A;  4A5W B;  3R62 A;  3GOV A;  4CSY A;  4AYD A;  4K12 A;  1UOT P;  4ZH1 D;  1OK9 A;  4F4O C;  1H2P P;  3ERB A;  2MCZ A;  2RLQ A;  1OJV A;  2RL0 A;  2UWN A;  1TPG A;  1E5G A;  3O8E B;  2G7I A;  1Q3X A;  5JPM G;  1C1Z A;  1TPN A;  1OJY A;  2MCY A;  2CG6 A;  3MQL A;  1PPQ A;  3EJH A;  1HFI A;  1H03 P;  1OJW A;  4AYE A;  2W81 A;  1G4G A;  1OK2 A;  5FO8 C;  3IX0 A;  3T5O A;  2XWB F;  4DJZ A;  2YRA A;  3TVJ A;  3NFP I;  1NWV A;  1GPZ A;  5HYT B;  3KZJ A;  4IGD A;  3M7P A;  1QO6 A;  1MD8 A;  1ZJK A;  1SS2 A;  4LOT A;  1QGB A;  4PZ5 A;  3IU3 I;  2BZM A;  2B5I D;  2XQW C;  1VVD A;  1VVC A;  3ZD1 A;  2RKY A;  1LY2 A;  2YBY A; 
#chains in the Genus database with same CATH topology
 2XRD A;  2ZYC A;  2V8E A;  2RLP A;  2Y8S A;  4C16 A;  2W80 A;  1HFH A;  2A55 A;  3INB C;  4YIZ A;  1U5M A;  4LOS A;  5I0Q B;  2KMS A;  1E8B A;  3KXV A;  3ZD2 A;  2XRB A;  2Y8T A;  4WJG 2;  1FBR A;  5HYU B;  4AYI A;  2I2L A;  3K3T A;  4YNX A;  3ZLE A;  3RJ3 D;  4MUC A;  3ZLD A;  4AYM A;  1H2Q P;  1GHQ B;  4FXG G;  1Z92 B;  1GKN A;  2IZ3 A;  2EC3 A;  2CG7 A;  4J38 B;  3WSX A;  2WII C;  2JGX A;  2JRA A;  3OED C;  3L89 M;  1OK1 A;  1QUB A;  5DN5 A;  2QY0 A;  3VWO A;  1SRZ A;  1ELV A;  4N7E A;  2RKZ A;  1OK3 A;  1G4F A;  4MSL A;  2EHF A;  1TPM A;  1GKG A;  4ONT D;  5HYP A;  2KRI A;  4JHS A;  3OP8 A;  1MD7 A;  2LOJ A;  3CAL A;  3ZRZ A;  3FGR A;  3OXU D;  4KKD A;  2CKU A;  2Y8R A;  3GXE A;  1HCC A;  3SW0 X;  1H04 P;  2ERJ A;  2O39 C;  2IZ4 A;  4APL A;  5HZP B;  4B2R A;  2JGW A;  1CKL A;  4B2S A;  2XWJ I;  1E88 A;  1O9A A;  4A5W B;  3R62 A;  3GOV A;  4CSY A;  4PO7 A;  4BWC A;  3NJA A;  4AYD A;  4K12 A;  1UOT P;  3WSY A;  4ZH1 D;  1OK9 A;  4F4O C;  3FGT A;  1H2P P;  3ERB A;  3F6K A;  2MCZ A;  2RLQ A;  1OJV A;  2RL0 A;  2UWN A;  1TPG A;  5DN4 A;  1E5G A;  3O8E B;  1RLH A;  2G7I A;  1Q3X A;  5JPM G;  1C1Z A;  1TPN A;  1OJY A;  2MCY A;  2CG6 A;  3MQL A;  1PPQ A;  3EJH A;  1HFI A;  1H03 P;  1OJW A;  4AYE A;  2W81 A;  1G4G A;  1OK2 A;  5FO8 C;  3IX0 A;  3T5O A;  2XWB F;  4DJZ A;  2YRA A;  3TVJ A;  3NFP I;  1NWV A;  1GPZ A;  5HYT B;  3KZJ A;  4IGD A;  3M7P A;  1QO6 A;  1MD8 A;  1ZJK A;  1SS2 A;  2X2Z A;  4LOT A;  1QGB A;  4PZ5 A;  3IU3 I;  2BZM A;  3CI0 J;  2B5I D;  2XQW C;  1VVD A;  1VVC A;  3ZD1 A;  2RKY A;  1LY2 A;  2YBY A; 
#chains in the Genus database with same CATH homology
 2XRD A;  2V8E A;  2RLP A;  4C16 A;  2W80 A;  1HFH A;  2A55 A;  3INB C;  1U5M A;  4LOS A;  5I0Q B;  2KMS A;  1E8B A;  3KXV A;  3ZD2 A;  2XRB A;  4WJG 2;  1FBR A;  5HYU B;  4AYI A;  4YNX A;  3RJ3 D;  4MUC A;  4AYM A;  1H2Q P;  1GHQ B;  4FXG G;  1Z92 B;  1GKN A;  2IZ3 A;  2EC3 A;  2CG7 A;  4J38 B;  2WII C;  2JGX A;  2JRA A;  3OED C;  3L89 M;  1OK1 A;  1QUB A;  2QY0 A;  1SRZ A;  1ELV A;  2RKZ A;  1OK3 A;  1G4F A;  2EHF A;  1TPM A;  1GKG A;  4ONT D;  5HYP A;  2KRI A;  4JHS A;  3OP8 A;  1MD7 A;  2LOJ A;  3CAL A;  3ZRZ A;  3OXU D;  4KKD A;  2CKU A;  3GXE A;  3SW0 X;  1HCC A;  1H04 P;  2ERJ A;  2O39 C;  2IZ4 A;  5HZP B;  4B2R A;  2JGW A;  1CKL A;  4B2S A;  2XWJ I;  1E88 A;  1O9A A;  4A5W B;  3R62 A;  3GOV A;  4CSY A;  4AYD A;  4K12 A;  1UOT P;  4ZH1 D;  1OK9 A;  4F4O C;  1H2P P;  3ERB A;  2MCZ A;  2RLQ A;  1OJV A;  2RL0 A;  2UWN A;  1TPG A;  1E5G A;  3O8E B;  2G7I A;  1Q3X A;  5JPM G;  1C1Z A;  1TPN A;  1OJY A;  2MCY A;  2CG6 A;  3MQL A;  1PPQ A;  3EJH A;  1HFI A;  1H03 P;  1OJW A;  4AYE A;  2W81 A;  1G4G A;  1OK2 A;  5FO8 C;  3IX0 A;  3T5O A;  2XWB F;  4DJZ A;  2YRA A;  3TVJ A;  3NFP I;  1NWV A;  1GPZ A;  5HYT B;  3KZJ A;  4IGD A;  3M7P A;  1QO6 A;  1MD8 A;  1ZJK A;  1SS2 A;  4LOT A;  1QGB A;  4PZ5 A;  3IU3 I;  2BZM A;  2B5I D;  2XQW C;  1VVD A;  1VVC A;  3ZD1 A;  2RKY A;  1LY2 A;  2YBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...