3SW0X

Structure of the c-terminal region (modules 18-20) of complement regulator factor h
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
186
structure length
186
Chain Sequence
GTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement factor H
publication title Structural Analysis of the C-Terminal Region (Modules 18-20) of Complement Regulator Factor H (FH).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3sw0X01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3sw0X02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3sw0X03
2CG7A 5I0QB 3GXEA 1FBRA 4F4OC 4PZ5A 3OXUD 1Z92B 2W81A 2BZMA 2B5ID 4B2SA 4J38B 3R62A 3IU3I 3TVJA 2CKUA 2JRAA 5HYPA 3ERBA 4A5WB 2RL0A 1OK9A 1E88A 1G4GA 1QO6A 2UWNA 2WIIC 1VVDA 3INBC 2XRDA 1TPNA 2LOJA 2V8EA 2JGWA 4AYMA 2IZ3A 2RKYA 1E8BA 2KMSA 3T5OA 2YRAA 3CALA 3ZD2A 3NFPI 2XQWC 2XWJI 1OK2A 1PPQA 1SS2A 3OEDC 3MQLA 2ERJA 2W80A 1GKNA 2O39C 1H04P 2EHFA 1H2PP 1HFHA 2YBYA 1OK3A 4ZH1D 1OK1A 2A55A 3OP8A 1MD7A 2EC3A 2JGXA 1QGBA 1H2QP 2MCZA 4JHSA 1OJVA 4C16A 4FXGG 2CG6A 4K12A 1UOTP 1E5GA 3GOVA 1TPMA 1U5MA 3EJHA 3O8EB 3ZD1A 2IZ4A 1G4FA 2XRBA 5FO8C 2XWBF 4B2RA 1GHQB 4KKDA 4IGDA 3SW0X 3M7PA 2MCYA 4LOTA 5HZPB 1H03P 3KZJA 4WJG2 3RJ3D 1Q3XA 1C1ZA 4LOSA 1TPGA 3IX0A 4DJZA 1QUBA 1SRZA 2RKZA 4MUCA 2RLPA 4YNXA 5HYUB 2QY0A 4AYIA 1ELVA 1HCCA 5JPMG 1NWVA 1VVCA 4CSYA 2KRIA 4ONTD 1OJYA 3ZRZA 3L89M 1MD8A 1HFIA 5HYTB 1LY2A 1CKLA 1OJWA 2G7IA 4AYDA 1O9AA 1GPZA 1GKGA 1ZJKA 3KXVA 4AYEA 2RLQA
chains in the Genus database with same CATH superfamily
2CG7A 5I0QB 2X2ZA 3GXEA 1FBRA 4YIZA 4F4OC 4PZ5A 3ZLDA 3OXUD 1Z92B 2W81A 2BZMA 2B5ID 3FGTA 4BWCA 4B2SA 4J38B 3R62A 3IU3I 4PO7A 3TVJA 2CKUA 2JRAA 5HYPA 3ERBA 4A5WB 2RL0A 1OK9A 3WSYA 1E88A 3VWOA 1G4GA 1QO6A 2UWNA 2WIIC 1VVDA 3INBC 3FGRA 2XRDA 1TPNA 2LOJA 2V8EA 2JGWA 5DN4A 4AYMA 2IZ3A 2RKYA 1E8BA 2KMSA 3K3TA 3T5OA 2YRAA 5DN5A 3CALA 2Y8TA 3ZD2A 3NFPI 2XQWC 2XWJI 1OK2A 1PPQA 1RLHA 1SS2A 3OEDC 3MQLA 2ERJA 2W80A 1GKNA 2O39C 1H04P 2EHFA 1H2PP 1HFHA 2YBYA 1OK3A 4ZH1D 1OK1A 2A55A 3OP8A 3F6KA 1MD7A 2EC3A 2JGXA 1QGBA 1H2QP 2MCZA 4JHSA 1OJVA 4C16A 2I2LA 4FXGG 2CG6A 4K12A 1UOTP 1E5GA 3GOVA 3CI0J 1TPMA 1U5MA 3EJHA 3O8EB 3ZD1A 2IZ4A 1G4FA 2XRBA 4APLA 5FO8C 2XWBF 2Y8SA 4B2RA 1GHQB 4KKDA 4IGDA 3SW0X 3M7PA 2MCYA 4LOTA 3NJAA 5HZPB 1H03P 3KZJA 4WJG2 2Y8RA 3RJ3D 1Q3XA 1C1ZA 4LOSA 1TPGA 3IX0A 4DJZA 1QUBA 1SRZA 2RKZA 4MUCA 2RLPA 4YNXA 5HYUB 2QY0A 4AYIA 1ELVA 1HCCA 5JPMG 1NWVA 1VVCA 2ZYCA 4CSYA 2KRIA 4ONTD 1OJYA 3ZRZA 3L89M 4N7EA 3WSXA 1MD8A 1HFIA 5HYTB 3ZLEA 1LY2A 1CKLA 1OJWA 4MSLA 2G7IA 4AYDA 1O9AA 1GPZA 1GKGA 1ZJKA 3KXVA 4AYEA 2RLQA
chains in the Genus database with same CATH topology
2CG7A 5I0QB 3GXEA 1FBRA 4F4OC 4PZ5A 3OXUD 1Z92B 2W81A 2BZMA 2B5ID 4B2SA 4J38B 3R62A 3IU3I 3TVJA 2CKUA 2JRAA 5HYPA 3ERBA 4A5WB 2RL0A 1OK9A 1E88A 1G4GA 1QO6A 2UWNA 2WIIC 1VVDA 3INBC 2XRDA 1TPNA 2LOJA 2V8EA 2JGWA 4AYMA 2IZ3A 2RKYA 1E8BA 2KMSA 3T5OA 2YRAA 3CALA 3ZD2A 3NFPI 2XQWC 2XWJI 1OK2A 1PPQA 1SS2A 3OEDC 3MQLA 2ERJA 2W80A 1GKNA 2O39C 1H04P 2EHFA 1H2PP 1HFHA 2YBYA 1OK3A 4ZH1D 1OK1A 2A55A 3OP8A 1MD7A 2EC3A 2JGXA 1QGBA 1H2QP 2MCZA 4JHSA 1OJVA 4C16A 4FXGG 2CG6A 4K12A 1UOTP 1E5GA 3GOVA 1TPMA 1U5MA 3EJHA 3O8EB 3ZD1A 2IZ4A 1G4FA 2XRBA 5FO8C 2XWBF 4B2RA 1GHQB 4KKDA 4IGDA 3SW0X 3M7PA 2MCYA 4LOTA 5HZPB 1H03P 3KZJA 4WJG2 3RJ3D 1Q3XA 1C1ZA 4LOSA 1TPGA 3IX0A 4DJZA 1QUBA 1SRZA 2RKZA 4MUCA 2RLPA 4YNXA 5HYUB 2QY0A 4AYIA 1ELVA 1HCCA 5JPMG 1NWVA 1VVCA 4CSYA 2KRIA 4ONTD 1OJYA 3ZRZA 3L89M 1MD8A 1HFIA 5HYTB 1LY2A 1CKLA 1OJWA 2G7IA 4AYDA 1O9AA 1GPZA 1GKGA 1ZJKA 3KXVA 4AYEA 2RLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CG7 A;  5I0Q B;  3GXE A;  1FBR A;  4F4O C;  4PZ5 A;  3OXU D;  1Z92 B;  2W81 A;  2BZM A;  2B5I D;  4B2S A;  4J38 B;  3R62 A;  3IU3 I;  3TVJ A;  2CKU A;  2JRA A;  5HYP A;  3ERB A;  4A5W B;  2RL0 A;  1OK9 A;  1E88 A;  1G4G A;  1QO6 A;  2UWN A;  2WII C;  1VVD A;  3INB C;  2XRD A;  1TPN A;  2LOJ A;  2V8E A;  2JGW A;  4AYM A;  2IZ3 A;  2RKY A;  1E8B A;  2KMS A;  3T5O A;  2YRA A;  3CAL A;  3ZD2 A;  3NFP I;  2XQW C;  2XWJ I;  1OK2 A;  1PPQ A;  1SS2 A;  3OED C;  3MQL A;  2ERJ A;  2W80 A;  1GKN A;  2O39 C;  1H04 P;  2EHF A;  1H2P P;  1HFH A;  2YBY A;  1OK3 A;  4ZH1 D;  1OK1 A;  2A55 A;  3OP8 A;  1MD7 A;  2EC3 A;  2JGX A;  1QGB A;  1H2Q P;  2MCZ A;  4JHS A;  1OJV A;  4C16 A;  4FXG G;  2CG6 A;  4K12 A;  1UOT P;  1E5G A;  3GOV A;  1TPM A;  1U5M A;  3EJH A;  3O8E B;  3ZD1 A;  2IZ4 A;  1G4F A;  2XRB A;  5FO8 C;  2XWB F;  4B2R A;  1GHQ B;  4KKD A;  4IGD A;  3SW0 X;  3M7P A;  2MCY A;  4LOT A;  5HZP B;  1H03 P;  3KZJ A;  4WJG 2;  3RJ3 D;  1Q3X A;  1C1Z A;  4LOS A;  1TPG A;  3IX0 A;  4DJZ A;  1QUB A;  1SRZ A;  2RKZ A;  4MUC A;  2RLP A;  4YNX A;  5HYU B;  2QY0 A;  4AYI A;  1ELV A;  1HCC A;  5JPM G;  1NWV A;  1VVC A;  4CSY A;  2KRI A;  4ONT D;  1OJY A;  3ZRZ A;  3L89 M;  1MD8 A;  1HFI A;  5HYT B;  1LY2 A;  1CKL A;  1OJW A;  2G7I A;  4AYD A;  1O9A A;  1GPZ A;  1GKG A;  1ZJK A;  3KXV A;  4AYE A;  2RLQ A; 
#chains in the Genus database with same CATH topology
 2CG7 A;  5I0Q B;  2X2Z A;  3GXE A;  1FBR A;  4YIZ A;  4F4O C;  4PZ5 A;  3ZLD A;  3OXU D;  1Z92 B;  2W81 A;  2BZM A;  2B5I D;  3FGT A;  4BWC A;  4B2S A;  4J38 B;  3R62 A;  3IU3 I;  4PO7 A;  3TVJ A;  2CKU A;  2JRA A;  5HYP A;  3ERB A;  4A5W B;  2RL0 A;  1OK9 A;  3WSY A;  1E88 A;  3VWO A;  1G4G A;  1QO6 A;  2UWN A;  2WII C;  1VVD A;  3INB C;  3FGR A;  2XRD A;  1TPN A;  2LOJ A;  2V8E A;  2JGW A;  5DN4 A;  4AYM A;  2IZ3 A;  2RKY A;  1E8B A;  2KMS A;  3K3T A;  3T5O A;  2YRA A;  5DN5 A;  3CAL A;  2Y8T A;  3ZD2 A;  3NFP I;  2XQW C;  2XWJ I;  1OK2 A;  1PPQ A;  1RLH A;  1SS2 A;  3OED C;  3MQL A;  2ERJ A;  2W80 A;  1GKN A;  2O39 C;  1H04 P;  2EHF A;  1H2P P;  1HFH A;  2YBY A;  1OK3 A;  4ZH1 D;  1OK1 A;  2A55 A;  3OP8 A;  3F6K A;  1MD7 A;  2EC3 A;  2JGX A;  1QGB A;  1H2Q P;  2MCZ A;  4JHS A;  1OJV A;  4C16 A;  2I2L A;  4FXG G;  2CG6 A;  4K12 A;  1UOT P;  1E5G A;  3GOV A;  3CI0 J;  1TPM A;  1U5M A;  3EJH A;  3O8E B;  3ZD1 A;  2IZ4 A;  1G4F A;  2XRB A;  4APL A;  5FO8 C;  2XWB F;  2Y8S A;  4B2R A;  1GHQ B;  4KKD A;  4IGD A;  3SW0 X;  3M7P A;  2MCY A;  4LOT A;  3NJA A;  5HZP B;  1H03 P;  3KZJ A;  4WJG 2;  2Y8R A;  3RJ3 D;  1Q3X A;  1C1Z A;  4LOS A;  1TPG A;  3IX0 A;  4DJZ A;  1QUB A;  1SRZ A;  2RKZ A;  4MUC A;  2RLP A;  4YNX A;  5HYU B;  2QY0 A;  4AYI A;  1ELV A;  1HCC A;  5JPM G;  1NWV A;  1VVC A;  2ZYC A;  4CSY A;  2KRI A;  4ONT D;  1OJY A;  3ZRZ A;  3L89 M;  4N7E A;  3WSX A;  1MD8 A;  1HFI A;  5HYT B;  3ZLE A;  1LY2 A;  1CKL A;  1OJW A;  4MSL A;  2G7I A;  4AYD A;  1O9A A;  1GPZ A;  1GKG A;  1ZJK A;  3KXV A;  4AYE A;  2RLQ A; 
#chains in the Genus database with same CATH homology
 2CG7 A;  5I0Q B;  3GXE A;  1FBR A;  4F4O C;  4PZ5 A;  3OXU D;  1Z92 B;  2W81 A;  2BZM A;  2B5I D;  4B2S A;  4J38 B;  3R62 A;  3IU3 I;  3TVJ A;  2CKU A;  2JRA A;  5HYP A;  3ERB A;  4A5W B;  2RL0 A;  1OK9 A;  1E88 A;  1G4G A;  1QO6 A;  2UWN A;  2WII C;  1VVD A;  3INB C;  2XRD A;  1TPN A;  2LOJ A;  2V8E A;  2JGW A;  4AYM A;  2IZ3 A;  2RKY A;  1E8B A;  2KMS A;  3T5O A;  2YRA A;  3CAL A;  3ZD2 A;  3NFP I;  2XQW C;  2XWJ I;  1OK2 A;  1PPQ A;  1SS2 A;  3OED C;  3MQL A;  2ERJ A;  2W80 A;  1GKN A;  2O39 C;  1H04 P;  2EHF A;  1H2P P;  1HFH A;  2YBY A;  1OK3 A;  4ZH1 D;  1OK1 A;  2A55 A;  3OP8 A;  1MD7 A;  2EC3 A;  2JGX A;  1QGB A;  1H2Q P;  2MCZ A;  4JHS A;  1OJV A;  4C16 A;  4FXG G;  2CG6 A;  4K12 A;  1UOT P;  1E5G A;  3GOV A;  1TPM A;  1U5M A;  3EJH A;  3O8E B;  3ZD1 A;  2IZ4 A;  1G4F A;  2XRB A;  5FO8 C;  2XWB F;  4B2R A;  1GHQ B;  4KKD A;  4IGD A;  3SW0 X;  3M7P A;  2MCY A;  4LOT A;  5HZP B;  1H03 P;  3KZJ A;  4WJG 2;  3RJ3 D;  1Q3X A;  1C1Z A;  4LOS A;  1TPG A;  3IX0 A;  4DJZ A;  1QUB A;  1SRZ A;  2RKZ A;  4MUC A;  2RLP A;  4YNX A;  5HYU B;  2QY0 A;  4AYI A;  1ELV A;  1HCC A;  5JPM G;  1NWV A;  1VVC A;  4CSY A;  2KRI A;  4ONT D;  1OJY A;  3ZRZ A;  3L89 M;  1MD8 A;  1HFI A;  5HYT B;  1LY2 A;  1CKL A;  1OJW A;  2G7I A;  4AYD A;  1O9A A;  1GPZ A;  1GKG A;  1ZJK A;  3KXV A;  4AYE A;  2RLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...