3SWSD

Crystal structure of the quinone form of methylamine dehydrogenase in complex with the diferric form of maug
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structure of the Quinone Form of Methylamine Dehydrogenase in Complex with the Diferric Form of MauG
rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 98
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3swsD00
3JZNA 5IT9g 2IUQA 5HE0B 4J87A 1JJUB 3JROA 4GM9A 3J81g 4CZYA 4ES0A 1VYHC 3RFGA 3I7OA 5C9ZB 4ESGA 3CFVA 1OMWB 4PXWA 4L3HD 2IWFA 3RSEC 2AQ5A 3K27A 4JSXC 3SWSD 2YMUA 3IIWA 1B9XA 3NVXA 2BCJB 1SQJA 5IJ7E 3A0FA 3OKWA 4HDJA 5TDHB 1JMZB 2QXVA 5EMKB 1JOFA 3UKUC 3RRMC 4I79A 4D0KA 1A0RB 5CXBB 3B7FA 2H9MA 1PGUA 3MKSB 4O1QD 4J0XA 1U2VC 2AGYA 3EMHA 5EMLB 2PM7B 3HFQA 4GGDA 3SBQA 3U4YA 3I7LA 2PBIB 3BWSA 3I8CA 1B9YA 3BG0A 2P9IC 2G99A 2HXCA 4GGAA 5CXBA 4O9DA 2I3TA 1N6DA 5TEEA 5TEFA 2YBAA 2Q7QA 4X61B 2CE9A 2AH0A 3VGZA 4Z8LA 2H68A 2J56H 4A2LA 3DXMC 3I7KA 2I0RA 3PXTD 3UVKA 4U7AA 5I5IA 1NR0A 4CY2A 3PXSD 4J78A 3VA6A 3EI2B 1OLZA 2UZYB 2J57G 5B4WA 2CE8A 4A2MA 2HJBA 2YB8B 1ERJA 3EI3B 5K19A 5HE2B 4CZXA 2AGWA 3PVUB 3EI2A 3N0EA 4TZ4A 4ZOXA 5EAMA 3EI4B 2MTAH 4GQ1A 4X3EA 4A0BB 5FA5B 5H1MA 3EI3A 3F3PA 3UVNA 4FWWA 4NSXA 4LG8A 2AGXA 3W15A 3N0DA 4A08B 2YNNA 2H9LA 2IWKA 3PVWB 3PSCB 3SBRA 2H9PA 4E5ZB 3GFCA 2GNQA 2B5NA 1S4UX 2QC5A 2XYIA 3EI4A 2TRCB 3UVLA 3IJCA 3L4OD 5GXHA 4A0BA 3C99A 2P9SC 1GG2B 4CY1A 3P4FA 2XL2A 4LG9A 4JT5C 3EWEA 1XKSA 2EBSA 4A08A 4U1EI 2UZXB 3AL8B 4E5ZA 5C2WB 1TBGA 3I7HA 1GXRA 1TYQC 1FWXA 2J55H 5FXYA 4L1QD 5HE1B 4FA4D 2XU7A 3FRXA 2IUVA 3C75H 2Z2PA 3SBPA 4EWRA 3AL8A 3JZGA 3RMZD 4J8GA 2W18A 3SCYA 3I89A 4CY3A 2OVRB 4A09B 3MMYA 3UVOA 1GP2B 1K32A 3ULEC 2OK4A 3DWLC 5AJAA 2HKMA 4Y5RD 3EI1B 5IGOA 3FGBA 5H17A 5KDOB 4QL1A 2HYEA 1P22A 4AEZA 2H9NA 3AH8B 2CO0C 2H6NA 3I8EA 4MK0B 4JD2C 4A09A 4AOWA 2B4EA 3BG1A 3PXWD 2IAAA 4GM3A 5FQDA 3EI1A 2B5MA 2HKRA 2IURA 2P9NC 4A0AB 4JXMA 3F3FA 5A2Qg 3MKQA 5FKSA 3MXXA 3J80g 2H14A 1R5MA 5H14A 4ZOYA 3IJ0A 3UKRC 2IUPA 3I7PA 4D6VA 5FKQA 2G9AA 2OIZA 2YNOA 2P9UC 3KRXB 4X63B 1PEVA 4A0AA 4A7JA 4CI3A 2YNPA 2P9KC 5THAA 3ORVD 4JSPC 5FKTA 3RLMD 1MG2A 4QRJA 2CN3A 4CZVA 3JPXA 2I0SA 3RN1D 4IMMA 3JAMg 2OVQB 4O3UB 1L0QA 1SQ9A 3CIKB 4ERZA 5EM2B 1MDAH 4OZUA 5EALA 4XEIC 4QT8A 5EMMB 4J73A 4GQ2P 3SVWD 4J82A 4E54B 5FKRA 4BH6A 2GC7A 4XYHA 2CN2A 3PSLA 3SHFA 2OK6A 5EM2A 5GXIA 3KRWB 1PBYB 3V9FA 3OW8A 4J79A 4L3GD 3JRPA 3ODTA 5I5MA 5K1CC 4E54A 4CC9A 2H3XA 2XL3A 4CI1A 4XYIA 5JWZA 4PSXB 4FAND 4PSWB 1N6EA 4R7AB 4K3ID 3V7DB 5SXMA 2CNXA 3E0CA 1XHMA 3V5WB 4A11B 4JT6C 4Y7RA 4ERQA 2B5LA 2OVPB 3CFSB 2AGLA 2HJ4A 4JSVC 4PBZA 2H6QA 4ZN4A 4PBYA 3SJLD 5GMKn 4O45A 2AH1A 4J0WA 2O9KA 3EG6A 3OKTA 5TF2A 1N6FA 2H6KA 4N14A 4CI2A 4FB1D 4J77A 4H5JA 4CI8A 3VH0A 4PC0A 4ZOZA 2P9LC 2P9PC 4A11A 4BUJC 3AL9A 3UR4A 3RN0D 3C9CA 3SN6B 5I5JA 4J84A 3DSMA 3DXKC 1YFQA 4ZOVA 3JB9L 2PM9B 2HESX 3F3GA 4FA1D 3JZHA 4ERYA 1XIPA 2H13A 1NEXB 4PNKB 3OL2B 1Q47A 2I3SA 3UVMA 3I2NA 3DM0A 3NVQA 5IC7A 4GZ8A 5AMSA 5FLXg 2PM9A 2Z2NA 2CO0A 3SFZA 4J8BA 3FM0A 4IA9A 3PE7A 4K3JB 4G56B 3OL2A 5EMJB 2AGZA 3ZWLB 4FHLA 1PI6A 3MZKA 5CYKB 3C5MA 3GREA 1RI6A 3K26A 3OKYB 4LGNA 5HQGA 3SLED 5EARA 4FAVD 4O3TB 3RFHA 4UI9R 5EAPA 3SMRA 3IIYA 2I0TA 4J86A 4JSNC 5CXCB 4FA5D 3OTTA 4GGCA 4H5IA 1U4CA 1MG3A 4GMBA 3L4MD 1SHYB 1GOTB 5CYKA 3IJ1A 4KFMB 3MZLA 3NVNA 1JMXB 3OKYA 5IGQA 4GM8A 2H47A 3I7NA 2PM6B 4FA9D 4OWRA 4YVDA 5CXCA 5HE3B 2BBKH 2Z2OA 4GQBB 3IKOA 4X60B 3AFCA 3SXTD 5HYNB 1QNIA 4J81A 4L9OA 5IJ8E 1K8KC 4CY5A 2OJYA 4QQEA 5GSAA 5AFU3 4BL0A 2GC4A 5C2VB 3EU7A
chains in the Genus database with same CATH superfamily
3JZNA 5IT9g 2IUQA 5HE0B 4J87A 1A12A 1JJUB 3JROA 4GM9A 4Z7NA 3J81g 4CZYA 2VZ1A 1E5TA 4ES0A 1VYHC 3RFGA 3I7OA 5C9ZB 4ESGA 3CFVA 1OMWB 4PXWA 2VDPA 4JHNA 4L3HD 2IWFA 3RSEC 2AQ5A 3K27A 4JSXC 3SWSD 2YMUA 3IIWA 1B9XA 4IRZA 3NVXA 2BCJB 1SQJA 2HU5A 4BCDA 5IJ7E 3A0FA 3OKWA 3ZE1A 4HDJA 5TDHB 1JMZB 2QXVA 5EMKB 1JOFA 2EICA 3RRMC 4I79A 3UKUC 4D0KA 1A0RB 5CXBB 3B7FA 2H9MA 1PGUA 3MKSB 5FFGA 1QFMA 4O1QD 4J0XA 1U2VC 2AGYA 3EMHA 2VC2A 5EMLB 2PM7B 3HFQA 4GGDA 3SBQA 3U4YA 1GOFA 3I7LA 2PBIB 4Z7OA 5FFOA 3BWSA 3I8CA 1B9YA 3BG0A 2P9IC 3O4JA 2G99A 2HXCA 4GGAA 5CXBA 4O9DA 2I3TA 5M5RA 4O2WA 1C9IA 1N6DA 5TEEA 5TEFA 2YBAA 2Q7QA 3QHYB 1VZ3A 4X61B 1YR2A 2CE9A 2AH0A 3VGZA 4Z8LA 1H2XA 2H68A 4BP8A 2J56H 4A2LA 2BKLA 3DXMC 3ZDYA 2XE4A 3I7KA 2I0RA 3PXTD 3UVKA 2QZPA 3ZDZA 4U7AA 3T3PA 3VI4A 5I5IA 1NR0A 4CY2A 3PXSD 4J78A 3VA6A 3EI2B 2XZGA 1OLZA 2UZYB 1C9LA 5M5VA 4DNWA 1TYEA 2J57G 5B4WA 2CE8A 4A2MA 2HJBA 2YB8B 1ERJA 3EI3B 5K19A 5HE2B 4CZXA 2AGWA 4NBMA 3PVUB 3EI2A 2VDNA 3N0EA 4TZ4A 4ZOXA 5EAMA 3EI4B 2MTAH 4GQ1A 4X3EA 4A0BB 5FA5B 3T3MA 5H1MA 3EI3A 3F3PA 3UVNA 4FWWA 4NSXA 4LG8A 2AGXA 3W15A 3N0DA 4A08B 2YNNA 2H9LA 2IWKA 3PVWB 1E8NA 3PSCB 3SBRA 2H9PA 4D9SA 4E5ZB 3GFCA 2B5NA 1S4UX 2GNQA 2QC5A 2XDWA 2XYIA 2TRCB 3EI4A 3UVLA 3IJCA 3L4OD 2VDLA 2VDRA 5GXHA 2HU8A 4A0BA 3C99A 2P9SC 4MMZA 4NC4A 3IJEA 1GG2B 4CY1A 3P4FA 2XL2A 5M5TA 4LG9A 4JT5C 3EWEA 1XKSA 3MVDK 2EBSA 4A08A 4U1EI 2UZXB 3AL8B 4Z7QA 4E5ZA 5C2WB 1U8CA 1TBGA 3I7HA 3NIGA 1GXRA 1JV2A 1TYQC 1UTCA 1FWXA 2J55H 5E6RA 5FXYA 4L1QD 1QFSA 5HE1B 4BUJC 4FA4D 2XU7A 3FRXA 4JHPC 2IUVA 3C75H 2Z2PA 3SBPA 4EWRA 3AL8A 3JZGA 3RMZD 1T2XA 1VE7A 4J8GA 3IVMA 4L1MA 2W18A 3SCYA 4BCBA 1UOPA 3I89A 4CY3A 1K3IA 2OVRB 3O4IA 4A09B 3MMYA 3UVOA 5HDBA 1GP2B 1K32A 3IURA 3ULEC 2OK4A 3DWLC 5AJAA 4AX4A 1O6GA 2HKMA 4Y5RD 3EI1B 5IGOA 3FGBA 5H17A 5KDOB 4QL1A 2HYEA 1P22A 4AEZA 2H9NA 3AH8B 2CO0C 2H6NA 1L5GA 3I8EA 3VI3A 4WK0A 1BPOA 2VDKA 3NIFA 4MK0B 4JD2C 4A09A 4AOWA 2B4EA 3BG1A 3PXWD 2IAAA 4GM3A 3NIDA 5FQDA 4G1MA 3EI1A 2B5MA 2HKRA 5C92A 2IURA 2P9NC 1E8MA 4A0AB 4JXMA 1I2MB 3F3FA 1UOOA 5A2Qg 4AMYA 3MKQA 4QAMA 3MXXA 4G55A 5FKSA 2H14A 3J80g 1H2WA 1R5MA 5H14A 3K71A 4ZOYA 3IJ0A 4WK2A 2IUPA 3UKRC 3I7PA 4D6VA 5FKQA 2G9AA 2OIZA 4UM9A 2YNOA 2P9UC 3V4VA 3KRXB 2HU7A 4X63B 1VE6A 1PEVA 4A0AA 4A7JA 4CI3A 2YNPA 3OF7A 2P9KC 5THAA 3ORVD 4JSPC 5FKTA 3RLMD 1MG2A 4QRJA 2CN3A 4CZVA 3JPXA 2I0SA 3RN1D 4IMMA 3JAMg 4AN0A 3ZE2A 2OVQB 4O3UB 1L0QA 1SQ9A 3CIKB 2WQ8A 4ERZA 5EM2B 1H2ZA 1MDAH 4OZUA 5EALA 4XEIC 4QT8A 5EMMB 3IULA 4J73A 4GQ2P 3IUJA 2QR5A 3SVWD 4J82A 4DNUA 4BP9A 3MUNA 4E54B 3IUQA 5FKRA 4BH6A 2GC7A 4XYHA 2CN2A 3PSLA 3SHFA 2OK6A 5EM2A 5GXIA 3KRWB 1PBYB 3V9FA 3OW8A 1VZ2A 3V4PA 4WJKA 4J79A 4L3GD 1GOGA 3JRPA 3ODTA 5I5MA 5K1CC 5M5UA 4E54A 3IUMA 4CC9A 2H3XA 2XL3A 4CI1A 4XYIA 5JWZA 4PSXB 4FAND 3FCSA 5M61A 2VZ3A 4PSWB 1N6EA 4R7AB 4K3ID 3V7DB 5SXMA 2CNXA 3E0CA 2EIBA 1XHMA 3V5WB 5M5SA 4A11B 4JT6C 5E6SA 4Y7RA 4ERQA 2B5LA 2OVPB 2EIEA 2AGLA 2HJ4A 3CFSB 3KCIA 4JSVC 4PBZA 2H6QA 4ZN4A 4PBYA 3SJLD 5GMKn 4O45A 1JTDB 2AH1A 4J0WA 2O9KA 2VDQA 3EG6A 3OKTA 5TF2A 1N6FA 2EIDA 3GD1I 2H6KA 5C86A 4N14A 4CI2A 4FB1D 3EQ9A 4J77A 4H5JA 4CI8A 4RE5A 3VH0A 4PC0A 4ZOZA 2P9LC 2P9PC 3FCUA 4G1EA 4A11A 3AL9A 3K72A 3UR4A 3RN0D 3C9CA 3SN6B 5I5JA 4J84A 1GOHA 3DSMA 1YFQA 3DXKC 4ZOVA 3JB9L 2PM9B 2HESX 3F3GA 4FA1D 3JZHA 4MMYA 4ERYA 1XIPA 2H13A 1NEXB 4PNKB 3OL2B 1Q47A 2I3SA 4UM8A 3UVMA 4AMZA 3I2NA 4NAAA 3DM0A 3NVQA 5IC7A 3O4GA 2VDOA 4GZ8A 5AMSA 5FLXg 2PM9A 2Z2NA 4MMXA 2CO0A 3SFZA 4J8BA 3FM0A 4RE6A 4IA9A 3PE7A 4K3JB 4G56B 3OL2A 5EMJB 4DNVA 2AGZA 3ZWLB 4FHLA 3DDUA 1PI6A 1M1XA 3MZKA 5CYKB 3C5MA 3GREA 1RI6A 3K26A 3OKYB 4LGNA 5HQGA 3SLED 4BCCA 5E6UA 5EARA 4WK4A 4AN1A 4FAVD 4O3TB 3RFHA 4UI9R 3EQ8A 5EAPA 3SMRA 3IIYA 2I0TA 4J86A 4JSNC 5CXCB 4FA5D 3K6SA 2JKXA 3OTTA 4GGCA 4H5IA 1U4CA 3ZDXA 3EQ7A 3ZE0A 1MG3A 1UOQA 4GMBA 3L4MD 1SHYB 1GOTB 5CYKA 3IJ1A 4KFMB 3MZLA 3NVNA 1JMXB 3OKYA 3IUNA 5IGQA 4GM8A 2H47A 3I7NA 3MUOA 2PM6B 4FA9D 4OWRA 4YVDA 5CXCA 5HE3B 2BBKH 2Z2OA 4GQBB 3IKOA 3O4HA 4NENA 4X60B 3AFCA 3SXTD 1H2YA 3GC3B 5HYNB 1QNIA 4J81A 4L9OA 5IJ8E 1O6FA 1K8KC 4O02A 4CY5A 2OJYA 4QQEA 3QI0A 5GSAA 5AFU3 2VDMA 4BL0A 2GC4A 5C2VB 3EU7A
chains in the Genus database with same CATH topology
3JZNA 5IT9g 2IUQA 5HE0B 4J87A 1JJUB 3JROA 4GM9A 3J81g 4CZYA 4ES0A 1VYHC 3RFGA 3I7OA 5C9ZB 4ESGA 3CFVA 1OMWB 4PXWA 4L3HD 2IWFA 3RSEC 2AQ5A 3K27A 4JSXC 3SWSD 2YMUA 3IIWA 1B9XA 3NVXA 2BCJB 1SQJA 5IJ7E 3A0FA 3OKWA 4HDJA 5TDHB 1JMZB 2QXVA 5EMKB 1JOFA 3UKUC 3RRMC 4I79A 4D0KA 1A0RB 5CXBB 3B7FA 2H9MA 1PGUA 3MKSB 4O1QD 4J0XA 1U2VC 2AGYA 3EMHA 5EMLB 2PM7B 3HFQA 4GGDA 3SBQA 3U4YA 3I7LA 2PBIB 3BWSA 3I8CA 1B9YA 3BG0A 2P9IC 2G99A 2HXCA 4GGAA 5CXBA 4O9DA 2I3TA 1N6DA 5TEEA 5TEFA 2YBAA 2Q7QA 4X61B 2CE9A 2AH0A 3VGZA 4Z8LA 2H68A 2J56H 4A2LA 3DXMC 3I7KA 2I0RA 3PXTD 3UVKA 4U7AA 5I5IA 1NR0A 4CY2A 3PXSD 4J78A 3VA6A 3EI2B 1OLZA 2UZYB 2J57G 5B4WA 2CE8A 4A2MA 2HJBA 2YB8B 1ERJA 3EI3B 5K19A 5HE2B 4CZXA 2AGWA 3PVUB 3EI2A 3N0EA 4TZ4A 4ZOXA 5EAMA 3EI4B 2MTAH 4GQ1A 4X3EA 4A0BB 5FA5B 5H1MA 3EI3A 3F3PA 3UVNA 4FWWA 4NSXA 4LG8A 2AGXA 3W15A 3N0DA 4A08B 2YNNA 2H9LA 2IWKA 3PVWB 3PSCB 3SBRA 2H9PA 4E5ZB 3GFCA 2GNQA 2B5NA 1S4UX 2QC5A 2XYIA 3EI4A 2TRCB 3UVLA 3IJCA 3L4OD 5GXHA 4A0BA 3C99A 2P9SC 1GG2B 4CY1A 3P4FA 2XL2A 4LG9A 4JT5C 3EWEA 1XKSA 2EBSA 4A08A 4U1EI 2UZXB 3AL8B 4E5ZA 5C2WB 1TBGA 3I7HA 1GXRA 1TYQC 1FWXA 2J55H 5FXYA 4L1QD 5HE1B 4FA4D 2XU7A 3FRXA 2IUVA 3C75H 2Z2PA 3SBPA 4EWRA 3AL8A 3JZGA 3RMZD 4J8GA 2W18A 3SCYA 3I89A 4CY3A 2OVRB 4A09B 3MMYA 3UVOA 1GP2B 1K32A 3ULEC 2OK4A 3DWLC 5AJAA 2HKMA 4Y5RD 3EI1B 5IGOA 3FGBA 5H17A 5KDOB 4QL1A 2HYEA 1P22A 4AEZA 2H9NA 3AH8B 2CO0C 2H6NA 3I8EA 4MK0B 4JD2C 4A09A 4AOWA 2B4EA 3BG1A 3PXWD 2IAAA 4GM3A 5FQDA 3EI1A 2B5MA 2HKRA 2IURA 2P9NC 4A0AB 4JXMA 3F3FA 5A2Qg 3MKQA 5FKSA 3MXXA 3J80g 2H14A 1R5MA 5H14A 4ZOYA 3IJ0A 3UKRC 2IUPA 3I7PA 4D6VA 5FKQA 2G9AA 2OIZA 2YNOA 2P9UC 3KRXB 4X63B 1PEVA 4A0AA 4A7JA 4CI3A 2YNPA 2P9KC 5THAA 3ORVD 4JSPC 5FKTA 3RLMD 1MG2A 4QRJA 2CN3A 4CZVA 3JPXA 2I0SA 3RN1D 4IMMA 3JAMg 2OVQB 4O3UB 1L0QA 1SQ9A 3CIKB 4ERZA 5EM2B 1MDAH 4OZUA 5EALA 4XEIC 4QT8A 5EMMB 4J73A 4GQ2P 3SVWD 4J82A 4E54B 5FKRA 4BH6A 2GC7A 4XYHA 2CN2A 3PSLA 3SHFA 2OK6A 5EM2A 5GXIA 3KRWB 1PBYB 3V9FA 3OW8A 4J79A 4L3GD 3JRPA 3ODTA 5I5MA 5K1CC 4E54A 4CC9A 2H3XA 2XL3A 4CI1A 4XYIA 5JWZA 4PSXB 4FAND 4PSWB 1N6EA 4R7AB 4K3ID 3V7DB 5SXMA 2CNXA 3E0CA 1XHMA 3V5WB 4A11B 4JT6C 4Y7RA 4ERQA 2B5LA 2OVPB 3CFSB 2AGLA 2HJ4A 4JSVC 4PBZA 2H6QA 4ZN4A 4PBYA 3SJLD 5GMKn 4O45A 2AH1A 4J0WA 2O9KA 3EG6A 3OKTA 5TF2A 1N6FA 2H6KA 4N14A 4CI2A 4FB1D 4J77A 4H5JA 4CI8A 3VH0A 4PC0A 4ZOZA 2P9LC 2P9PC 4A11A 4BUJC 3AL9A 3UR4A 3RN0D 3C9CA 3SN6B 5I5JA 4J84A 3DSMA 3DXKC 1YFQA 4ZOVA 3JB9L 2PM9B 2HESX 3F3GA 4FA1D 3JZHA 4ERYA 1XIPA 2H13A 1NEXB 4PNKB 3OL2B 1Q47A 2I3SA 3UVMA 3I2NA 3DM0A 3NVQA 5IC7A 4GZ8A 5AMSA 5FLXg 2PM9A 2Z2NA 2CO0A 3SFZA 4J8BA 3FM0A 4IA9A 3PE7A 4K3JB 4G56B 3OL2A 5EMJB 2AGZA 3ZWLB 4FHLA 1PI6A 3MZKA 5CYKB 3C5MA 3GREA 1RI6A 3K26A 3OKYB 4LGNA 5HQGA 3SLED 5EARA 4FAVD 4O3TB 3RFHA 4UI9R 5EAPA 3SMRA 3IIYA 2I0TA 4J86A 4JSNC 5CXCB 4FA5D 3OTTA 4GGCA 4H5IA 1U4CA 1MG3A 4GMBA 3L4MD 1SHYB 1GOTB 5CYKA 3IJ1A 4KFMB 3MZLA 3NVNA 1JMXB 3OKYA 5IGQA 4GM8A 2H47A 3I7NA 2PM6B 4FA9D 4OWRA 4YVDA 5CXCA 5HE3B 2BBKH 2Z2OA 4GQBB 3IKOA 4X60B 3AFCA 3SXTD 5HYNB 1QNIA 4J81A 4L9OA 5IJ8E 1K8KC 4CY5A 2OJYA 4QQEA 5GSAA 5AFU3 4BL0A 2GC4A 5C2VB 3EU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JZN A;  5IT9 g;  2IUQ A;  5HE0 B;  4J87 A;  1JJU B;  3JRO A;  4GM9 A;  3J81 g;  4CZY A;  4ES0 A;  1VYH C;  3RFG A;  3I7O A;  5C9Z B;  4ESG A;  3CFV A;  1OMW B;  4PXW A;  4L3H D;  2IWF A;  3RSE C;  2AQ5 A;  3K27 A;  4JSX C;  3SWS D;  2YMU A;  3IIW A;  1B9X A;  3NVX A;  2BCJ B;  1SQJ A;  5IJ7 E;  3A0F A;  3OKW A;  4HDJ A;  5TDH B;  1JMZ B;  2QXV A;  5EMK B;  1JOF A;  3UKU C;  3RRM C;  4I79 A;  4D0K A;  1A0R B;  5CXB B;  3B7F A;  2H9M A;  1PGU A;  3MKS B;  4O1Q D;  4J0X A;  1U2V C;  2AGY A;  3EMH A;  5EML B;  2PM7 B;  3HFQ A;  4GGD A;  3SBQ A;  3U4Y A;  3I7L A;  2PBI B;  3BWS A;  3I8C A;  1B9Y A;  3BG0 A;  2P9I C;  2G99 A;  2HXC A;  4GGA A;  5CXB A;  4O9D A;  2I3T A;  1N6D A;  5TEE A;  5TEF A;  2YBA A;  2Q7Q A;  4X61 B;  2CE9 A;  2AH0 A;  3VGZ A;  4Z8L A;  2H68 A;  2J56 H;  4A2L A;  3DXM C;  3I7K A;  2I0R A;  3PXT D;  3UVK A;  4U7A A;  5I5I A;  1NR0 A;  4CY2 A;  3PXS D;  4J78 A;  3VA6 A;  3EI2 B;  1OLZ A;  2UZY B;  2J57 G;  5B4W A;  2CE8 A;  4A2M A;  2HJB A;  2YB8 B;  1ERJ A;  3EI3 B;  5K19 A;  5HE2 B;  4CZX A;  2AGW A;  3PVU B;  3EI2 A;  3N0E A;  4TZ4 A;  4ZOX A;  5EAM A;  3EI4 B;  2MTA H;  4GQ1 A;  4X3E A;  4A0B B;  5FA5 B;  5H1M A;  3EI3 A;  3F3P A;  3UVN A;  4FWW A;  4NSX A;  4LG8 A;  2AGX A;  3W15 A;  3N0D A;  4A08 B;  2YNN A;  2H9L A;  2IWK A;  3PVW B;  3PSC B;  3SBR A;  2H9P A;  4E5Z B;  3GFC A;  2GNQ A;  2B5N A;  1S4U X;  2QC5 A;  2XYI A;  3EI4 A;  2TRC B;  3UVL A;  3IJC A;  3L4O D;  5GXH A;  4A0B A;  3C99 A;  2P9S C;  1GG2 B;  4CY1 A;  3P4F A;  2XL2 A;  4LG9 A;  4JT5 C;  3EWE A;  1XKS A;  2EBS A;  4A08 A;  4U1E I;  2UZX B;  3AL8 B;  4E5Z A;  5C2W B;  1TBG A;  3I7H A;  1GXR A;  1TYQ C;  1FWX A;  2J55 H;  5FXY A;  4L1Q D;  5HE1 B;  4FA4 D;  2XU7 A;  3FRX A;  2IUV A;  3C75 H;  2Z2P A;  3SBP A;  4EWR A;  3AL8 A;  3JZG A;  3RMZ D;  4J8G A;  2W18 A;  3SCY A;  3I89 A;  4CY3 A;  2OVR B;  4A09 B;  3MMY A;  3UVO A;  1GP2 B;  1K32 A;  3ULE C;  2OK4 A;  3DWL C;  5AJA A;  2HKM A;  4Y5R D;  3EI1 B;  5IGO A;  3FGB A;  5H17 A;  5KDO B;  4QL1 A;  2HYE A;  1P22 A;  4AEZ A;  2H9N A;  3AH8 B;  2CO0 C;  2H6N A;  3I8E A;  4MK0 B;  4JD2 C;  4A09 A;  4AOW A;  2B4E A;  3BG1 A;  3PXW D;  2IAA A;  4GM3 A;  5FQD A;  3EI1 A;  2B5M A;  2HKR A;  2IUR A;  2P9N C;  4A0A B;  4JXM A;  3F3F A;  5A2Q g;  3MKQ A;  5FKS A;  3MXX A;  3J80 g;  2H14 A;  1R5M A;  5H14 A;  4ZOY A;  3IJ0 A;  3UKR C;  2IUP A;  3I7P A;  4D6V A;  5FKQ A;  2G9A A;  2OIZ A;  2YNO A;  2P9U C;  3KRX B;  4X63 B;  1PEV A;  4A0A A;  4A7J A;  4CI3 A;  2YNP A;  2P9K C;  5THA A;  3ORV D;  4JSP C;  5FKT A;  3RLM D;  1MG2 A;  4QRJ A;  2CN3 A;  4CZV A;  3JPX A;  2I0S A;  3RN1 D;  4IMM A;  3JAM g;  2OVQ B;  4O3U B;  1L0Q A;  1SQ9 A;  3CIK B;  4ERZ A;  5EM2 B;  1MDA H;  4OZU A;  5EAL A;  4XEI C;  4QT8 A;  5EMM B;  4J73 A;  4GQ2 P;  3SVW D;  4J82 A;  4E54 B;  5FKR A;  4BH6 A;  2GC7 A;  4XYH A;  2CN2 A;  3PSL A;  3SHF A;  2OK6 A;  5EM2 A;  5GXI A;  3KRW B;  1PBY B;  3V9F A;  3OW8 A;  4J79 A;  4L3G D;  3JRP A;  3ODT A;  5I5M A;  5K1C C;  4E54 A;  4CC9 A;  2H3X A;  2XL3 A;  4CI1 A;  4XYI A;  5JWZ A;  4PSX B;  4FAN D;  4PSW B;  1N6E A;  4R7A B;  4K3I D;  3V7D B;  5SXM A;  2CNX A;  3E0C A;  1XHM A;  3V5W B;  4A11 B;  4JT6 C;  4Y7R A;  4ERQ A;  2B5L A;  2OVP B;  3CFS B;  2AGL A;  2HJ4 A;  4JSV C;  4PBZ A;  2H6Q A;  4ZN4 A;  4PBY A;  3SJL D;  5GMK n;  4O45 A;  2AH1 A;  4J0W A;  2O9K A;  3EG6 A;  3OKT A;  5TF2 A;  1N6F A;  2H6K A;  4N14 A;  4CI2 A;  4FB1 D;  4J77 A;  4H5J A;  4CI8 A;  3VH0 A;  4PC0 A;  4ZOZ A;  2P9L C;  2P9P C;  4A11 A;  4BUJ C;  3AL9 A;  3UR4 A;  3RN0 D;  3C9C A;  3SN6 B;  5I5J A;  4J84 A;  3DSM A;  3DXK C;  1YFQ A;  4ZOV A;  3JB9 L;  2PM9 B;  2HES X;  3F3G A;  4FA1 D;  3JZH A;  4ERY A;  1XIP A;  2H13 A;  1NEX B;  4PNK B;  3OL2 B;  1Q47 A;  2I3S A;  3UVM A;  3I2N A;  3DM0 A;  3NVQ A;  5IC7 A;  4GZ8 A;  5AMS A;  5FLX g;  2PM9 A;  2Z2N A;  2CO0 A;  3SFZ A;  4J8B A;  3FM0 A;  4IA9 A;  3PE7 A;  4K3J B;  4G56 B;  3OL2 A;  5EMJ B;  2AGZ A;  3ZWL B;  4FHL A;  1PI6 A;  3MZK A;  5CYK B;  3C5M A;  3GRE A;  1RI6 A;  3K26 A;  3OKY B;  4LGN A;  5HQG A;  3SLE D;  5EAR A;  4FAV D;  4O3T B;  3RFH A;  4UI9 R;  5EAP A;  3SMR A;  3IIY A;  2I0T A;  4J86 A;  4JSN C;  5CXC B;  4FA5 D;  3OTT A;  4GGC A;  4H5I A;  1U4C A;  1MG3 A;  4GMB A;  3L4M D;  1SHY B;  1GOT B;  5CYK A;  3IJ1 A;  4KFM B;  3MZL A;  3NVN A;  1JMX B;  3OKY A;  5IGQ A;  4GM8 A;  2H47 A;  3I7N A;  2PM6 B;  4FA9 D;  4OWR A;  4YVD A;  5CXC A;  5HE3 B;  2BBK H;  2Z2O A;  4GQB B;  3IKO A;  4X60 B;  3AFC A;  3SXT D;  5HYN B;  1QNI A;  4J81 A;  4L9O A;  5IJ8 E;  1K8K C;  4CY5 A;  2OJY A;  4QQE A;  5GSA A;  5AFU 3;  4BL0 A;  2GC4 A;  5C2V B;  3EU7 A; 
#chains in the Genus database with same CATH topology
 3JZN A;  5IT9 g;  2IUQ A;  5HE0 B;  4J87 A;  1A12 A;  1JJU B;  3JRO A;  4GM9 A;  4Z7N A;  3J81 g;  4CZY A;  2VZ1 A;  1E5T A;  4ES0 A;  1VYH C;  3RFG A;  3I7O A;  5C9Z B;  4ESG A;  3CFV A;  1OMW B;  4PXW A;  2VDP A;  4JHN A;  4L3H D;  2IWF A;  3RSE C;  2AQ5 A;  3K27 A;  4JSX C;  3SWS D;  2YMU A;  3IIW A;  1B9X A;  4IRZ A;  3NVX A;  2BCJ B;  1SQJ A;  2HU5 A;  4BCD A;  5IJ7 E;  3A0F A;  3OKW A;  3ZE1 A;  4HDJ A;  5TDH B;  1JMZ B;  2QXV A;  5EMK B;  1JOF A;  2EIC A;  3RRM C;  4I79 A;  3UKU C;  4D0K A;  1A0R B;  5CXB B;  3B7F A;  2H9M A;  1PGU A;  3MKS B;  5FFG A;  1QFM A;  4O1Q D;  4J0X A;  1U2V C;  2AGY A;  3EMH A;  2VC2 A;  5EML B;  2PM7 B;  3HFQ A;  4GGD A;  3SBQ A;  3U4Y A;  1GOF A;  3I7L A;  2PBI B;  4Z7O A;  5FFO A;  3BWS A;  3I8C A;  1B9Y A;  3BG0 A;  2P9I C;  3O4J A;  2G99 A;  2HXC A;  4GGA A;  5CXB A;  4O9D A;  2I3T A;  5M5R A;  4O2W A;  1C9I A;  1N6D A;  5TEE A;  5TEF A;  2YBA A;  2Q7Q A;  3QHY B;  1VZ3 A;  4X61 B;  1YR2 A;  2CE9 A;  2AH0 A;  3VGZ A;  4Z8L A;  1H2X A;  2H68 A;  4BP8 A;  2J56 H;  4A2L A;  2BKL A;  3DXM C;  3ZDY A;  2XE4 A;  3I7K A;  2I0R A;  3PXT D;  3UVK A;  2QZP A;  3ZDZ A;  4U7A A;  3T3P A;  3VI4 A;  5I5I A;  1NR0 A;  4CY2 A;  3PXS D;  4J78 A;  3VA6 A;  3EI2 B;  2XZG A;  1OLZ A;  2UZY B;  1C9L A;  5M5V A;  4DNW A;  1TYE A;  2J57 G;  5B4W A;  2CE8 A;  4A2M A;  2HJB A;  2YB8 B;  1ERJ A;  3EI3 B;  5K19 A;  5HE2 B;  4CZX A;  2AGW A;  4NBM A;  3PVU B;  3EI2 A;  2VDN A;  3N0E A;  4TZ4 A;  4ZOX A;  5EAM A;  3EI4 B;  2MTA H;  4GQ1 A;  4X3E A;  4A0B B;  5FA5 B;  3T3M A;  5H1M A;  3EI3 A;  3F3P A;  3UVN A;  4FWW A;  4NSX A;  4LG8 A;  2AGX A;  3W15 A;  3N0D A;  4A08 B;  2YNN A;  2H9L A;  2IWK A;  3PVW B;  1E8N A;  3PSC B;  3SBR A;  2H9P A;  4D9S A;  4E5Z B;  3GFC A;  2B5N A;  1S4U X;  2GNQ A;  2QC5 A;  2XDW A;  2XYI A;  2TRC B;  3EI4 A;  3UVL A;  3IJC A;  3L4O D;  2VDL A;  2VDR A;  5GXH A;  2HU8 A;  4A0B A;  3C99 A;  2P9S C;  4MMZ A;  4NC4 A;  3IJE A;  1GG2 B;  4CY1 A;  3P4F A;  2XL2 A;  5M5T A;  4LG9 A;  4JT5 C;  3EWE A;  1XKS A;  3MVD K;  2EBS A;  4A08 A;  4U1E I;  2UZX B;  3AL8 B;  4Z7Q A;  4E5Z A;  5C2W B;  1U8C A;  1TBG A;  3I7H A;  3NIG A;  1GXR A;  1JV2 A;  1TYQ C;  1UTC A;  1FWX A;  2J55 H;  5E6R A;  5FXY A;  4L1Q D;  1QFS A;  5HE1 B;  4BUJ C;  4FA4 D;  2XU7 A;  3FRX A;  4JHP C;  2IUV A;  3C75 H;  2Z2P A;  3SBP A;  4EWR A;  3AL8 A;  3JZG A;  3RMZ D;  1T2X A;  1VE7 A;  4J8G A;  3IVM A;  4L1M A;  2W18 A;  3SCY A;  4BCB A;  1UOP A;  3I89 A;  4CY3 A;  1K3I A;  2OVR B;  3O4I A;  4A09 B;  3MMY A;  3UVO A;  5HDB A;  1GP2 B;  1K32 A;  3IUR A;  3ULE C;  2OK4 A;  3DWL C;  5AJA A;  4AX4 A;  1O6G A;  2HKM A;  4Y5R D;  3EI1 B;  5IGO A;  3FGB A;  5H17 A;  5KDO B;  4QL1 A;  2HYE A;  1P22 A;  4AEZ A;  2H9N A;  3AH8 B;  2CO0 C;  2H6N A;  1L5G A;  3I8E A;  3VI3 A;  4WK0 A;  1BPO A;  2VDK A;  3NIF A;  4MK0 B;  4JD2 C;  4A09 A;  4AOW A;  2B4E A;  3BG1 A;  3PXW D;  2IAA A;  4GM3 A;  3NID A;  5FQD A;  4G1M A;  3EI1 A;  2B5M A;  2HKR A;  5C92 A;  2IUR A;  2P9N C;  1E8M A;  4A0A B;  4JXM A;  1I2M B;  3F3F A;  1UOO A;  5A2Q g;  4AMY A;  3MKQ A;  4QAM A;  3MXX A;  4G55 A;  5FKS A;  2H14 A;  3J80 g;  1H2W A;  1R5M A;  5H14 A;  3K71 A;  4ZOY A;  3IJ0 A;  4WK2 A;  2IUP A;  3UKR C;  3I7P A;  4D6V A;  5FKQ A;  2G9A A;  2OIZ A;  4UM9 A;  2YNO A;  2P9U C;  3V4V A;  3KRX B;  2HU7 A;  4X63 B;  1VE6 A;  1PEV A;  4A0A A;  4A7J A;  4CI3 A;  2YNP A;  3OF7 A;  2P9K C;  5THA A;  3ORV D;  4JSP C;  5FKT A;  3RLM D;  1MG2 A;  4QRJ A;  2CN3 A;  4CZV A;  3JPX A;  2I0S A;  3RN1 D;  4IMM A;  3JAM g;  4AN0 A;  3ZE2 A;  2OVQ B;  4O3U B;  1L0Q A;  1SQ9 A;  3CIK B;  2WQ8 A;  4ERZ A;  5EM2 B;  1H2Z A;  1MDA H;  4OZU A;  5EAL A;  4XEI C;  4QT8 A;  5EMM B;  3IUL A;  4J73 A;  4GQ2 P;  3IUJ A;  2QR5 A;  3SVW D;  4J82 A;  4DNU A;  4BP9 A;  3MUN A;  4E54 B;  3IUQ A;  5FKR A;  4BH6 A;  2GC7 A;  4XYH A;  2CN2 A;  3PSL A;  3SHF A;  2OK6 A;  5EM2 A;  5GXI A;  3KRW B;  1PBY B;  3V9F A;  3OW8 A;  1VZ2 A;  3V4P A;  4WJK A;  4J79 A;  4L3G D;  1GOG A;  3JRP A;  3ODT A;  5I5M A;  5K1C C;  5M5U A;  4E54 A;  3IUM A;  4CC9 A;  2H3X A;  2XL3 A;  4CI1 A;  4XYI A;  5JWZ A;  4PSX B;  4FAN D;  3FCS A;  5M61 A;  2VZ3 A;  4PSW B;  1N6E A;  4R7A B;  4K3I D;  3V7D B;  5SXM A;  2CNX A;  3E0C A;  2EIB A;  1XHM A;  3V5W B;  5M5S A;  4A11 B;  4JT6 C;  5E6S A;  4Y7R A;  4ERQ A;  2B5L A;  2OVP B;  2EIE A;  2AGL A;  2HJ4 A;  3CFS B;  3KCI A;  4JSV C;  4PBZ A;  2H6Q A;  4ZN4 A;  4PBY A;  3SJL D;  5GMK n;  4O45 A;  1JTD B;  2AH1 A;  4J0W A;  2O9K A;  2VDQ A;  3EG6 A;  3OKT A;  5TF2 A;  1N6F A;  2EID A;  3GD1 I;  2H6K A;  5C86 A;  4N14 A;  4CI2 A;  4FB1 D;  3EQ9 A;  4J77 A;  4H5J A;  4CI8 A;  4RE5 A;  3VH0 A;  4PC0 A;  4ZOZ A;  2P9L C;  2P9P C;  3FCU A;  4G1E A;  4A11 A;  3AL9 A;  3K72 A;  3UR4 A;  3RN0 D;  3C9C A;  3SN6 B;  5I5J A;  4J84 A;  1GOH A;  3DSM A;  1YFQ A;  3DXK C;  4ZOV A;  3JB9 L;  2PM9 B;  2HES X;  3F3G A;  4FA1 D;  3JZH A;  4MMY A;  4ERY A;  1XIP A;  2H13 A;  1NEX B;  4PNK B;  3OL2 B;  1Q47 A;  2I3S A;  4UM8 A;  3UVM A;  4AMZ A;  3I2N A;  4NAA A;  3DM0 A;  3NVQ A;  5IC7 A;  3O4G A;  2VDO A;  4GZ8 A;  5AMS A;  5FLX g;  2PM9 A;  2Z2N A;  4MMX A;  2CO0 A;  3SFZ A;  4J8B A;  3FM0 A;  4RE6 A;  4IA9 A;  3PE7 A;  4K3J B;  4G56 B;  3OL2 A;  5EMJ B;  4DNV A;  2AGZ A;  3ZWL B;  4FHL A;  3DDU A;  1PI6 A;  1M1X A;  3MZK A;  5CYK B;  3C5M A;  3GRE A;  1RI6 A;  3K26 A;  3OKY B;  4LGN A;  5HQG A;  3SLE D;  4BCC A;  5E6U A;  5EAR A;  4WK4 A;  4AN1 A;  4FAV D;  4O3T B;  3RFH A;  4UI9 R;  3EQ8 A;  5EAP A;  3SMR A;  3IIY A;  2I0T A;  4J86 A;  4JSN C;  5CXC B;  4FA5 D;  3K6S A;  2JKX A;  3OTT A;  4GGC A;  4H5I A;  1U4C A;  3ZDX A;  3EQ7 A;  3ZE0 A;  1MG3 A;  1UOQ A;  4GMB A;  3L4M D;  1SHY B;  1GOT B;  5CYK A;  3IJ1 A;  4KFM B;  3MZL A;  3NVN A;  1JMX B;  3OKY A;  3IUN A;  5IGQ A;  4GM8 A;  2H47 A;  3I7N A;  3MUO A;  2PM6 B;  4FA9 D;  4OWR A;  4YVD A;  5CXC A;  5HE3 B;  2BBK H;  2Z2O A;  4GQB B;  3IKO A;  3O4H A;  4NEN A;  4X60 B;  3AFC A;  3SXT D;  1H2Y A;  3GC3 B;  5HYN B;  1QNI A;  4J81 A;  4L9O A;  5IJ8 E;  1O6F A;  1K8K C;  4O02 A;  4CY5 A;  2OJY A;  4QQE A;  3QI0 A;  5GSA A;  5AFU 3;  2VDM A;  4BL0 A;  2GC4 A;  5C2V B;  3EU7 A; 
#chains in the Genus database with same CATH homology
 3JZN A;  5IT9 g;  2IUQ A;  5HE0 B;  4J87 A;  1JJU B;  3JRO A;  4GM9 A;  3J81 g;  4CZY A;  4ES0 A;  1VYH C;  3RFG A;  3I7O A;  5C9Z B;  4ESG A;  3CFV A;  1OMW B;  4PXW A;  4L3H D;  2IWF A;  3RSE C;  2AQ5 A;  3K27 A;  4JSX C;  3SWS D;  2YMU A;  3IIW A;  1B9X A;  3NVX A;  2BCJ B;  1SQJ A;  5IJ7 E;  3A0F A;  3OKW A;  4HDJ A;  5TDH B;  1JMZ B;  2QXV A;  5EMK B;  1JOF A;  3UKU C;  3RRM C;  4I79 A;  4D0K A;  1A0R B;  5CXB B;  3B7F A;  2H9M A;  1PGU A;  3MKS B;  4O1Q D;  4J0X A;  1U2V C;  2AGY A;  3EMH A;  5EML B;  2PM7 B;  3HFQ A;  4GGD A;  3SBQ A;  3U4Y A;  3I7L A;  2PBI B;  3BWS A;  3I8C A;  1B9Y A;  3BG0 A;  2P9I C;  2G99 A;  2HXC A;  4GGA A;  5CXB A;  4O9D A;  2I3T A;  1N6D A;  5TEE A;  5TEF A;  2YBA A;  2Q7Q A;  4X61 B;  2CE9 A;  2AH0 A;  3VGZ A;  4Z8L A;  2H68 A;  2J56 H;  4A2L A;  3DXM C;  3I7K A;  2I0R A;  3PXT D;  3UVK A;  4U7A A;  5I5I A;  1NR0 A;  4CY2 A;  3PXS D;  4J78 A;  3VA6 A;  3EI2 B;  1OLZ A;  2UZY B;  2J57 G;  5B4W A;  2CE8 A;  4A2M A;  2HJB A;  2YB8 B;  1ERJ A;  3EI3 B;  5K19 A;  5HE2 B;  4CZX A;  2AGW A;  3PVU B;  3EI2 A;  3N0E A;  4TZ4 A;  4ZOX A;  5EAM A;  3EI4 B;  2MTA H;  4GQ1 A;  4X3E A;  4A0B B;  5FA5 B;  5H1M A;  3EI3 A;  3F3P A;  3UVN A;  4FWW A;  4NSX A;  4LG8 A;  2AGX A;  3W15 A;  3N0D A;  4A08 B;  2YNN A;  2H9L A;  2IWK A;  3PVW B;  3PSC B;  3SBR A;  2H9P A;  4E5Z B;  3GFC A;  2GNQ A;  2B5N A;  1S4U X;  2QC5 A;  2XYI A;  3EI4 A;  2TRC B;  3UVL A;  3IJC A;  3L4O D;  5GXH A;  4A0B A;  3C99 A;  2P9S C;  1GG2 B;  4CY1 A;  3P4F A;  2XL2 A;  4LG9 A;  4JT5 C;  3EWE A;  1XKS A;  2EBS A;  4A08 A;  4U1E I;  2UZX B;  3AL8 B;  4E5Z A;  5C2W B;  1TBG A;  3I7H A;  1GXR A;  1TYQ C;  1FWX A;  2J55 H;  5FXY A;  4L1Q D;  5HE1 B;  4FA4 D;  2XU7 A;  3FRX A;  2IUV A;  3C75 H;  2Z2P A;  3SBP A;  4EWR A;  3AL8 A;  3JZG A;  3RMZ D;  4J8G A;  2W18 A;  3SCY A;  3I89 A;  4CY3 A;  2OVR B;  4A09 B;  3MMY A;  3UVO A;  1GP2 B;  1K32 A;  3ULE C;  2OK4 A;  3DWL C;  5AJA A;  2HKM A;  4Y5R D;  3EI1 B;  5IGO A;  3FGB A;  5H17 A;  5KDO B;  4QL1 A;  2HYE A;  1P22 A;  4AEZ A;  2H9N A;  3AH8 B;  2CO0 C;  2H6N A;  3I8E A;  4MK0 B;  4JD2 C;  4A09 A;  4AOW A;  2B4E A;  3BG1 A;  3PXW D;  2IAA A;  4GM3 A;  5FQD A;  3EI1 A;  2B5M A;  2HKR A;  2IUR A;  2P9N C;  4A0A B;  4JXM A;  3F3F A;  5A2Q g;  3MKQ A;  5FKS A;  3MXX A;  3J80 g;  2H14 A;  1R5M A;  5H14 A;  4ZOY A;  3IJ0 A;  3UKR C;  2IUP A;  3I7P A;  4D6V A;  5FKQ A;  2G9A A;  2OIZ A;  2YNO A;  2P9U C;  3KRX B;  4X63 B;  1PEV A;  4A0A A;  4A7J A;  4CI3 A;  2YNP A;  2P9K C;  5THA A;  3ORV D;  4JSP C;  5FKT A;  3RLM D;  1MG2 A;  4QRJ A;  2CN3 A;  4CZV A;  3JPX A;  2I0S A;  3RN1 D;  4IMM A;  3JAM g;  2OVQ B;  4O3U B;  1L0Q A;  1SQ9 A;  3CIK B;  4ERZ A;  5EM2 B;  1MDA H;  4OZU A;  5EAL A;  4XEI C;  4QT8 A;  5EMM B;  4J73 A;  4GQ2 P;  3SVW D;  4J82 A;  4E54 B;  5FKR A;  4BH6 A;  2GC7 A;  4XYH A;  2CN2 A;  3PSL A;  3SHF A;  2OK6 A;  5EM2 A;  5GXI A;  3KRW B;  1PBY B;  3V9F A;  3OW8 A;  4J79 A;  4L3G D;  3JRP A;  3ODT A;  5I5M A;  5K1C C;  4E54 A;  4CC9 A;  2H3X A;  2XL3 A;  4CI1 A;  4XYI A;  5JWZ A;  4PSX B;  4FAN D;  4PSW B;  1N6E A;  4R7A B;  4K3I D;  3V7D B;  5SXM A;  2CNX A;  3E0C A;  1XHM A;  3V5W B;  4A11 B;  4JT6 C;  4Y7R A;  4ERQ A;  2B5L A;  2OVP B;  3CFS B;  2AGL A;  2HJ4 A;  4JSV C;  4PBZ A;  2H6Q A;  4ZN4 A;  4PBY A;  3SJL D;  5GMK n;  4O45 A;  2AH1 A;  4J0W A;  2O9K A;  3EG6 A;  3OKT A;  5TF2 A;  1N6F A;  2H6K A;  4N14 A;  4CI2 A;  4FB1 D;  4J77 A;  4H5J A;  4CI8 A;  3VH0 A;  4PC0 A;  4ZOZ A;  2P9L C;  2P9P C;  4A11 A;  4BUJ C;  3AL9 A;  3UR4 A;  3RN0 D;  3C9C A;  3SN6 B;  5I5J A;  4J84 A;  3DSM A;  3DXK C;  1YFQ A;  4ZOV A;  3JB9 L;  2PM9 B;  2HES X;  3F3G A;  4FA1 D;  3JZH A;  4ERY A;  1XIP A;  2H13 A;  1NEX B;  4PNK B;  3OL2 B;  1Q47 A;  2I3S A;  3UVM A;  3I2N A;  3DM0 A;  3NVQ A;  5IC7 A;  4GZ8 A;  5AMS A;  5FLX g;  2PM9 A;  2Z2N A;  2CO0 A;  3SFZ A;  4J8B A;  3FM0 A;  4IA9 A;  3PE7 A;  4K3J B;  4G56 B;  3OL2 A;  5EMJ B;  2AGZ A;  3ZWL B;  4FHL A;  1PI6 A;  3MZK A;  5CYK B;  3C5M A;  3GRE A;  1RI6 A;  3K26 A;  3OKY B;  4LGN A;  5HQG A;  3SLE D;  5EAR A;  4FAV D;  4O3T B;  3RFH A;  4UI9 R;  5EAP A;  3SMR A;  3IIY A;  2I0T A;  4J86 A;  4JSN C;  5CXC B;  4FA5 D;  3OTT A;  4GGC A;  4H5I A;  1U4C A;  1MG3 A;  4GMB A;  3L4M D;  1SHY B;  1GOT B;  5CYK A;  3IJ1 A;  4KFM B;  3MZL A;  3NVN A;  1JMX B;  3OKY A;  5IGQ A;  4GM8 A;  2H47 A;  3I7N A;  2PM6 B;  4FA9 D;  4OWR A;  4YVD A;  5CXC A;  5HE3 B;  2BBK H;  2Z2O A;  4GQB B;  3IKO A;  4X60 B;  3AFC A;  3SXT D;  5HYN B;  1QNI A;  4J81 A;  4L9O A;  5IJ8 E;  1K8K C;  4CY5 A;  2OJY A;  4QQE A;  5GSA A;  5AFU 3;  4BL0 A;  2GC4 A;  5C2V B;  3EU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...