3SWSD

Crystal structure of the quinone form of methylamine dehydrogenase in complex with the diferric form of maug
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
376
structure length
376
Chain Sequence
b'QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
molecule tags Oxidoreductase/electron transport
source organism Paracoccus denitrificans
publication title Crystal Structure of the Quinone Form of Methylamine Dehydrogenase in Complex with the Diferric Form of MauG
rcsb
total genus 98
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3swsD00
4A2MA 5K1CC 2OJYA 5GMKn 3SBRA 3AL8A 5KDOB 4N14A 2TRCB 2P9UC 2B5LA 2XYIA 3K27A 4ESGA 2YB8B 5EAMA 5CYKA 4E5ZB 4J77A 2AH1A 5EM2A 1K32A 5THAA 3VA6A 3DXMC 4UI9R 4GQ2P 4A0BB 3JZNA 2IUQA 3OL2A 3VGZA 4CY5A 1B9XA 3B7FA 5CXBB 2IAAA 2I0SA 3EU7A 3FRXA 5FKTA 2H6QA 3C5MA 3KRWB 5I5JA 3IIYA 1JMZB 5K19A 3EI3A 2Z2OA 4JSXC 4XYHA 4E54A 4ZOXA 3RN1D 2B4EA 2B5NA 2H9NA 2AQ5A 1NEXB 4CY2A 4X61B 2XL3A 3SN6B 4A09A 5IGOA 2OK6A 5HE3B 2UZYB 4JD2C 4FAND 3N0DA 4J86A 3SBPA 4ZOZA 4BL0A 4J8BA 2HKMA 3IIWA 3PSLA 1FWXA 5H17A 5C9ZB 3PVUB 4GMBA 4ERYA 3EI1A 4IMMA 2Z2PA 2QXVA 2I3SA 3RFGA 1OLZA 4QL1A 5IJ8E 4CY3A 2CE8A 3EI1B 3NVNA 4CZXA 2UZXB 1S4UX 4L9OA 4GQBB 1N6DA 2H9LA 5I5MA 4PNKB 2PM6B 2YNPA 4L3HD 2HJ4A 3OL2B 3UVNA 3JZGA 1N6FA 2IWFA 3SBQA 5EMMB 1NR0A 1MG3A 5FKRA 1JMXB 2PM9A 1JJUB 3PE7A 5EMLB 4A08A 3I2NA 2AH0A 3MKSB 5IC7A 3PSCB 4A0BA 3P4FA 2GC7A 3JPXA 3UVKA 3N0EA 2CN2A 3RMZD 5GSAA 3BG1A 5B4WA 3SXTD 4CI8A 2HYEA 3BWSA 3DSMA 4EWRA 1K8KC 4JSPC 4D6VA 2PM9B 4Y5RD 4HDJA 3AL9A 4R7AB 3UR4A 2PBIB 2P9NC 5IJ7E 3OKWA 4J81A 4U1EI 3AH8B 1YFQA 2HXCA 2YNOA 2P9LC 4CI1A 2OVQB 2QC5A 5FQDA 2Z2NA 3KRXB 3MMYA 3GFCA 2YBAA 2IWKA 2W18A 3EI2B 4NSXA 1N6EA 1ERJA 3IKOA 4U7AA 2GNQA 4ZN4A 5FKSA 2AGXA 4H5IA 1B9YA 1VYHC 4XEIC 5AJAA 2I0TA 4FHLA 2HJBA 5HE1B 3I8EA 2MTAH 4LG8A 4OWRA 3W15A 5EMJB 3UKRC 4JT6C 4QQEA 5HYNB 4A08B 4GM3A 3FM0A 1PI6A 3SHFA 4TZ4A 5H14A 1GXRA 1GOTB 5CXCB 3GREA 1L0QA 1OMWB 3CIKB 1GP2B 4PSWB 3PXTD 4A11A 2H6KA 3NVQA 4O45A 3FGBA 3SJLD 5EMKB 4JSNC 4GQ1A 4PBZA 3U4YA 3EMHA 2P9SC 3F3GA 5EAPA 5TEFA 2H14A 1TBGA 3F3PA 4X63B 5AMSA 4J84A 4MK0B 3RFHA 4H5JA 4O3UB 4BUJC 3BG0A 4Z8LA 2H9PA 5TF2A 4KFMB 1PBYB 3OW8A 4CZVA 2CO0C 2GC4A 1MDAH 4X3EA 5EALA 1TYQC 3V5WB 5C2WB 4GGDA 4LG9A 2OIZA 4QT8A 4PSXB 2IUVA 4GM8A 5EM2B 3UVLA 2H47A 4ES0A 3PXWD 4J87A 2BCJB 5IT9g 3VH0A 4ZOVA 1XKSA 3ULEC 1MG2A 5FA5B 4L3GD 3JB9L 3C99A 3NVXA 4FWWA 1GG2B 2J57G 3RN0D 3DM0A 5HE0B 4QRJA 1P22A 4ZOYA 3I89A 1Q47A 3SFZA 3IJCA 2CNXA 2I3TA 4IA9A 3MZKA 4G56B 3I7PA 3I7KA 4ERQA 2G99A 4L1QD 2AGLA 3SMRA 2B5MA 4AOWA 1SQ9A 4CI2A 4O1QD 2IUPA 2O9KA 3RRMC 1U2VC 4FAVD 4Y7RA 2H13A 1RI6A 4A09B 3ODTA 5CYKB 4J79A 4AEZA 4JT5C 3JAMg 1R5MA 5GXIA 4GGCA 3I7OA 2XU7A 1PEVA 4CY1A 1SHYB 3JROA 3RLMD 3C75H 5CXBA 2PM7B 2AGZA 3OKTA 4J8GA 2Q7QA 3PVWB 3SWSD 3MZLA 3UVOA 3DXKC 3EWEA 2H68A 3PXSD 4J0WA 4A0AB 3UVMA 4JSVC 3V9FA 3IJ1A 4K3JB 2AGYA 2XL2A 4CC9A 3I7NA 2EBSA 3EG6A 4PBYA 5JWZA 4A7JA 3HFQA 1PGUA 4FA5D 3J80g 4GZ8A 2HESX 2J55H 5SXMA 2H6NA 4BH6A 4FA1D 5AFU3 4LGNA 4A11B 3OTTA 4O3TB 2YNNA 5EARA 3C9CA 3AFCA 3E0CA 2J56H 2HKRA 3A0FA 3AL8B 1XHMA 2OK4A 3CFVA 3IJ0A 5TEEA 4PC0A 3L4OD 2OVPB 5FKQA 5HE2B 3ZWLB 1QNIA 1XIPA 1U4CA 3UKUC 2CE9A 1A0RB 2AGWA 4A0AA 3L4MD 3EI4A 2P9PC 4PXWA 3I8CA 5C2VB 4I79A 3OKYB 2CO0A 3JRPA 3EI4B 5FXYA 1JOFA 3SVWD 5FLXg 4J78A 3OKYA 2CN3A 4GGAA 3J81g 3JZHA 2G9AA 3EI2A 2P9KC 4FA9D 5TDHB 4JXMA 4J82A 2OVRB 5H1MA 2P9IC 4D0KA 4A2LA 4O9DA 4ERZA 3K26A 2BBKH 3EI3B 4FA4D 5GXHA 3MXXA 2I0RA 3SLED 4CZYA 4E54B 2IURA 2YMUA 3I7LA 4E5ZA 2H3XA 4J73A 3SCYA 5I5IA 5CXCA 2H9MA 4CI3A 3ORVD 5IGQA 3V7DB 3RSEC 4XYIA 5A2Qg 3I7HA 3DWLC 4FB1D 4OZUA 4J0XA 4YVDA 4GM9A 3MKQA 1SQJA 4K3ID 4X60B 5HQGA 3F3FA 3CFSB
chains in the Genus database with same CATH superfamily
4A2MA 2EICA 2OJYA 5K1CC 5GMKn 3K72A 3SBRA 3AL8A 4UM9A 3ZDZA 5KDOB 4N14A 2TRCB 2P9UC 2B5LA 2XYIA 3K27A 4ESGA 2BKLA 2YB8B 3MUNA 5CYKA 5EAMA 4E5ZB 4J77A 2AH1A 5EM2A 1K32A 5THAA 3VA6A 3DXMC 4UI9R 4GQ2P 3EQ9A 4A0BB 3JZNA 2IUQA 3OL2A 3VGZA 4CY5A 5M5RA 3NIFA 1B9XA 3B7FA 1I2MB 5CXBB 4BP9A 2IAAA 2I0SA 3EQ7A 3EU7A 3FRXA 5FKTA 2H6QA 3C5MA 3KRWB 3NIGA 5I5JA 3IIYA 1JMZB 2EIBA 4AN0A 5K19A 3GC3B 3EI3A 2Z2OA 4JSXC 5FFOA 4XYHA 4E54A 4NC4A 4ZOXA 3ZE2A 3RN1D 2B4EA 1O6FA 2XE4A 1H2WA 2B5NA 4AMYA 2HU8A 2H9NA 2AQ5A 1NEXB 4CY2A 4X61B 2XL3A 3SN6B 4A09A 5IGOA 2OK6A 1UOOA 2UZYB 5HE3B 4JD2C 4FAND 3N0DA 2XZGA 4J86A 2VDMA 3SBPA 4ZOZA 4BL0A 1UTCA 4BCBA 4J8BA 2HKMA 1U8CA 4RE6A 3IIWA 3PSLA 4DNVA 1FWXA 5H17A 5C9ZB 3QHYB 3PVUB 2VZ1A 4GMBA 4ERYA 3EI1A 1O6GA 4IMMA 2Z2PA 2QXVA 2I3SA 3RFGA 1OLZA 4QL1A 5IJ8E 4CY3A 2CE8A 3FCUA 3EI1B 1UOQA 3NVNA 4CZXA 5C86A 2UZXB 1S4UX 4L9OA 4GQBB 1N6DA 2H9LA 5I5MA 4PNKB 1VZ3A 2PM6B 5HDBA 2YNPA 4L3HD 5M5TA 2HJ4A 3OL2B 3UVNA 3JZGA 1N6FA 2IWFA 3SBQA 5EMMB 1NR0A 1MG3A 5FKRA 1JMXB 2PM9A 1JJUB 3PE7A 4Z7QA 5EMLB 4A08A 3I2NA 2AH0A 3MKSB 5IC7A 3PSCB 4A0BA 3P4FA 2GC7A 3JPXA 3UVKA 3N0EA 2CN2A 3RMZD 5GSAA 3BG1A 4WK4A 1JV2A 5B4WA 3SXTD 4CI8A 2VDRA 2HYEA 3BWSA 3DSMA 4EWRA 1K8KC 4JSPC 5FFGA 4D6VA 2PM9B 1GOHA 4O2WA 4Y5RD 4HDJA 3AL9A 4R7AB 1E8MA 1YR2A 3MUOA 1E5TA 3UR4A 1GOGA 2PBIB 4NENA 5C92A 2P9NC 5IJ7E 3OKWA 4J81A 4U1EI 5M5VA 3AH8B 4RE5A 1YFQA 5M61A 2HXCA 2YNOA 2P9LC 4CI1A 2OVQB 3ZDXA 2QC5A 3QI0A 5FQDA 2Z2NA 4BP8A 3KRXB 3MMYA 3GFCA 2YBAA 2IWKA 3DDUA 2W18A 3EI2B 4BCDA 4NSXA 4DNUA 1N6EA 4MMXA 1ERJA 2VZ3A 1QFSA 3IKOA 4U7AA 2GNQA 4AN1A 3IVMA 4ZN4A 5FKSA 2AGXA 4H5IA 3T3PA 1B9YA 1VYHC 4XEIC 5AJAA 2I0TA 4FHLA 2HJBA 5HE1B 3I8EA 2MTAH 4LG8A 1A12A 4OWRA 3W15A 4AX4A 1M1XA 5EMJB 3UKRC 4JT6C 3ZE0A 4QQEA 4WK2A 5HYNB 4A08B 4GM3A 3FM0A 1PI6A 3SHFA 4TZ4A 1VZ2A 5H14A 1GXRA 1GOTB 5CXCB 3GREA 1L0QA 1OMWB 3CIKB 1GP2B 4PSWB 3PXTD 4A11A 2H6KA 3NVQA 4O45A 5E6RA 3FGBA 3SJLD 5EMKB 4JSNC 4GQ1A 3IJEA 2WQ8A 4PBZA 3U4YA 3EMHA 2P9SC 3F3GA 5EAPA 5TEFA 5M5SA 2H14A 2VDOA 1TBGA 3F3PA 4L1MA 4X63B 4BCCA 3MVDK 5AMSA 4J84A 4MK0B 3IUQA 3RFHA 4H5JA 4Z7NA 4O3UB 4O02A 4BUJC 3BG0A 4Z8LA 2H9PA 2VDNA 5TF2A 4KFMB 1PBYB 3V4VA 4MMYA 3OW8A 4CZVA 2CO0C 2GC4A 1MDAH 4X3EA 5EALA 1TYQC 2XDWA 3V5WB 3ZDYA 5C2WB 2VDQA 4GGDA 4LG9A 2OIZA 4QT8A 2EIDA 3IULA 3NIDA 3FCSA 4PSXB 4UM8A 3VI4A 2IUVA 4GM8A 5EM2B 3UVLA 2H47A 1C9IA 3O4HA 4ES0A 3PXWD 4WK0A 4J87A 2BCJB 5IT9g 4DNWA 2JKXA 3VH0A 4ZOVA 1XKSA 1QFMA 3ULEC 1MG2A 5FA5B 1TYEA 4L3GD 3JB9L 3C99A 3NVXA 4FWWA 1UOPA 4JHPC 1GG2B 2J57G 4D9SA 3RN0D 3DM0A 5HE0B 4QRJA 1P22A 4ZOYA 3I89A 4MMZA 1Q47A 3K6SA 3SFZA 3IJCA 2CNXA 2I3TA 4IA9A 4G56B 3MZKA 4NAAA 3I7PA 3I7KA 4ERQA 2QZPA 4AMZA 2G99A 4L1QD 5M5UA 2HU7A 2AGLA 3SMRA 2B5MA 4AOWA 1SQ9A 4CI2A 4O1QD 2IUPA 2O9KA 3IUMA 3RRMC 1U2VC 4FAVD 4Y7RA 3O4GA 2H13A 1RI6A 4A09B 1T2XA 3ODTA 4WJKA 4J79A 5CYKB 4AEZA 4JT5C 3JAMg 3O4IA 1R5MA 1C9LA 4G1MA 5GXIA 4GGCA 3I7OA 2XU7A 1PEVA 4CY1A 1E8NA 1SHYB 3JROA 3RLMD 3C75H 5CXBA 2PM7B 2AGZA 3OKTA 4J8GA 2Q7QA 3PVWB 3SWSD 3MZLA 3UVOA 3DXKC 2VDPA 2H68A 3EWEA 3PXSD 1BPOA 4J0WA 3UVMA 4A0AB 4JSVC 3V9FA 3IJ1A 4K3JB 2AGYA 3IURA 2XL2A 4CC9A 3I7NA 2EBSA 3EG6A 4PBYA 5JWZA 4A7JA 3K71A 3HFQA 4IRZA 1PGUA 4FA5D 3J80g 4GZ8A 2HESX 2J55H 5SXMA 2H6NA 4BH6A 4FA1D 5AFU3 1K3IA 3ZE1A 4LGNA 4A11B 3OTTA 4O3TB 2YNNA 5EARA 3C9CA 3AFCA 3E0CA 2J56H 3VI3A 1JTDB 2HKRA 4QAMA 3A0FA 3AL8B 1XHMA 2OK4A 3CFVA 3IJ0A 5TEEA 4PC0A 1H2ZA 3L4OD 2OVPB 5FKQA 5HE2B 4NBMA 3ZWLB 1QNIA 1XIPA 1U4CA 3UKUC 2CE9A 1A0RB 2AGWA 4A0AA 3L4MD 3EI4A 2P9PC 3O4JA 4PXWA 3I8CA 5C2VB 2QR5A 1H2YA 4I79A 3T3MA 4Z7OA 1VE7A 3OKYB 2CO0A 3JRPA 3EI4B 5FXYA 1JOFA 3SVWD 5FLXg 2VC2A 4J78A 3OKYA 2CN3A 3V4PA 4JHNA 4GGAA 4G1EA 3J81g 2EIEA 2G9AA 3JZHA 3OF7A 3EI2A 2P9KC 4FA9D 5TDHB 3IUNA 2HU5A 4JXMA 4J82A 2OVRB 5H1MA 2P9IC 4D0KA 1VE6A 4A2LA 4O9DA 3IUJA 4ERZA 3K26A 2BBKH 3EI3B 4FA4D 5GXHA 3MXXA 2VDLA 2I0RA 3SLED 4CZYA 4E54B 2IURA 2YMUA 3I7LA 4E5ZA 2H3XA 3KCIA 4J73A 3SCYA 5E6UA 5I5IA 5CXCA 2H9MA 3GD1I 4CI3A 3ORVD 5IGQA 3V7DB 1L5GA 4XYIA 3RSEC 5A2Qg 3I7HA 1GOFA 3DWLC 4FB1D 4OZUA 2VDKA 4J0XA 4G55A 4YVDA 1H2XA 4GM9A 3EQ8A 5E6SA 3MKQA 1SQJA 4K3ID 4X60B 5HQGA 3F3FA 3CFSB
chains in the Genus database with same CATH topology
4A2MA 5K1CC 2OJYA 5GMKn 3SBRA 3AL8A 5KDOB 4N14A 2TRCB 2P9UC 2B5LA 2XYIA 3K27A 4ESGA 2YB8B 5EAMA 5CYKA 4E5ZB 4J77A 2AH1A 5EM2A 1K32A 5THAA 3VA6A 3DXMC 4UI9R 4GQ2P 4A0BB 3JZNA 2IUQA 3OL2A 3VGZA 4CY5A 1B9XA 3B7FA 5CXBB 2IAAA 2I0SA 3EU7A 3FRXA 5FKTA 2H6QA 3C5MA 3KRWB 5I5JA 3IIYA 1JMZB 5K19A 3EI3A 2Z2OA 4JSXC 4XYHA 4E54A 4ZOXA 3RN1D 2B4EA 2B5NA 2H9NA 2AQ5A 1NEXB 4CY2A 4X61B 2XL3A 3SN6B 4A09A 5IGOA 2OK6A 5HE3B 2UZYB 4JD2C 4FAND 3N0DA 4J86A 3SBPA 4ZOZA 4BL0A 4J8BA 2HKMA 3IIWA 3PSLA 1FWXA 5H17A 5C9ZB 3PVUB 4GMBA 4ERYA 3EI1A 4IMMA 2Z2PA 2QXVA 2I3SA 3RFGA 1OLZA 4QL1A 5IJ8E 4CY3A 2CE8A 3EI1B 3NVNA 4CZXA 2UZXB 1S4UX 4L9OA 4GQBB 1N6DA 2H9LA 5I5MA 4PNKB 2PM6B 2YNPA 4L3HD 2HJ4A 3OL2B 3UVNA 3JZGA 1N6FA 2IWFA 3SBQA 5EMMB 1NR0A 1MG3A 5FKRA 1JMXB 2PM9A 1JJUB 3PE7A 5EMLB 4A08A 3I2NA 2AH0A 3MKSB 5IC7A 3PSCB 4A0BA 3P4FA 2GC7A 3JPXA 3UVKA 3N0EA 2CN2A 3RMZD 5GSAA 3BG1A 5B4WA 3SXTD 4CI8A 2HYEA 3BWSA 3DSMA 4EWRA 1K8KC 4JSPC 4D6VA 2PM9B 4Y5RD 4HDJA 3AL9A 4R7AB 3UR4A 2PBIB 2P9NC 5IJ7E 3OKWA 4J81A 4U1EI 3AH8B 1YFQA 2HXCA 2YNOA 2P9LC 4CI1A 2OVQB 2QC5A 5FQDA 2Z2NA 3KRXB 3MMYA 3GFCA 2YBAA 2IWKA 2W18A 3EI2B 4NSXA 1N6EA 1ERJA 3IKOA 4U7AA 2GNQA 4ZN4A 5FKSA 2AGXA 4H5IA 1B9YA 1VYHC 4XEIC 5AJAA 2I0TA 4FHLA 2HJBA 5HE1B 3I8EA 2MTAH 4LG8A 4OWRA 3W15A 5EMJB 3UKRC 4JT6C 4QQEA 5HYNB 4A08B 4GM3A 3FM0A 1PI6A 3SHFA 4TZ4A 5H14A 1GXRA 1GOTB 5CXCB 3GREA 1L0QA 1OMWB 3CIKB 1GP2B 4PSWB 3PXTD 4A11A 2H6KA 3NVQA 4O45A 3FGBA 3SJLD 5EMKB 4JSNC 4GQ1A 4PBZA 3U4YA 3EMHA 2P9SC 3F3GA 5EAPA 5TEFA 2H14A 1TBGA 3F3PA 4X63B 5AMSA 4J84A 4MK0B 3RFHA 4H5JA 4O3UB 4BUJC 3BG0A 4Z8LA 2H9PA 5TF2A 4KFMB 1PBYB 3OW8A 4CZVA 2CO0C 2GC4A 1MDAH 4X3EA 5EALA 1TYQC 3V5WB 5C2WB 4GGDA 4LG9A 2OIZA 4QT8A 4PSXB 2IUVA 4GM8A 5EM2B 3UVLA 2H47A 4ES0A 3PXWD 4J87A 2BCJB 5IT9g 3VH0A 4ZOVA 1XKSA 3ULEC 1MG2A 5FA5B 4L3GD 3JB9L 3C99A 3NVXA 4FWWA 1GG2B 2J57G 3RN0D 3DM0A 5HE0B 4QRJA 1P22A 4ZOYA 3I89A 1Q47A 3SFZA 3IJCA 2CNXA 2I3TA 4IA9A 3MZKA 4G56B 3I7PA 3I7KA 4ERQA 2G99A 4L1QD 2AGLA 3SMRA 2B5MA 4AOWA 1SQ9A 4CI2A 4O1QD 2IUPA 2O9KA 3RRMC 1U2VC 4FAVD 4Y7RA 2H13A 1RI6A 4A09B 3ODTA 5CYKB 4J79A 4AEZA 4JT5C 3JAMg 1R5MA 5GXIA 4GGCA 3I7OA 2XU7A 1PEVA 4CY1A 1SHYB 3JROA 3RLMD 3C75H 5CXBA 2PM7B 2AGZA 3OKTA 4J8GA 2Q7QA 3PVWB 3SWSD 3MZLA 3UVOA 3DXKC 3EWEA 2H68A 3PXSD 4J0WA 4A0AB 3UVMA 4JSVC 3V9FA 3IJ1A 4K3JB 2AGYA 2XL2A 4CC9A 3I7NA 2EBSA 3EG6A 4PBYA 5JWZA 4A7JA 3HFQA 1PGUA 4FA5D 3J80g 4GZ8A 2HESX 2J55H 5SXMA 2H6NA 4BH6A 4FA1D 5AFU3 4LGNA 4A11B 3OTTA 4O3TB 2YNNA 5EARA 3C9CA 3AFCA 3E0CA 2J56H 2HKRA 3A0FA 3AL8B 1XHMA 2OK4A 3CFVA 3IJ0A 5TEEA 4PC0A 3L4OD 2OVPB 5FKQA 5HE2B 3ZWLB 1QNIA 1XIPA 1U4CA 3UKUC 2CE9A 1A0RB 2AGWA 4A0AA 3L4MD 3EI4A 2P9PC 4PXWA 3I8CA 5C2VB 4I79A 3OKYB 2CO0A 3JRPA 3EI4B 5FXYA 1JOFA 3SVWD 5FLXg 4J78A 3OKYA 2CN3A 4GGAA 3J81g 3JZHA 2G9AA 3EI2A 2P9KC 4FA9D 5TDHB 4JXMA 4J82A 2OVRB 5H1MA 2P9IC 4D0KA 4A2LA 4O9DA 4ERZA 3K26A 2BBKH 3EI3B 4FA4D 5GXHA 3MXXA 2I0RA 3SLED 4CZYA 4E54B 2IURA 2YMUA 3I7LA 4E5ZA 2H3XA 4J73A 3SCYA 5I5IA 5CXCA 2H9MA 4CI3A 3ORVD 5IGQA 3V7DB 3RSEC 4XYIA 5A2Qg 3I7HA 3DWLC 4FB1D 4OZUA 4J0XA 4YVDA 4GM9A 3MKQA 1SQJA 4K3ID 4X60B 5HQGA 3F3FA 3CFSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2M A;  5K1C C;  2OJY A;  5GMK n;  3SBR A;  3AL8 A;  5KDO B;  4N14 A;  2TRC B;  2P9U C;  2B5L A;  2XYI A;  3K27 A;  4ESG A;  2YB8 B;  5EAM A;  5CYK A;  4E5Z B;  4J77 A;  2AH1 A;  5EM2 A;  1K32 A;  5THA A;  3VA6 A;  3DXM C;  4UI9 R;  4GQ2 P;  4A0B B;  3JZN A;  2IUQ A;  3OL2 A;  3VGZ A;  4CY5 A;  1B9X A;  3B7F A;  5CXB B;  2IAA A;  2I0S A;  3EU7 A;  3FRX A;  5FKT A;  2H6Q A;  3C5M A;  3KRW B;  5I5J A;  3IIY A;  1JMZ B;  5K19 A;  3EI3 A;  2Z2O A;  4JSX C;  4XYH A;  4E54 A;  4ZOX A;  3RN1 D;  2B4E A;  2B5N A;  2H9N A;  2AQ5 A;  1NEX B;  4CY2 A;  4X61 B;  2XL3 A;  3SN6 B;  4A09 A;  5IGO A;  2OK6 A;  5HE3 B;  2UZY B;  4JD2 C;  4FAN D;  3N0D A;  4J86 A;  3SBP A;  4ZOZ A;  4BL0 A;  4J8B A;  2HKM A;  3IIW A;  3PSL A;  1FWX A;  5H17 A;  5C9Z B;  3PVU B;  4GMB A;  4ERY A;  3EI1 A;  4IMM A;  2Z2P A;  2QXV A;  2I3S A;  3RFG A;  1OLZ A;  4QL1 A;  5IJ8 E;  4CY3 A;  2CE8 A;  3EI1 B;  3NVN A;  4CZX A;  2UZX B;  1S4U X;  4L9O A;  4GQB B;  1N6D A;  2H9L A;  5I5M A;  4PNK B;  2PM6 B;  2YNP A;  4L3H D;  2HJ4 A;  3OL2 B;  3UVN A;  3JZG A;  1N6F A;  2IWF A;  3SBQ A;  5EMM B;  1NR0 A;  1MG3 A;  5FKR A;  1JMX B;  2PM9 A;  1JJU B;  3PE7 A;  5EML B;  4A08 A;  3I2N A;  2AH0 A;  3MKS B;  5IC7 A;  3PSC B;  4A0B A;  3P4F A;  2GC7 A;  3JPX A;  3UVK A;  3N0E A;  2CN2 A;  3RMZ D;  5GSA A;  3BG1 A;  5B4W A;  3SXT D;  4CI8 A;  2HYE A;  3BWS A;  3DSM A;  4EWR A;  1K8K C;  4JSP C;  4D6V A;  2PM9 B;  4Y5R D;  4HDJ A;  3AL9 A;  4R7A B;  3UR4 A;  2PBI B;  2P9N C;  5IJ7 E;  3OKW A;  4J81 A;  4U1E I;  3AH8 B;  1YFQ A;  2HXC A;  2YNO A;  2P9L C;  4CI1 A;  2OVQ B;  2QC5 A;  5FQD A;  2Z2N A;  3KRX B;  3MMY A;  3GFC A;  2YBA A;  2IWK A;  2W18 A;  3EI2 B;  4NSX A;  1N6E A;  1ERJ A;  3IKO A;  4U7A A;  2GNQ A;  4ZN4 A;  5FKS A;  2AGX A;  4H5I A;  1B9Y A;  1VYH C;  4XEI C;  5AJA A;  2I0T A;  4FHL A;  2HJB A;  5HE1 B;  3I8E A;  2MTA H;  4LG8 A;  4OWR A;  3W15 A;  5EMJ B;  3UKR C;  4JT6 C;  4QQE A;  5HYN B;  4A08 B;  4GM3 A;  3FM0 A;  1PI6 A;  3SHF A;  4TZ4 A;  5H14 A;  1GXR A;  1GOT B;  5CXC B;  3GRE A;  1L0Q A;  1OMW B;  3CIK B;  1GP2 B;  4PSW B;  3PXT D;  4A11 A;  2H6K A;  3NVQ A;  4O45 A;  3FGB A;  3SJL D;  5EMK B;  4JSN C;  4GQ1 A;  4PBZ A;  3U4Y A;  3EMH A;  2P9S C;  3F3G A;  5EAP A;  5TEF A;  2H14 A;  1TBG A;  3F3P A;  4X63 B;  5AMS A;  4J84 A;  4MK0 B;  3RFH A;  4H5J A;  4O3U B;  4BUJ C;  3BG0 A;  4Z8L A;  2H9P A;  5TF2 A;  4KFM B;  1PBY B;  3OW8 A;  4CZV A;  2CO0 C;  2GC4 A;  1MDA H;  4X3E A;  5EAL A;  1TYQ C;  3V5W B;  5C2W B;  4GGD A;  4LG9 A;  2OIZ A;  4QT8 A;  4PSX B;  2IUV A;  4GM8 A;  5EM2 B;  3UVL A;  2H47 A;  4ES0 A;  3PXW D;  4J87 A;  2BCJ B;  5IT9 g;  3VH0 A;  4ZOV A;  1XKS A;  3ULE C;  1MG2 A;  5FA5 B;  4L3G D;  3JB9 L;  3C99 A;  3NVX A;  4FWW A;  1GG2 B;  2J57 G;  3RN0 D;  3DM0 A;  5HE0 B;  4QRJ A;  1P22 A;  4ZOY A;  3I89 A;  1Q47 A;  3SFZ A;  3IJC A;  2CNX A;  2I3T A;  4IA9 A;  3MZK A;  4G56 B;  3I7P A;  3I7K A;  4ERQ A;  2G99 A;  4L1Q D;  2AGL A;  3SMR A;  2B5M A;  4AOW A;  1SQ9 A;  4CI2 A;  4O1Q D;  2IUP A;  2O9K A;  3RRM C;  1U2V C;  4FAV D;  4Y7R A;  2H13 A;  1RI6 A;  4A09 B;  3ODT A;  5CYK B;  4J79 A;  4AEZ A;  4JT5 C;  3JAM g;  1R5M A;  5GXI A;  4GGC A;  3I7O A;  2XU7 A;  1PEV A;  4CY1 A;  1SHY B;  3JRO A;  3RLM D;  3C75 H;  5CXB A;  2PM7 B;  2AGZ A;  3OKT A;  4J8G A;  2Q7Q A;  3PVW B;  3SWS D;  3MZL A;  3UVO A;  3DXK C;  3EWE A;  2H68 A;  3PXS D;  4J0W A;  4A0A B;  3UVM A;  4JSV C;  3V9F A;  3IJ1 A;  4K3J B;  2AGY A;  2XL2 A;  4CC9 A;  3I7N A;  2EBS A;  3EG6 A;  4PBY A;  5JWZ A;  4A7J A;  3HFQ A;  1PGU A;  4FA5 D;  3J80 g;  4GZ8 A;  2HES X;  2J55 H;  5SXM A;  2H6N A;  4BH6 A;  4FA1 D;  5AFU 3;  4LGN A;  4A11 B;  3OTT A;  4O3T B;  2YNN A;  5EAR A;  3C9C A;  3AFC A;  3E0C A;  2J56 H;  2HKR A;  3A0F A;  3AL8 B;  1XHM A;  2OK4 A;  3CFV A;  3IJ0 A;  5TEE A;  4PC0 A;  3L4O D;  2OVP B;  5FKQ A;  5HE2 B;  3ZWL B;  1QNI A;  1XIP A;  1U4C A;  3UKU C;  2CE9 A;  1A0R B;  2AGW A;  4A0A A;  3L4M D;  3EI4 A;  2P9P C;  4PXW A;  3I8C A;  5C2V B;  4I79 A;  3OKY B;  2CO0 A;  3JRP A;  3EI4 B;  5FXY A;  1JOF A;  3SVW D;  5FLX g;  4J78 A;  3OKY A;  2CN3 A;  4GGA A;  3J81 g;  3JZH A;  2G9A A;  3EI2 A;  2P9K C;  4FA9 D;  5TDH B;  4JXM A;  4J82 A;  2OVR B;  5H1M A;  2P9I C;  4D0K A;  4A2L A;  4O9D A;  4ERZ A;  3K26 A;  2BBK H;  3EI3 B;  4FA4 D;  5GXH A;  3MXX A;  2I0R A;  3SLE D;  4CZY A;  4E54 B;  2IUR A;  2YMU A;  3I7L A;  4E5Z A;  2H3X A;  4J73 A;  3SCY A;  5I5I A;  5CXC A;  2H9M A;  4CI3 A;  3ORV D;  5IGQ A;  3V7D B;  3RSE C;  4XYI A;  5A2Q g;  3I7H A;  3DWL C;  4FB1 D;  4OZU A;  4J0X A;  4YVD A;  4GM9 A;  3MKQ A;  1SQJ A;  4K3I D;  4X60 B;  5HQG A;  3F3F A;  3CFS B; 
#chains in the Genus database with same CATH topology
 4A2M A;  2EIC A;  2OJY A;  5K1C C;  5GMK n;  3K72 A;  3SBR A;  3AL8 A;  4UM9 A;  3ZDZ A;  5KDO B;  4N14 A;  2TRC B;  2P9U C;  2B5L A;  2XYI A;  3K27 A;  4ESG A;  2BKL A;  2YB8 B;  3MUN A;  5CYK A;  5EAM A;  4E5Z B;  4J77 A;  2AH1 A;  5EM2 A;  1K32 A;  5THA A;  3VA6 A;  3DXM C;  4UI9 R;  4GQ2 P;  3EQ9 A;  4A0B B;  3JZN A;  2IUQ A;  3OL2 A;  3VGZ A;  4CY5 A;  5M5R A;  3NIF A;  1B9X A;  3B7F A;  1I2M B;  5CXB B;  4BP9 A;  2IAA A;  2I0S A;  3EQ7 A;  3EU7 A;  3FRX A;  5FKT A;  2H6Q A;  3C5M A;  3KRW B;  3NIG A;  5I5J A;  3IIY A;  1JMZ B;  2EIB A;  4AN0 A;  5K19 A;  3GC3 B;  3EI3 A;  2Z2O A;  4JSX C;  5FFO A;  4XYH A;  4E54 A;  4NC4 A;  4ZOX A;  3ZE2 A;  3RN1 D;  2B4E A;  1O6F A;  2XE4 A;  1H2W A;  2B5N A;  4AMY A;  2HU8 A;  2H9N A;  2AQ5 A;  1NEX B;  4CY2 A;  4X61 B;  2XL3 A;  3SN6 B;  4A09 A;  5IGO A;  2OK6 A;  1UOO A;  2UZY B;  5HE3 B;  4JD2 C;  4FAN D;  3N0D A;  2XZG A;  4J86 A;  2VDM A;  3SBP A;  4ZOZ A;  4BL0 A;  1UTC A;  4BCB A;  4J8B A;  2HKM A;  1U8C A;  4RE6 A;  3IIW A;  3PSL A;  4DNV A;  1FWX A;  5H17 A;  5C9Z B;  3QHY B;  3PVU B;  2VZ1 A;  4GMB A;  4ERY A;  3EI1 A;  1O6G A;  4IMM A;  2Z2P A;  2QXV A;  2I3S A;  3RFG A;  1OLZ A;  4QL1 A;  5IJ8 E;  4CY3 A;  2CE8 A;  3FCU A;  3EI1 B;  1UOQ A;  3NVN A;  4CZX A;  5C86 A;  2UZX B;  1S4U X;  4L9O A;  4GQB B;  1N6D A;  2H9L A;  5I5M A;  4PNK B;  1VZ3 A;  2PM6 B;  5HDB A;  2YNP A;  4L3H D;  5M5T A;  2HJ4 A;  3OL2 B;  3UVN A;  3JZG A;  1N6F A;  2IWF A;  3SBQ A;  5EMM B;  1NR0 A;  1MG3 A;  5FKR A;  1JMX B;  2PM9 A;  1JJU B;  3PE7 A;  4Z7Q A;  5EML B;  4A08 A;  3I2N A;  2AH0 A;  3MKS B;  5IC7 A;  3PSC B;  4A0B A;  3P4F A;  2GC7 A;  3JPX A;  3UVK A;  3N0E A;  2CN2 A;  3RMZ D;  5GSA A;  3BG1 A;  4WK4 A;  1JV2 A;  5B4W A;  3SXT D;  4CI8 A;  2VDR A;  2HYE A;  3BWS A;  3DSM A;  4EWR A;  1K8K C;  4JSP C;  5FFG A;  4D6V A;  2PM9 B;  1GOH A;  4O2W A;  4Y5R D;  4HDJ A;  3AL9 A;  4R7A B;  1E8M A;  1YR2 A;  3MUO A;  1E5T A;  3UR4 A;  1GOG A;  2PBI B;  4NEN A;  5C92 A;  2P9N C;  5IJ7 E;  3OKW A;  4J81 A;  4U1E I;  5M5V A;  3AH8 B;  4RE5 A;  1YFQ A;  5M61 A;  2HXC A;  2YNO A;  2P9L C;  4CI1 A;  2OVQ B;  3ZDX A;  2QC5 A;  3QI0 A;  5FQD A;  2Z2N A;  4BP8 A;  3KRX B;  3MMY A;  3GFC A;  2YBA A;  2IWK A;  3DDU A;  2W18 A;  3EI2 B;  4BCD A;  4NSX A;  4DNU A;  1N6E A;  4MMX A;  1ERJ A;  2VZ3 A;  1QFS A;  3IKO A;  4U7A A;  2GNQ A;  4AN1 A;  3IVM A;  4ZN4 A;  5FKS A;  2AGX A;  4H5I A;  3T3P A;  1B9Y A;  1VYH C;  4XEI C;  5AJA A;  2I0T A;  4FHL A;  2HJB A;  5HE1 B;  3I8E A;  2MTA H;  4LG8 A;  1A12 A;  4OWR A;  3W15 A;  4AX4 A;  1M1X A;  5EMJ B;  3UKR C;  4JT6 C;  3ZE0 A;  4QQE A;  4WK2 A;  5HYN B;  4A08 B;  4GM3 A;  3FM0 A;  1PI6 A;  3SHF A;  4TZ4 A;  1VZ2 A;  5H14 A;  1GXR A;  1GOT B;  5CXC B;  3GRE A;  1L0Q A;  1OMW B;  3CIK B;  1GP2 B;  4PSW B;  3PXT D;  4A11 A;  2H6K A;  3NVQ A;  4O45 A;  5E6R A;  3FGB A;  3SJL D;  5EMK B;  4JSN C;  4GQ1 A;  3IJE A;  2WQ8 A;  4PBZ A;  3U4Y A;  3EMH A;  2P9S C;  3F3G A;  5EAP A;  5TEF A;  5M5S A;  2H14 A;  2VDO A;  1TBG A;  3F3P A;  4L1M A;  4X63 B;  4BCC A;  3MVD K;  5AMS A;  4J84 A;  4MK0 B;  3IUQ A;  3RFH A;  4H5J A;  4Z7N A;  4O3U B;  4O02 A;  4BUJ C;  3BG0 A;  4Z8L A;  2H9P A;  2VDN A;  5TF2 A;  4KFM B;  1PBY B;  3V4V A;  4MMY A;  3OW8 A;  4CZV A;  2CO0 C;  2GC4 A;  1MDA H;  4X3E A;  5EAL A;  1TYQ C;  2XDW A;  3V5W B;  3ZDY A;  5C2W B;  2VDQ A;  4GGD A;  4LG9 A;  2OIZ A;  4QT8 A;  2EID A;  3IUL A;  3NID A;  3FCS A;  4PSX B;  4UM8 A;  3VI4 A;  2IUV A;  4GM8 A;  5EM2 B;  3UVL A;  2H47 A;  1C9I A;  3O4H A;  4ES0 A;  3PXW D;  4WK0 A;  4J87 A;  2BCJ B;  5IT9 g;  4DNW A;  2JKX A;  3VH0 A;  4ZOV A;  1XKS A;  1QFM A;  3ULE C;  1MG2 A;  5FA5 B;  1TYE A;  4L3G D;  3JB9 L;  3C99 A;  3NVX A;  4FWW A;  1UOP A;  4JHP C;  1GG2 B;  2J57 G;  4D9S A;  3RN0 D;  3DM0 A;  5HE0 B;  4QRJ A;  1P22 A;  4ZOY A;  3I89 A;  4MMZ A;  1Q47 A;  3K6S A;  3SFZ A;  3IJC A;  2CNX A;  2I3T A;  4IA9 A;  4G56 B;  3MZK A;  4NAA A;  3I7P A;  3I7K A;  4ERQ A;  2QZP A;  4AMZ A;  2G99 A;  4L1Q D;  5M5U A;  2HU7 A;  2AGL A;  3SMR A;  2B5M A;  4AOW A;  1SQ9 A;  4CI2 A;  4O1Q D;  2IUP A;  2O9K A;  3IUM A;  3RRM C;  1U2V C;  4FAV D;  4Y7R A;  3O4G A;  2H13 A;  1RI6 A;  4A09 B;  1T2X A;  3ODT A;  4WJK A;  4J79 A;  5CYK B;  4AEZ A;  4JT5 C;  3JAM g;  3O4I A;  1R5M A;  1C9L A;  4G1M A;  5GXI A;  4GGC A;  3I7O A;  2XU7 A;  1PEV A;  4CY1 A;  1E8N A;  1SHY B;  3JRO A;  3RLM D;  3C75 H;  5CXB A;  2PM7 B;  2AGZ A;  3OKT A;  4J8G A;  2Q7Q A;  3PVW B;  3SWS D;  3MZL A;  3UVO A;  3DXK C;  2VDP A;  2H68 A;  3EWE A;  3PXS D;  1BPO A;  4J0W A;  3UVM A;  4A0A B;  4JSV C;  3V9F A;  3IJ1 A;  4K3J B;  2AGY A;  3IUR A;  2XL2 A;  4CC9 A;  3I7N A;  2EBS A;  3EG6 A;  4PBY A;  5JWZ A;  4A7J A;  3K71 A;  3HFQ A;  4IRZ A;  1PGU A;  4FA5 D;  3J80 g;  4GZ8 A;  2HES X;  2J55 H;  5SXM A;  2H6N A;  4BH6 A;  4FA1 D;  5AFU 3;  1K3I A;  3ZE1 A;  4LGN A;  4A11 B;  3OTT A;  4O3T B;  2YNN A;  5EAR A;  3C9C A;  3AFC A;  3E0C A;  2J56 H;  3VI3 A;  1JTD B;  2HKR A;  4QAM A;  3A0F A;  3AL8 B;  1XHM A;  2OK4 A;  3CFV A;  3IJ0 A;  5TEE A;  4PC0 A;  1H2Z A;  3L4O D;  2OVP B;  5FKQ A;  5HE2 B;  4NBM A;  3ZWL B;  1QNI A;  1XIP A;  1U4C A;  3UKU C;  2CE9 A;  1A0R B;  2AGW A;  4A0A A;  3L4M D;  3EI4 A;  2P9P C;  3O4J A;  4PXW A;  3I8C A;  5C2V B;  2QR5 A;  1H2Y A;  4I79 A;  3T3M A;  4Z7O A;  1VE7 A;  3OKY B;  2CO0 A;  3JRP A;  3EI4 B;  5FXY A;  1JOF A;  3SVW D;  5FLX g;  2VC2 A;  4J78 A;  3OKY A;  2CN3 A;  3V4P A;  4JHN A;  4GGA A;  4G1E A;  3J81 g;  2EIE A;  2G9A A;  3JZH A;  3OF7 A;  3EI2 A;  2P9K C;  4FA9 D;  5TDH B;  3IUN A;  2HU5 A;  4JXM A;  4J82 A;  2OVR B;  5H1M A;  2P9I C;  4D0K A;  1VE6 A;  4A2L A;  4O9D A;  3IUJ A;  4ERZ A;  3K26 A;  2BBK H;  3EI3 B;  4FA4 D;  5GXH A;  3MXX A;  2VDL A;  2I0R A;  3SLE D;  4CZY A;  4E54 B;  2IUR A;  2YMU A;  3I7L A;  4E5Z A;  2H3X A;  3KCI A;  4J73 A;  3SCY A;  5E6U A;  5I5I A;  5CXC A;  2H9M A;  3GD1 I;  4CI3 A;  3ORV D;  5IGQ A;  3V7D B;  1L5G A;  4XYI A;  3RSE C;  5A2Q g;  3I7H A;  1GOF A;  3DWL C;  4FB1 D;  4OZU A;  2VDK A;  4J0X A;  4G55 A;  4YVD A;  1H2X A;  4GM9 A;  3EQ8 A;  5E6S A;  3MKQ A;  1SQJ A;  4K3I D;  4X60 B;  5HQG A;  3F3F A;  3CFS B; 
#chains in the Genus database with same CATH homology
 4A2M A;  5K1C C;  2OJY A;  5GMK n;  3SBR A;  3AL8 A;  5KDO B;  4N14 A;  2TRC B;  2P9U C;  2B5L A;  2XYI A;  3K27 A;  4ESG A;  2YB8 B;  5EAM A;  5CYK A;  4E5Z B;  4J77 A;  2AH1 A;  5EM2 A;  1K32 A;  5THA A;  3VA6 A;  3DXM C;  4UI9 R;  4GQ2 P;  4A0B B;  3JZN A;  2IUQ A;  3OL2 A;  3VGZ A;  4CY5 A;  1B9X A;  3B7F A;  5CXB B;  2IAA A;  2I0S A;  3EU7 A;  3FRX A;  5FKT A;  2H6Q A;  3C5M A;  3KRW B;  5I5J A;  3IIY A;  1JMZ B;  5K19 A;  3EI3 A;  2Z2O A;  4JSX C;  4XYH A;  4E54 A;  4ZOX A;  3RN1 D;  2B4E A;  2B5N A;  2H9N A;  2AQ5 A;  1NEX B;  4CY2 A;  4X61 B;  2XL3 A;  3SN6 B;  4A09 A;  5IGO A;  2OK6 A;  5HE3 B;  2UZY B;  4JD2 C;  4FAN D;  3N0D A;  4J86 A;  3SBP A;  4ZOZ A;  4BL0 A;  4J8B A;  2HKM A;  3IIW A;  3PSL A;  1FWX A;  5H17 A;  5C9Z B;  3PVU B;  4GMB A;  4ERY A;  3EI1 A;  4IMM A;  2Z2P A;  2QXV A;  2I3S A;  3RFG A;  1OLZ A;  4QL1 A;  5IJ8 E;  4CY3 A;  2CE8 A;  3EI1 B;  3NVN A;  4CZX A;  2UZX B;  1S4U X;  4L9O A;  4GQB B;  1N6D A;  2H9L A;  5I5M A;  4PNK B;  2PM6 B;  2YNP A;  4L3H D;  2HJ4 A;  3OL2 B;  3UVN A;  3JZG A;  1N6F A;  2IWF A;  3SBQ A;  5EMM B;  1NR0 A;  1MG3 A;  5FKR A;  1JMX B;  2PM9 A;  1JJU B;  3PE7 A;  5EML B;  4A08 A;  3I2N A;  2AH0 A;  3MKS B;  5IC7 A;  3PSC B;  4A0B A;  3P4F A;  2GC7 A;  3JPX A;  3UVK A;  3N0E A;  2CN2 A;  3RMZ D;  5GSA A;  3BG1 A;  5B4W A;  3SXT D;  4CI8 A;  2HYE A;  3BWS A;  3DSM A;  4EWR A;  1K8K C;  4JSP C;  4D6V A;  2PM9 B;  4Y5R D;  4HDJ A;  3AL9 A;  4R7A B;  3UR4 A;  2PBI B;  2P9N C;  5IJ7 E;  3OKW A;  4J81 A;  4U1E I;  3AH8 B;  1YFQ A;  2HXC A;  2YNO A;  2P9L C;  4CI1 A;  2OVQ B;  2QC5 A;  5FQD A;  2Z2N A;  3KRX B;  3MMY A;  3GFC A;  2YBA A;  2IWK A;  2W18 A;  3EI2 B;  4NSX A;  1N6E A;  1ERJ A;  3IKO A;  4U7A A;  2GNQ A;  4ZN4 A;  5FKS A;  2AGX A;  4H5I A;  1B9Y A;  1VYH C;  4XEI C;  5AJA A;  2I0T A;  4FHL A;  2HJB A;  5HE1 B;  3I8E A;  2MTA H;  4LG8 A;  4OWR A;  3W15 A;  5EMJ B;  3UKR C;  4JT6 C;  4QQE A;  5HYN B;  4A08 B;  4GM3 A;  3FM0 A;  1PI6 A;  3SHF A;  4TZ4 A;  5H14 A;  1GXR A;  1GOT B;  5CXC B;  3GRE A;  1L0Q A;  1OMW B;  3CIK B;  1GP2 B;  4PSW B;  3PXT D;  4A11 A;  2H6K A;  3NVQ A;  4O45 A;  3FGB A;  3SJL D;  5EMK B;  4JSN C;  4GQ1 A;  4PBZ A;  3U4Y A;  3EMH A;  2P9S C;  3F3G A;  5EAP A;  5TEF A;  2H14 A;  1TBG A;  3F3P A;  4X63 B;  5AMS A;  4J84 A;  4MK0 B;  3RFH A;  4H5J A;  4O3U B;  4BUJ C;  3BG0 A;  4Z8L A;  2H9P A;  5TF2 A;  4KFM B;  1PBY B;  3OW8 A;  4CZV A;  2CO0 C;  2GC4 A;  1MDA H;  4X3E A;  5EAL A;  1TYQ C;  3V5W B;  5C2W B;  4GGD A;  4LG9 A;  2OIZ A;  4QT8 A;  4PSX B;  2IUV A;  4GM8 A;  5EM2 B;  3UVL A;  2H47 A;  4ES0 A;  3PXW D;  4J87 A;  2BCJ B;  5IT9 g;  3VH0 A;  4ZOV A;  1XKS A;  3ULE C;  1MG2 A;  5FA5 B;  4L3G D;  3JB9 L;  3C99 A;  3NVX A;  4FWW A;  1GG2 B;  2J57 G;  3RN0 D;  3DM0 A;  5HE0 B;  4QRJ A;  1P22 A;  4ZOY A;  3I89 A;  1Q47 A;  3SFZ A;  3IJC A;  2CNX A;  2I3T A;  4IA9 A;  3MZK A;  4G56 B;  3I7P A;  3I7K A;  4ERQ A;  2G99 A;  4L1Q D;  2AGL A;  3SMR A;  2B5M A;  4AOW A;  1SQ9 A;  4CI2 A;  4O1Q D;  2IUP A;  2O9K A;  3RRM C;  1U2V C;  4FAV D;  4Y7R A;  2H13 A;  1RI6 A;  4A09 B;  3ODT A;  5CYK B;  4J79 A;  4AEZ A;  4JT5 C;  3JAM g;  1R5M A;  5GXI A;  4GGC A;  3I7O A;  2XU7 A;  1PEV A;  4CY1 A;  1SHY B;  3JRO A;  3RLM D;  3C75 H;  5CXB A;  2PM7 B;  2AGZ A;  3OKT A;  4J8G A;  2Q7Q A;  3PVW B;  3SWS D;  3MZL A;  3UVO A;  3DXK C;  3EWE A;  2H68 A;  3PXS D;  4J0W A;  4A0A B;  3UVM A;  4JSV C;  3V9F A;  3IJ1 A;  4K3J B;  2AGY A;  2XL2 A;  4CC9 A;  3I7N A;  2EBS A;  3EG6 A;  4PBY A;  5JWZ A;  4A7J A;  3HFQ A;  1PGU A;  4FA5 D;  3J80 g;  4GZ8 A;  2HES X;  2J55 H;  5SXM A;  2H6N A;  4BH6 A;  4FA1 D;  5AFU 3;  4LGN A;  4A11 B;  3OTT A;  4O3T B;  2YNN A;  5EAR A;  3C9C A;  3AFC A;  3E0C A;  2J56 H;  2HKR A;  3A0F A;  3AL8 B;  1XHM A;  2OK4 A;  3CFV A;  3IJ0 A;  5TEE A;  4PC0 A;  3L4O D;  2OVP B;  5FKQ A;  5HE2 B;  3ZWL B;  1QNI A;  1XIP A;  1U4C A;  3UKU C;  2CE9 A;  1A0R B;  2AGW A;  4A0A A;  3L4M D;  3EI4 A;  2P9P C;  4PXW A;  3I8C A;  5C2V B;  4I79 A;  3OKY B;  2CO0 A;  3JRP A;  3EI4 B;  5FXY A;  1JOF A;  3SVW D;  5FLX g;  4J78 A;  3OKY A;  2CN3 A;  4GGA A;  3J81 g;  3JZH A;  2G9A A;  3EI2 A;  2P9K C;  4FA9 D;  5TDH B;  4JXM A;  4J82 A;  2OVR B;  5H1M A;  2P9I C;  4D0K A;  4A2L A;  4O9D A;  4ERZ A;  3K26 A;  2BBK H;  3EI3 B;  4FA4 D;  5GXH A;  3MXX A;  2I0R A;  3SLE D;  4CZY A;  4E54 B;  2IUR A;  2YMU A;  3I7L A;  4E5Z A;  2H3X A;  4J73 A;  3SCY A;  5I5I A;  5CXC A;  2H9M A;  4CI3 A;  3ORV D;  5IGQ A;  3V7D B;  3RSE C;  4XYI A;  5A2Q g;  3I7H A;  3DWL C;  4FB1 D;  4OZU A;  4J0X A;  4YVD A;  4GM9 A;  3MKQ A;  1SQJ A;  4K3I D;  4X60 B;  5HQG A;  3F3F A;  3CFS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...