3SWXA

Crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
259
structure length
257
Chain Sequence
DYETLRIRRDGYVLVIGLNRPAKRNAFDKTMLEELALALGEYETDTDLRAAVLYGEGPLFTAGLDLASVAAEIQASLTPEGGINPWQVDGRQLSKPLLVAVHGKVLTLGIELALAADIVIADETATFAQLEVNRGIYPFGGATIRFPRTAGWGNAMRWMLTADTFDAVEAHRIGIVQEIVPVGEHVDTAIAIAQTIARQAPLGVQATLRNARLAVREGDAAAEEQLVPTVRELFTSEDATLGVQAFLSRTTAEFVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Isomerase
molecule keywords Probable enoyl-CoA hydratase/isomerase
total genus 89
structure length 257
sequence length 259
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3swxA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3swxA01
1VRGA 3H0SA 3QYRA 3MYBA 4ELXA 3TV5A 3IAVA 3U9RB 4DI1A 5DUFA 1YG6A 2ZQRA 3QK8A 1WDMA 1UYSA 3Q0JA 3GMAA 1OD2A 1RJMA 5E0SH 2J5GD 2F6QA 5FIFA 3KTHA 3R9SA 4K29A 3K50A 3PEAA 1TG6A 4JOTA 4ELSA 4Q0GA 5KDRA 3ZWBA 1O8UA 2VSUE 3Q7HA 4ZU2A 1UYTA 3FDUA 2W3PA 2PG8A 2A81A 4MXIA 2FW2A 2VSSA 5DUCA 3T8BA 3BEZA 2VREA 4RYFA 3RSIA 5INGA 5INFA 4EMMA 1DUBA 4WYOB 4ZDFA 3R9TA 4YLHA 3ZWCA 3TLFA 3WG5A 4K2NA 3TRRA 2C8TA 4JVTA 3TT7A 3NJBA 2ZL2A 3QXIA 2J5IA 3RSTA 4JYLA 4EMLA 4HNKA 3L3SA 3ZW9A 1K39A 2F9IA 5KDRB 3IB9A 2Q35A 3H81A 5IKLB 1TYFA 3M6MA 4U18A 3ZW8A 4QIJA 4FZWC 1ON9A 2VSSF 2J5SA 3ISAA 3RRVA 5MGBA 1K32A 1HZDA 3U9TB 3QREA 4JCSA 1N6FA 2A7SA 5DTPA 4RCNA 3K8XA 2VX2A 2BZRA 4JSBA 3VIVA 5DZKA 4ZDBA 4NNQA 5JBXA 1EF9A 3HRXA 2QQ3A 2IEXA 3IBBA 4FJWD 1XNWA 3GLMA 2J5IB 5C90A 3HINA 4MOUA 5DZKH 1J7XA 3TDCA 4U19A 2ZL3A 4L6WA 1XNVA 5CTBA 3QMJA 5G1RA 4I4ZA 2ZL4A 4MI2A 4QIIA 4OLQA 4KNPA 5DTWA 1MJ3A 1UIYA 3JU1A 4K3WA 2VSSE 4FN7A 2A7KA 3STAA 1PJHA 3H0JA 2CBYA 4IZBA 1N6DA 2Q34A 4ZDEA 3LKEA 5G1SA 3Q1TA 4ELWA 4U0GH 4JFCA 1FCFA 4JCTA 3T8AA 3KTIA 3H0QA 3N6RB 1SZOA 1RJNA 2GTRA 4EMPA 1Q51A 3QWDA 1N6EA 5CTCA 3DORA 4JWVA 1UYRA 3MOYA 4GHNA 3HE2A 4KWBA 3R9QA 3FF6A 4KD6A 2FBMA 2PBPA 3PGQA 4U0HA 1WDLA 5INIA 1JXZA 2D3TA 2WTBA 3P2LA 4WZ8B 4G2RA 2X24A 1DCIA 1HNUA 2EJ5A 3BPPA 3TZ3A 5DL1A 4RYFH 1NZYB 3R6HA 1XX4A 3GKBA 3T88A 4JJTA 2DEOA 3G64A 3KTKA 1SG4A 4OG1A 5DU8A 3BF0A 3MT6A 5DU4A 5DKPA 3GF3A 3SWXA 4NEKA 3TT6A 4OMRA 1EY3A 1WDKA 1HNOA 5E0NX 2J5II 4B3JA 4Q1IA 3Q0GA 2Q2XA 4QFEA 5FUSA 4KPKA 2F9YB 4ZDCA 1EF8A 4U0GA 3NJDA 4GM2A 1FC9A 3GF7A 3KQFA 3PZKA 1OD4A 2NP9A 4B3IA 3V5EA 3SLLA 1YG8A 5DU6A 3H0UA 1UYVA 3U9SB 5E0SA 1FC6A 2CE3A 3HLN1 4FNBA 3H02A 4JCQA 4ZDDA 3KTGA 4HC8A 1W2XA 3DJAA 4FNDA 4WCZA 4FB8A 3OC7A 4L8KA 4F47A 1PIXA 4FZWA 2F6IA 2X58A 1XNYA 2VSUC 3OMEA 2HW5A 3P85A 5C9GA 3I47A 3T89A 4Z0MA 3P5MA 4I42A 2J5GA 4U1AA 2VSUA 3QKAA 3M6NA 3V5IA 4IZDA 2FZSA 4LK5A 2PPYA 3ST9A 4JCRA 3QXZA 2VSUF 3TVWA 3PE8A 2F9YA 5JBWA 2UZFA 1FC7A 4ASIA 3LAOA 2ZL0A 2DUBA 1Y7OA 1ON3A 1Q52A 3TVUA 4FN8A 2F9IB 5KJPA 2ZQQA 3KTJA 1X0UA 4I52A 4JYJA 3ZWAA 1NZYA 3OT6A 3MFMA 1WZ8A 5G1QA 3R0OA 3HP0A 4IZCA 3T3WA 1XO6A 4B3HA
chains in the Genus database with same CATH superfamily
1VRGA 3H0SA 3QYRA 3MYBA 4ELXA 3TV5A 3ADBA 3IAVA 3U9RB 4DI1A 5DUFA 3BPTA 1YG6A 2ZQRA 3QK8A 1WDMA 1UYSA 3Q0JA 3GMAA 1OD2A 1RJMA 5E0SH 2J5GD 2F6QA 5FIFA 3KTHA 3R9SA 4K29A 3K50A 3PEAA 1TG6A 4JOTA 4ELSA 1Y64B 4Q0GA 5KDRA 3ZWBA 1O8UA 2VSUE 3Q7HA 4ZU2A 1UYTA 3FDUA 2W3PA 2PG8A 2A81A 4MXIA 2FW2A 2VSSA 5DUCA 3T8BA 1UX4A 3BEZA 2VREA 4RYFA 3RSIA 5INFA 4EMMA 5INGA 1DUBA 4WYOB 4ZDFA 3R9TA 4YLHA 3ZWCA 3TLFA 3W8IB 3WG5A 4NARA 4K2NA 3TRRA 2C8TA 4JVTA 3TT7A 3NJBA 2ZL2A 3QXIA 2J5IA 3RSTA 4JYLA 4EMLA 4HNKA 3L3SA 3ZW9A 1K39A 2F9IA 5KDRB 3IB9A 2Q35A 3H81A 5IKLB 1TYFA 3M6MA 4U18A 3ZW8A 4QIJA 4FZWC 1ON9A 2VSSF 2J5SA 3ISAA 3RRVA 5MGBA 1K32A 1HZDA 3U9TB 3QREA 4JCSA 1N6FA 2P63A 2A7SA 5DTPA 4RCNA 3K8XA 2VX2A 2BZRA 3RQFA 4JSBA 3VIVA 5DZKA 4ZDBA 4NNQA 5JBXA 1EF9A 3HRXA 2QQ3A 2IEXA 3A4LA 3IBBA 4FJWD 1XNWA 3GLMA 2J5IB 5C90A 3HINA 4MOUA 5DZKH 1J7XA 3TDCA 4U19A 2ZL3A 3RQGA 4L6WA 1XNVA 5CTBA 3QMJA 5G1RA 4I4ZA 2ZL4A 4MI2A 4OLQA 4KNPA 4QIIA 5DTWA 1MJ3A 1UIYA 3JU1A 4K3WA 2VSSE 4FN7A 3O4XE 2A7KA 3STAA 1PJHA 3H0JA 2CBYA 3ADCA 4IZBA 1N6DA 2Q34A 4ZDEA 3LKEA 5G1SA 3Q1TA 4ELWA 4U0GH 3L8IA 4JFCA 1FCFA 4JCTA 3T8AA 3KTIA 4HDTA 3H0QA 3N6RB 1SZOA 1RJNA 2GTRA 4EMPA 1Q51A 3QWDA 1N6EA 5CTCA 3DORA 4JWVA 1UYRA 3MOYA 4GHNA 3HE2A 4KWBA 3R9QA 3FF6A 4KD6A 2FBMA 2PBPA 3PGQA 4U0HA 1WDLA 3ADDA 5INIA 1JXZA 2D3TA 2WTBA 3P2LA 4WZ8B 4G2RA 2X24A 1UX5A 1DCIA 1HNUA 2EJ5A 3BPPA 3TZ3A 5DL1A 4RYFH 1NZYB 3R6HA 3W8HB 1XX4A 3T88A 3GKBA 4JJTA 2DEOA 2YJGA 3G64A 3KTKA 1SG4A 4OG1A 5DU8A 3BF0A 5HUQA 3MT6A 5DU4A 5DKPA 3GF3A 3SWXA 4NEKA 4GEHB 3TT6A 4OMRA 3IRBA 3L8JA 1EY3A 1WDKA 1HNOA 5E0NX 2J5II 4B3JA 4J2UA 4Q1IA 3Q0GA 2Q2XA 4QFEA 5FUSA 4KPKA 2F9YB 4ZDCA 1EF8A 4U0GA 3NJDA 4GM2A 1FC9A 3GF7A 3KQFA 3PZKA 1OD4A 2NP9A 4B3IA 3V5EA 3SLLA 1YG8A 5DU6A 3H0UA 1UYVA 3A4MA 3U9SB 3AM1A 5E0SA 1FC6A 2CE3A 3HLN1 4FNBA 3H02A 3A4NA 3RQEA 4JCQA 4ZDDA 3KTGA 4HC8A 1W2XA 3DJAA 4FNDA 4WCZA 4FB8A 3OC7A 4L8KA 4F47A 1PIXA 4FZWA 2F6IA 2X58A 1XNYA 2VSUC 3OMEA 2HW5A 3P85A 5C9GA 3I47A 3T89A 4Z0MA 3P5MA 4I42A 2J5GA 4U1AA 2VSUA 3QKAA 3M6NA 3V5IA 4IZDA 2FZSA 4LK5A 2PPYA 3ST9A 4JCRA 3QXZA 2VSUF 3TVWA 3AJMA 3PE8A 2F9YA 5JBWA 2UZFA 1FC7A 4ASIA 3LAOA 2ZL0A 2DUBA 1Y7OA 1ON3A 1Q52A 3TVUA 4FN8A 2F9IB 5KJPA 2ZQQA 3KTJA 1X0UA 4I52A 4JYJA 3ZWAA 1NZYA 3OT6A 3MFMA 1WZ8A 5G1QA 3R0OA 3HP0A 4IZCA 3T3WA 1XO6A 4B3HA
chains in the Genus database with same CATH topology
1VRGA 3H0SA 3QYRA 3MYBA 4ELXA 3TV5A 3IAVA 3U9RB 4DI1A 5DUFA 3BPTA 1YG6A 2ZQRA 3QK8A 1WDMA 1UYSA 3Q0JA 3GMAA 1OD2A 1RJMA 5E0SH 2J5GD 2F6QA 5FIFA 3KTHA 3R9SA 4K29A 3K50A 3PEAA 1TG6A 4JOTA 4ELSA 4Q0GA 5KDRA 3ZWBA 1O8UA 2VSUE 3Q7HA 4ZU2A 1UYTA 3FDUA 2W3PA 2PG8A 2A81A 4MXIA 2FW2A 2VSSA 5DUCA 3T8BA 3BEZA 2VREA 4RYFA 3RSIA 5INFA 4EMMA 5INGA 1DUBA 4WYOB 4ZDFA 3R9TA 4YLHA 3ZWCA 3TLFA 3WG5A 4NARA 4K2NA 3TRRA 2C8TA 4JVTA 3TT7A 3NJBA 2ZL2A 3QXIA 2J5IA 3RSTA 4JYLA 4EMLA 4HNKA 3L3SA 3ZW9A 1K39A 2F9IA 5KDRB 3IB9A 2Q35A 3H81A 5IKLB 1TYFA 3M6MA 4U18A 3ZW8A 4QIJA 4FZWC 1ON9A 2VSSF 2J5SA 3ISAA 3RRVA 5MGBA 1K32A 1HZDA 3U9TB 3QREA 4JCSA 1N6FA 2A7SA 5DTPA 4RCNA 3K8XA 2VX2A 2BZRA 4JSBA 3VIVA 5DZKA 4ZDBA 4NNQA 5JBXA 1EF9A 3HRXA 2QQ3A 2IEXA 3IBBA 4FJWD 1XNWA 3GLMA 2J5IB 5C90A 3HINA 4MOUA 5DZKH 1J7XA 3TDCA 4U19A 2ZL3A 4L6WA 1XNVA 5CTBA 3QMJA 5G1RA 4I4ZA 2ZL4A 4MI2A 4QIIA 4OLQA 4KNPA 5DTWA 1MJ3A 1UIYA 3JU1A 4K3WA 2VSSE 4FN7A 2A7KA 3STAA 1PJHA 3H0JA 2CBYA 4IZBA 1N6DA 2Q34A 4ZDEA 3LKEA 5G1SA 3Q1TA 4ELWA 4U0GH 4JFCA 1FCFA 4JCTA 3T8AA 3KTIA 4HDTA 3H0QA 3N6RB 1SZOA 1RJNA 2GTRA 4EMPA 1Q51A 3QWDA 1N6EA 5CTCA 3DORA 4JWVA 1UYRA 3MOYA 4GHNA 3HE2A 4KWBA 3R9QA 3FF6A 4KD6A 2FBMA 2PBPA 3PGQA 4U0HA 1WDLA 5INIA 1JXZA 2D3TA 2WTBA 3P2LA 4WZ8B 4G2RA 2X24A 1DCIA 1HNUA 2EJ5A 3BPPA 3TZ3A 5DL1A 4RYFH 1NZYB 3R6HA 1XX4A 3GKBA 3T88A 4JJTA 2DEOA 2YJGA 3G64A 3KTKA 1SG4A 4OG1A 5DU8A 3BF0A 5HUQA 3MT6A 5DU4A 5DKPA 3GF3A 3SWXA 4NEKA 3TT6A 4OMRA 1EY3A 1WDKA 1HNOA 5E0NX 2J5II 4B3JA 4J2UA 4Q1IA 3Q0GA 2Q2XA 4QFEA 5FUSA 4KPKA 2F9YB 4ZDCA 1EF8A 4U0GA 3NJDA 4GM2A 1FC9A 3GF7A 3KQFA 3PZKA 1OD4A 2NP9A 4B3IA 3V5EA 3SLLA 1YG8A 5DU6A 3H0UA 1UYVA 3U9SB 5E0SA 1FC6A 2CE3A 3HLN1 4FNBA 3H02A 4JCQA 4ZDDA 3KTGA 4HC8A 1W2XA 3DJAA 4FNDA 4WCZA 4FB8A 3OC7A 4L8KA 4F47A 1PIXA 4FZWA 2F6IA 2X58A 1XNYA 2VSUC 3OMEA 2HW5A 3P85A 5C9GA 3I47A 3T89A 4Z0MA 3P5MA 4I42A 2J5GA 4U1AA 2VSUA 3QKAA 3M6NA 3V5IA 4IZDA 2FZSA 4LK5A 2PPYA 3ST9A 4JCRA 3QXZA 2VSUF 3TVWA 3PE8A 2F9YA 5JBWA 2UZFA 1FC7A 4ASIA 3LAOA 2ZL0A 2DUBA 1Y7OA 1ON3A 1Q52A 3TVUA 4FN8A 2F9IB 5KJPA 2ZQQA 3KTJA 1X0UA 4I52A 4JYJA 3ZWAA 1NZYA 3OT6A 3MFMA 1WZ8A 5G1QA 3R0OA 3HP0A 4IZCA 3T3WA 1XO6A 4B3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VRG A;  3H0S A;  3QYR A;  3MYB A;  4ELX A;  3TV5 A;  3IAV A;  3U9R B;  4DI1 A;  5DUF A;  1YG6 A;  2ZQR A;  3QK8 A;  1WDM A;  1UYS A;  3Q0J A;  3GMA A;  1OD2 A;  1RJM A;  5E0S H;  2J5G D;  2F6Q A;  5FIF A;  3KTH A;  3R9S A;  4K29 A;  3K50 A;  3PEA A;  1TG6 A;  4JOT A;  4ELS A;  4Q0G A;  5KDR A;  3ZWB A;  1O8U A;  2VSU E;  3Q7H A;  4ZU2 A;  1UYT A;  3FDU A;  2W3P A;  2PG8 A;  2A81 A;  4MXI A;  2FW2 A;  2VSS A;  5DUC A;  3T8B A;  3BEZ A;  2VRE A;  4RYF A;  3RSI A;  5ING A;  5INF A;  4EMM A;  1DUB A;  4WYO B;  4ZDF A;  3R9T A;  4YLH A;  3ZWC A;  3TLF A;  3WG5 A;  4K2N A;  3TRR A;  2C8T A;  4JVT A;  3TT7 A;  3NJB A;  2ZL2 A;  3QXI A;  2J5I A;  3RST A;  4JYL A;  4EML A;  4HNK A;  3L3S A;  3ZW9 A;  1K39 A;  2F9I A;  5KDR B;  3IB9 A;  2Q35 A;  3H81 A;  5IKL B;  1TYF A;  3M6M A;  4U18 A;  3ZW8 A;  4QIJ A;  4FZW C;  1ON9 A;  2VSS F;  2J5S A;  3ISA A;  3RRV A;  5MGB A;  1K32 A;  1HZD A;  3U9T B;  3QRE A;  4JCS A;  1N6F A;  2A7S A;  5DTP A;  4RCN A;  3K8X A;  2VX2 A;  2BZR A;  4JSB A;  3VIV A;  5DZK A;  4ZDB A;  4NNQ A;  5JBX A;  1EF9 A;  3HRX A;  2QQ3 A;  2IEX A;  3IBB A;  4FJW D;  1XNW A;  3GLM A;  2J5I B;  5C90 A;  3HIN A;  4MOU A;  5DZK H;  1J7X A;  3TDC A;  4U19 A;  2ZL3 A;  4L6W A;  1XNV A;  5CTB A;  3QMJ A;  5G1R A;  4I4Z A;  2ZL4 A;  4MI2 A;  4QII A;  4OLQ A;  4KNP A;  5DTW A;  1MJ3 A;  1UIY A;  3JU1 A;  4K3W A;  2VSS E;  4FN7 A;  2A7K A;  3STA A;  1PJH A;  3H0J A;  2CBY A;  4IZB A;  1N6D A;  2Q34 A;  4ZDE A;  3LKE A;  5G1S A;  3Q1T A;  4ELW A;  4U0G H;  4JFC A;  1FCF A;  4JCT A;  3T8A A;  3KTI A;  3H0Q A;  3N6R B;  1SZO A;  1RJN A;  2GTR A;  4EMP A;  1Q51 A;  3QWD A;  1N6E A;  5CTC A;  3DOR A;  4JWV A;  1UYR A;  3MOY A;  4GHN A;  3HE2 A;  4KWB A;  3R9Q A;  3FF6 A;  4KD6 A;  2FBM A;  2PBP A;  3PGQ A;  4U0H A;  1WDL A;  5INI A;  1JXZ A;  2D3T A;  2WTB A;  3P2L A;  4WZ8 B;  4G2R A;  2X24 A;  1DCI A;  1HNU A;  2EJ5 A;  3BPP A;  3TZ3 A;  5DL1 A;  4RYF H;  1NZY B;  3R6H A;  1XX4 A;  3GKB A;  3T88 A;  4JJT A;  2DEO A;  3G64 A;  3KTK A;  1SG4 A;  4OG1 A;  5DU8 A;  3BF0 A;  3MT6 A;  5DU4 A;  5DKP A;  3GF3 A;  3SWX A;  4NEK A;  3TT6 A;  4OMR A;  1EY3 A;  1WDK A;  1HNO A;  5E0N X;  2J5I I;  4B3J A;  4Q1I A;  3Q0G A;  2Q2X A;  4QFE A;  5FUS A;  4KPK A;  2F9Y B;  4ZDC A;  1EF8 A;  4U0G A;  3NJD A;  4GM2 A;  1FC9 A;  3GF7 A;  3KQF A;  3PZK A;  1OD4 A;  2NP9 A;  4B3I A;  3V5E A;  3SLL A;  1YG8 A;  5DU6 A;  3H0U A;  1UYV A;  3U9S B;  5E0S A;  1FC6 A;  2CE3 A;  3HLN 1;  4FNB A;  3H02 A;  4JCQ A;  4ZDD A;  3KTG A;  4HC8 A;  1W2X A;  3DJA A;  4FND A;  4WCZ A;  4FB8 A;  3OC7 A;  4L8K A;  4F47 A;  1PIX A;  4FZW A;  2F6I A;  2X58 A;  1XNY A;  2VSU C;  3OME A;  2HW5 A;  3P85 A;  5C9G A;  3I47 A;  3T89 A;  4Z0M A;  3P5M A;  4I42 A;  2J5G A;  4U1A A;  2VSU A;  3QKA A;  3M6N A;  3V5I A;  4IZD A;  2FZS A;  4LK5 A;  2PPY A;  3ST9 A;  4JCR A;  3QXZ A;  2VSU F;  3TVW A;  3PE8 A;  2F9Y A;  5JBW A;  2UZF A;  1FC7 A;  4ASI A;  3LAO A;  2ZL0 A;  2DUB A;  1Y7O A;  1ON3 A;  1Q52 A;  3TVU A;  4FN8 A;  2F9I B;  5KJP A;  2ZQQ A;  3KTJ A;  1X0U A;  4I52 A;  4JYJ A;  3ZWA A;  1NZY A;  3OT6 A;  3MFM A;  1WZ8 A;  5G1Q A;  3R0O A;  3HP0 A;  4IZC A;  3T3W A;  1XO6 A;  4B3H A; 
#chains in the Genus database with same CATH topology
 1VRG A;  3H0S A;  3QYR A;  3MYB A;  4ELX A;  3TV5 A;  3ADB A;  3IAV A;  3U9R B;  4DI1 A;  5DUF A;  3BPT A;  1YG6 A;  2ZQR A;  3QK8 A;  1WDM A;  1UYS A;  3Q0J A;  3GMA A;  1OD2 A;  1RJM A;  5E0S H;  2J5G D;  2F6Q A;  5FIF A;  3KTH A;  3R9S A;  4K29 A;  3K50 A;  3PEA A;  1TG6 A;  4JOT A;  4ELS A;  1Y64 B;  4Q0G A;  5KDR A;  3ZWB A;  1O8U A;  2VSU E;  3Q7H A;  4ZU2 A;  1UYT A;  3FDU A;  2W3P A;  2PG8 A;  2A81 A;  4MXI A;  2FW2 A;  2VSS A;  5DUC A;  3T8B A;  1UX4 A;  3BEZ A;  2VRE A;  4RYF A;  3RSI A;  5INF A;  4EMM A;  5ING A;  1DUB A;  4WYO B;  4ZDF A;  3R9T A;  4YLH A;  3ZWC A;  3TLF A;  3W8I B;  3WG5 A;  4NAR A;  4K2N A;  3TRR A;  2C8T A;  4JVT A;  3TT7 A;  3NJB A;  2ZL2 A;  3QXI A;  2J5I A;  3RST A;  4JYL A;  4EML A;  4HNK A;  3L3S A;  3ZW9 A;  1K39 A;  2F9I A;  5KDR B;  3IB9 A;  2Q35 A;  3H81 A;  5IKL B;  1TYF A;  3M6M A;  4U18 A;  3ZW8 A;  4QIJ A;  4FZW C;  1ON9 A;  2VSS F;  2J5S A;  3ISA A;  3RRV A;  5MGB A;  1K32 A;  1HZD A;  3U9T B;  3QRE A;  4JCS A;  1N6F A;  2P63 A;  2A7S A;  5DTP A;  4RCN A;  3K8X A;  2VX2 A;  2BZR A;  3RQF A;  4JSB A;  3VIV A;  5DZK A;  4ZDB A;  4NNQ A;  5JBX A;  1EF9 A;  3HRX A;  2QQ3 A;  2IEX A;  3A4L A;  3IBB A;  4FJW D;  1XNW A;  3GLM A;  2J5I B;  5C90 A;  3HIN A;  4MOU A;  5DZK H;  1J7X A;  3TDC A;  4U19 A;  2ZL3 A;  3RQG A;  4L6W A;  1XNV A;  5CTB A;  3QMJ A;  5G1R A;  4I4Z A;  2ZL4 A;  4MI2 A;  4OLQ A;  4KNP A;  4QII A;  5DTW A;  1MJ3 A;  1UIY A;  3JU1 A;  4K3W A;  2VSS E;  4FN7 A;  3O4X E;  2A7K A;  3STA A;  1PJH A;  3H0J A;  2CBY A;  3ADC A;  4IZB A;  1N6D A;  2Q34 A;  4ZDE A;  3LKE A;  5G1S A;  3Q1T A;  4ELW A;  4U0G H;  3L8I A;  4JFC A;  1FCF A;  4JCT A;  3T8A A;  3KTI A;  4HDT A;  3H0Q A;  3N6R B;  1SZO A;  1RJN A;  2GTR A;  4EMP A;  1Q51 A;  3QWD A;  1N6E A;  5CTC A;  3DOR A;  4JWV A;  1UYR A;  3MOY A;  4GHN A;  3HE2 A;  4KWB A;  3R9Q A;  3FF6 A;  4KD6 A;  2FBM A;  2PBP A;  3PGQ A;  4U0H A;  1WDL A;  3ADD A;  5INI A;  1JXZ A;  2D3T A;  2WTB A;  3P2L A;  4WZ8 B;  4G2R A;  2X24 A;  1UX5 A;  1DCI A;  1HNU A;  2EJ5 A;  3BPP A;  3TZ3 A;  5DL1 A;  4RYF H;  1NZY B;  3R6H A;  3W8H B;  1XX4 A;  3T88 A;  3GKB A;  4JJT A;  2DEO A;  2YJG A;  3G64 A;  3KTK A;  1SG4 A;  4OG1 A;  5DU8 A;  3BF0 A;  5HUQ A;  3MT6 A;  5DU4 A;  5DKP A;  3GF3 A;  3SWX A;  4NEK A;  4GEH B;  3TT6 A;  4OMR A;  3IRB A;  3L8J A;  1EY3 A;  1WDK A;  1HNO A;  5E0N X;  2J5I I;  4B3J A;  4J2U A;  4Q1I A;  3Q0G A;  2Q2X A;  4QFE A;  5FUS A;  4KPK A;  2F9Y B;  4ZDC A;  1EF8 A;  4U0G A;  3NJD A;  4GM2 A;  1FC9 A;  3GF7 A;  3KQF A;  3PZK A;  1OD4 A;  2NP9 A;  4B3I A;  3V5E A;  3SLL A;  1YG8 A;  5DU6 A;  3H0U A;  1UYV A;  3A4M A;  3U9S B;  3AM1 A;  5E0S A;  1FC6 A;  2CE3 A;  3HLN 1;  4FNB A;  3H02 A;  3A4N A;  3RQE A;  4JCQ A;  4ZDD A;  3KTG A;  4HC8 A;  1W2X A;  3DJA A;  4FND A;  4WCZ A;  4FB8 A;  3OC7 A;  4L8K A;  4F47 A;  1PIX A;  4FZW A;  2F6I A;  2X58 A;  1XNY A;  2VSU C;  3OME A;  2HW5 A;  3P85 A;  5C9G A;  3I47 A;  3T89 A;  4Z0M A;  3P5M A;  4I42 A;  2J5G A;  4U1A A;  2VSU A;  3QKA A;  3M6N A;  3V5I A;  4IZD A;  2FZS A;  4LK5 A;  2PPY A;  3ST9 A;  4JCR A;  3QXZ A;  2VSU F;  3TVW A;  3AJM A;  3PE8 A;  2F9Y A;  5JBW A;  2UZF A;  1FC7 A;  4ASI A;  3LAO A;  2ZL0 A;  2DUB A;  1Y7O A;  1ON3 A;  1Q52 A;  3TVU A;  4FN8 A;  2F9I B;  5KJP A;  2ZQQ A;  3KTJ A;  1X0U A;  4I52 A;  4JYJ A;  3ZWA A;  1NZY A;  3OT6 A;  3MFM A;  1WZ8 A;  5G1Q A;  3R0O A;  3HP0 A;  4IZC A;  3T3W A;  1XO6 A;  4B3H A; 
#chains in the Genus database with same CATH homology
 1VRG A;  3H0S A;  3QYR A;  3MYB A;  4ELX A;  3TV5 A;  3IAV A;  3U9R B;  4DI1 A;  5DUF A;  3BPT A;  1YG6 A;  2ZQR A;  3QK8 A;  1WDM A;  1UYS A;  3Q0J A;  3GMA A;  1OD2 A;  1RJM A;  5E0S H;  2J5G D;  2F6Q A;  5FIF A;  3KTH A;  3R9S A;  4K29 A;  3K50 A;  3PEA A;  1TG6 A;  4JOT A;  4ELS A;  4Q0G A;  5KDR A;  3ZWB A;  1O8U A;  2VSU E;  3Q7H A;  4ZU2 A;  1UYT A;  3FDU A;  2W3P A;  2PG8 A;  2A81 A;  4MXI A;  2FW2 A;  2VSS A;  5DUC A;  3T8B A;  3BEZ A;  2VRE A;  4RYF A;  3RSI A;  5INF A;  4EMM A;  5ING A;  1DUB A;  4WYO B;  4ZDF A;  3R9T A;  4YLH A;  3ZWC A;  3TLF A;  3WG5 A;  4NAR A;  4K2N A;  3TRR A;  2C8T A;  4JVT A;  3TT7 A;  3NJB A;  2ZL2 A;  3QXI A;  2J5I A;  3RST A;  4JYL A;  4EML A;  4HNK A;  3L3S A;  3ZW9 A;  1K39 A;  2F9I A;  5KDR B;  3IB9 A;  2Q35 A;  3H81 A;  5IKL B;  1TYF A;  3M6M A;  4U18 A;  3ZW8 A;  4QIJ A;  4FZW C;  1ON9 A;  2VSS F;  2J5S A;  3ISA A;  3RRV A;  5MGB A;  1K32 A;  1HZD A;  3U9T B;  3QRE A;  4JCS A;  1N6F A;  2A7S A;  5DTP A;  4RCN A;  3K8X A;  2VX2 A;  2BZR A;  4JSB A;  3VIV A;  5DZK A;  4ZDB A;  4NNQ A;  5JBX A;  1EF9 A;  3HRX A;  2QQ3 A;  2IEX A;  3IBB A;  4FJW D;  1XNW A;  3GLM A;  2J5I B;  5C90 A;  3HIN A;  4MOU A;  5DZK H;  1J7X A;  3TDC A;  4U19 A;  2ZL3 A;  4L6W A;  1XNV A;  5CTB A;  3QMJ A;  5G1R A;  4I4Z A;  2ZL4 A;  4MI2 A;  4QII A;  4OLQ A;  4KNP A;  5DTW A;  1MJ3 A;  1UIY A;  3JU1 A;  4K3W A;  2VSS E;  4FN7 A;  2A7K A;  3STA A;  1PJH A;  3H0J A;  2CBY A;  4IZB A;  1N6D A;  2Q34 A;  4ZDE A;  3LKE A;  5G1S A;  3Q1T A;  4ELW A;  4U0G H;  4JFC A;  1FCF A;  4JCT A;  3T8A A;  3KTI A;  4HDT A;  3H0Q A;  3N6R B;  1SZO A;  1RJN A;  2GTR A;  4EMP A;  1Q51 A;  3QWD A;  1N6E A;  5CTC A;  3DOR A;  4JWV A;  1UYR A;  3MOY A;  4GHN A;  3HE2 A;  4KWB A;  3R9Q A;  3FF6 A;  4KD6 A;  2FBM A;  2PBP A;  3PGQ A;  4U0H A;  1WDL A;  5INI A;  1JXZ A;  2D3T A;  2WTB A;  3P2L A;  4WZ8 B;  4G2R A;  2X24 A;  1DCI A;  1HNU A;  2EJ5 A;  3BPP A;  3TZ3 A;  5DL1 A;  4RYF H;  1NZY B;  3R6H A;  1XX4 A;  3GKB A;  3T88 A;  4JJT A;  2DEO A;  2YJG A;  3G64 A;  3KTK A;  1SG4 A;  4OG1 A;  5DU8 A;  3BF0 A;  5HUQ A;  3MT6 A;  5DU4 A;  5DKP A;  3GF3 A;  3SWX A;  4NEK A;  3TT6 A;  4OMR A;  1EY3 A;  1WDK A;  1HNO A;  5E0N X;  2J5I I;  4B3J A;  4J2U A;  4Q1I A;  3Q0G A;  2Q2X A;  4QFE A;  5FUS A;  4KPK A;  2F9Y B;  4ZDC A;  1EF8 A;  4U0G A;  3NJD A;  4GM2 A;  1FC9 A;  3GF7 A;  3KQF A;  3PZK A;  1OD4 A;  2NP9 A;  4B3I A;  3V5E A;  3SLL A;  1YG8 A;  5DU6 A;  3H0U A;  1UYV A;  3U9S B;  5E0S A;  1FC6 A;  2CE3 A;  3HLN 1;  4FNB A;  3H02 A;  4JCQ A;  4ZDD A;  3KTG A;  4HC8 A;  1W2X A;  3DJA A;  4FND A;  4WCZ A;  4FB8 A;  3OC7 A;  4L8K A;  4F47 A;  1PIX A;  4FZW A;  2F6I A;  2X58 A;  1XNY A;  2VSU C;  3OME A;  2HW5 A;  3P85 A;  5C9G A;  3I47 A;  3T89 A;  4Z0M A;  3P5M A;  4I42 A;  2J5G A;  4U1A A;  2VSU A;  3QKA A;  3M6N A;  3V5I A;  4IZD A;  2FZS A;  4LK5 A;  2PPY A;  3ST9 A;  4JCR A;  3QXZ A;  2VSU F;  3TVW A;  3PE8 A;  2F9Y A;  5JBW A;  2UZF A;  1FC7 A;  4ASI A;  3LAO A;  2ZL0 A;  2DUB A;  1Y7O A;  1ON3 A;  1Q52 A;  3TVU A;  4FN8 A;  2F9I B;  5KJP A;  2ZQQ A;  3KTJ A;  1X0U A;  4I52 A;  4JYJ A;  3ZWA A;  1NZY A;  3OT6 A;  3MFM A;  1WZ8 A;  5G1Q A;  3R0O A;  3HP0 A;  4IZC A;  3T3W A;  1XO6 A;  4B3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...