3SWXA

Crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
259
structure length
257
Chain Sequence
DYETLRIRRDGYVLVIGLNRPAKRNAFDKTMLEELALALGEYETDTDLRAAVLYGEGPLFTAGLDLASVAAEIQASLTPEGGINPWQVDGRQLSKPLLVAVHGKVLTLGIELALAADIVIADETATFAQLEVNRGIYPFGGATIRFPRTAGWGNAMRWMLTADTFDAVEAHRIGIVQEIVPVGEHVDTAIAIAQTIARQAPLGVQATLRNARLAVREGDAAAEEQLVPTVRELFTSEDATLGVQAFLSRTTAEFVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Isomerase
molecule keywords Probable enoyl-CoA hydratase/isomerase
total genus 89
structure length 257
sequence length 259
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3swxA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3swxA01
4F47A 4FB8A 3KTJA 4ZDEA 3OT6A 5FIFA 1W2XA 3NJDA 1TYFA 2VSUF 2Q35A 4U19A 3T8BA 3TT7A 2D3TA 1HZDA 3K8XA 5INFA 4KNPA 4U0HA 3P85A 4ZU2A 3IB9A 3NJBA 3GMAA 3FF6A 5INIA 1DCIA 3QKAA 2F6QA 4ZDBA 3HRXA 2GTRA 3PEAA 4GM2A 4JYJA 4MXIA 2IEXA 4FN7A 3M6NA 3RSTA 4OMRA 3PGQA 3Q1TA 2X58A 5G1RA 3OMEA 2CBYA 5E0SA 3ISAA 3IBBA 4Q0GA 1K32A 3ZWBA 1N6EA 3T89A 1SZOA 2FBMA 1XNVA 2F9IB 4FJWD 1J7XA 5INGA 3KTIA 3U9SB 3R6HA 4ELWA 2FZSA 1OD4A 4NNQA 2ZQRA 1Y7OA 3ZWCA 4L6WA 3I47A 1X0UA 2UZFA 4NEKA 3Q0JA 5JBWA 3QXIA 3GF7A 3TVWA 3JU1A 2WTBA 3WG5A 3H81A 3U9TB 1WDMA 2Q34A 3LKEA 3FDUA 3KTGA 4ZDDA 4JYLA 3HE2A 4Z0MA 3R0OA 2A81A 5KDRA 1XNWA 4RYFH 2DEOA 5E0SH 2F6IA 4GHNA 4OLQA 3HLN1 3U9RB 3MYBA 4JWVA 3R9SA 3H0SA 5G1SA 4KD6A 3KTKA 5JBXA 2A7SA 3LAOA 5KDRB 2DUBA 3H0UA 4I52A 4JJTA 3V5IA 1O8UA 4ZDFA 5DU6A 4WYOB 1JXZA 2VSSE 1EF8A 4FZWA 4EMLA 3TV5A 4EMPA 3ST9A 1RJNA 5DUCA 2ZL2A 1FC6A 1UYTA 1FC7A 3ZW8A 2FW2A 3H0QA 5G1QA 3OC7A 4FN8A 4FZWC 1TG6A 1WDLA 3P2LA 4MI2A 1SG4A 2VSUA 2F9IA 5DZKA 3RSIA 4U0GA 4JFCA 4IZBA 1PIXA 2J5II 2C8TA 2BZRA 2W3PA 2VREA 3SLLA 2EJ5A 3QYRA 5DTPA 1UYRA 5C9GA 3STAA 4B3HA 3TVUA 1YG8A 1EY3A 2CE3A 3R9QA 1XNYA 4FNBA 4B3JA 1ON3A 2X24A 3GF3A 4JCRA 2HW5A 4L8KA 2Q2XA 4I4ZA 5MGBA 3VIVA 2NP9A 3BPPA 4RYFA 4ASIA 3TRRA 1HNOA 3IAVA 2ZL4A 3TT6A 5DUFA 3RRVA 4KPKA 4KWBA 4IZDA 1N6DA 3KTHA 5DZKH 3HP0A 3T88A 3DJAA 5KJPA 1WZ8A 2PBPA 1FC9A 4QFEA 2J5GA 3P5MA 2VSSF 3M6MA 3MOYA 3L3SA 4WCZA 3Q7HA 4EMMA 1DUBA 2ZL0A 4U0GH 4DI1A 5C90A 3HINA 2J5SA 4RCNA 4ZDCA 3PZKA 2ZQQA 1Q52A 1UYSA 3H02A 1K39A 5DL1A 3H0JA 3TDCA 5DU8A 1N6FA 1XX4A 4I42A 4FNDA 4K29A 1RJMA 1ON9A 4QIIA 4IZCA 4JCSA 4OG1A 1YG6A 2PPYA 4LK5A 3R9TA 3Q0GA 3QREA 3TLFA 5DU4A 3BEZA 3TZ3A 3BF0A 5DTWA 1UYVA 1OD2A 1MJ3A 3ZW9A 1WDKA 3N6RB 4ELSA 1NZYA 5FUSA 3T8AA 4HNKA 2A7KA 3T3WA 2J5GD 3QXZA 1NZYB 4QIJA 3QWDA 4ELXA 4U1AA 1UIYA 3DORA 2VSUE 4MOUA 4YLHA 2VX2A 2J5IA 4U18A 5CTCA 1VRGA 2F9YB 4G2RA 4K3WA 4JVTA 3G64A 3MT6A 4HC8A 3ZWAA 5CTBA 3QMJA 4Q1IA 4B3IA 3PE8A 1FCFA 3GLMA 4JCQA 4WZ8B 2VSUC 2ZL3A 3K50A 4JCTA 3MFMA 1HNUA 3V5EA 3GKBA 5E0NX 2F9YA 2VSSA 3SWXA 2J5IB 3QK8A 1PJHA 5IKLB 4JOTA 1Q51A 1EF9A 3KQFA 4K2NA 5DKPA 1XO6A 2PG8A 4JSBA 2QQ3A
chains in the Genus database with same CATH superfamily
4F47A 4FB8A 3KTJA 4ZDEA 3OT6A 5FIFA 1W2XA 3NJDA 1TYFA 2VSUF 2Q35A 4U19A 3T8BA 3TT7A 2D3TA 1HZDA 3K8XA 5INFA 4KNPA 4U0HA 3P85A 4ZU2A 3IB9A 3NJBA 3GMAA 3O4XE 3FF6A 5INIA 1DCIA 3ADBA 3QKAA 2F6QA 4ZDBA 3HRXA 4J2UA 2GTRA 3PEAA 4GM2A 4JYJA 4MXIA 2IEXA 3BPTA 4FN7A 3M6NA 3RSTA 4OMRA 3A4MA 3PGQA 3Q1TA 2X58A 5G1RA 3OMEA 2CBYA 5E0SA 3ISAA 4NARA 3AM1A 3IBBA 2YJGA 4Q0GA 1K32A 3ZWBA 1N6EA 3T89A 1SZOA 2FBMA 1XNVA 3W8IB 2F9IB 4FJWD 1J7XA 5INGA 3KTIA 3U9SB 3R6HA 4ELWA 2FZSA 1OD4A 4NNQA 2ZQRA 1Y7OA 3ZWCA 4L6WA 3I47A 1X0UA 2UZFA 4NEKA 3Q0JA 5JBWA 3QXIA 3GF7A 3TVWA 3JU1A 2WTBA 3WG5A 3H81A 3ADDA 3U9TB 3L8IA 1WDMA 2Q34A 3LKEA 3FDUA 3KTGA 4ZDDA 4JYLA 1Y64B 3HE2A 4Z0MA 3R0OA 2A81A 5KDRA 1XNWA 4RYFH 2DEOA 5E0SH 2F6IA 4GHNA 4OLQA 4HDTA 3HLN1 3U9RB 3MYBA 4JWVA 3R9SA 3H0SA 5G1SA 4KD6A 3KTKA 5JBXA 2A7SA 3LAOA 5KDRB 2DUBA 3H0UA 4I52A 4JJTA 4GEHB 3V5IA 1O8UA 4ZDFA 5DU6A 4WYOB 1JXZA 2VSSE 1EF8A 4FZWA 4EMLA 3TV5A 4EMPA 3ST9A 1RJNA 5DUCA 3A4NA 2ZL2A 1FC6A 1UYTA 1FC7A 3ZW8A 2FW2A 3H0QA 5G1QA 3OC7A 4FN8A 4FZWC 1TG6A 1WDLA 3P2LA 4MI2A 1SG4A 2VSUA 2F9IA 5DZKA 3RSIA 4U0GA 4JFCA 4IZBA 1PIXA 2J5II 1UX4A 3RQFA 2C8TA 2BZRA 2W3PA 2VREA 3SLLA 2EJ5A 3QYRA 5DTPA 1UYRA 5C9GA 3STAA 4B3HA 3TVUA 3IRBA 1YG8A 1EY3A 2CE3A 3R9QA 1XNYA 4FNBA 4B3JA 1ON3A 2X24A 3GF3A 4JCRA 2HW5A 4L8KA 2Q2XA 4I4ZA 5MGBA 3VIVA 2NP9A 3BPPA 4RYFA 4ASIA 3TRRA 1HNOA 3IAVA 2ZL4A 3TT6A 5DUFA 3RRVA 4KPKA 4KWBA 4IZDA 1N6DA 3KTHA 5DZKH 3HP0A 3T88A 3DJAA 5KJPA 1WZ8A 2PBPA 1FC9A 4QFEA 2J5GA 3P5MA 2VSSF 3W8HB 3M6MA 3MOYA 3L3SA 3A4LA 4WCZA 3Q7HA 4EMMA 1DUBA 2ZL0A 4U0GH 4DI1A 5C90A 3HINA 2J5SA 4RCNA 4ZDCA 3PZKA 2ZQQA 1Q52A 1UYSA 5HUQA 3H02A 1K39A 5DL1A 3H0JA 3TDCA 5DU8A 1N6FA 1XX4A 4I42A 1UX5A 4FNDA 4K29A 1RJMA 1ON9A 4QIIA 4IZCA 4JCSA 4OG1A 1YG6A 2PPYA 4LK5A 3R9TA 3Q0GA 3QREA 3TLFA 5DU4A 3BEZA 3TZ3A 3BF0A 5DTWA 1UYVA 1OD2A 1MJ3A 2P63A 3ZW9A 1WDKA 3N6RB 4ELSA 1NZYA 5FUSA 3T8AA 4HNKA 2A7KA 3T3WA 2J5GD 3QXZA 1NZYB 4QIJA 3QWDA 4ELXA 4U1AA 1UIYA 3DORA 2VSUE 4MOUA 4YLHA 2VX2A 2J5IA 4U18A 5CTCA 1VRGA 3ADCA 2F9YB 4G2RA 4K3WA 4JVTA 3G64A 3AJMA 3MT6A 4HC8A 3ZWAA 5CTBA 3QMJA 4Q1IA 4B3IA 3PE8A 1FCFA 3GLMA 4JCQA 4WZ8B 2VSUC 2ZL3A 3K50A 4JCTA 3MFMA 1HNUA 3V5EA 3GKBA 5E0NX 2F9YA 3L8JA 2VSSA 3RQEA 3SWXA 2J5IB 3QK8A 3RQGA 1PJHA 5IKLB 4JOTA 1Q51A 1EF9A 3KQFA 4K2NA 5DKPA 1XO6A 2PG8A 4JSBA 2QQ3A
chains in the Genus database with same CATH topology
4F47A 4FB8A 3KTJA 4ZDEA 3OT6A 5FIFA 1W2XA 3NJDA 1TYFA 2VSUF 2Q35A 4U19A 3T8BA 3TT7A 2D3TA 1HZDA 3K8XA 5INFA 4KNPA 4U0HA 3P85A 4ZU2A 3IB9A 3NJBA 3GMAA 3FF6A 5INIA 1DCIA 3QKAA 2F6QA 4ZDBA 3HRXA 4J2UA 2GTRA 3PEAA 4GM2A 4JYJA 4MXIA 2IEXA 3BPTA 4FN7A 3M6NA 3RSTA 4OMRA 3PGQA 3Q1TA 2X58A 5G1RA 3OMEA 2CBYA 5E0SA 3ISAA 4NARA 3IBBA 2YJGA 4Q0GA 1K32A 3ZWBA 1N6EA 3T89A 1SZOA 2FBMA 1XNVA 2F9IB 4FJWD 1J7XA 5INGA 3KTIA 3U9SB 3R6HA 4ELWA 2FZSA 1OD4A 4NNQA 2ZQRA 1Y7OA 3ZWCA 4L6WA 3I47A 1X0UA 2UZFA 4NEKA 3Q0JA 5JBWA 3QXIA 3GF7A 3TVWA 3JU1A 2WTBA 3WG5A 3H81A 3U9TB 1WDMA 2Q34A 3LKEA 3FDUA 3KTGA 4ZDDA 4JYLA 3HE2A 4Z0MA 3R0OA 2A81A 5KDRA 1XNWA 4RYFH 2DEOA 5E0SH 2F6IA 4GHNA 4OLQA 4HDTA 3HLN1 3U9RB 3MYBA 4JWVA 3R9SA 3H0SA 5G1SA 4KD6A 3KTKA 5JBXA 2A7SA 3LAOA 5KDRB 2DUBA 3H0UA 4I52A 4JJTA 3V5IA 1O8UA 4ZDFA 5DU6A 4WYOB 1JXZA 2VSSE 1EF8A 4FZWA 4EMLA 3TV5A 4EMPA 3ST9A 1RJNA 5DUCA 2ZL2A 1FC6A 1UYTA 1FC7A 3ZW8A 2FW2A 3H0QA 5G1QA 3OC7A 4FN8A 4FZWC 1TG6A 1WDLA 3P2LA 4MI2A 1SG4A 2VSUA 2F9IA 5DZKA 3RSIA 4U0GA 4JFCA 4IZBA 1PIXA 2J5II 2C8TA 2BZRA 2W3PA 2VREA 3SLLA 2EJ5A 3QYRA 5DTPA 1UYRA 5C9GA 3STAA 4B3HA 3TVUA 1YG8A 1EY3A 2CE3A 3R9QA 1XNYA 4FNBA 4B3JA 1ON3A 2X24A 3GF3A 4JCRA 2HW5A 4L8KA 2Q2XA 4I4ZA 5MGBA 3VIVA 2NP9A 3BPPA 4RYFA 4ASIA 3TRRA 1HNOA 3IAVA 2ZL4A 3TT6A 5DUFA 3RRVA 4KPKA 4KWBA 4IZDA 1N6DA 3KTHA 5DZKH 3HP0A 3T88A 3DJAA 5KJPA 1WZ8A 2PBPA 1FC9A 4QFEA 2J5GA 3P5MA 2VSSF 3M6MA 3MOYA 3L3SA 4WCZA 3Q7HA 4EMMA 1DUBA 2ZL0A 4U0GH 4DI1A 5C90A 3HINA 2J5SA 4RCNA 4ZDCA 3PZKA 2ZQQA 1Q52A 1UYSA 5HUQA 3H02A 1K39A 5DL1A 3H0JA 3TDCA 5DU8A 1N6FA 1XX4A 4I42A 4FNDA 4K29A 1RJMA 1ON9A 4QIIA 4IZCA 4JCSA 4OG1A 1YG6A 2PPYA 4LK5A 3R9TA 3Q0GA 3QREA 3TLFA 5DU4A 3BEZA 3TZ3A 3BF0A 5DTWA 1UYVA 1OD2A 1MJ3A 3ZW9A 1WDKA 3N6RB 4ELSA 1NZYA 5FUSA 3T8AA 4HNKA 2A7KA 3T3WA 2J5GD 3QXZA 1NZYB 4QIJA 3QWDA 4ELXA 4U1AA 1UIYA 3DORA 2VSUE 4MOUA 4YLHA 2VX2A 2J5IA 4U18A 5CTCA 1VRGA 2F9YB 4G2RA 4K3WA 4JVTA 3G64A 3MT6A 4HC8A 3ZWAA 5CTBA 3QMJA 4Q1IA 4B3IA 3PE8A 1FCFA 3GLMA 4JCQA 4WZ8B 2VSUC 2ZL3A 3K50A 4JCTA 3MFMA 1HNUA 3V5EA 3GKBA 5E0NX 2F9YA 2VSSA 3SWXA 2J5IB 3QK8A 1PJHA 5IKLB 4JOTA 1Q51A 1EF9A 3KQFA 4K2NA 5DKPA 1XO6A 2PG8A 4JSBA 2QQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F47 A;  4FB8 A;  3KTJ A;  4ZDE A;  3OT6 A;  5FIF A;  1W2X A;  3NJD A;  1TYF A;  2VSU F;  2Q35 A;  4U19 A;  3T8B A;  3TT7 A;  2D3T A;  1HZD A;  3K8X A;  5INF A;  4KNP A;  4U0H A;  3P85 A;  4ZU2 A;  3IB9 A;  3NJB A;  3GMA A;  3FF6 A;  5INI A;  1DCI A;  3QKA A;  2F6Q A;  4ZDB A;  3HRX A;  2GTR A;  3PEA A;  4GM2 A;  4JYJ A;  4MXI A;  2IEX A;  4FN7 A;  3M6N A;  3RST A;  4OMR A;  3PGQ A;  3Q1T A;  2X58 A;  5G1R A;  3OME A;  2CBY A;  5E0S A;  3ISA A;  3IBB A;  4Q0G A;  1K32 A;  3ZWB A;  1N6E A;  3T89 A;  1SZO A;  2FBM A;  1XNV A;  2F9I B;  4FJW D;  1J7X A;  5ING A;  3KTI A;  3U9S B;  3R6H A;  4ELW A;  2FZS A;  1OD4 A;  4NNQ A;  2ZQR A;  1Y7O A;  3ZWC A;  4L6W A;  3I47 A;  1X0U A;  2UZF A;  4NEK A;  3Q0J A;  5JBW A;  3QXI A;  3GF7 A;  3TVW A;  3JU1 A;  2WTB A;  3WG5 A;  3H81 A;  3U9T B;  1WDM A;  2Q34 A;  3LKE A;  3FDU A;  3KTG A;  4ZDD A;  4JYL A;  3HE2 A;  4Z0M A;  3R0O A;  2A81 A;  5KDR A;  1XNW A;  4RYF H;  2DEO A;  5E0S H;  2F6I A;  4GHN A;  4OLQ A;  3HLN 1;  3U9R B;  3MYB A;  4JWV A;  3R9S A;  3H0S A;  5G1S A;  4KD6 A;  3KTK A;  5JBX A;  2A7S A;  3LAO A;  5KDR B;  2DUB A;  3H0U A;  4I52 A;  4JJT A;  3V5I A;  1O8U A;  4ZDF A;  5DU6 A;  4WYO B;  1JXZ A;  2VSS E;  1EF8 A;  4FZW A;  4EML A;  3TV5 A;  4EMP A;  3ST9 A;  1RJN A;  5DUC A;  2ZL2 A;  1FC6 A;  1UYT A;  1FC7 A;  3ZW8 A;  2FW2 A;  3H0Q A;  5G1Q A;  3OC7 A;  4FN8 A;  4FZW C;  1TG6 A;  1WDL A;  3P2L A;  4MI2 A;  1SG4 A;  2VSU A;  2F9I A;  5DZK A;  3RSI A;  4U0G A;  4JFC A;  4IZB A;  1PIX A;  2J5I I;  2C8T A;  2BZR A;  2W3P A;  2VRE A;  3SLL A;  2EJ5 A;  3QYR A;  5DTP A;  1UYR A;  5C9G A;  3STA A;  4B3H A;  3TVU A;  1YG8 A;  1EY3 A;  2CE3 A;  3R9Q A;  1XNY A;  4FNB A;  4B3J A;  1ON3 A;  2X24 A;  3GF3 A;  4JCR A;  2HW5 A;  4L8K A;  2Q2X A;  4I4Z A;  5MGB A;  3VIV A;  2NP9 A;  3BPP A;  4RYF A;  4ASI A;  3TRR A;  1HNO A;  3IAV A;  2ZL4 A;  3TT6 A;  5DUF A;  3RRV A;  4KPK A;  4KWB A;  4IZD A;  1N6D A;  3KTH A;  5DZK H;  3HP0 A;  3T88 A;  3DJA A;  5KJP A;  1WZ8 A;  2PBP A;  1FC9 A;  4QFE A;  2J5G A;  3P5M A;  2VSS F;  3M6M A;  3MOY A;  3L3S A;  4WCZ A;  3Q7H A;  4EMM A;  1DUB A;  2ZL0 A;  4U0G H;  4DI1 A;  5C90 A;  3HIN A;  2J5S A;  4RCN A;  4ZDC A;  3PZK A;  2ZQQ A;  1Q52 A;  1UYS A;  3H02 A;  1K39 A;  5DL1 A;  3H0J A;  3TDC A;  5DU8 A;  1N6F A;  1XX4 A;  4I42 A;  4FND A;  4K29 A;  1RJM A;  1ON9 A;  4QII A;  4IZC A;  4JCS A;  4OG1 A;  1YG6 A;  2PPY A;  4LK5 A;  3R9T A;  3Q0G A;  3QRE A;  3TLF A;  5DU4 A;  3BEZ A;  3TZ3 A;  3BF0 A;  5DTW A;  1UYV A;  1OD2 A;  1MJ3 A;  3ZW9 A;  1WDK A;  3N6R B;  4ELS A;  1NZY A;  5FUS A;  3T8A A;  4HNK A;  2A7K A;  3T3W A;  2J5G D;  3QXZ A;  1NZY B;  4QIJ A;  3QWD A;  4ELX A;  4U1A A;  1UIY A;  3DOR A;  2VSU E;  4MOU A;  4YLH A;  2VX2 A;  2J5I A;  4U18 A;  5CTC A;  1VRG A;  2F9Y B;  4G2R A;  4K3W A;  4JVT A;  3G64 A;  3MT6 A;  4HC8 A;  3ZWA A;  5CTB A;  3QMJ A;  4Q1I A;  4B3I A;  3PE8 A;  1FCF A;  3GLM A;  4JCQ A;  4WZ8 B;  2VSU C;  2ZL3 A;  3K50 A;  4JCT A;  3MFM A;  1HNU A;  3V5E A;  3GKB A;  5E0N X;  2F9Y A;  2VSS A;  3SWX A;  2J5I B;  3QK8 A;  1PJH A;  5IKL B;  4JOT A;  1Q51 A;  1EF9 A;  3KQF A;  4K2N A;  5DKP A;  1XO6 A;  2PG8 A;  4JSB A;  2QQ3 A; 
#chains in the Genus database with same CATH topology
 4F47 A;  4FB8 A;  3KTJ A;  4ZDE A;  3OT6 A;  5FIF A;  1W2X A;  3NJD A;  1TYF A;  2VSU F;  2Q35 A;  4U19 A;  3T8B A;  3TT7 A;  2D3T A;  1HZD A;  3K8X A;  5INF A;  4KNP A;  4U0H A;  3P85 A;  4ZU2 A;  3IB9 A;  3NJB A;  3GMA A;  3O4X E;  3FF6 A;  5INI A;  1DCI A;  3ADB A;  3QKA A;  2F6Q A;  4ZDB A;  3HRX A;  4J2U A;  2GTR A;  3PEA A;  4GM2 A;  4JYJ A;  4MXI A;  2IEX A;  3BPT A;  4FN7 A;  3M6N A;  3RST A;  4OMR A;  3A4M A;  3PGQ A;  3Q1T A;  2X58 A;  5G1R A;  3OME A;  2CBY A;  5E0S A;  3ISA A;  4NAR A;  3AM1 A;  3IBB A;  2YJG A;  4Q0G A;  1K32 A;  3ZWB A;  1N6E A;  3T89 A;  1SZO A;  2FBM A;  1XNV A;  3W8I B;  2F9I B;  4FJW D;  1J7X A;  5ING A;  3KTI A;  3U9S B;  3R6H A;  4ELW A;  2FZS A;  1OD4 A;  4NNQ A;  2ZQR A;  1Y7O A;  3ZWC A;  4L6W A;  3I47 A;  1X0U A;  2UZF A;  4NEK A;  3Q0J A;  5JBW A;  3QXI A;  3GF7 A;  3TVW A;  3JU1 A;  2WTB A;  3WG5 A;  3H81 A;  3ADD A;  3U9T B;  3L8I A;  1WDM A;  2Q34 A;  3LKE A;  3FDU A;  3KTG A;  4ZDD A;  4JYL A;  1Y64 B;  3HE2 A;  4Z0M A;  3R0O A;  2A81 A;  5KDR A;  1XNW A;  4RYF H;  2DEO A;  5E0S H;  2F6I A;  4GHN A;  4OLQ A;  4HDT A;  3HLN 1;  3U9R B;  3MYB A;  4JWV A;  3R9S A;  3H0S A;  5G1S A;  4KD6 A;  3KTK A;  5JBX A;  2A7S A;  3LAO A;  5KDR B;  2DUB A;  3H0U A;  4I52 A;  4JJT A;  4GEH B;  3V5I A;  1O8U A;  4ZDF A;  5DU6 A;  4WYO B;  1JXZ A;  2VSS E;  1EF8 A;  4FZW A;  4EML A;  3TV5 A;  4EMP A;  3ST9 A;  1RJN A;  5DUC A;  3A4N A;  2ZL2 A;  1FC6 A;  1UYT A;  1FC7 A;  3ZW8 A;  2FW2 A;  3H0Q A;  5G1Q A;  3OC7 A;  4FN8 A;  4FZW C;  1TG6 A;  1WDL A;  3P2L A;  4MI2 A;  1SG4 A;  2VSU A;  2F9I A;  5DZK A;  3RSI A;  4U0G A;  4JFC A;  4IZB A;  1PIX A;  2J5I I;  1UX4 A;  3RQF A;  2C8T A;  2BZR A;  2W3P A;  2VRE A;  3SLL A;  2EJ5 A;  3QYR A;  5DTP A;  1UYR A;  5C9G A;  3STA A;  4B3H A;  3TVU A;  3IRB A;  1YG8 A;  1EY3 A;  2CE3 A;  3R9Q A;  1XNY A;  4FNB A;  4B3J A;  1ON3 A;  2X24 A;  3GF3 A;  4JCR A;  2HW5 A;  4L8K A;  2Q2X A;  4I4Z A;  5MGB A;  3VIV A;  2NP9 A;  3BPP A;  4RYF A;  4ASI A;  3TRR A;  1HNO A;  3IAV A;  2ZL4 A;  3TT6 A;  5DUF A;  3RRV A;  4KPK A;  4KWB A;  4IZD A;  1N6D A;  3KTH A;  5DZK H;  3HP0 A;  3T88 A;  3DJA A;  5KJP A;  1WZ8 A;  2PBP A;  1FC9 A;  4QFE A;  2J5G A;  3P5M A;  2VSS F;  3W8H B;  3M6M A;  3MOY A;  3L3S A;  3A4L A;  4WCZ A;  3Q7H A;  4EMM A;  1DUB A;  2ZL0 A;  4U0G H;  4DI1 A;  5C90 A;  3HIN A;  2J5S A;  4RCN A;  4ZDC A;  3PZK A;  2ZQQ A;  1Q52 A;  1UYS A;  5HUQ A;  3H02 A;  1K39 A;  5DL1 A;  3H0J A;  3TDC A;  5DU8 A;  1N6F A;  1XX4 A;  4I42 A;  1UX5 A;  4FND A;  4K29 A;  1RJM A;  1ON9 A;  4QII A;  4IZC A;  4JCS A;  4OG1 A;  1YG6 A;  2PPY A;  4LK5 A;  3R9T A;  3Q0G A;  3QRE A;  3TLF A;  5DU4 A;  3BEZ A;  3TZ3 A;  3BF0 A;  5DTW A;  1UYV A;  1OD2 A;  1MJ3 A;  2P63 A;  3ZW9 A;  1WDK A;  3N6R B;  4ELS A;  1NZY A;  5FUS A;  3T8A A;  4HNK A;  2A7K A;  3T3W A;  2J5G D;  3QXZ A;  1NZY B;  4QIJ A;  3QWD A;  4ELX A;  4U1A A;  1UIY A;  3DOR A;  2VSU E;  4MOU A;  4YLH A;  2VX2 A;  2J5I A;  4U18 A;  5CTC A;  1VRG A;  3ADC A;  2F9Y B;  4G2R A;  4K3W A;  4JVT A;  3G64 A;  3AJM A;  3MT6 A;  4HC8 A;  3ZWA A;  5CTB A;  3QMJ A;  4Q1I A;  4B3I A;  3PE8 A;  1FCF A;  3GLM A;  4JCQ A;  4WZ8 B;  2VSU C;  2ZL3 A;  3K50 A;  4JCT A;  3MFM A;  1HNU A;  3V5E A;  3GKB A;  5E0N X;  2F9Y A;  3L8J A;  2VSS A;  3RQE A;  3SWX A;  2J5I B;  3QK8 A;  3RQG A;  1PJH A;  5IKL B;  4JOT A;  1Q51 A;  1EF9 A;  3KQF A;  4K2N A;  5DKP A;  1XO6 A;  2PG8 A;  4JSB A;  2QQ3 A; 
#chains in the Genus database with same CATH homology
 4F47 A;  4FB8 A;  3KTJ A;  4ZDE A;  3OT6 A;  5FIF A;  1W2X A;  3NJD A;  1TYF A;  2VSU F;  2Q35 A;  4U19 A;  3T8B A;  3TT7 A;  2D3T A;  1HZD A;  3K8X A;  5INF A;  4KNP A;  4U0H A;  3P85 A;  4ZU2 A;  3IB9 A;  3NJB A;  3GMA A;  3FF6 A;  5INI A;  1DCI A;  3QKA A;  2F6Q A;  4ZDB A;  3HRX A;  4J2U A;  2GTR A;  3PEA A;  4GM2 A;  4JYJ A;  4MXI A;  2IEX A;  3BPT A;  4FN7 A;  3M6N A;  3RST A;  4OMR A;  3PGQ A;  3Q1T A;  2X58 A;  5G1R A;  3OME A;  2CBY A;  5E0S A;  3ISA A;  4NAR A;  3IBB A;  2YJG A;  4Q0G A;  1K32 A;  3ZWB A;  1N6E A;  3T89 A;  1SZO A;  2FBM A;  1XNV A;  2F9I B;  4FJW D;  1J7X A;  5ING A;  3KTI A;  3U9S B;  3R6H A;  4ELW A;  2FZS A;  1OD4 A;  4NNQ A;  2ZQR A;  1Y7O A;  3ZWC A;  4L6W A;  3I47 A;  1X0U A;  2UZF A;  4NEK A;  3Q0J A;  5JBW A;  3QXI A;  3GF7 A;  3TVW A;  3JU1 A;  2WTB A;  3WG5 A;  3H81 A;  3U9T B;  1WDM A;  2Q34 A;  3LKE A;  3FDU A;  3KTG A;  4ZDD A;  4JYL A;  3HE2 A;  4Z0M A;  3R0O A;  2A81 A;  5KDR A;  1XNW A;  4RYF H;  2DEO A;  5E0S H;  2F6I A;  4GHN A;  4OLQ A;  4HDT A;  3HLN 1;  3U9R B;  3MYB A;  4JWV A;  3R9S A;  3H0S A;  5G1S A;  4KD6 A;  3KTK A;  5JBX A;  2A7S A;  3LAO A;  5KDR B;  2DUB A;  3H0U A;  4I52 A;  4JJT A;  3V5I A;  1O8U A;  4ZDF A;  5DU6 A;  4WYO B;  1JXZ A;  2VSS E;  1EF8 A;  4FZW A;  4EML A;  3TV5 A;  4EMP A;  3ST9 A;  1RJN A;  5DUC A;  2ZL2 A;  1FC6 A;  1UYT A;  1FC7 A;  3ZW8 A;  2FW2 A;  3H0Q A;  5G1Q A;  3OC7 A;  4FN8 A;  4FZW C;  1TG6 A;  1WDL A;  3P2L A;  4MI2 A;  1SG4 A;  2VSU A;  2F9I A;  5DZK A;  3RSI A;  4U0G A;  4JFC A;  4IZB A;  1PIX A;  2J5I I;  2C8T A;  2BZR A;  2W3P A;  2VRE A;  3SLL A;  2EJ5 A;  3QYR A;  5DTP A;  1UYR A;  5C9G A;  3STA A;  4B3H A;  3TVU A;  1YG8 A;  1EY3 A;  2CE3 A;  3R9Q A;  1XNY A;  4FNB A;  4B3J A;  1ON3 A;  2X24 A;  3GF3 A;  4JCR A;  2HW5 A;  4L8K A;  2Q2X A;  4I4Z A;  5MGB A;  3VIV A;  2NP9 A;  3BPP A;  4RYF A;  4ASI A;  3TRR A;  1HNO A;  3IAV A;  2ZL4 A;  3TT6 A;  5DUF A;  3RRV A;  4KPK A;  4KWB A;  4IZD A;  1N6D A;  3KTH A;  5DZK H;  3HP0 A;  3T88 A;  3DJA A;  5KJP A;  1WZ8 A;  2PBP A;  1FC9 A;  4QFE A;  2J5G A;  3P5M A;  2VSS F;  3M6M A;  3MOY A;  3L3S A;  4WCZ A;  3Q7H A;  4EMM A;  1DUB A;  2ZL0 A;  4U0G H;  4DI1 A;  5C90 A;  3HIN A;  2J5S A;  4RCN A;  4ZDC A;  3PZK A;  2ZQQ A;  1Q52 A;  1UYS A;  5HUQ A;  3H02 A;  1K39 A;  5DL1 A;  3H0J A;  3TDC A;  5DU8 A;  1N6F A;  1XX4 A;  4I42 A;  4FND A;  4K29 A;  1RJM A;  1ON9 A;  4QII A;  4IZC A;  4JCS A;  4OG1 A;  1YG6 A;  2PPY A;  4LK5 A;  3R9T A;  3Q0G A;  3QRE A;  3TLF A;  5DU4 A;  3BEZ A;  3TZ3 A;  3BF0 A;  5DTW A;  1UYV A;  1OD2 A;  1MJ3 A;  3ZW9 A;  1WDK A;  3N6R B;  4ELS A;  1NZY A;  5FUS A;  3T8A A;  4HNK A;  2A7K A;  3T3W A;  2J5G D;  3QXZ A;  1NZY B;  4QIJ A;  3QWD A;  4ELX A;  4U1A A;  1UIY A;  3DOR A;  2VSU E;  4MOU A;  4YLH A;  2VX2 A;  2J5I A;  4U18 A;  5CTC A;  1VRG A;  2F9Y B;  4G2R A;  4K3W A;  4JVT A;  3G64 A;  3MT6 A;  4HC8 A;  3ZWA A;  5CTB A;  3QMJ A;  4Q1I A;  4B3I A;  3PE8 A;  1FCF A;  3GLM A;  4JCQ A;  4WZ8 B;  2VSU C;  2ZL3 A;  3K50 A;  4JCT A;  3MFM A;  1HNU A;  3V5E A;  3GKB A;  5E0N X;  2F9Y A;  2VSS A;  3SWX A;  2J5I B;  3QK8 A;  1PJH A;  5IKL B;  4JOT A;  1Q51 A;  1EF9 A;  3KQF A;  4K2N A;  5DKP A;  1XO6 A;  2PG8 A;  4JSB A;  2QQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...