3SXPA

Crystal structure of helicobacter pylori adp-l-glycero-d-manno-heptose-6-epimerase (rfad, hp0859)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
324
structure length
310
Chain Sequence
MRYIDDELENQTILITGGAGFVGSNLAFHFQENHPKAKVVVLDKFRSNPSSLGHFKNLIGFKGEVIAADINNPLDLRRLEKLHFDYLFHQAAVSDTTMLNQELVMKTNYQAFLNLLEIARSKKAKVIYASSAGVYGNTKAPNVVGKNESPENVYGFSKLCMDEFVLSHSNDNVQVGLRYFNVYGPREFYKEKTASMVLQLALGAMAFKEVKLFEFGEQLRDFVYIEDVIQANVKAMKAQKSGVYNVGYSQARSYNEIVSILKEHLGDFKVTYIKKHTQAHIEPTILDLDYTPLYDLESGIKDYLPHIHAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of ADP-L-glycero-D-manno-heptose-6-epimerase (HP0859) from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Isomerase
molecule keywords ADP-L-glycero-D-mannoheptose-6-epimerase
total genus 111
structure length 310
sequence length 324
chains with identical sequence B, C, D, E
ec nomenclature ec 5.1.3.20: ADP-glyceromanno-heptose 6-epimerase.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sxpA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3sxpA02
4LCJA 1E77A 1LLQA 1T26A 5ENDA 3FSRA 4RVFA 3SC6A 3H3JA 3H2SA 2C5AA 1ZBQA 3ZWYA 4YCAA 2YDYA 4ND1A 5DBIA 3WIEA 4GMGA 3B6ZA 4UEKA 1V6AA 3EC7A 1BDBA 2J5KA 1L7EA 4E5NA 1IPFA 2ZTUA 3LVFO 4DMMA 5G4KB 2OFPA 2B0JA 4IY1A 4AICA 3W8DA 2YHIA 2FSVA 4JX8A 5JDIC 3OMLA 3GUCA 1I3KA 4UEOA 3OHSX 3DZIA 1EVJA 2ZCVA 5CDGA 3PDJA 4OSOA 1PWZA 1ORRA 3BTUA 3C1OA 2J5QA 2VRCD 4PG6A 5KJ6A 1T2CA 4XDYA 4B8ZA 4PLYA 3RUHA 1C1XA 1T4BA 4NJMA 1MFPA 3AK4A 1Q1NA 1U2GA 3ZW9A 5CFZA 2RBEA 1CIVA 3TL2A 4BO2A 3AUAA 2O4UX 2DQ4A 2FPGA 3TPCA 4RF5A 4BGVA 3ON5A 4GGOA 3OBBA 1Z6ZA 2C59A 5I9MA 3UICA 1WPQA 3PJDA 3VZQA 2EKLA 2BD0A 2OO5A 2VHZA 3F1KA 4CQMD 1W6UA 4YA6A 4ZJUA 3Q9NA 1DIGA 3D0OA 3RUFA 2I9PA 1E5LA 2DFVA 4CUKA 3GZNB 4KUGA 2W98A 2LDBA 4OL9A 2Y66A 1NVTA 4D43A 3ONDA 4GVXA 3WSWA 4ZA2A 4EJ6A 3PIIA 1TT7A 1HDGO 2FHSA 4MVJH 1QMGA 5DF1A 1GQQA 2YZ7A 4BNFA 4D41A 3SXPA 2VTDA 4YJHB 3EGOA 3WWZA 3BHJA 1Q0QA 4RPJA 3OJ0A 1YJQA 2QX7A 1GU7A 1MLDA 2R00C 3M2PA 3U3XA 2X5KO 3PJEA 3JQGA 1E6EA 4DLAA 4CM4B 3ZNPA 1NQOA 2OP1A 4OSPA 4EJ0A 3W6ZA 4MP6A 4R69A 1LQUA 1ZSYA 3EVTA 1GPDG 1KVTA 1NAHA 2B36A 5BQFA 1VI2A 1E7YA 4YQYA 2GLXA 1OC4A 1EVZA 3DZGA 1V35A 4Y8VA 1SNYA 1XG5A 3Q2KA 3KEOA 4PRLA 1U3UA 1VL8A 3OEYA 2HK7A 4PN3A 1DAPA 2BMAA 3VZPA 1T2DA 1ZK4A 5JE8A 4YAKA 4ND2A 4ZGWA 4EUEA 2G82A 3RAJA 2PZMA 4CV1A 5KVQA 2IEDA 3HDJA 1YB4A 4BO5A 3WGIA 2FN7A 4ZU3A 1J6UA 3EYWA 4J90A 2C82A 4CM3A 4WUVA 2V65A 5TSDA 4CPDA 3MWDB 1DO8A 2X5OA 4MVJI 3TOXA 1N7HA 2XPCA 1B8VA 4I9HA 4RQTA 5FI3A 5T64A 1EK5A 1GPJA 3DL2A 5A06A 4E2YA 3D3WB 1ZO8A 3UXYA 2D2IA 3ZWVA 3PJGA 5C7LO 3RJ5A 3ZWPA 1LJ8A 2EV9A 3U49A 1B2LA 3C24A 1VC2A 1Y9AA 4E2XA 5DCWA 1H9AA 3ABIA 3KTDA 3QA9A 3R3SA 4WLEA 3RIHA 2OMEA 1PQPA 3GY0A 4XIJA 1GYRA 3CUKA 1I2BA 1WLYA 5L4NA 4Q39A 1W0CA 1X7DA 1ADGA 1KERA 2B4QA 4UVEA 3SJUA 4BNIA 4D3FA 4A03A 2CD9A 1LSUA 1H5QA 3PHLA 4BNTA 2WDZA 3IJPA 3DB2A 4MVJD 3R3JA 4N5LA 2Y1GA 1M67A 3EDMA 1B14A 3U9LA 3HFSA 1LSJA 1PJTA 3FNHA 1EE9A 1GZ3A 2GSDA 5DDIP 5EQFA 3HDQA 4RO0A 1IL0A 5EN4A 2ILTA 3NT2A 3NDRA 4K28A 2WYVA 2RIRA 5A3VA 2NTJA 3PHJA 4KUHA 5JAIA 1N2SA 3RFVA 4IJWA 1BHSA 4TVBA 5JNLA 1A7AA 1EDOA 1V0JA 3ZNOA 4BV8A 3H9EO 5DP1A 5EINA 2VOEA 3I52A 4IGFA 1ZK1A 4HWKA 2DTEA 1Z7EA 4MIOA 3RC1A 1VL0A 1BRMA 3ETEA 2J8ZA 1WDLA 3DHNA 2D3TA 3VPGA 4BO1A 4EYEA 1PR9A 2AQIA 1X0VA 4GWKA 4JP2A 1NXQA 4B4VA 4G81A 1WMBA 1V9LA 3GOHA 2C20A 4IIVA 2I67A 4IDCA 4L9RA 4ZICA 1JU9A 2VOJA 1HL3A 2BKAA 1YB1A 3F1LA 4ZRNA 2OL4A 4M87A 3VOSA 3WXBA 2Y99A 4RPHA 4GX2A 4BKOA 4DBZA 4YRAA 3KB6A 4PLZA 1DXYA 5MDHA 1DJNA 1X7GA 3QVSA 3AI1A 4MIEA 1H0KA 4X54A 5DBGA 5DCYA 1H6DA 3IJRA 4PZDA 2GYYA 2B35A 2YV3A 4KDFA 3GHHA 4DYDA 2BGKA 5T8KC 4KWHA 1A9ZA 1WP4A 1PIWA 3GVPA 4TMFA 3WGGA 4PCVA 4UAGA 1MGOA 1P1JA 1WNTA 3KLPX 4Z0HO 4YRBA 2WD8A 1BGVA 4WNCA 4DA9A 4FFMA 3ZGYA 3GN2A 3VH3A 1E1KA 3NYWA 4U5QA 3T7EA 1IHYA 2VRBA 3DAFA 1MXHA 5TC4A 1LRLA 1A4UA 3HADA 4A2CA 3PQDA 4BNHA 1NP3A 1NWCA 3GFBA 1OBFO 1G0OA 1YE3A 5IXSA 1LEHA 2GZ1A 3MJEA 4YJDA 3ANLA 2V6FA 1MV8A 3T4XA 3EZYA 4JJIA 1PL6A 3K96A 4IMRA 1YL5A 4LN1A 5A02A 3IUPA 3MOIA 1SZJG 3DZHA 4Z0TA 4CLEA 1C0LA 1UP7A 1WDKA 4FQ8A 4R3NA 5L45A 3OSUA 3JQBA 4DC1A 2CVZA 2QIOA 3CZMA 4EBFA 5JSFA 1ZFNA 4BS9A 4PVDA 4LISA 2UAGA 3F5SA 4R1UA 4A10A 3ZWBA 1UZMA 1JTVA 5G0TA 3FI9A 1E3WB 3AOEC 1I8TA 3AU9A 4D42A 3JQ7B 3GAFA 3GQVA 3M6IA 4P4NA 3LK7A 3RUIA 4XQEA 4AG3A 2AG5A 1P1KA 2GO1A 1HRDA 5L3ZA 3QE3A 4M1QA 3E9NA 3UCEA 1FF9A 5HS6A 4M54A 1QORA 3JYNA 1Y8RA 3INGA 1SOWA 3JSAA 4U0JA 2BI8A 1PGNA 3RUDA 5TT1A 3GC6A 1ADCA 1E1LA 1KIFA 1TT5A 4IXTA 4E30A 1GUZA 3IC5A 4WLVA 4PLGA 3QVTA 1UXKA 4NU5A 3QW2A 3AY3A 1LX6A 4CJXA 2AW5A 1GADO 2OHXA 4FW8A 4RDIA 3KZVA 1HDCA 4YB8A 1XR3A 2JD2A 4Z9YA 2Q1TA 4F46A 3WGOA 5ENVA 2Y67A 4ESOA 4CODB 1MFZA 4TRNA 4DPLA 4FS3A 4WOJA 2X9NA 2JL1A 3H5NA 3ROMA 1LUAA 3TWOA 5JBIA 4RF2A 5G4LA 1EUCA 3WX0A 5I7EA 4AJ1A 3GDOA 2DKNA 3RBVA 4BQRA 2GN9A 4IDDA 2RAFA 4YR9A 1OZAA 2B4RO 4OQYA 5KKAA 3BMNA 4XIYA 3OH8A 5TJHA 3F3SA 4RVGA 5EQDA 2WYWA 4FFPA 1M66A 3WG9A 4PZEA 1K6XA 2GDZA 3ZZNA 1ULUA 1NR7A 4WCFA 4RJTA 1NTOA 3W6UA 4FFLA 4JGBA 1CDOA 1SOVA 4CLOA 1JLLA 2CVOA 2FRDA 4BMVA 3ZV6A 5LDHA 4H7PA 3WQSB 1GQ2A 4IQGA 1Q7CA 1NFQA 1BVRA 2QRKA 1ZK0A 3Q9UA 1Z7BA 4CLRA 1BW9A 3EK2A 1GFSA 1GV0A 4U6SA 2DPGA 3I9NA 5I8WA 4CM1A 4R1NA 2O3QA 1DIRA 4TRMA 1W4ZA 2XAAA 3H9GA 4MVJP 4XQ9A 4CR7A 4CM4A 4UUMA 2PK3A 3H8VA 4H3VA 2AHRA 1ZJZA 1ZW1A 4NJMB 1PJBA 3COSA 3QSGA 2JJYA 4IMPA 4CM6A 3WGHA 1G6KA 1DFHA 1VLLA 4NJOA 3GLQA 4GBJA 1X14A 1ZZEA 3LT1A 2BF7A 2CDAA 4KTVE 3VPFA 4CMJA 1EVYA 2HMSA 1X0XA 1LC3A 4DLLA 1HTBA 1Q7GA 4BGUA 2ZB8A 4E5MA 3HJAA 5JC8A 2VN8A 1QP8A 1MG0A 3ANMA 3WGZA 1P45A 4YT2A 4CMEA 2PY6A 4YTEA 4LVUA 1K5HA 4OMUA 1T4DA 1IPEA 5JXWA 2PD3A 1Y9EA 3OIFA 2P9GA 4ALMA 4BB5A 1YVEI 2AEJA 4TRJA 4WASA 3LQFA 3B1JA 4BNNA 3DZKA 1OC2A 3CINA 5G0UA 3PFWO 1SC6A 5LCXA 1E3SA 3G3EA 2FR0A 4R16A 3ICCA 1X15A 4QXMA 4BO0A 3QWBA 4LRSB 4BV9A 1VKOA 1PJCA 1M2WA 4NBTA 5AXCA 5JO9A 1NVMB 4Q9NA 3RKUA 4ND5A 3RWBA 1U3TA 3N74A 1E3LA 1C3VA 2FOIA 4IJUA 4Y6PA 4U8GA 4YAJA 5AXBA 2X1HA 3GRPA 5IZCA 3QIVA 5H81A 3PEFA 3DBRB 3NJ4A 1D3AA 4MVJM 2OBYA 2EXXA 1LTHR 1CERA 1NVGA 3LT4A 1H6CA 4GKBA 4K6FA 1FDTA 4E4YA 1ISJA 1U7TA 1WW8A 3I9JA 3KLMX 4UVHA 3M1AA 3RC2A 4CUZA 3OP4A 3D64A 2WE8A 3IMFA 5JAQA 3PTZA 4F6CA 1U3VA 3UOGA 5C37A 3QJ5A 3I6QA 1L7DA 1I0ZA 4YQZA 1E3EA 1N5DA 4OO3A 5F21A 3C1AA 5K0ZA 3G79A 2HQ1A 2BFMA 1PGOA 1UH5A 4YEDA 1H9BA 2IYOA 1XU7A 1ZUD1 4AJKA 1GCUA 1B8UA 1QYVA 2HO5A 2ZYGA 4R1SA 1PS0A 2I3GA 1CEQA 3GUYA 2F1KA 1JKIA 3DEYX 4J49A 4WOKA 1BW9B 1XQ6A 2G0TA 4AJJA 1Y8RB 4PLVA 4J4HA 1KYQA 3PK0A 4DXHA 3DOOA 1IE3A 4P4LA 3H7AA 3WSVA 3JQGB 4BUCA 4MOWA 1XA0A 3FWNA 2VYVD 3QVWA 5I9NA 4BNXA 4AJNA 3W8FA 1XELA 9LDBA 4BNZA 4DVJA 4TRRA 3H5AA 4L75A 2X0RA 3K73O 1Y5MA 3GRKA 3TN7A 3K2EA 3QLJA 1NX6A 4O6VA 2WEKA 4J4TA 2PR2A 2CF5A 4JNKA 3ZV5A 4AJIA 2DAPA 5G0SA 2Z5LA 3E5RA 2PTGA 3PQEA 4JJGA 5TGDA 3H9QA 1ZVMA 1CQJA 2VWPA 3PZRA 4RF4A 3PPIA 1P77A 2WE7A 3V2HA 4NK4A 1D1SA 7ADHA 3CXRA 1I3MA 4ITUA 4J6FA 3HZZA 4ROSA 4TZTA 3VH4A 5THQA 3QVXA 1MX3A 2I76A 2NV6A 5TX7A 1I2ZA 1N9GB 2NVUB 2HMVA 3EUWA 1EDZA 2W4QA 1E1MA 3ZV4A 3BMQB 1FDUA 1RKXA 1IYZA 2GUGA 3AM3A 2ZJ1A 3DMTC 4FB5A 4I9UA 3RFTA 3TZCA 3GR6A 4ZQBA 5DT9A 3PDUA 4JXKA 2EHDA 3ZCXA 1GQYA 4R68A 3MEQA 2FZEA 1LNQA 2ZATA 1PL8A 4E13A 3HB4X 1C0KA 4JCOA 4W7IA 2DVMA 4B79A 2HRBA 2IZZA 1HZJA 4YVFA 1CWUA 2X22A 1EUDA 4URFA 1R15A 4WPGA 2DC1A 2GERA 4QFDA 5DZSA 4AL4A 1ZXBA 2P2SA 5AYVA 4C4OA 1ENYA 2Y1DA 4HY3A 4XYGA 4BNUA 2OORA 1Y81A 4MVJF 1TA4A 4XEHA 4XGKA 2W2KA 5FEUA 3WQRA 1YONA 4ALJA 5JDCA 2GZ3A 5BSGA 1JWAB 2Q46A 2WD7A 4CV2A 3GEGA 3HG7A 1E7MA 1O5IA 2PGJA 1ISGA 2Z95A 3H9UA 1YJ8A 2HMWA 3BHMA 1VPDA 4BNVA 3E03A 3B1KA 5TNXA 3OIDA 4TSKA 2EGGA 3AY7A 2Y93A 5MGBA 1GUFA 2VNSA 1F8GA 1HYEA 1RM4A 2WJPA 3IP1A 4DYVA 3V5NA 2Y1OA 2Y0DA 3PQFA 4MP3A 2PWZA 4ZRMA 1PGQA 1ZSNA 1ADBA 4TVOA 1GUYA 1MB4A 2C5EA 2XXJA 2FPPA 1D8AA 3KUXA 4Y9DA 1EK6A 4OXNA 3L4BC 4PLWA 5H83A 1HSOA 1LDBA 5F5NA 4JP3A 3AFMA 3DAGA 4J1SA 2CDBA 3WYBA 4WE3A 1Z74A 4MO2A 1HKUA 3JD2A 2Q1WA 3GDGA 2P91A 3SEFA 4MJLA 5DOVA 1P74A 4YAIA 5BSHA 1NYTA 4RVDA 3ZWCA 4H15A 3LC1O 4WNIA 2D5CA 4FCCA 4Y6SA 3PI7A 1O8CA 5C7OO 4ND4A 2PFGA 1XCBA 3E5MA 3U5TA 3U4HA 3KBOA 3RJ9A 4FN4A 1HYHA 3OIGA 4IZIA 5AOVA 3ZDFA 2P5UA 3GVIA 1O9BA 5DBFA 3JQAD 3NRCA 1ZK3A 3BZUA 1MG5A 4O0LA 4CMIA 4PIVA 5AQ1A 1YBMA 1YL6A 3N58A 4II2A 5IZ4A 3FN4A 5IDQA 1M6WA 3PYMA 2BFOA 1PEDA 5U9CA 1VJ1A 4HADA 4UVIA 4GX5A 5T67A 3BTVA 1R4MB 5TF4A 3QWAA 4CM5A 4D3SA 3JV7A 1TLTA 2HRZA 1PS9A 2IEBA 2VT2A 3HDYA 3ZN2A 3RUCA 1J49A 3ZU5A 4CMHA 3VZRA 3FRJA 2YUTA 3BMOA 2HKIA 4DL9A 1ZK2A 1LLUA 1QV6A 2NU9A 1E7QA 1VSVA 5ILGA 4IJVA 1V3UA 3IOYA 3JD1A 5AXAA 1U1IA 2X23A 3PGXA 4XR9A 4DC0A 2A35A 3JYPA 1D4FA 1N9GA 1P0CA 2DLDA 1F12A 3AUSA 3MWEB 3WJAA 1R0LA 4ZQGA 1UUFA 2DTXA 5COAA 2R00A 4XZ3A 3PWZA 1QYCA 4FC7A 4CLRB 4BL5A 2PZKA 1CYDA 1B3RA 4NBUA 5IFLA 1R37A 2HCTA 3L77A 2B5VA 5L7WA 5B4UA 1W8DA 1TI7A 3GNTA 5L40A 1QYDA 3MJVA 4J2HA 1GYQA 5IF3A 3QHAA 1RYEA 3FD8A 3G17A 1GTMA 3BAZA 4BO7A 4R9SA 4WLNA 3WYCA 3H3FA 1Y8QA 3NTQA 4JIGA 4BGIA 3EY4A 2GZ2A 4HFMA 3AI3A 4TKMA 4L4RA 3TL3A 3UN1A 4E5KA 8LDHA 5F1PA 4A7PA 3VAZA 4G5HA 4CMGA 1BMDA 5FYDA 2CVQA 3O8QA 1LSOA 1E6WA 3GZNA 4Q3NA 3UVEA 3W4KA 5A9TA 2AQKA 3CE6A 1OOEA 2O4CA 5ITWA 3G0OA 2FR1A 3C7DB 1B26A 4UUPA 3CZRA 1A5ZA 3KYDB 3DBVO 4J16A 5A03A 1ZJYA 3D4NA 3DHYA 5A5EA 2E82A 1IULA 5B1YA 1V3TA 2Y0EA 1NPYA 3HHPA 1OMOA 3KSDO 3ZV3A 1HE2A 1BSVA 4YPOA 2Q99A 4L8VA 1C1XB 3ZHXA 1Y6JA 2POQX 3Q11A 3ADPA 3GVHA 1N8KA 3L6OO 4CM7A 1A27A 4P4GA 1T24A 1SB9A 4J0FA 2BELA 3WS7A 3I3OA 1KEVA 2NU6A 4M55A 1GZ4A 3T4EA 2B69A 4FDAA 5JFOA 1YB5A 4LGVA 4J3FA 5AVOA 3D1LA 2VYVA 2J5RA 2UUOA 1A9YA 2PGDA 3F46A 4RLHA 3O8QB 1ZSVA 4TQGA 1YDWA 5DULA 4BKRA 4INAA 3EHEA 3U4CA 4JROA 4EEXA 4OJNA 2H5LA 2VWGA 3WMWA 3IIEA 3S2EA 2VCYA 3PWKA 3KSZO 1ID1A 1YDEA 4CMIB 4HUJA 3UHAA 1XSEA 1UXGA 3K5PA 3LF1A 5T6BA 1M76A 4QEDA 2HUNA 4OOFA 3K92A 3NTOA 1HLDA 5COBA 2EIHA 1PZFA 4U0KA 4D0RA 5T57A 2W2KB 4DQUA 5CP8A 1NPDA 1ONPA 3KHUA 5DNAA 3I9KA 3JQEA 1R16A 2PA3A 3JQAB 4K9DA 4XRRA 1B3BA 3PHHA 5CAEA 2ZQZA 3ZWXA 3L4SO 4EUHA 3ETGA 4D46A 2VRCA 1EUZA 3MJ4A 3NEPX 4YT4A 3TF5A 3F9IA 3CMMA 3I6IA 1UZNA 3G1TA 1WZEA 3BXXA 4YAGA 5A3JA 3NT5A 1TB4A 2QW8A 2P4HX 1MA0A 3JQ9A 3HN7A 4RL6A 2PH5A 3LF2A 4KWIA 3QWFA 1NQAO 2C07A 5FWNA 5K6AC 1U5AA 1NASA 4EEZA 1AHIA 4Q3AA 2V6BA 1W73A 1EEHA 5GMOA 9LDTA 2QQ5A 5ES3A 5G0VA 3C7CB 3D4OA 3ZHYA 1BXZA 2JFHA 2I66A 3BMNB 1GV1A 3ASUA 3BIOA 1KVRA 3I4CA 1FMCA 3KM0A 3ORFA 4EI2A 1K6IA 3S2FA 3KEQA 4A27A 1R4NA 2I65A 3IKVA 2VWQA 3ROKA 4D0SA 3OJLA 2H63A 1J4AA 1LQTA 3OA0A 1VE9A 1I30A 2LDXA 2RH4A 4IIUA 1JDJA 2AEMA 1BG6A 1E7SA 4WK6A 1F0YA 1DSSG 2GN4A 3GA0A 1HE3A 4R01A 1P1IA 1QXSA 3O4RA 1U28A 1N7GA 2D59A 3K8ZA 2IYPA 4I08A 2Q2VA 4IS2A 4JJFA 1DAOA 2YJZA 1IY8A 2HAEA 4KQXA 4Q3DA 4E32A 4GVLA 2Y1FA 1DEHA 4W9NA 1PSDA 1JW9B 2IXBA 4E2ZA 1B7GO 3TZ6A 3KYDA 4OHUA 2X5JO 4XDZA 3LLVA 4CM8A 1Q2XA 5KVSA 1C0PA 4PG7A 4YJFA 4J91A 3WLFA 2FWMX 5KJ1A 3E1KA 2DT5A 4J1TA 2P9EA 3D7LA 4XWYA 5ER9A 5CDTA 3GVCA 3OJFA 4CMCA 1Z45A 3WTBA 2GASA 3MTJA 4CLDA 5TT0A 4PLHA 4XX0A 4DLBA 4BB6A 2IXAA 4IDAA 3U4IA 4NPCA 1KVUA 3VHRA 2EJVA 1LXCA 3MCVA 5TQVA 3ZU2A 3F47A 2DPHA 3PZBA 4FFRA 1N1EA 3FBGA 1I3LA 3A14A 2JCXA 3WGTA 2DFDA 4E0BA 4QFCA 1UAYA 3TZQA 3LC7O 3OEWA 2HJSA 3PYLA 1ZKMA 2PKRA 2AA3A 3JQDA 1I10A 2X0JA 1Y5RA 3JQ6A 4JQCA 5EPOA 2RHCA 2V7PA 2W8ZA 3BMCB 3NGLA 4JLWA 3DC2A 3GGGA 1UR5A 2X8LA 1JVSA 4NMHA 4AJ4A 4JBGA 4J7CA 3FHLA 3Q0EA 1NFFA 5IZCC 1P3DA 2NVUA 4Z9FA 3PHIA 3UAGA 5A9SA 4PG5A 1O95A 3PYXA 1ISMA 2GF2A 2EGHA 1H6BA 3NAQA 4HFJA 5G2OA 1HT0A 4RGBA 1PL7A 2IZ0A 2O3TA 4AJEA 4EUFA 3PIDA 2DU8A 4O63O 1DIHA 3DR3A 5I9LA 1DHTA 5EMHA 5TJ9A 1QR6A 5CDUA 3O9ZA 5KVCA 3IP3A 5CPFA 5F5LA 4WEOA 1P1RA 2AXQA 5JY1A 3NKLA 3QWIA 5T5QA 2HK8A 3DBHA 1D7OA 2X86A 1B8PA 5B37A 1GEEA 3DBHB 5BR7A 4HFNA 5JAZA 2I5PO 3L6EA 1LSSA 5IDYA 1HDZA 4AJHA 3CIFA 4I5FA 1IOLA 3ROQA 3TQHA 2SCUA 1DFGA 4NU6A 3H5RA 1EFLA 1HDXA 1ENZA 3GN1A 4UREA 1NQ5A 2NM0A 4NQZA 5LC1A 1C14A 2P4QA 3JQ8B 4KQWA 3CTMA 4XB2A 4E5PA 1ADFA 3M1LA 3OJOA 5EERA 1KC3A 1RPNA 4YDRA 4II3A 3CMCO 4I5DA 5CHEA 4CLOB 2B5WA 3L9XA 4OH1A 3RI3A 3STHA 1Z82A 2NQ8A 4I8XA 4WLFA 1HLPA 5AXDA 1U7HA 3VPSA 4HV4A 5KCZA 1DIAA 4JBHA 1K2WA 4UUOA 2GN8A 2R2GA 3JTMA 4LW8A 5IN4A 4KTTE 1YXMA 3ST7A 4ID9A 3SX2A 2OOSA 5CEJA 2HSDA 4FFNA 4XRGA 4R5MA 3JQFC 3RUEA 4E3ZA 1XQ1A 4Z3DA 1LA2A 1S7CA 3G1UA 4UUNA 1NHGA 4J1NA 3VTZA 3TZHA 3NJ8A 4NNJA 3MJCA 2CDCA 1CJCA 3TDKA 2HJRA 5JPIA 3OQ6A 2VNAA 5DCUA 4RZHA 2EG9A 1B16A 3WGYA 1H93A 4Y67A 3GK3A 3EVNA 1BXGA 1YWGO 1TEHA 4R54A 4CMBA 2X9GA 1BXGB 2H6EA 3P2YA 4B4OA 1E7WA 2I99A 5C7IO 1XGKA 1XIVA 2IZ1A 3IUSA 4IDGA 4O1MA 1DB3A 4RZIA 2YHIB 2BI7A 4GQAA 3UH1A 5IXYA 2FPIA 3HE3A 4YT5A 3JQBC 1HETA 4FR5A 4DRYA 3DTYA 3GNQA 3I9LA 2EW2A 3F6YA 4YJFB 5CG2A 3PFFA 4CMKA 1WZIA 2YY7A 1YOVB 3D3EA 3K9QO 3H6KA 1UDCA 5JO0A 2Q50A 4XYMA 1CRWG 1H2BA 5HS4A 4FJ2A 1ISFA 5C5IA 3UF0A 4N5NA 2QYSA 4UEJA 1KS9A 3AWDA 5JDCC 4GLOA 1O0SA 3DFZA 4QT0A 1B15A 4R51A 4XKJA 4ALKA 3A1NA 4YJGA 4OXYA 3F4LA 4WCFC 2DBVO 4CQMA 3KV3O 4IXWA 3D3WA 1SPXA 4QTZA 1GYPA 5L53A 2NU8A 3DWFA 1AGNA 1QSGA 1SEVA 1AN9A 1I5RA 3DDNA 1A7KA 2NVWA 1E3JA 4PG4A 4GPD1 3DZBA 5JMPA 4RVHA 1PJ3A 5BNTA 3GHYA 1KEUA 5IDWA 4ILKA 1ISIA 1UP6A 5JDIA 3MJSA 3ONFA 2VT3A 3OM9A 4IQ0A 4BO9A 4LCEA 5HBRA 2C54A 4NDNE 5K9ZA 4IZHA 1U8XX 1Q0HA 2FY8A 4J7UA 2FSSA 5KJFA 2CNBA 2B83A 3OECA 4FOSA 2GCGA 4ALNA 1QRRA 2VQ3A 3FPCA 3HB5X 1DBVO 2AQ8A 3OICA 3QY9A 2G76A 1J0XO 1QYWA 4B7XA 4RQUA 5DOZA 5TLSA 3QV1A 4XR4A 1LC0A 3DZFA 4Z9XA 4BO6A 1KOLA 1VSUA 1YGYA 4IGEA 4LMRA 4LSWA 4PFJA 4Z6KA 4OGWA 3GEMA 1RYDA 1JVBA 4EDFA 5JCXA 2PZJA 4PG8A 1LRKA 4GAEA 2DBZA 2VTEA 1R4MA 1P1FA 3PP8A 4HX5A 4B7CA 1PJ4A 3WFJA 4CR6A 3A28A 1JAYA 3BTSA 2RH8A 4ND3A 3OF2A 4J2OA 2VUSA 3BA1A 3U4DA 2BLLA 3RROA 4CLXA 1PR3A 2JAPA 3DOJA 4L76A 4GSLA 4DBVO 5L7TA 3WDSA 4FBGA 4I9NA 1YKFA 4L4SA 4PRKA 4YRDA 2PH3A 4CM8B 1VKNA 1HEUA 1I33A 5A5FA 3ZHZA 3T7CA 3RKRA 2NNLD 2W2LA 1DRUA 4PVCA 3AU8A 3UFXA 3E9QA 2EP7A 4ZHSA 6ADHA 1PGJA 2HMUA 4CV3A 1LDNA 1LU9A 1BDMA 3DFUA 1VL6A 1WVGA 3EAGA 4M89A 4P38A 4EGFA 3BYZA 3WNQA 4PLTA 3VKUA 2VYND 3WICA 4AFNA 4RPLA 2J6IA 4QECA 4RPKA 5C3MA 1DHRA 4GKVA 3GG9A 3SLGA 1X7HA 3GZ4A 1EZ4A 4JBIA 3ZH2A 3H2ZA 3FPLA 2EKQA 3UCFA 3R0IA 1RM3A 3N7UA 4B4UA 4HFRA 4K1LA 2CFCA 1CQIA 5H82A 1B0AA 1SMKA 2HMTA 7MDHA 5JW6A 5THKA 4GLLA 2X4GA 5JC1A 1ISHA 1H2HA 3NT4A 3A06A 3A9WA 2Y05A 1JKFA 2X7HA 4AVYA 2HDHA 3DBLB 4XB1A 3VVCA 4OXKA 2Y0CA 2AEFA 4D79A 3V1YA 4D7AA 4Q3EA 2Q1UA 1DRVA 1U5CA 3K31A 4O5OA 2ZQYA 3F4BA 1PGPA 3ICPA 1ONNA 4WCFB 3S2IA 3GT0A 3HN2A 1KVSA 1Q7BA 1P33A 5HA5A 3PVZA 3ITDA 5TRTA 3IQDB 5BSFA 3RQSA 5ICSA 1LDEA 2P9CA 5I8ZA 1FDVA 3WTCA 2IRWA 1I36A 1HE4A 3QVOA 4XYEA 3WYEA 5DN9A 5U4QA 3W1VA 2XOXA 4QX6A 1F06A 4JN6B 4IDFA 2GD1O 4NI5A 3NDIA 3VPHA 4ZQEA 3WFIA 2O3JA 1K89A 1C1DA 4TZKA 4L73A 4NFSA 3FWZA 1KY4A 2CUKA 2BRUA 2JCYA 4DGSA 3R6DA 5GZ3A 4N18A 2ZTVA 1U9JA 3U09A 3ITKA 1KC1A 1TXGA 2FZWA 4TROA 3DZJA 1M6HA 1GD1O 4BNGA 1EBFA 2YDXA 3ENKA 5A4DA 4DREA 1GZ6A 1R0KA 1RM5A 4WJZA 2NTVA 4D3DA 4W99A 1Y8QB 2Y1EA 2I6TA 3U62A 1HYGA 4Z3KA 1IB6A 4N7RA 3P7MA 4DPKA 2PZLA 3B1FA 3TFQA 3HNPA 2D4AA 3E82A 4IQ8A 3BTOA 3SC4A 4QUKA 1SEPA 3HFGA 2J3HA 3WIDA 1BXKA 3UCXA 1GAEO 3L07A 2TMDA 1UJMA 3AOGA 4FGSA 4GI2A 3C7AA 5L4LA 1VJTA 1AXEA 3ADOA 4IINA 4HKTA 4IM7A 1A72A 4OIMA 3RVDA 5A9RA 4PZCA 3F5QA 2NQTA 3UW3A 3GVXA 1DIBA 5HRUA 1NPTO 5A9SB 4FJ1A 4B3JA 2ZTMA 2WTBA 4LVCA 4GL4A 4J4BA 3ZHBA 1TT5B 1EVIA 1R66A 3QQPA 1RJWA 2O2SA 3VVBA 4AJOA 1HSZA 3K30A 1JKJA 1ZCJA 4M8SA 3HQ4O 3L9WA 2FP4A 4EZBA 2PGLA 1X1EA 1UXIA 3UUWA 2NVBA 3PRJA 2Y68A 4LRTB 2JCVA 3DBRA 5J23A 1ZIDA 2P68A 3V8BA 1YQDA 2AG8A 2WSBA 3ZWMA 4BO4A 4D45A 4NFYA 3NUGA 4IUYA 1GDHA 5EIOA 2WM3A 4NIMA 5EESA 4U7WA 3KO8A 3LT0A 1LDMA 1F14A 4LMPA 3HDHA 4EW6A 3A4VA 3V1UA 5ITVA 3WNVA 1E7RA 4DQVA 3AM5A 4QO8A 1GY8A 1NM5A 3GFGA 1I2CA 4RVSA 3KOUA 5KJCA 5KOIA 3B70A 2PKQO 1E6UA 1XLTA 2BHLA 1BTOA 4YT8A 3AUTA 1Y7TA 2YQ4A 4FOOA 3D5TA 1R4NB 1PX0A 2E6UX 4GH5A 1YH3A 3ZWNA 1XKQA 3DO5A 3SBOA 5IJZA 1PTJA 3IKTA 3LSYA 4I5GA 2B4TO 3NX4A 2IODA 2C2XA 1LI4A 4J43A 2VZ9A 4E5YA 1AHHA 4LK3A 4WCDA 3O03A 2Q49A 2EF1A 1O6ZA 2H9IA 5G4KA 4E6PA 4KMSA 1PU2A 5GZ6A 4BVAA 1U2DA 1NWHA 5A05A 1X1TA 3RUAA 4S3MA 1DFIA 1DC4A 4LSMA 5BNIA 1JA9A 3WLEA 3OA2A 3DONA 4DUPA 3OFSA 3TOZA 1DC6A 1DPGA 2D0IA 2Z1NA 2ET6A 4NG5A 1BVUA 4OKIA 3WOHA 1KEWA 4IJKA 2PV7A 3VDRA 4YAEA 1PJSA 4P8RA 1FXSA 3WB9A 3CEAA 2JKVA 4CUJA 1AUPA 1UDBA 4XJTA 4RORA 1OAAA 1P9LA 1XYGA 3KVOA 5JY6A 4KDEA 4DQXA 1AE1A 5JMWA 5ICMA 4IDEA 3Q1LA 3HSKA 2ZTLA 4KP7A 4Z0PA 6LDHA 4YACA 3TFOA 2X58A 2CF6A 1FK8A 2XF8A 4FJ0A 1JWBB 4C7JA 1I01A 3ZWWA 4FC6A 3MJTA 1A71A 2DUWA 4U6QA 3JQ9C 1LBEA 2Q2QA 2BH9A 5F1OA 5B4TA 2QZ9A 5B12A 1V8BA 2EEZA 2RCYA 1F8FA 3AUUA 5COQA 3GH3A 5JYEA 1N1GA 5G0WA 1PS8A 3K6JA 2O23A 3LDHA 4RV9A 4W4TA 3FNFA 3I23A 3LLSA 3NV9A 3RSHA 1LLDA 2J3JA 2VZ0A 4ZD6A 3VTFA 4BKQA 1VM6A 2UDPA 3FF4A 3P19A 4MKRA 3RCBA 5TIIA 3INTA 1Q0LA 1RWBA 2OBNA 3JD0A 1E92A 4NK5A 5FF9A 4OAQA 3ULKA 3KRTA 1T2EA 3TJRA 2C7VA 5F1KA 4F45A 2ZCUA 4A0SA 3L0DA 4HBGA 2AE1A 4G65A 3I9OA 3Q6IA 3ASVA 4NZ9A 1NQTA 2VZ8A 1XDWA 1XHLA 4BNLA 3UKOA 3X2FA 4BGEA 1VRWA 4FFOA 1XEAA 4MVJE 1LDYA 3GAZA 3L4BA 4WLOA 2J3KA 1L1FA 3GMDA 1EBUA 3IAHA 3LZ6A 3PLRA 4MVJG 2BFPA 4NBRA 4UULA 1QLHA 5KWEA 3JQ8A 1P31A 2IDZA 4K6CA 2I3AA 2YQ5A 3PHGA 1C1DB 3QWHA 3TSCA 2JD1A 4ONEA 5LDGA 3V1TC 1WAMA 4GX0A 3DMYA 4PLCA 4UVDA 3Q3CA 2G1UA 4OOEA 1YBAA 1YRLA 3JYLA 1JAXA 1SBYA 2F00A 3ANNA 3C1TA 1GEGA 1FDSA 1U3WA 2NWQA 2YV1A 3FCOA 3PWSA 5TS3A 4R41A 3AOEA 3WGQA 5L4SA 3RU7A 4BO8A 2C0CA 5A04A 1X13A 4DIFA 3O38A 4NBVA 3RFXA 1KY5A 4MVJA 4HP8A 5A1TA 1DC5A 3NGXA 4AJ2A 4R1TA 1HDRA 2Q4BA 1ZEJA 3I4FA 1I24A 3DBLA 3PGJA 2NSDA 2GGSA 2ZYAA 4GGPA 1JQBA 2UYYA 4J9UE 3VDQA 1PZGA 3KSUA 1NNUA 4XQGA 2ZK7A 2PLAA 4MKZA 3GDFA 3CPSA 4J7XA 2O2YA 3EZLA 1ZNQO 3M2TA 4RCVA 4CQLB 2OP0A 2NUAA 5CEEA 3SVTA 3FR8A 2HK9A 4XQCA 1WWKA 3CSDA 2O7QA 3EW7A 4CMEC 4L0QA 4P22A 2X9VA 1RM0A 3W8EA 5JYDA 1CF2O 4MIYA 2ZJ0A 3FNGA 2JHGA 1E3IA 2WWRA 2Z1MA 4S1VA 4AJPA 1QYXA 4BIIA 4A5OA 4BQPA 1P0FA 4BNJA 4BNMA 2YW9A 4FSHA 5JCJA 3NTRA 3ZNNA 4BO3A 5KKCA 4E21A 2VWHA 2E48A 3INRA 4KOAA 4CM9D 1UZLA 5I7SA 3WR5A 1ZEMA 2V6MA 4IPTA 8ADHA 2O3RA 4DTIA 2ZB3A 3ZWOA 3JYOA 2X0IA 3K2BA 4FGWA 1JN0A 2VYNA 4IDBA 3AY6A 4ZQFA 2D1YA 2AQHA 1U4OA 4ZN6A 1P1HA 1DOHA 3O26A 1LLCA 3RC9A 1YQXA 2PKQP 2E49A 3EMKA 4BKUA 2NLOA 3E9MA 3QRWA 2JHFA 1E3WA 3ZI0A 3WJ7A 4DMLA 2JAHA 1P44A 2C29D 3ZU3A 5EJ2A 3GNSA 4E2WA 4MDHA 2AMFA 3RD5A 1LRJA 5IAAA 4QSMA 3ZNQA 3D5QA 3GEDA 4NHEA 1ULSA 2E4AA 3AJRA 3VH1A 4E12A 1ZMTA 1O89A 2EERA 2TMGA 4J0EA 1ZMOA 4H16A 3AFNA 5T8KA 3RC7A 3Q2IA 4D44A 3GGOA 1GR0A 2Q2WA 2UUPA 3I9MA 3PXXA 1D1TA 2VHXA 4BMNA 1HDOA 2O3UA 4QQRA 3LYLA 5HWSA 3FNEA 1CETA 4R4JA 2D5AA 4N54A 3C3XA 4CV0A 1H6AA 2O50A 3BHIA 4I5EA 2ZB4A 5DP2A 4NBWA 5K6AA 2DBRA 2WMDA 3GPDG 1PJQA 3RBXA 1QG6A 1S6YA 4OYRA 2ZIZA 3V2GA 1NR1A 3W4IA 5CPBA 2HLPA 1TVEA 1NBOA 1YOVA 5BNFA 2PNFA 1R0SA 1SCUA 5L51A 5GZ1A 2GN6A 3JD4A 2JFFA 3JQAA 3JYQA 1K3TA 4F3YA 5BSEA 3ZWAA 3DAPA 4NH4A 2ZYDA 5ILOA 4GWGA 3ENNA 4PLFA 5IDXA 4OKNA 3ROPA 4TKLA 1G0NA 5JS6A 1M75A 1E1NA 2CY0A 3PJFA 3BMQA 3UGKA 1T2AA 4BNKA 2AE2A 1ENOA 2UV8A 4J9VA 5CEFA 3IL2A 3WBFA 3OQBA 3P5SA 3OJEA 4OQZA 1SB8A 1PQWA 4IS3A 1VJ0A 5CG1A 4TWRA 2GRAA 4MPDA 5CDYA 1K0UA 1DC3A 2VHYA 3IDSA 3MZ0A 4BMSA 3D4PA 3I1JA 1DLJA 4QO7A 4CQLA 2YV2A 4Q3BA 4J1QA 4XYBA 3W4JA 1MXFA 1DLIA 1OI7A 2EKPA 1U8FO 3GF4A 3TRIA 2JFGA 2B37A 2BGLA 1MP0A 1HXHA 3RASA 1LDGA 5KJEA 1HF3A 4BHTA 1T2FA 4OM8A 5B4VA 5HM8A 3E48A 3ONEA 4PGFA 1PZHA 1E0DA 1EFKA 4L4XA 5JLAA 1BWSA 3CKYA 2FR8A 5GY7A 5JCJD 2IE0A 2J3IA 3OETA 2WD7B 3E6AA 4CR8A 2DTDA 1GCOA 2QZZA 2EP5A 1WXDA 1IZ0A 1G1AA 2QYTA 2DUUA 1KETA 1MC4A 2OUIA 3VC7A 1YL7A 2X6TA 4ALIA 3RU9A 1T1SA 2DM6A 5IG2A 4WLUA 4ZVVA 1HWYA 1UXHA 4R9RA 1EQUA 1I3NA 2DBQA 2Y1CA 3S55A 1H94A 3DMTA 3NDJA 3P2OA 4WGGA 5FI5A 4YXFA 2RHRA 2Q4EA 5ADHA 1YS4A 1PJLA 1FJHA 2GR9A 2UVDA 3DTTA 4MP8A 2XXBA 1UDAA 4YYZA 1EE2A 2NADA 4WEQA 2C7GA 1KBZA 3C85A 2VHWA 3S1LA 4B3HA 4DIOA 3AW9A 2YFHA 3JD3A 4ALLA 2YYYA 3I83A 4BKPA 4HNGA 5KTKA 4G2NA 5F3RA 3MOGA 5U1PA 1WMAA 2Q1SA 4XD2A 4MINA 2WYUA 1DRWA 2W2LD 1F17A 3KXDA 4K26A 3DQPA 2VHVA 3VH2A 3DXFA 1HZZA 3KYCA 4JK3A 1KEPA 4XJSA 4XGIA 1Z73A 4Y98A 3GPIA 4FD3A 2PD4A 3HWRA 3H65A 3PLNA 3FR7A 2R6JA 4W9NC 4CL8A 2EJWA 4W82A 1A4IA 3WBBA 3TNLA 2BFAA 1PWXA 3AI2A 5CDSA 4HNHA 4KZPA 3WMXA 2W90A 2A4KA 2QRLA 3JCZA 3VPXA 3LT2A 5L95A 2GNAA 1YBVA 1YO6A 2O7SA 3AM4A 1C0IA 3TZKA 1NHWA 1ZXLA 2BGMA 5JAMA 2ZB7A 1DJQA 2HU2A 3C8MA 3ZW8A 2NTNA 2EW8A 2Q45A 4C7KA 3WQQA 4ZQHA 4A26A 1ONOA 2A9FA 4CL3A 3KETA 4N5MA 1K6JA 3KYCB 4XYLA 2QHXA 1PQUA 1YQGA 3U0BA 1ARZA 1IUKA 2E37A 3BMOB 5ER6A 3LC2O 4WECA 4CLHA 2VUUA 4CMAA 4F6LA 1XU9A 5L9AA 4BNWA 3FTNA 4M49A 4DPMA 4XA8A 3MTGA 1T25A 4EITA 3FTPA 1J5PA 3S8MA 5KVVA 4DWVA 2NACA 3KYBA 4RDHA 3H9JA 3GMSA 2G17A 4FPXA 1T1RA 5BT9A 3V2UA 4B3IA 3WWYA 5HTOA 1O94A 1IZ9A 4UVGA 3E8XA 1R6DA 4W7HA 1E5QA 4CQMB 4HXYA 3H4VA 1V3VA 1MUUA 4Y6RA 1Z75A 4RVUA 2YFQA 2OXIA 4I1IA 3OQ1A 1I32A 4E33A 1ML3A 2O48X 4NFHA 4YJHA 3ETDA 4Q3CA 1ENPA 2JD0A 5KNLA 4NR0A 1QKIA 3DOCA 1SO8A 1OFGA 2G5CA 3ZU4A 2GPTA 4B7UA 2O3SA 4BOYA 3R1IA 2CZCA 2Q3EA 4MKXA 4B8WA 4R5HA 2A92A 3JQFA 4O59O 1UAGA 4YWJA 3S2GA 1WDMA 3SJ7A 2CMDA 1KVQA 2VUTA 3QP9A 2X0NA 3B20A 4EJMA 2QRJA 1FDWA 3X2EA 3RBZA 5EL0A 1QV7A 3VZSA 1UP4A 1ZH8A 2FMUA 3L6DA 2EWMA 4W6ZA 1R12A 3CH6A 4E31A 1HE5A 1XWFA 1PJ2A 1GL3A 2D8AA 1N92A 5I7VA 2A94A 4YBZA 1NFRA 4M86A 2V6GA 4GX1A 3LU1A 4WKGA 3JQ7A 4XGNA 1DDOA 4GSKA 3G49A 2OZPA 5L7YA 5IN5A 1UXJA 2P5YA 3SLKA 1Y1PA 5KIAA 1EQ2A 3DHEA 3VKVA 1AXGA 1U4SA 2NU7A 2ZKLA 2QG4A 3GG2A 3I5MA 4PLPA 3FBTA 3BMCA 3IS3A 3JQCA 1PZEA 4DIBA 4R3WA 2H1SA 4IBOA 4A73A 4RPGA 2C2YA 4FIZA 4B4WA 4L74A 4BNYA 4GMFA 1QLJA 2YHUA 1EMDA 2PD6A 4KUEA 4XCVA 3GGPA 5I7FA 4RF3A 1MC5A 5FFFA 3E18A 4CM9A 4YJGB 4RLSA 3HUDA 1IHXA 2OGUA 1NAIA 4AJLA 1SAYA 2CSUA 1HDYA
chains in the Genus database with same CATH superfamily
4XCXA 1QJCA 1IMJA 4LCJA 1HK7A 2A0UA 4Y2YA 1LLQA 3TIXB 3FSRA 3VDNB 3SC6A 4EG3A 3V4VB 4HDRA 2FMFA 2IZ7A 2XMSA 1AGRA 1OU0A 3HDGA 4ND1A 3W90A 3UMJA 2P30A 3N0RA 1N8TA 5TARA 4XPZA 1GZHB 3F7TA 3WMEA 3KL2A 1L7EA 4U9IS 4QZVA 1IPFA 1SFRA 3HCWA 2QX8A 4OFBA 4ZVQA 2ZSHA 3QNUA 4XVRA 3Q7SA 1CC1S 1W1UA 1Z4NA 4MK4A 3A1UA 4FNMA 4JLDA 5HMMA 4F2PA 5LJLA 2I6FA 1MRNA 1ZKDA 2R9VA 2X5XA 2YHIA 4MR8A 3OMLA 5KTTA 3RYCA 4US1R 1N57A 1A9TA 1ODJA 5KNDA 4ZAGA 4WK4B 1AZTA 2H4ZA 2NIPA 2WVAA 1UOOA 3MQFA 2IGTA 1XTQA 2QNRA 4DV3B 5DT2A 1KA9H 4OSOA 1KJ8A 1PWZA 1ORRA 5BUSA 3FNQA 3UJNA 1JDNA 5EMKA 3C1OA 4MR7B 4WA7A 2J5QA 3HV0A 4HDMB 3EIHA 5EKTA 3UFBA 3BXEA 3N87A 2HA2A 4B8ZA 4G1VA 4PLYA 2AFHA 4NJMA 3ZWVA 4G0YA 4A0RA 2NVOA 5BOSB 1U2GA 2WHYA 5JLJA 5KTPA 5CVTA 4ZCQA 5D00A 4BO2A 4BIMA 2EG5A 2HXSA 3IBSA 2DQ4A 1FSSA 3D8HA 4BGVA 3DV0A 1A98A 5DLPA 2P7IA 4CKBB 4MHTA 1JG3A 5I9MA 1JEAA 1SUBA 1VHQA 3PJDA 3SOPA 3OIVA 4L4ZA 1MH9A 2BD0A 1G2PA 2EKLA 2EZ8A 2OO5A 3E2MA 4I4TA 4R31A 5D3QA 1NVEA 4CQMD 4OGGA 1NG1A 3GLGE 2DFVA 1F1JA 3TBFA 4GL2A 5CIQA 3ZZ1A 2LDBA 1SZDA 1J22A 1WUHS 3CB2A 3IUMA 1LF0A 3OPNA 3ONDA 2Q28A 4ZA2A 5ESRA 1J8MF 3PIIA 1DC7A 1TT7A 3RHSA 3ZDEA 2ZZNA 1GQQA 4OK3A 2YZ7A 2WV7A 4BNFA 4I1RA 4OHBA 5E9QA 3SXJA 4ZZ1A 4BV2A 5G41A 5JHGB 1L3BA 4ETWA 1Q0QA 4LQLA 2P6UA 4Y2JA 4ZI7A 4Z2AA 2H1RA 2VF7A 3ITNA 3M2PA 4JJ4A 3F5DA 4KACA 2KLHA 3U3XA 4IV8A 3JW8A 1H2YA 2UVPB 2HIAA 1VLQA 3PGVA 2J32A 4DLAA 4ERXA 1P4RA 1R10A 1XL0A 3IAEA 1NQOA 1C2TA 1XZMA 2A30A 2GD6A 4OSPA 4K6OA 4EJ0A 5IEJA 3QVGB 2YWBA 5JR3A 1RAEA 4P6VF 4C07A 1EDBA 1XMVA 2B36A 5BQFA 3T3OA 4BX9A 1E7YA 3TH5A 4YQYA 3HU1A 1TOAA 4A1OA 4NXNB 1BWRA 4G84A 3KEOA 4P0QB 2KI5A 3QV2A 1SQ5A 1VL8A 1OVMA 2HK7A 1IVSA 3ZHQA 4B3FX 2IU3A 1O6FA 2J0EA 3EN0A 3VZPA 1SUEA 2REQA 4TSFA 1ZK4A 3WISA 5BW4A 3ZI4A 5JE8A 3QU9A 1V5FA 2G82A 1H3FA 1F1BA 2A0WA 2J31A 3LKVA 3K0BA 4OU5A 3RC3A 4ZK2A 2VDUE 5KVQA 4I99A 3VHXA 4BFWA 2ZYUX 1J6UA 4J90A 2HQBA 4NU8X 2V65A 3RLFA 4KIFA 1F0PA 4A9AA 1IN8A 3NFRA 4M0MA 3RUPA 3TOXA 2X5OA 1N4AA 1U0NA 2UYCA 1B8VA 10MHA 4MYCA 4KPUA 4CQJA 1GPJA 5AI0A 1PNTA 3DL2A 4R7TA 5C8DA 3D1JA 2G5GX 1KSFX 1V41E 2D1FA 3LWBA 3N7AA 2Q6KA 2FH5B 4OXQA 3UXYA 1CNFA 1E5VA 1O1YA 1UF9A 5G02A 2J48A 2H7YA 1TA0A 2MSEB 2B2NA 3BVPA 3KD2A 3KLBA 3PJGA 4Q9IA 3RJ5A 1Z2OX 1LJ8A 3SR0A 1C1HA 3ZLVA 1P7PA 4QDJA 2CK3D 1KQPA 2DSNA 2OQIA 1QOPB 2A5JA 2NUBA 4AM8A 2W6OA 1H9AA 3ZGZA 2YBEA 3V33A 5KWJA 3QA9A 4EY5A 8OHMA 5KO2A 1DMSA 3LOPA 2BGNA 1RLMA 4WBNF 4HL6A 1PWEA 2CV0A 3KJNA 3R6GA 3RIHA 3UGQA 5A3SA 1WCIA 3EGWA 2B9EA 2W43A 5AOCA 1GYRA 4U5XA 4JLNA 4D0LB 4NH0A 1I2BA 3CRQA 3I6ZA 2QUZA 3QFCA 2C04A 2OFXA 2W5UA 2HNKA 1AV6A 1W0CA 3B1XA 1ADGA 4XARA 3SJUA 4BNIA 4D3FA 4JYZA 3OIUA 4QXAA 2CD9A 4NATA 4AF8A 1H5QA 3PHLA 3AJ8A 3S5JA 5DO9A 2OILA 3AHHA 4MVJD 1GQOA 3AY0A 4GP6A 3B2QA 4XUCA 1JR3D 4YRIA 1B8OA 1B14A 1DUSA 2ZPTX 2GAOA 3EDMA 2ZWVA 3HFSA 2ZU0C 4H1UA 1EE9A 1NTRA 5BQ3A 1BH2A 2XDQA 2HA7A 4RO0A 2ODEA 4CRWB 5AKJA 5IBCA 2H2DA 2D5IA 3G7NA 3PHJA 2HF2A 2X8JA 4KUHA 3THXB 3ND9A 2OTCA 2CKDA 2ZR7A 4IEEA 3RFVA 5JAIA 4FGKA 2V7QA 4TVBA 1UOPA 1ZD1A 3UTDA 1V0JA 1XZKA 4YY3B 4JB0A 2V9PA 3OX1A 3ZBPA 1P17A 1T6YA 5LIRA 2CZQA 1M1NB 3CF6R 5AW1A 3I52A 4GZ5A 4IGFA 3WL4A 1QHYA 3NXKA 1CJVC 1L5KA 3MWJA 2DTEA 1J1UA 3ETEA 2Z30A 5LMCA 3LHDA 1WDLA 5F7OA 2BDEA 1T1JA 2PH1A 3CRMA 1G20E 4JP2A 4B4VA 1E5TA 1I0LA 4GDMA 4RFSA 1FP2A 3AR5A 3GOHA 1DG3A 1YUMA 4JMPA 3L8DA 1OXUA 3C3MA 3F1LA 4ZRNA 2BKAA 1T5DX 1XCMA 2OL4A 1TCUA 3PFGA 2RK4A 4DLUA 4XD7A 5BN3A 3VOSA 5A3QA 3EOAI 3IV6A 5GPBA 1CHDA 2OXEA 4RPHA 1JTFA 3WLQA 3WXBA 5TMBA 4YUVA 1A5SB 3HEBA 3OMWA 1FPMA 1KPGA 3KZXA 1DXYA 3JVUA 4HG2A 5EJFA 1DJNA 2CUZA 2JCGA 3IESA 3G8DA 4JJ8A 2F9LA 2OGZA 2YNMA 3FGOA 5DBGA 2P2ZA 5F4ZA 4O29A 4HGRA 4DJTA 3IJRA 1ZQ1A 2IYXA 1G17A 2P62A 1ZRNA 4ATNA 1OBOA 4LHVA 4LSZA 1A9ZA 4OHFA 1WP4A 1PIWA 5KYWB 4W5TA 1BFUA 3KUCA 4PCVA 2HWXA 1MGOA 5IMBA 1LPAB 1LZKA 2JATA 4Z0HO 1TO1E 3PGLA 4Z9BA 4WVLA 3GLFE 2ZU6A 2BMDA 3CLUD 3W0LB 4WJLA 3T7EA 3R5TA 3OAAA 4XIFA 4OHMA 5TC4A 2F8TA 2I3DA 4A2CA 4P3XA 4R98A 4EW1A 3PQDA 4BNHA 1ETHA 2K5UA 2MSNA 1NWCA 2H4HA 2ATEA 2IZ5A 2OHJA 4MW4A 3SKXA 2YVUA 5AW4A 2C1ZA 3MTAA 1JDTA 4I66A 4C1NA 2HHHB 3B5EA 2EKBA 1NUHA 2GZ1A 3FB4A 2V6FA 1MV8A 4A8JB 3T4XA 3G2IA 1W4AA 4JJIA 2O5EA 4X1KA 1KP3A 3K96A 3VZBA 4CG2A 2L17A 1OW3B 1TJ3A 3LPLA 3PC7A 1RLTA 3MD0A 5A02A 3SIRA 4TV9B 4Z0TA 3SGLA 1OX4A 4F8JA 1C0LA 2VAXA 3GDHA 4AIIA 1JG6A 2YMQA 4AO6A 1C50A 1TTQB 3U1VA 1V43A 4P1ZA 1QH0A 2XWPA 4M36A 2YXDA 2GZDA 3ZEIA 2H1LA 4EBFA 4F2HA 5JSFA 2IJGX 1LVUA 1ID8A 4J0KA 3TRHA 3FIUA 3V2IA 3F5SA 3HH8A 2FDXA 4R1UA 4TGLA 5CNIA 2VPIA 3MLAA 5A6SA 1JTVA 5G0TA 2G67A 4EYKA 5B64A 5BP7A 1I8TA 3AU9A 3T5CA 1ZD4A 3JQ7B 2QPOA 4OY3A 5J4YA 3GQVA 4X1YA 5CGZA 2OCGA 1Y1QA 2R6FA 3CF0A 4P4NA 3KFVA 1GWNA 5EXTA 3TXYA 2PBRA 3SIPA 3D6HA 1ZJJA 2OVBA 3ILYA 4D74A 3BQNB 3QHPA 4ZO6A 5L3ZA 4ZVOA 3QE3A 4M1QA 3UB3A 1F2VA 2A9RA 5HG0A 4OX9B 1JFLA 4XGQA 4AX8A 4CF3A 3E3LA 5LIPA 3F6SA 5IANA 5IAJA 5HS6A 4FZ5A 1JJFA 1C0EA 2AC7A 2GK7A 2JJ2D 2ZROA 3B1YA 4TLLB 5GV7A 2DFKB 3G2KA 4U0JA 3PGA1 3DT6A 1P5JA 4ZHQB 2FR8C 2PWAA 1QH8A 1Z0JA 1YUBA 2PN1A 3ETHA 4PICA 4RYLA 4X6YA 1WSDA 5LQSA 4DG8A 5JZMA 3PQ8A 2PQ0A 3DE5X 1KYYA 4PLGA 5CX4A 5KINB 3DM5A 4X20B 4PZLA 4Q34A 1FX0A 1DDIA 2IY9A 2DECA 1NDQA 2XTJA 3WGMA 1P8AA 4NZYA 4FYWA 4I19A 1W4CA 1ZN7A 3VR5D 3TG8A 2WPDA 1NF2A 2QTBA 4PPGA 1V11B 1Z13A 3AF3A 1RXWA 1PK9A 4F46A 3ND5A 3IOEA 1ZD3A 5FNVA 4TRNA 3S6JA 4CODB 4DPLA 2UZ1A 2X9NA 2ZOSA 1TU3A 2JL1A 3T61A 3ROMA 5JBIA 3L93A 3B2EA 3NBYC 5ALNA 1JU4A 2RI0A 1EUCA 2C83A 1OYVA 4A8PA 3BS4A 3RV4A 1RIFA 3IXLA 1N5MA 4A23A 2YKGA 1U94A 1Z6YA 2DKNA 2XQGA 3EFOA 4RWZA 1EFPB 2XW6A 3RBVA 4BQRA 1Z08A 4IDDA 5T4BA 1CULC 3BIWA 4MNTA 2ACWA 4OQYA 9MHTA 1QGZA 1NKSA 3ESQA 3LUCA 4KXQA 2AJ8A 3EXHB 1CR0A 1FRNA 4NFLA 1Y9ZA 4M99A 3F3SA 1R3UA 4ETIA 2P27A 3BRWA 1G4HA 1M66A 2XWSA 4OQQA 3B3FA 3R5KA 1K6XA 3L0OA 1ULUA 5DWVA 4JIMA 3CS3A 3G8YA 3JYHA 3W6UA 4D56A 4YREA 4FFLA 4DNQA 9ABPA 2WQZA 1CKEA 1RHQA 2HDWA 1NXOA 1RMYA 3UYLA 1Y7LA 3RSSA 1JLLA 4E22A 1Y3CE 3LLUA 2CVOA 3GLKA 2FRDA 3LXXA 3P96A 2DPYA 4QIHA 5DMXA 3WQSB 3NALA 3U7QB 2QIPA 1NFQA 3R09A 3TE7A 4XOIA 2HFKA 2C98A 1AVTA 4R81A 1E4VA 4ZVKA 1IN4A 1RJEA 2ECOA 4PWZA 2O3QA 3ZL9A 2H52A 1SIOA 4HXEB 4TRMA 1YB7A 1FC0A 3HU3A 4CR7A 3QX8A 3OLWA 4KYTA 2WU1A 4MVJP 2J45A 1E64A 4LYFA 5IF9A 1EFVA 2FSHA 1N4DA 4EZIA 3H99A 3MNFA 3ZDCA 2A9VA 3MCUA 4H3VA 3UGTA 1F8UA 2J9FB 1DI0A 4LC1A 1PO7A 3D2LA 3K6SA 1N5KA 3CCCA 3COSA 3QSGA 4QOGA 1I6MA 7REQB 2KHZA 1RPJA 3EXHC 1G6KA 4YCLA 5BUCA 1MRZA 3BQMB 4LJKA 1PDOA 1RKBA 3E70C 4LJ4A 1YZNA 4TTVA 3LT1A 5CDFA 1NNI1 4M46A 4CMJA 1HDIA 1J8VA 2I8CA 5E7IA 4C2AA 4R3UC 1LC3A 1Q84A 3IMKA 5C8YB 3L4JA 2UZ4A 5AVTA 4URUR 1I3OA 1C81A 1N3LA 2VXBA 5JC8A 1G63A 2BR5A 4RELA 1QP8A 2CHFA 4MGHA 4G6ZA 1XCPA 3E23A 3PUYA 4YAFA 5K5EA 4FYXA 3MB8A 1U9ZA 1P45A 4TT3D 5SICE 4CMEA 4TWIA 4YT2A 2IXDA 1MV5A 4Q93A 4D96A 1T36B 3EIFA 2ORED 3WKDA 4YPFA 3ZG6A 4FFWA 4YTEA 2QBYA 3G9XA 4M1OA 3IP9A 4JDPA 4O1IA 1BYUA 4C87A 4ZMRA 3WK9A 1CQPA 1T4DA 3SYTA 1BJKA 1XA4A 1BD3A 4FWIB 4WKPA 1VHJA 2EATA 3SC3A 4YI5A 3OZDA 3L2OB 3FMVA 4UQPA 4ALMA 2QMYA 2FZVA 3SNKA 4WASA 5ENZA 3OM1A 3I30X 3M5WA 4NU0A 1FOEB 4P7GA 3RIEA 2C2MA 3RYHA 1O3YA 1BDIA 1S8OA 1S96A 1SC6A 1H2RS 1NJSA 5G0UA 5LCXA 1ML4A 3RS3A 1WZCA 3EIQA 3I2HA 2CBGA 4L72A 4BMPB 2BTOA 1DOAA 2H1HA 4PNPA 3ICCA 3EMVA 3HBAA 4QXMA 5FPHA 3RRXA 3WHPA 4BO0A 3TIIA 3UYKA 4LRSB 1LBQA 3IP6A 1NVUQ 3CN7A 3BZWA 2B4AA 4H1WA 5EIXA 2VSNA 2YX1A 3HBJA 4IKOA 1L7RA 1NVMB 3WZMA 4Q9NA 1UC9A 5EJ8A 4GVPA 4P2BA 1M6VA 1CQWA 3HB9A 5EHXA 2DB3A 3N74A 1I2AA 3MK31 4GEKA 5AK6A 1C3VA 2PPLA 5FFNA 3SEQA 1T8TA 3RS2A 1ULTA 2FOIA 3DE3X 1E2HA 4G3XA 4Y6PA 4DV4B 1TM1E 4FFSA 1QUFA 2JDIA 3GRPA 5LP6B 2ERYA 1PDWA 2OE2A 2GARA 4FI3F 3F7NA 4MLCA 4TYYA 1DRJA 1YCGA 2VLIA 2NSHA 3N2YA 3NJ4A 1JMYA 1S8FA 2OBYA 2EXXA 4LYDA 1LTHR 1CERA 2C1XA 3CX7A 3PRYA 1H6CA 3DPIA 2FEWB 1K88A 3EWAA 5E2AA 1JIUA 2G0AA 2IDKA 3I9JA 2DUMA 5CCEA 4N82A 1GPKA 4WT7A 1QCCA 4LFBB 3K1JA 4MVCA 4HGQA 4JYPA 4BFVA 2OZLB 3DW3X 3H4TA 3HDVA 2YW2A 3OP4A 3ZD8A 2ZW9A 2WE8A 4HQ0A 2IYRA 3DOEA 4PY2A 2F55A 1OZ0A 2VZEA 1M34E 2O1WA 2Q2NA 1NMXA 5C37A 2F9MA 3OU7A 3B6JA 1FFXA 2CUNA 2GJ4A 4C0KA 4X3CA 4YQZA 1XJ5A 3C1AA 4BZXA 2HA5A 1G5QA 1CZNA 1Y89A 2WYOA 3G79A 3PVSA 3T5MA 3T95A 1NW4A 3KQUA 3V4RA 2KW5A 3ECSA 4Q16A 4YEDA 2NXWA 2XOKD 4ZANA 2IYLD 1XU7A 1ZUD1 2XGOA 3F7MA 3G8BA 4UTZA 5D5QA 4C5CA 1KY2A 2H85A 2OFOA 3AG6A 4JGGA 4YRKA 3IO5A 4J49A 3NQ41 2OZEA 3BE8A 4O2LA 1KYWA 3EYAA 5E38A 3U37A 1GLGA 1XQ6A 2G0TA 1KK2A 5LMZA 2JIZD 4G63A 1P4GA 3ELWA 2WSSD 2AD1A 2JFNA 4J4HA 2AK3A 4UMVA 3SZUA 4E4TA 1RJFA 4P4LA 3H7AA 3ZHOA 3SFVA 2F8SA 3WSVA 2AIRA 3I3SR 3CIOA 5HZKA 2C2BA 4B8WA 1G60A 3PD1A 3VC1A 4B6EA 2G71A 4G5XA 2PBLA 2VYVD 3MJRA 3MERA 4ZGGA 4FKMA 1NMYA 4AJNA 1PP4A 1G1MA 1XELA 2RGNA 4BTEA 1NUQA 2VSXA 9LDBA 2BEUA 4Y2HA 3TXAA 2IFTA 3V6MA 1RQLA 1Q0TA 2GYVA 4EJ2A 3MS4A 3TLAA 3EX7C 4RK4A 4Y1FA 2O0KA 4YCCA 4JVSB 3L8YA 3TN7A 3QNWA 4TWZA 2HBYA 5B58C 3NHFA 4J4TA 2A33A 2QN3A 4NBNA 4RZSA 5FR1A 1UPFA 1OLSA 2DAPA 4I0WB 4DSTA 4Q1EA 4N1AA 3NCTA 5GM2A 4DUGD 5L6MB 5I5EA 2Z5LA 1HTTA 4GLJA 3PQEA 4EMBA 4OMCA 3U4GA 3OM0A 1I5OA 1P7VA 2VWPA 2H3HA 3QELA 3V2HA 1S5PA 4NK4A 1D1SA 3NIBA 4KZKA 5FOQA 3CXRA 4L27A 4FILA 1NV9A 2R85A 3K6KA 3BIFA 2YASA 3REQA 3FPSA 1MX3A 2NV6A 3UUGA 1TUGA 1SA0B 2NZJA 4TWBA 5JCOA 1NJ2A 2JJ2A 4B35A 3GLHA 2IF2A 2OESA 4X65B 2I2CA 3V46A 1Q57A 3TW4A 1WIWA 3EUWA 2W4QA 3I2KA 1ZRSA 4OQ4A 2A78A 2O9JA 3MG9A 3BMQB 4IDPA 4K9PA 1VLVA 3WLKX 1RKXA 3AM3A 3ZV4A 2CNLA 1VA4A 3FNIA 1WKCA 1G2QA 3DMNA 3K0HA 4LYHA 3GR6A 1U2TA 4ZQBA 1JB1A 5A7HA 3TZCA 5D7NA 2F48A 1ZBDA 2NSYA 3F6EX 3ICEA 1PL8A 3WO0A 1C0KA 1Y1SA 3DE1X 2IVZA 3NYIA 4CDMA 2DERA 2UZ3A 5LLDA 2WPDD 4URFA 1QIHA 3AKEA 4GRDA 4KRYA 2PPVA 3ROTA 4ZOEA 2GZMA 3LXMA 4CF4A 1ITZA 3EE6A 2J6CA 1ENYA 5K0TA 3OC0A 1Y81A 2PKWA 2XUKA 3W9UA 4XGKA 1ORWA 3TXXA 2DYKA 1MOSA 1D2GA 2W2KA 3EWNA 5ARBA 4JQSA 1XZNA 1TMOA 1A2BA 1JP7A 1PEKE 3BOSA 4ZAZA 2GZ3A 2VJDA 3QLEA 2WD7A 1QM5A 2ZVDA 3G23A 3HG7A 5ALEA 1KRWA 2JIPA 2EEPA 3RTEA 3T3MB 2CMHA 3KUKA 3LRTA 1A8UA 1VFNA 2Z95A 1YJ8A 5KTRA 1PFQA 4ML3A 2D5BA 3BHMA 1JHAA 1L7BA 2AOUB 2C9OA 3E61A 4LEIA 4WXYB 5B2ZA 5TNXA 1P19A 2IEIA 4DADA 5FAKA 3DOIA 3ENVA 1PI3A 3M3PA 3DB1A 1Z6PA 1UBHS 2ZULA 1I51A 3CFYA 3E3AA 3GFPA 1GUFA 1HYEA 1U8UA 1RM4A 1Z68A 3LCRA 3HPRA 4YRLA 2WSLA 1FQJA 2GA9A 4AZ0B 2E89A 5JSUA 1EUQA 5DNCA 2C92A 4YONB 4AUEA 3AT1A 3EA4A 1ADBA 3NHMA 5H0IA 1DWOA 5C5EA 4KFCA 3DV9A 3EFEA 4ON9A 5JJLA 3M5PA 2WNSA 3B6MA 1HOXA 1D8AA 1QF9A 2RJ3A 5C7YA 1D5CA 4OXNA 2WT9A 3VSAA 3PC8C 1XPRA 1HSOA 5FB3A 4C0HA 1QC5A 5LSAA 1CP2A 2QM8A 1JHMA 4MR9B 3WYBA 4WE3A 4M9QA 1PD1A 5AKZA 3QLTA 1BS1A 3B36A 1N5OX 1VXRA 5EZ6B 2PV0A 2VK2A 2P91A 3T3IA 3SEFA 3UK0A 2PX2A 1T2NA 5DOVA 4KFSA 1IQUA 2QN2A 4H15A 3SJZA 1NUSA 3LC1O 5JS8A 1QHEA 4OXRA 2D5CA 2BSXA 2VFAA 5F7XA 1ZNXA 2XYGA 4NJEB 4RAOA 1XCBA 4ZC8A 2C4MA 4PRYA 3D2CA 3K0FB 2ZWIA 3R7BA 1AQJA 2QTWB 4KQIA 3U4HA 3KBOA 3KX2A 3NS7A 3A3NA 4FN4A 2WINI 4U1RA 3RJ9A 3W78A 1E2EA 3WYGA 1H5NA 2P5UA 2A14A 3EZXA 5CLFA 1NLFA 2QRGA 2QD2A 5BMVF 2RAVA 1JFTA 3NRCA 3VNQA 3MGAA 3OTOB 4O0LA 2WTNA 1SU6A 2DPMA 2PAFA 1FLNA 1YBMA 4II2A 3N58A 3WKEA 3H84A 2J5BA 5BN3B 3L7OA 1M6WA 2WIAA 1QZZA 1PEDA 2BFOA 3R0XA 5T67A 1TZ2A 4PX2A 5JTUA 3KQSA 3DUWA 1FFCA 1KDOA 1RQRA 1XNRB 2PXCA 5LLTA 2IEBA 3HDYA 3M4JA 4G89A 2DSTA 3ZN2A 1KBOA 1AO3A 4GI1A 4O4LA 1KFJB 5I3ZA 1L5MA 2CSXA 5KMGB 2OK7A 3OIWA 1LLUA 1QONA 1QV6A 1S1CA 1VJ5A 3K6SB 2ZAGA 1ZH6A 3BD7A 4MWSA 4MAFA 2QX6A 5JADA 2BYTA 5KU7A 3IKLA 2ZSEA 3URKA 2I78A 4DAEA 2OV2A 2JLSA 5J4LA 3H18A 4QDZA 2ORWA 1Z0IA 4ERNA 3WJAA 4XWTA 3MOSA 4UUBA 1WXIA 4X7MA 3IEUA 1M10A 1NZFA 2A9JA 4AZ3A 4RTJA 2D3WA 4NOJA 5EKDA 1HI9A 2AYXA 1RWXA 2A1TR 4IIBA 2C9MA 3DCNA 3ESYA 4ZT3A 1Y7IA 4UHJA 4BL5A 2PZKA 5KHLB 1CYDA 4KQ1A 4Y1GA 1GG2A 4PXAA 1T9DA 4JEMA 1TECE 1GQRA 4XDHA 5MF6A 1R37A 2W6CX 4HRAA 2BEVA 4ZV7A 1PR4A 2F62A 2JPDA 5LA6A 1TI7A 3A4IA 2JI8A 2R8YA 1KAMA 1P5RA 4J2HA 5IC6A 3SQMA 3BL5A 3D4LA 5IF3A 4H6XA 3URMA 4N8SA 3FD8A 3ZK7A 3BILA 3IEPA 3PX2A 2IHYA 3UO8B 4K88A 1C8VB 1E61A 2QJRA 4UM5A 3SLRA 4BGIA 4AAYA 3D2BA 4KDCA 2HRRA 4E5KA 5DHRA 2EL7A 2GCOA 4A7PA 5CFPA 3O75A 3QKRA 4J0GA 4KBGA 4TL9A 1BKYA 4R2WA 4TT3A 4ZEXA 1LSOA 1E6WA 1KZYC 2YZMA 3GZNA 4Q3NA 1I1NA 1ZGZA 1DS6A 2QE7A 4XXHA 1IBSA 4JBXA 5GOTA 1SGWA 5HF5A 1FRFS 1MEEA 1OOEA 3C2QA 2HSZA 5CYFA 4B6PA 3G0OA 2FR1A 4OD0A 4UUPA 2XEXA 3CSUA 4ASUD 4EB6B 1V5WA 3ETJA 1W52X 1EAMA 2SKDA 2ZJ8A 3OWXA 3R5HA 3SM3A 1KF0A 5A5EA 2H7VA 3I2JA 1NBAA 1PNQA 5JVDA 5B3LA 3UMYA 2O59A 4DM7A 1V7QA 3BD8A 1IU9A 3CUUA 3PX7A 2Q99A 1C1XB 1HYBA 2XKAA 4KE7A 3ZHXA 1T9GS 4TXMA 4LI3X 2BR4A 2IDJA 2I0FA 3IA2A 4FI3C 1XVLA 3GVHA 3L6OO 1TQ4A 5FPQA 3R2JA 4BZQA 1T24A 1B4DA 3AVPA 3H5LA 3P4YA 2Z57A 3FVWA 1OTHA 2WFAA 1Q77A 1AKUA 2DQZA 1V7CA 1XCLA 3P4UA 1KEVA 4M55A 3VJMA 2ZREA 3PNSA 3T4EA 3X1WA 4F3KA 3DPUA 4KXYA 4UFPA 5LWQA 1YB5A 3ISVA 4U8HA 3OE7D 2OCYC 3D1LA 3A3KA 3F46A 1J0CA 3L1UA 2FFJA 4RLHA 1J1ZA 1ZSVA 3DVSX 3R9KA 5F51A 1Z0DA 2GXSA 2H5LA 4OJNA 1RXEA 4RZQA 4EEXA 4TMYA 3MHTA 5E0OA 4A0GA 1RAAA 4LWOA 3JR7A 5EYPA 4ED9A 1Y98A 1YBFA 1WHTB 3N28A 3I61A 4ZCRA 3F9CA 3WFZA 5HSGA 4DV2B 4LXXA 4AP6A 4TXLA 1J7KA 3UHAA 1UXGA 2VAVA 2X3FA 4JUBA 3K5PA 4PZPA 2B7LA 1Y4SA 3GCGA 5LP6A 1TYZA 2JI6A 2WI8A 3GWGA 3MTQA 1QRUA 1HLDA 1UODA 2EIHA 2ZI4A 1FJXA 1GTSA 1QAMA 4D0RA 1SBQA 5T57A 4DZTA 1U7PA 5AK5A 4HYEA 4JKIA 4JLBA 1ONBA 2VP4A 1NPDA 5J2UF 2Q6IA 1JVNA 1AKVA 3I9KA 1MB2A 1ZONA 2PFSA 3NGMA 4K9DA 3TI7A 3K70D 2AN1A 5HPYB 5LZ8A 2B61A 3PHHA 2KBFA 2ZQZA 1RXYA 1WMDA 2NO9A 5CM2Z 4M1MA 5BYJA 3ZWXA 4EUHA 4XIIA 1MOPA 4ZAFA 3R7WB 4JBWA 4WUTA 4TT8A 1T0JB 2IYZA 4KN6A 3SZMA 3EGDB 2PL3A 3MJ4A 4TTTS 3OCWA 4DCNA 2EJUA 3F9IA 2P6RA 1XVIA 3GZJA 1T6ZA 2OKCA 1UZNA 3G1TA 4C4PA 3V4LA 2Z4TA 3OZRA 4RCZA 3GLGB 1TB4A 4FTWA 3DOHA 4O4IB 4EJSB 1KEEA 1TIPA 1MA0A 2XSZD 4LOLA 1VHLA 3PVCA 3FG9A 1OU4A 2PH5A 2WKQA 4B5KA 2YH2A 1QIDA 1Q21A 3R3WA 4WKCA 3LE8A 4EK9A 3HBNA 1NW8A 5DBHX 4JDUA 3B6EA 1T5HX 4KITB 3CVVA 1LWOA 4RABA 4B9AA 1G66A 1RNLA 1P5HA 3GYGA 1K9VF 1SJ9A 3G2OA 2V98A 3HP4A 4HDSA 1BXZA 2H1OA 1LI5A 1A5TA 1GV1A 3GGCA 3JWHA 1FMCA 1K6IA 5HCNA 3AHIA 3AF5A 2BEVB 3KEQA 3S2FA 1HFJA 1U9YA 1XDZA 4QELA 4A27A 1U1FA 4PHFA 2P4SA 4KYUA 1RVDA 4D0SA 3OJLA 1SUIA 2H63A 5FJIA 2EW1A 1LQTA 2SNIE 1ACMA 3HN6A 3RTDA 4EB0A 4YV0A 1A77A 2MWMA 5H7XA 3ZDDA 5EWJB 3KB2A 1JDJA 1BG6A 3FBWA 2F1JA 1E7SA 4K9MA 2FK8A 2G72A 1C8KA 3M9LA 2GN4A 1U2DC 3U3DA 5JCOC 1TPYA 1U28A 3DOFA 1TKCA 2FSUA 4A2QA 2IP2A 1DV2A 4HB4A 1I4OA 2QD1A 4KL8S 2YJZA 1YA4A 4ZP1A 4V1CI 5P8WA 3KFLA 3NBXX 4P53A 1OLXB 1QFYA 2BZ0A 4PNHA 4GVLA 2YS6A 4GYJA 1TYDE 2WAXA 5F64A 5BW6B 4B73A 3DP7A 3A6DA 4R1PA 1NUAA 1MOZA 1I7LA 1XKLA 1PK8A 1PSDA 1JW9B 2FPIB 2IXBA 1Q1EA 3DLTA 4QNNA 3O4HA 1XLVA 4E2ZA 4B3SB 5HDBB 3LX5A 3X1XA 4LIPD 4XDZA 2XXAA 4MMZB 2NP6A 1Q2XA 3N8IA 1DBIA 4FM9A 1RLOA 5T3UA 4YIHA 2QTNA 2FWMX 1N7JA 3FVQA 1VL2A 3S1AA 4F7DA 1H8HD 5IVHA 1U28C 3DD5A 1GSHA 4R1QA 1CJUC 1O9GA 4BTLA 4E7OA 1I4TD 3NHUA 3P0FA 3NTXA 2V7UA 3D6NB 4XX1A 3EVEA 5TPZA 4PLHA 4LC9A 2OA0A 4XX0A 1B2RA 5E7JA 1SIUA 1BA2A 1XZBA 2W7TA 5G40A 4BB6A 1R6BX 4YMGA 2DUNA 4Z7QB 2HBRA 3U4IA 3KAJA 4OUKX 3EPLA 3GL9A 1BA3A 2EJVA 1U8ZA 2CK3A 3NOVA 3WKCA 5TQVA 4RD3A 3DMHA 1OFUX 1B0PA 4Q48A 3TSZA 3ZTWA 3ADDA 3I64A 2DPHA 4FFRA 7YASA 2YVLA 4Q4HA 3F98A 4I55F 2R87A 1CF9A 1C5KA 1JDSA 1HG1A 2FP4B 4KGZA 3SI7A 4QFCA 1MCZA 1YZKA 5C8YA 5AUOB 3WMGA 5L3QB 3A6KA 4G0ZA 1CQZA 3PXEA 4PYRA 3PYLA 3LOUA 1ZKMA 2V3WA 2PKRA 2XQFA 1U8AA 3RQIA 4PXYA 2G88A 1Y5RA 3JQ6A 3WK6A 2RHCA 5AVJA 5D3KA 1GP2A 1M1ZA 1KWKA 1U81A 1JVSA 2YXLA 2ZTSA 4IV5A 2V7BA 2XKBA 2P2CA 1ESCA 3Q0EA 3NR2A 1P3DA 4FINA 3M0EA 4ARZB 1JEDA 4E5SA 1BDHA 1PR6A 2VSQA 4IAOA 4PG5A 1T4CB 3QTTA 3ZBTA 3PYXA 1ISMA 2GM9A 1C7IA 2WRZA 5ERXA 1GZSA 1Z29A 4YROA 3TM5A 1H6BA 4L5BA 2JLZA 3NAQA 2QJOA 3N6XA 1PYGA 5E1BA 4TX1A 5E1MA 5G2OA 3SHTA 3ZHSA 1DGQA 1G98A 1L8LA 2YCLA 3AR9A 3L6RA 3TCNA 2CHVA 4J0CA 4MB0A 3T5GA 3THOA 5BVGA 2IZ0A 3U3MA 3QF4A 1MABA 3GUVA 4Q4JA 1M54A 2M1XA 1S2GA 1P8JA 5J2TB 3MCWA 3UA3A 5ELLA 1VDZA 3ENWA 2M6RA 4MI1A 1KH2A 5IUKC 3V1NA 4B6FA 5I9LA 4NCAA 3PUIA 1NY5A 2I6UA 3OTIA 4FDVA 4IYRA 4RHCA 5F77A 2AOXA 1A76A 1QR6A 3KOWA 1TD1A 3OE4A 4ESEA 5LZ4A 4RHUA 2D1QA 3IP3A 1BE6A 1G5PA 1US8B 3HKEA 5F5LA 1UT5A 1VCMA 4WEOA 4B2PA 4ZXFA 3STYA 2FOXA 3ZE7A 2I4NA 2VCEA 2VCHA 1CY8A 3HC7A 3LD9A 4BAGA 4E5DA 2VZLA 2WU8A 4GGMX 4NULA 4FGZA 2AW3A 3IP8A 1QHIA 3OZXA 3UB2A 3AIKA 3RRMA 1IOLA 2W6PA 5CRIA 2AH5A 1V5EA 2H18A 4Q4LA 4EDHA 1DFGA 1LWNA 1TYCA 6ADHA 2KX7A 3AF0A 1UC8A 2ST1A 4UREA 1VLZA 3IVGA 3S2UA 2XKKA 3Q7RA 4UXIA 2WQ6A 3QF7A 1JEYB 2PUEA 4B3RB 1Z6GA 4FS8A 1OHHD 2YNMD 4KQWA 3ROZA 3GP5A 3IULA 3Q3EA 3V00A 1A2QA 3CF4A 1ADFA 3M1LA 4E5PA 1GAWA 3D59A 3SP1A 4YDRA 4II3A 3CMCO 1QK4A 4I5DA 3Q7IA 1FW6A 2DJIA 2ZZMA 4H7FA 5KPDA 3H6GA 1NW9B 2HPAA 3RI3A 2QF7A 2E9SA 1MJ5A 1Z82A 5B6IA 4WLFA 3ADCA 5EHZA 1HLPA 4HQRA 3VPSA 5K0EA 5KCZA 1YR9A 2ETXA 4DIKA 4DLXA 1ADJA 2X2FA 3ZDRA 1SG0A 3PR2B 4UUOA 2BISA 3JPWA 1MF7A 3PXCX 2C96A 4UTOA 3G5MA 4LJ7A 5K0GA 3VNRA 3NHKA 4ID9A 4ZHQA 2VNKA 4FFNA 2EP8A 2PVPA 2Z6VA 3A2LA 2D74A 3CG4A 1UFQA 3COWA 1H1TA 2G77B 3F97A 4M38A 2O8VA 3WHLA 2ZBDA 3KQYA 3LTEA 4KO4S 3RUEA 3HL4A 3U48A 3BWXA 4Z3DA 3CO5A 2IBTA 4B3DA 4J6EA 1A7JA 3G1UA 4MV4A 1OH8A 5KX5B 1CUXA 1TYBE 5B1HA 3SZRA 4XWKA 4YUZA 4QHYA 3TK1A 4HH4A 5CB4B 2HJRA 5JPIA 1QVAA 3OQ6A 2GQ0A 3RS0A 1W0JA 2FZ5A 3Q1KA 4TN1A 1B16A 3PFCA 4BLPA 3EC2A 1KSGA 3MRVA 1BXGA 4O0MA 4LNAA 1TEHA 4R54A 3V4FA 2LGJA 2HB6A 2YY6A 1HFWA 1JR3A 2DLNA 1E7WA 4L7QA 4F97A 1XGKA 1J8DA 1EI9A 2C9DA 3EH1A 3LMKA 4RZIA 1DJOA 2YHIB 2O54A 1M6VB 4AO7A 8AT1A 4UPDA 4OHRA 3UH1A 5BR8B 2BMFA 1W1WA 3F6CA 4W8HA 1OREA 4F04A 3DTYA 5ALDA 2YYZA 4QQNA 1JBKA 1O6CA 3O92A 2V7EA 3VPCA 2C3YA 2GPBA 4PS0A 3OU6A 3VTKA 4P08A 1ILEA 3FOZA 4Q7MB 2Q3HA 3D3EA 3TB4A 1DG9A 1WF6A 5JO0A 3OZWA 3FJ1A 4A8JA 1OLUB 5HS4A 4OB6A 3DVLA 5D86A 4RDXA 2OQRA 1ISFA 1R6AA 3QE9Y 4U7HA 4QDKA 4B8YA 2XDWA 4GMHA 1S89A 3JZIA 3EJ6A 3N53A 1O0SA 3DFZA 3ZE0B 1B15A 1ZL2A 4EUKA 1XRJA 3A1NA 2FUG6 4YJGA 4MUGA 4KJXA 4HMQA 3KKNA 4U7PB 3I42A 4ZI5A 3RDPA 2HX1A 3KV3O 3AUXA 4IXWA 3WYFA 4ZARA 3W7AA 1GTJ1 3EXIA 1SPXA 4JWTA 2B34A 1NP6A 1TM5E 5C8XA 3E7FA 1AGNA 1JDBB 1QSGA 1SEVA 4J8PA 4MARA 4M7WA 1A7KA 4EM6A 4PWYA 4GPD1 3DZBA 3DD1A 1AGPA 4HRXA 3VFDA 2P9TA 1QFSA 5UKDA 1NUUA 1ZG3A 1KEUA 3GHYA 2Q07A 4DM4A 1SCUB 1BCSA 4ZDKA 3U9SA 1D2HA 4C03A 5JDIA 1J2EA 2FPSA 5K3CA 1JKJB 4FBLA 3ZQUA 2OT3B 1ZCAA 2VHUA 2H1CA 5HBRA 3AKZA 2XZLA 1Q0SA 2R8BA 4NDNE 4OB7A 3RE1A 2OCXA 3A6GA 3DJFA 5IABA 4WD3A 1U8XX 4J7UA 5D7BA 2CVPA 4G8JA 3D4IA 2QAGB 3EXFB 4FOSA 3GRUA 5DKFA 1QGYA 1KO5A 2WVGA 4OJKA 3L04A 2PNJA 1Y7PA 1U04A 2P2NA 3ZKAA 5J3JA 1F9EA 1O96A 1I4DD 3IFSA 4YBRA 3PF8A 5G1NA 1KQGA 2MYPA 3QY9A 2MSWA 1O97C 1VG0B 1S2NA 1VJRA 2BZGA 4HYQA 4US0R 3ELUA 2HCBA 4EGJA 1QYWA 3QYJA 4N8EA 2VEOA 3BIXA 1LC0A 4R8LA 3QFFA 4NBSA 2VPXA 3PR1A 4XR4A 4ZOLF 3IX7A 4KOEC 4ACBA 4BO6A 4D9EA 5K3EA 1AKQA 4CG3A 2AR9A 4DQDA 3LUAA 4LSWA 4HMOA 2ZQ5A 3HP7A 3PC4A 3HJNA 2NU8B 3GEMA 3COVA 2SECE 2G3YA 3AEUB 1GXSA 1M2VB 4ER7A 1HNWB 1FFYA 4PIMA 2C5FA 2PZJA 4PG8A 2DBZA 4JL5A 2VTEA 5CT9A 2ZUDA 1F4LA 4HX5A 1ZRHA 4ND3A 4MX8A 3VHXB 1JYFA 1WKVA 4J2OA 3EF3A 2PT9A 2Q6OA 5AHRA 1R74A 4BNDB 1W1IA 3LIPA 4UHFA 3O1HB 4Y30A 4D81A 2DPXA 4BDSA 1RPZA 3U4DA