3SXPA

Crystal structure of helicobacter pylori adp-l-glycero-d-manno-heptose-6-epimerase (rfad, hp0859)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
324
structure length
310
Chain Sequence
MRYIDDELENQTILITGGAGFVGSNLAFHFQENHPKAKVVVLDKFRSNPSSLGHFKNLIGFKGEVIAADINNPLDLRRLEKLHFDYLFHQAAVSDTTMLNQELVMKTNYQAFLNLLEIARSKKAKVIYASSAGVYGNTKAPNVVGKNESPENVYGFSKLCMDEFVLSHSNDNVQVGLRYFNVYGPREFYKEKTASMVLQLALGAMAFKEVKLFEFGEQLRDFVYIEDVIQANVKAMKAQKSGVYNVGYSQARSYNEIVSILKEHLGDFKVTYIKKHTQAHIEPTILDLDYTPLYDLESGIKDYLPHIHAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-L-glycero-D-mannoheptose-6-epimerase
publication title The crystal structure of ADP-L-glycero-D-manno-heptose-6-epimerase (HP0859) from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Isomerase
total genus 111
structure length 310
sequence length 324
chains with identical sequence B, C, D, E
ec nomenclature ec 5.1.3.20: ADP-glyceromanno-heptose 6-epimerase.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sxpA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3sxpA02
2QZZA 1C14A 4ZQEA 4AJPA 2W2KB 3I9OA 5DBIA 4CMKA 1TT5A 2VWQA 4E12A 5L45A 1QORA 4DMMA 1VC2A 2FY8A 3C7CB 3G0OA 3N74A 3BTUA 2C7GA 2YV1A 4PG5A 1I10A 4DC1A 4UREA 4BKPA 4JBIA 3KXDA 5B37A 1GU7A 1DHRA 1WXDA 1DC3A 2PGJA 4QUKA 1DC6A 2NU7A 3LYLA 5CAEA 2XOXA 2EGGA 2A4KA 3WGIA 1YJ8A 3DBHA 3NUGA 3RCBA 4CM1A 2ZTVA 2EKPA 3QW2A 3RU9A 2Y1EA 1VSUA 3RC7A 4J1QA 3V2UA 1IOLA 1Y8RA 2I65A 3JQFC 1ULUA 4H7PA 4IDDA 5DBGA 4Z3DA 3IC5A 4CM4A 5CDSA 3VKUA 1LC3A 3AU8A 4GVXA 4O63O 5CP8A 4FBGA 1M6HA 1X1TA 1YGYA 3OICA 1Z7BA 4XYLA 2G82A 1Z6ZA 3R3SA 1WZIA 3CH6A 4DMLA 5EJ2A 3ICPA 4IGEA 1SEVA 1K0UA 1EFKA 1YB4A 4FD3A 3RUCA 3BIOA 3D5QA 2BLLA 2X5KO 2HRZA 1LXCA 2OFPA 1M76A 1Q0QA 3ZHBA 5T67A 1P1RA 2BH9A 4ZQHA 3LC2O 3SC4A 3QY9A 4GL4A 2DTEA 1E3WB 4LK3A 1C1DB 1NM5A 3PHIA 4Y8VA 4CLXA 1I3MA 3CMMA 3BMCB 3WJ7A 2CZCA 1OFGA 4R41A 4OJNA 2IZ0A 1GZ3A 1O5IA 1SEPA 2BF7A 2AA3A 3FD8A 4P38A 3ROQA 5I7SA 4GSLA 5G4LA 3C8MA 3GDFA 3WGHA 3U4CA 1G0OA 4MVJF 5A04A 4NBUA 1OC4A 4LCJA 3PPIA 3JD4A 2AE1A 3OMLA 4CMJA 3PHJA 4O5OA 4BNIA 2Z1MA 1R16A 3WSWA 4GH5A 4TKMA 4B3IA 2AG5A 1TLTA 1EFLA 3BMNA 3IMFA 1SAYA 3OJEA 3ONFA 4K28A 2I9PA 1RM0A 4L4SA 4NG5A 4EJ0A 4YT4A 4A2CA 1CETA 4J1TA 2XAAA 1LSOA 2J3JA 5EN4A 4Z6KA 4UVDA 3PYLA 3LF2A 2EGHA 4YJHA 4IDFA 4Q3DA 3PEFA 2R2GA 3D4PA 3GUYA 3K5PA 4RVDA 4Z0PA 1ZBQA 3L4SO 1MXHA 4RGBA 1I24A 1JQBA 3Q2IA 3WGYA 5TJHA 1M75A 3OFSA 4FN4A 4KOAA 3CKYA 4WKGA 5MDHA 1GEGA 1PS9A 2X8LA 1JWBB 5DCYA 4E2XA 1V9LA 2Y66A 1IUKA 4BQPA 5KJ1A 1BXKA 4BO9A 3MOGA 3ONEA 4BGVA 3PTZA 3VZSA 1G0NA 4W6ZA 1C0LA 1YDEA 5G0SA 3UKOA 2I3GA 1EDOA 1DHTA 2C20A 3K8ZA 3TZKA 1EUCA 1I2BA 1PR9A 4HADA 1CQJA 1FDUA 2AQ8A 2FPIA 2JFHA 3AI3A 2FHSA 1Z7EA 4QTZA 4W7IA 1TA4A 1F17A 1K5HA 3KEQA 1DIGA 1H9AA 2A94A 2X1HA 3OJOA 1LQUA 2AQHA 2X0RA 3DBLB 3ZNPA 4E31A 4FGSA 1KS9A 1GUZA 2VYNA 4M87A 1B3RA 1ZSNA 2X9NA 4DBZA 4DUPA 4U8GA 2R00C 1KVUA 4PLHA 3GR6A 3WGGA 5T57A 2WM3A 2UVDA 4E4YA 2EWMA 4FSHA 2GO1A 1PJSA 4NI5A 3GG9A 3NDIA 1PS8A 3GF4A 1HDRA 1ZXLA 4J7XA 5LCXA 4E2ZA 2ZYAA 5EPOA 4CLHA 4CQMB 3R1IA 3DTTA 1Z82A 1GCOA 5JPIA 1MV8A 1NFFA 5KNLA 3AOEA 2FR1A 3KETA 1I33A 4E5YA 3GAFA 2YDXA 1J4AA 4GKBA 4GKVA 3QWHA 5F1PA 1NQTA 4XQ9A 3QE3A 2POQX 2B5WA 5HTOA 2VHXA 2RAFA 1B8UA 3DAFA 3NRCA 1ZMOA 1GFSA 3TJRA 1IPFA 4UEJA 2FZWA 3GN2A 4PLFA 5CDUA 3R0IA 3ETDA 4CMEA 2Z5LA 4CQLB 4DIOA 2EW2A 3W1VA 3DHEA 1U7HA 2GD1O 5KCZA 2W90A 4J90A 4EEXA 4I9HA 4PIVA 4CLOA 4NBVA 3FNFA 4PCVA 1TI7A 5DOZA 2G17A 1R66A 2I76A 4MIYA 3PDUA 3F6YA 1DRWA 1O94A 1EVIA 1X0XA 3JQ6A 4NJMA 2C0CA 4WE3A 5BNFA 3UN1A 3K92A 3DB2A 5THKA 3QJ5A 1CYDA 2Q4BA 4E5PA 3D0OA 1EVJA 3Q3CA 2NVUA 4PLWA 1U1IA 1OAAA 1E3JA 5L7TA 3G17A 2PZJA 3Q11A 3TL2A 5BR7A 5JXWA 1U4OA 5CDYA 3VVCA 2UYYA 5TJ9A 3U4IA 1B15A 1YH3A 3W4IA 4JIGA 4TMFA 3PGJA 4IDGA 1HETA 3FR7A 4UULA 3JQ8B 4YA6A 4A27A 2F1KA 1YL6A 3CZMA 2BGKA 3JQ9C 4YVFA 1MG0A 1W8DA 2YDYA 4Y6RA 5A05A 4WNCA 1H93A 4IQGA 1LEHA 1UZLA 4PG4A 1ZSVA 3F46A 4R68A 4DLBA 4CLRB 4D44A 1BDMA 1JU9A 4Z9XA 2O3JA 3RBXA 2VUSA 1VJ1A 4FB5A 5T64A 4D7AA 1R4NA 4I9NA 3C1TA 4DREA 1LTHR 1WDLA 2Q4EA 4AICA 4KWIA 4QEDA 4IGFA 5F1OA 2GRAA 4II2A 3R3JA 4KQWA 3I9NA 1JAYA 3WGTA 3S2IA 1YDWA 3FSRA 2CNBA 4YAGA 4NR0A 3WWZA 1DXYA 3ZNNA 1HYGA 4J43A 2FZEA 4Z0TA 4RJTA 4ITUA 1FXSA 4XYBA 4DBVO 5BQFA 3HZZA 5KIAA 2YYYA 3N58A 4AFNA 4EJ6A 2QQ5A 1UXGA 4MVJG 4JN6B 1ZH8A 1AUPA 4CV1A 4AG3A 1WDMA 2JD1A 4JP3A 4WLOA 4D43A 1SBYA 1YS4A 3AY6A 3CMCO 1BW9B 1R0LA 1H6BA 1HZJA 2J5KA 3MWDB 1EE9A 1KEUA 1MGOA 1RYEA 2AXQA 4G81A 4YQYA 4Q3EA 1MG5A 2GN9A 2HO5A 4FCCA 3RKUA 4BNFA 1Q0LA 3P7MA 1BVUA 1Q7BA 3DHNA 4YAJA 2JCYA 5I7VA 2Y68A 3H2SA 3E18A 2ZTLA 5GZ1A 1HEUA 3T7CA 4HWKA 2UUOA 2DAPA 3GVCA 3ROMA 2VOEA 1K3TA 3H65A 4M86A 1PZFA 4IZIA 4XDZA 4YJFA 3UOGA 4EUEA 2WSBA 3UF0A 3MJEA 3AUUA 1Y9AA 1DFIA 2BKAA 3BMQB 4R1SA 1NBOA 4R54A 4EBFA 3ZV4A 4YRBA 3TL3A 4YRAA 4LSWA 3H8VA 4MVJM 3KOUA 1YB5A 2WYWA 3GPDG 3DMTC 2FP4A 2NQTA 3EYWA 4P4NA 1UXIA 4UVGA 3PWZA 4RVHA 3JCZA 1SB9A 5F1KA 3IDSA 4BO4A 1Q2XA 1LX6A 4XYMA 3M1LA 1TEHA 3OQBA 1I3KA 1T4DA 4MP8A 4ALNA 4KTTE 5KTKA 2C59A 4OAQA 4WECA 3QVWA 3B1FA 1P31A 4CM9D 2YHIA 1R0KA 3T4EA 3LT4A 2A92A 3BHMA 3DO5A 4FFRA 1PWXA 2Q1WA 5L7YA 4BMVA 1K89A 4PLPA 3PLNA 3SXPA 3FN4A 4FFNA 1TB4A 4ALMA 4CUKA 4TRNA 4IS3A 3WTBA 4MINA 4J4HA 4ZVVA 4BNKA 1SPXA 4MIOA 4UUNA 2AG8A 4HUJA 4ONEA 3BMOB 2PD6A 3K9QO 2C5EA 2DT5A 5DF1A 1S7CA 2C54A 3M6IA 4E2YA 1HE3A 1P1JA 2OBYA 3KYCA 4CMCA 4BNVA 1UZNA 3IKVA 5B4VA 1GPJA 2OOSA 4M54A 4XR9A 1NPDA 5IF3A 3K73O 4JGBA 2PNFA 4KUEA 2WDZA 3AY7A 5F21A 4U6SA 1I5RA 3C3XA 1MFPA 4RZHA 4BNZA 3H9QA 3WQQA 1K6IA 1FMCA 2DLDA 3FRJA 2BFPA 4YQZA 1WNTA 5IZCC 3HNPA 2DTXA 3KB6A 4AVYA 9LDTA 3GEMA 2A9FA 2DTDA 3AFMA 3P2OA 1T1SA 3JQ7A 1V6AA 1ONNA 3GHHA 3I5MA 2X86A 4IBOA 2C82A 3GC6A 4CM8A 5LC1A 1PR3A 4A10A 1R37A 1EVYA 3GNQA 1NR7A 2Q49A 3PDJA 4FJ0A 5IN4A 4LN1A 3LLVA 3Q9UA 1M6WA 4IJWA 3SX2A 3AUSA 1GDHA 2PLAA 3DHYA 1ZEJA 1U2GA 3X2FA 3CSDA 1CRWG 3OBBA 3ADOA 3TZQA 4B7UA 4IXWA 2O7QA 2WYUA 3W8DA 4CL3A 1C1XB 3FR8A 3LT1A 3O8QB 3GZNA 2VNAA 1Q1NA 3LK7A 4A7PA 5KJ6A 3RUAA 3TOZA 2J3HA 2VNSA 4J7UA 3KRTA 4JK3A 2XXJA 4BO2A 1U5AA 3ETGA 4TQGA 4QX6A 2D8AA 2GSDA 4IY1A 4OXKA 3SEFA 3HJAA 3BXXA 2WYVA 4XJSA 3QLJA 3DL2A 2W8ZA 3RKRA 2AEMA 4JROA 3CUKA 2W2LA 3I9JA 5ES3A 3ZWAA 4IMPA 3VPSA 3STHA 1HSOA 3DOOA 4AJKA 4DPKA 4NHEA 1DJQA 5L40A 2O23A 1QLJA 2D4AA 3FTNA 3QHAA 4ZD6A 1HDGO 2GR9A 5I7EA 3LF1A 4A73A 1U2DA 3RUIA 2IXAA 3K31A 3ST7A 4HV4A 1XWFA 4OSPA 3VZRA 4FC6A 2VYVD 3QVXA 4MP3A 1U5CA 2FPPA 4D45A 4IQ8A 1ISFA 3W6UA 1L7DA 4RVGA 3OM9A 4R9SA 3KYDA 3LLSA 2DFVA 1AGNA 4N5MA 2X5JO 1VI2A 4NZ9A 4GX2A 5T6BA 1XDWA 1EEHA 1QXSA 1ZEMA 1LLDA 5KVSA 3JQGB 2NTJA 1GZ6A 1ZJZA 1U8XX 1XCBA 4IIUA 3RWBA 1VKOA 4M8SA 4CM6A 3KSUA 2HKIA 4PLCA 1LDBA 3OF2A 4R69A 2R6JA 3TDKA 3ZI0A 4RF3A 4C7JA 2AEJA 3MTGA 1U8FO 3NT5A 3WR5A 5K6AC 1ZK3A 3AWDA 4RPLA 4B4WA 3ORFA 3W4KA 3ZCXA 4II3A 3DXFA 4GGPA 3G3EA 4GQAA 4OYRA 4NNJA 2HSDA 3OJFA 4BNHA 2P68A 1HRDA 2E37A 4BQRA 3HADA 4Z0HO 1SO8A 2ZQZA 3EZLA 2RBEA 4DWVA 4A5OA 3TFOA 2FR8A 3LQFA 4M55A 4Z3KA 1VL8A 4QQRA 3TFQA 2OO5A 3ANLA 3X2EA 1F12A 2Q2WA 2Q46A 4NIMA 5EINA 4RCVA 4JBHA 4TVOA 2C2YA 4QT0A 5FFFA 1VM6A 4QECA 5EQDA 3OSUA 4JXKA 3WWYA 3BTVA 4FFMA 4J1NA 3HDHA 2GERA 2P9CA 4L9RA 4F45A 1PJ3A 2QIOA 3L6DA 3LT0A 3QA9A 1LNQA 1C3VA 2YW9A 3CIFA 3U4DA 3SJ7A 1GQQA 1QLHA 1N1EA 1QV7A 1WDKA 3W4JA 3ZV5A 3HN2A 1X13A 5AXAA 3WS7A 2O3RA 3KZVA 1CWUA 1DRVA 4B4OA 3GDGA 4IJKA 5T8KA 1ZUD1 3EUWA 5KJEA 4PLVA 4EUFA 3JD3A 1VSVA 4D3SA 4PG6A 1ISIA 3H6KA 1N7GA 2D1YA 5JYDA 2V7PA 2IODA 1YWGO 3L9WA 4YDRA 1N8KA 1D3AA 1PJQA 1KY4A 2O3QA 3K30A 1E3WA 2ZKLA 4G2NA 4YACA 1C1DA 1JKFA 1FJHA 1YBMA 4WEQA 4RL6A 2EKQA 1SOWA 4XYEA 5T5QA 3G1UA 4D0RA 1WWKA 1XLTA 2O2YA 2JD2A 3BMCA 1WAMA 5I9MA 2O7SA 3TQHA 1AHIA 1VJTA 1EBUA 3PJFA 4R1UA 3MOIA 4L76A 4BO0A 4UEKA 2X9VA 2ZQYA 3CEAA 4B8ZA 1LLUA 3SJUA 5JSFA 1U4SA 1Z45A 3C1AA 4OO3A 2CDBA 4J49A 3K96A 5EERA 2BI7A 5K9ZA 2Q2QA 3IKTA 3VC7A 2GDZA 3HSKA 4GSKA 2CF6A 4LCEA 3FTPA 1R4MB 3AJRA 3OEYA 4U0JA 3H9EO 5C7OO 1DIBA 4M49A 2ZIZA 2GUGA 3GGGA 3ROPA 1M2WA 1UAYA 5I9LA 4L0QA 5CEJA 3M2PA 4S1VA 1LJ8A 4B3HA 3GH3A 3F4BA 2PTGA 2O3UA 3HN7A 5CFZA 5HRUA 1ZSYA 1YQXA 1GY8A 2CD9A 3F3SA 4RPKA 5KKAA 3S1LA 2V6GA 2JJYA 3LZ6A 4BGUA 3SLKA 3DONA 4MDHA 4ND5A 1XSEA 3AM5A 1P45A 4DA9A 2UV8A 3F1KA 4CR6A 1WZEA 2TMDA 1OZAA 4NBWA 1J6UA 3PJDA 2PZMA 5DCWA 4RPGA 4O1MA 4R51A 1DRUA 4E5NA 3U09A 1ISHA 1PWZA 1P3DA 1GADO 2HQ1A 3B20A 2O2SA 5JO9A 2VRCA 2D3TA 1V8BA 1PQPA 1KEVA 5BNTA 1UP6A 4CLDA 4IIVA 1UXKA 4FPXA 3UFXA 3DBLA 3WGZA 5L53A 3RASA 3AFNA 3UCFA 2NWQA 3JYPA 2NVWA 1GAEO 1EK5A 4L4XA 3HFSA 3ZNOA 4W82A 1LLQA 1YB1A 4TWRA 4CMIA 2J8ZA 1HDCA 3C7AA 1FDTA 5G2OA 3Q9NA 5TT1A 3DAGA 1QRRA 4CQMA 1SZJG 1MFZA 3AW9A 1O8CA 3PYXA 2EIHA 5I8ZA 4ZICA 4XGKA 2BRUA 1ZCJA 2I6TA 4WCFC 3TF5A 1ADCA 4AJNA 1LDNA 3AU9A 3FI9A 3IUSA 4WGGA 1E92A 1MXFA 5FWNA 4OH1A 4AJEA 3RC2A 3JQBA 3DR3A 4RF4A 4Z9YA 1UZMA 1XELA 3K6JA 2VHYA 3E82A 2PD4A 5DBFA 4MPDA 3DZGA 2GZ3A 1V3TA 4CQLA 2ZK7A 1IE3A 1JKIA 3GGOA 3CE6A 2DUUA 3OQ1A 3VDRA 1R12A 3B70A 4HP8A 3IS3A 3V2HA 3HQ4O 5TC4A 3PHGA 3H5NA 2HK9A 2OP1A 2Q99A 2VUTA 2JHGA 3U4HA 5B12A 1Y5MA 1WP4A 1SMKA 3ZWPA 1H9BA 3AI1A 4R1TA 1P1IA 2BFAA 4MVJI 2E6UX 5L7WA 4MIEA 2A35A 4B4UA 2B69A 3GMDA 3N7UA 2NTNA 1JDJA 3KLPX 5AOVA 3S2GA 3W8FA 4ESOA 3L4BA 1VJ0A 1F06A 3D3WB 1LI4A 3GT0A 4WK6A 4RDHA 5CDGA 1HKUA 1T2AA 2WJPA 4G65A 5TGDA 2WTBA 5FI5A 3FPCA 2WD7A 4BO1A 4FDAA 1KVSA 1RKXA 2Q2VA 1T2DA 2AHRA 3GUCA 3VPHA 1A4IA 3S2EA 1GV0A 3FHLA 3L77A 5JCJD 5K6AA 1UUFA 3RU7A 3COSA 4X54A 2VQ3A 3OA2A 3PHLA 3ZWNA 3RC1A 2XF8A 1NWCA 4PN3A 3PRJA 5KOIA 5EMHA 1BG6A 5JYEA 4HXYA 3RC9A 1YXMA 2BMAA 2J3KA 2LDBA 3QIVA 3ASUA 4NFYA 4QFCA 4NK5A 1UXJA 3WOHA 5A03A 1PSDA 3FBGA 5ER6A 1HZZA 1RPNA 4D3DA 1YRLA 4R1NA 1T25A 4J3FA 4WLNA 2YQ5A 4JJGA 1FK8A 4LW8A 1JKJA 4L75A 5TT0A 3SLGA 4EGFA 4BKOA 2VZ9A 1P44A 2QZ9A 3IAHA 3WNVA 3ICCA 1Y8QB 4A26A 3WTCA 2C5AA 4MVJE 1RJWA 6LDHA 3EZYA 2FPGA 2DVMA 5C5IA 4GMFA 1YONA 1E7RA 4J9UE 3PFFA 5THQA 1W0CA 1M66A 3VTFA 4CODB 3DQPA 1PL8A 5F5NA 3SVTA 2NSDA 3CPSA 2H1SA 4P4GA 1WPQA 3DBHB 4NBRA 2Y0DA 4HBGA 4DPMA 2CF5A 1E1KA 1D8AA 3CINA 1KOLA 3BTOA 3ONDA 3ZHYA 4ALJA 1Y8RB 3BMQA 3GVXA 1HDYA 2CVOA 4RPJA 1IZ0A 4L73A 4J0EA 3UH1A 2EEZA 4XIYA 4W9NA 4CV3A 4RQTA 7ADHA 2B37A 3FNGA 5L9AA 4WLUA 4BNTA 2VYND 3DZBA 2IEDA 2VHWA 1V0JA 1A7AA 1PTJA 3E9MA 2ET6A 4MJLA 1JVSA 3CTMA 2DBRA 4OXYA 1ONPA 5JDCA 2Q3EA 2UAGA 4L4RA 1XG5A 2IE0A 5DN9A 3S8MA 2C2XA 5IN5A 4GAEA 3DZHA 3NT4A 5TS3A 1UDCA 4IPTA 4DQUA 3IIEA 3C1OA 2EP7A 3WGOA 3WLEA 3O4RA 3KTDA 2PKQP 4J9VA 1PZEA 5JCXA 1RM4A 1DIHA 3EVTA 3PJGA 4R5HA 1ADGA 1EQUA 3V2GA 5G0UA 5GZ3A 4R3WA 1ZNQO 1WLYA 5HS4A 4BNWA 4JLWA 1NNUA 1XR3A 1GYPA 4YXFA 2W4QA 2HJSA 3PWSA 2JAHA 3DMYA 3BMOA 1FDVA 1UJMA 3O38A 1EDZA 4FQ8A 1LRKA 1S6YA 4NBTA 3JD1A 5IXSA 4GX5A 1HF3A 1I32A 4M1QA 1FF9A 1U3TA 2P91A 3E03A 4GLLA 2IXBA 4DGSA 2I66A 1ZZEA 3F9IA 4EW6A 1QYDA 2D0IA 1E1LA 4YAEA 3BMNB 4EYEA 1BXGB 1EZ4A 3UCXA 1LDEA 1I3NA 5I8WA 4KMSA 5DT9A 4YPOA 4YJHB 2HMUA 3LVFO 4PZEA 4UEOA 4CR8A 3JD2A 5C7IO 2NVBA 1I2CA 3IOYA 1BDBA 3H3FA 1LDMA 5F3RA 4U7WA 5DP2A 3GK3A 4CV2A 1PZGA 4UAGA 4I1IA 1ENYA 1P1HA 3TRIA 4IUYA 1VLLA 1JVBA 1XQ6A 1HE2A 1E5QA 5IAAA 2X6TA 3JQFA 1ZKMA 1Y6JA 3LU1A 4YTEA 4XCVA 3KEOA 4ZGWA 1Z75A 3PIIA 5EIOA 3I6IA 1PJLA 5ICMA 1QYVA 3JYNA 4NFHA 3KBOA 3WMXA 4PRLA 2IZ1A 2Q1TA 1PL6A 4OKIA 3ZNQA 5JC8A 1C0KA 1KEWA 5IDWA 1C1XA 4K6FA 4ALIA 4BNNA 4P22A 4PZDA 3ZWMA 1B2LA 4NFSA 2X0IA 4HFRA 3A28A 4WPGA 3GQVA 3M2TA 1OOEA 4ZQBA 5B4UA 4BB5A 3H2ZA 2B35A 1H0KA 4YB8A 2CVQA 3WG9A 2VTDA 1H94A 3NTOA 1B7GO 1SB8A 2X22A 3LDHA 4J91A 2G5CA 2HMTA 2D5AA 3JQAA 2P5UA 1LRLA 4J4TA 4JP2A 4J2HA 1VPDA 4MVJA 1QSGA 1V3VA 1ENOA 1RM3A 2DBVO 3DOCA 4XRGA 4BKRA 3PWKA 3RUHA 4Q39A 4W4TA 4UUMA 2NNLD 2EERA 3RAJA 3PFWO 3VH4A 4FJ1A 4R16A 3VH3A 1XGKA 3OECA 2QRKA 5CG1A 4LRTB 5FYDA 4DTIA 1BXZA 4I8XA 1JAXA 5A06A 4QSMA 4IDCA 4M89A 1H6CA 4J2OA 4E0BA 4DC0A 2DM6A 1MLDA 1YL7A 1L1FA 1HLPA 3WICA 3KVOA 1YQGA 3UHAA 1HDXA 4WOJA 2H9IA 1CQIA 1PJBA 3ZHZA 4GWGA 3C85A 3NDJA 3OA0A 1GQYA 1X7DA 4ND1A 3ZU2A 1RM5A 1XKQA 4PLTA 3ABIA 4E13A 4FIZA 2RIRA 5JE8A 1QYWA 1ORRA 4NJMB 2NU8A 1SOVA 3UCEA 3EC7A 1KC1A 5GY7A 3HFGA 5U4QA 4FFLA 2WWRA 3FNHA 4TRMA 4DQXA 1QYXA 4R9RA 1YOVB 1EUDA 1Q7GA 5JDIC 1XHLA 1J0XO 2YY7A 2AE2A 4PGFA 3WSVA 3PYMA 3PJEA 3IJPA 4HFJA 3I1JA 1PS0A 3V5NA 4WEOA 2VWPA 3ITKA 4O59O 4BNYA 2YV2A 1LDGA 2DPHA 3E5MA 2DC1A 1AXEA 1P77A 5LDGA 4B8WA 1WW8A 3ASVA 3E1KA 3IQDB 1NQ5A 4QFDA 1KBZA 3P5SA 2JHFA 3WQRA 2RHRA 4BV8A 4HNHA 1E3IA 4UVHA 2VTEA 1EQ2A 2PD3A 4PG8A 4LRSB 4TKLA 1CF2O 1B8PA 2B4TO 1NVTA 2CFCA 4XQGA 4ROSA 3AUAA 4IINA 3VPFA 2CSUA 3UW3A 1U9JA 2R00A 1T1RA 1IY8A 4NJOA 1LSSA 2Q1UA 2TMGA 1YJQA 3DAPA 3UGKA 5FI3A 1KYQA 3WJAA 1UP7A 4WCDA 4NPCA 3GOHA 3RBZA 3GAZA 2CDCA 4C4OA 4LMRA 1E3LA 2JCXA 1SNYA 5I7FA 3GNSA 4WCFB 3MJ4A 5DNAA 4YWJA 2O3TA 2ZB3A 2Y99A 3U5TA 4F46A 5BSEA 1GEEA 1PQUA 1N1GA 4JJFA 4D46A 3LC7O 3FWZA 2YZ7A 1FDSA 4TRJA 3RJ9A 4RLSA 3H3JA 4KDFA 1D7OA 2CDAA 4EI2A 4MO2A 3UAGA 1GPDG 3VAZA 1ISGA 5HA5A 4MKXA 1GV1A 4OXNA 1R4MA 3F1LA 1UR5A 2GN4A 1W4ZA 2V6MA 3JD0A 4K1LA 1F8FA 4MVJH 4LSMA 4NDNE 4ILKA 1I3LA 1KEPA 4Y6SA 1F8GA 1WVGA 5CHEA 2J5RA 3ZHXA 2HRBA 5JAZA 3WDSA 2VN8A 1NQOA 2VOJA 3D4NA 4BIIA 5KVCA 5JAIA 2AMFA 1KETA 1JTVA 3G49A 3QWAA 2UDPA 3I4CA 3DWFA 3C24A 4CUJA 3WQSB 1E6UA 4BS9A 4OQZA 5JC1A 5JW6A 3D3EA 2W2LD 4DQVA 2XPCA 3KSZO 5CG2A 3RFVA 2W2KA 2WEKA 3JQ9A 4CM5A 4XZ3A 1G6KA 3GRKA 4CUZA 4IZHA 3ZW8A 3U49A 4FOSA 2Q45A 1O6ZA 3VVBA 3OH8A 3ZN2A 3O26A 2YHIB 4BNGA 5TQVA 5TIIA 1E77A 3DZJA 4YCAA 1DFGA 3I83A 3GN1A 4INAA 4XKJA 5HBRA 1I0ZA 3MJSA 1X1EA 4AL4A 2IZZA 5ICSA 2X58A 3WB9A 3ETEA 1GD1O 1GYQA 4P4LA 3V1UA 3I9KA 2SCUA 3HDQA 1AXGA 4B3JA 3Q6IA 3QWFA 2Y1GA 1H5QA 2HCTA 3DDNA 2ZTMA 3SBOA 2AEFA 3D64A 5C7LO 4BOYA 4Q3AA 1DAPA 3VDQA 2HMVA 4U5QA 5TSDA 3DFUA 4PVCA 4TRRA 1H6AA 1BGVA 4NQZA 1ZW1A 2GLXA 1HTBA 4B7CA 3KHUA 4ZHSA 3QSGA 1EUZA 1KERA 3EDMA 4D79A 1U3WA 2GN8A 4J1SA 3VTZA 1PGOA 2J3IA 1HDZA 1OI7A 2GF2A 1H6DA 2Y1OA 1NHGA 4YEDA 2P4HX 5COBA 5CPFA 4FS3A 2V65A 3KLMX 4DYDA 4XB1A 4CMHA 3WX0A 1E6EA 5A9SB 1P9LA 3S2FA 2X0JA 1PL7A 4UVEA 3RJ5A 3NAQA 5ER9A 5L4LA 3AM3A 4JX8A 4CM8B 1TVEA 1JW9B 4Q3BA 5G4KB 4L74A 1HE5A 1ZMTA 2P5YA 5HS6A 4S3MA 1CDOA 1AHHA 1PJ2A 4TROA 4Y9DA 4DVJA 2EJVA 2Y1FA 3KM0A 2YUTA 3OP4A 3IP3A 3DBRB 5MGBA 4WLEA 1O9BA 4ZRNA 5B4TA 1I2ZA 2EV9A 3NT2A 1CIVA 4JQCA 1DO8A 1E7MA 3Q2KA 3RSHA 4DLLA 1IHXA 3DMTA 3QVOA 4GX1A 1I01A 3AOEC 3F47A 1DAOA 3ADPA 1KVQA 4XGIA 5A1TA 3DEYX 3ANMA 2YHUA 4BNMA 2X23A 1BHSA 3G1TA 3GZNB 2Y1CA 5AVOA 4A0SA 4YT8A 4OKNA 3RIHA 3A14A 2X0NA 1KVTA 2YFHA 3S55A 3L0DA 1OMOA 1NPYA 3GLQA 4NH4A 2Y0CA 3TZ6A 2CY0A 4OL9A 4CMEC 4O0LA 1A71A 3D3WA 4UUPA 4BMNA 5FEUA 1VRWA 1PGPA 2NUAA 2EXXA 2WD8A 4B7XA 2GZ2A 5TF4A 4ND4A 1CERA 1DJNA 3OETA 4EUHA 9LDBA 3PP8A 5L4SA 4YAIA 4EDFA 2BFMA 4B79A 3INRA 3MEQA 4Y6PA 3MTJA 3JYOA 5BSFA 4IMRA 1O89A 2AQIA 1O0SA 4K6CA 1N9GB 2B4QA 4KZPA 2C29D 5TRTA 3BA1A 3E48A 2V6BA 1QP8A 3PQEA 4N7RA 5U9CA 5CPBA 3ZWBA 3WYEA 1T2CA 3QP9A 1DEHA 2P9GA 1NX6A 2ZB8A 4W7HA 1Y5RA 3RFXA 4BHTA 3EK2A 4FFPA 1OBFO 5KKCA 4W99A 1ADBA 1LSUA 4OM8A 4XQCA 3ENNA 2O50A 3DZFA 2HMSA 1U3UA 1QG6A 2PGLA 2VRBA 4OOEA 1PX0A 1A27A 4OQYA 4RO0A 3VH2A 2YJZA 4RVFA 2X4GA 3LT2A 5JAMA 2IDZA 3TSCA 2NACA 2EF1A 5IZCA 4YR9A 2JD0A 2I5PO 5ITVA 1UP4A 1YKFA 3O9ZA 3I23A 4GVLA 4N54A 4MVJP 2OL4A 3ZV6A 3L07A 3ULKA 3RVDA 1DPGA 1T26A 2JFGA 3NJ4A 4OSOA 2EHDA 1PJTA 2X5OA 3AK4A 2PKRA 5JMWA 3RUEA 4AJ1A 4BO5A 2QRLA 3NJ8A 1P0FA 4HY3A 4AJJA 3WYBA 4Q3CA 3ROKA 1Y8QA 1XU7A 7MDHA 5DP1A 4BO8A 1Y7TA 2JFFA 5TLSA 1GL3A 1E5LA 2GZ1A 4QXMA 4YJGB 2DFDA 2ZTUA 1E0DA 5DZSA 3PIDA 5H81A 1X7HA 1PQWA 1ZVMA 3A4VA 2VRCD 4BNXA 3H7AA 3JQCA 3PK0A 4R5MA 4ALKA 3OIGA 4E32A 4XYGA 1A5ZA 3BZUA 3WIDA 3H9GA 3G79A 4GI2A 4XIJA 4RQUA 5K0ZA 5G0WA 1DIRA 2E49A 5BSHA 1P1FA 4NK4A 3GVPA 4OMUA 2G0TA 4RORA 3EMKA 2H5LA 4JNKA 4R4JA 1AE1A 4ALLA 3LSYA 2WE7A 2D59A 2YFQA 3H9JA 2V6FA 3VH1A 4RZIA 4HFMA 1ZK2A 1MP0A 4AJ4A 3EHEA 2J6IA 4FR5A 4DL9A 5BNIA 1IULA 4XWYA 5IDQA 4BVAA 4PRKA 4CQMD 3GZ4A 4E3ZA 1KY5A 1NP3A 2BGLA 4JJIA 4MP6A 5A5EA 3OQ6A 1I30A 4TSKA 4IDEA 1CEQA 1MC4A 3T4XA 1NHWA 4FGWA 3H4VA 2OORA 3OIFA 3IUPA 5JCJA 1M67A 4WUVA 5JS6A 1ZK1A 3PZBA 2B5VA 4IDBA 3I3OA 3JQ8A 3BYZA 2C7VA 4RV9A 4H15A 1HXHA 3GA0A 5A9TA 2ZJ0A 3GY0A 5BSGA 3ITDA 1HL3A 1VE9A 3O03A 3U3XA 2EW8A 1VL0A 2Y1DA 5IJZA 4YBZA 4CLRA 1A4UA 5JAQA 8LDHA 1BXGA 2JKVA 4DYVA 5COQA 4WLVA 3FCOA 3VOSA 3HG7A 4IJVA 4N5LA 1DLIA 4J4BA 3R6DA 2PY6A 2DU8A 3ZWCA 2OP0A 1LSJA 2PKQO 4PFJA 5U1PA 4Y67A 4BNLA 4H3VA 3DOJA 3VZQA 5ITWA 3U0BA 5I9NA 4OGWA 2ZJ1A 3RUFA 2QHXA 5ILGA 3VKVA 1NAHA 2O48X 2VCYA 4I08A 4ZQGA 4FOOA 3AY3A 2QG4A 3TN7A 4KUGA 1UAGA 1MA0A 4ID9A 1MUUA 2VWHA 2VZ0A 1TT5B 3PQDA 5IZ4A 4PZCA 4XB2A 1E7YA 5EQFA 3GEDA 1U28A 2C07A 1BW9A 3M1AA 3V1YA 1IB6A 3QQPA 4D3FA 2OMEA 4UVIA 4Q9NA 5H83A 1G1AA 1UH5A 2J5QA 4WOKA 5A9RA 5A3VA 1HE4A 4E2WA 2ZB4A 4NMHA 1LBEA 2CUKA 4F6LA 2NM0A 2CMDA 2OXIA 4FJ2A 2QYTA 4BV9A 5CEFA 5KJCA 4H16A 1ZO8A 2H63A 3CZRA 3I9MA 1R15A 4KQXA 5JO0A 1GQ2A 2PFGA 2P4QA 2UUPA 5L3ZA 1UDAA 1LLCA 2DPGA 4YRDA 3QRWA 4GLOA 3U62A 3JQDA 5L51A 2F00A 4AJIA 1RWBA 4CR7A 4DPLA 1VKNA 2VT3A 4L8VA 4D0SA 5L95A 3KYBA 4CMIB 1EVZA 5GMOA 2GPTA 2P9EA 4JBGA 4CM4B 2EKLA 2IEBA 5BT9A 1DBVO 2AQKA 1BMDA 2ILTA 3H5RA 5CDTA 4KP7A 3H9UA 2RCYA 1N92A 4LMPA 3V1TC 3WYCA 1LRJA 4FW8A 5A02A 3KUXA 3TNLA 4YYZA 3BAZA 1Y9EA 4HX5A 1QV6A 3WIEA 4CMGA 3DFZA 1HYEA 4F3YA 1DIAA 3H5AA 1K6XA 2XXBA 3E9NA 5JY1A 2G1UA 3GFBA 1Z74A 3FPLA 3GRPA 4XGNA 6ADHA 4CMBA 2HMWA 3L9XA 2QRJA 4YJDA 1LU9A 1UDBA 1BRMA 4LVUA 3HWRA 3QWBA 3ZDFA 4GGOA 1H2HA 2VHZA 2YV3A 2NU6A 3HB4X 1N2SA 4CMAA 3OIDA 4MKRA 1J5PA 4DLAA 2PZKA 1JWAB 3WNQA 3EAGA 2IRWA 1B26A 1ONOA 2H6EA 3ZV3A 1K6JA 2NU9A 3ON5A 3JQEA 2BHLA 1T24A 3PI7A 3E8XA 1YOVA 1KVRA 3PVZA 4U6QA 4UUOA 3ENKA 3MCVA 1FDWA 3QWIA 2CVZA 3W6ZA 4BKQA 1E1NA 5FF9A 1NTOA 4C7KA 1ARZA 4I5GA 3P2YA 3PQFA 4DIFA 4ND3A 4QO8A 5KVQA 2FR0A 3OJ0A 2JCVA 1NYTA 1LA2A 2OUIA 1JLLA 1LC0A 1HWYA 1XIVA 2WD7B 4TZKA 3GNTA 4ZU3A 4PLGA 4YAKA 5ENDA 1NVMB 2GCGA 3QV1A 2HDHA 1W6UA 1T2FA 2FN7A 4K9DA 1B14A 1D1SA 2VHVA 1TT7A 1U7TA 2BI8A 4G5HA 3ZU3A 2PZLA 1I8TA 3I52A 4GPD1 1NPTO 1X7GA 3JTMA 1ISMA 1JN0A 1YE3A 3GDOA 1HYHA 2HK8A 4Y98A 4BL5A 5TX7A 4D42A 3ZWYA 2GN6A 1V3UA 3UVEA 4E5KA 1XEAA 3GVIA 5AXDA 3WFIA 3NKLA 4BGIA 5JLAA 3O8QA 2DKNA 4WCFA 1X15A 4KWHA 3OJLA 2Z1NA 3ZW9A 2NADA 4I5DA 5HM8A 1EK6A 1YO6A 3QVTA 3E5RA 1RYDA 1V35A 3INGA 4IS2A 5COAA 4CL8A 1K2WA 1X0VA 3E6AA 3GMSA 2PK3A 3EVNA 4B4VA 4ZRMA 3I6QA 5A5FA 3WMWA 3ZWVA 1NQAO 5T8KC 3AUTA 4CJXA 1E7SA 4NU6A 4DXHA 1R0SA 1P1KA 2G76A 3A9WA 4BUCA 4CM9A 1E6WA 5A4DA 1W73A 1IHYA 1PGJA 1Q7CA 1LQTA 3FBTA 1A72A 1PGQA 5JNLA 1HSZA 4Q3NA 1XA0A 2EJWA 2IYPA 3HDJA 4D41A 3VPGA 1OC2A 3JSAA 2NTVA 4FC7A 5KJFA 1ENPA 2ZB7A 5JY6A 3V8BA 4BO6A 3F5SA 5GZ6A 4E6PA 4DIBA 1WMAA 1YQDA 4RDIA 4WNIA 1C0PA 3HUDA 3KSDO 5AXCA 3JQGA 1HT0A 4J16A 1QMGA 4XA8A 4XQEA 4CLOB 2JL1A 3JQAD 3L6OO 5A3JA 4E5MA 4OOFA 1EBFA 3P19A 2P2SA 4DRYA 2DBZA 4MVJD 2PH5A 2D2IA 2VT2A 5DCUA 3WLFA 4CM3A 1CJCA 2LDXA 2I99A 4AJHA 2OBNA 1XQ1A 4NU5A 4J0FA 3PGXA 4MKZA 1T2EA 4PLZA 2NVUB 1A7KA 4BB6A 3AM4A 3RD5A 1HDOA 2HU2A 4OHUA 3F5QA 3RI3A 4ZQFA 2GNAA 3GVHA 4I5FA 5JFOA 3WGQA 1MC5A 1ZK0A 4K26A 3JV7A 1BWSA 3RFTA 1LDYA 4ZJUA 3TPCA 3UUWA 2YQ4A 1GZ4A 4BKUA 1Z73A 3DTYA 1PIWA 1B8VA 1E3EA 4LISA 3IP1A 1AN9A 3RUDA 2W98A 2D5CA 2QX7A 5JBIA 2GGSA 2Q1SA 2ZATA 1D4FA 1H2BA 1J49A 2RH8A 5H82A 4BO7A 3WXBA 4LVCA 1R4NB 4BO3A 5EL0A 5IXYA 3D4OA 1KC3A 3WBBA 4HNGA 3DZKA 4RVUA 2FWMX 2WE8A 4RF2A 2DUWA 4GBJA 1I36A 4EJMA 2PV7A 1NFRA 3GEGA 3JYLA 2ZCVA 3D5TA 4I5EA 4URFA 4N5NA 4XRRA 3ZZNA 4EITA 3UICA 4IM7A 5A9SA 4ND2A 2NLOA 4J7CA 3QVSA 1Y1PA 3IL2A 3WBFA 1PU2A 1ID1A 1XU9A 1DDOA 2AW5A 3NGXA 5G4KA 3TOXA 1QYCA 2B0JA 3ZU5A 4F6CA 1YL5A 4AJLA 3B6ZA 1O95A 2O4UX 3B1KA 3NTRA 3HB5X 1ML3A 3PLRA 3A06A 1P33A 1R6DA 3DBRA 3B1JA 2ZYDA 1JA9A 1B16A 2WMDA 2HUNA 3NEPX 3INTA 2I3AA 5ILOA 1B3BA 5KWEA 1E1MA 1YBVA 4BMSA 1NWHA 2RHCA 1SC6A 3HHPA 3IJRA 3AOGA 1DB3A 2VYVA 3W8EA 1ULSA 4R3NA 1VL6A 3ZH2A 4CM7A 4RVSA 5TNXA 3JQBC 2X7HA 5IG2A 2OZPA 5ADHA 5B1YA 1PGNA 2B4RO 1IPEA 1T4BA 1GUYA 4IDAA 2FRDA 1U3VA 3I4FA 5F5LA 5AQ1A 4OIMA 3DZIA 3NV9A 1NR1A 1PZHA 4YJFB 4TVBA 1F14A 4KTVE 3JQAB 2I67A 4GWKA 1DOHA 4I9UA 4PLYA 3T7EA 1DLJA 2O4CA 3BHIA 1N7HA 5KVVA 1NVGA 2VZ8A 1NFQA 1SCUA 4WLFA 1N9GA 1L7EA 1MX3A 2Z95A 2QYSA 5DOVA 1ZFNA 4IQ0A 1KIFA 4A03A 4CV0A 4GMGA 2VUUA 4P8RA 5AXBA 4R01A 4PG7A 5DULA 1B0AA 4Z9FA 4RF5A 3L4BC 3NDRA 3RBVA 3I9LA 2ZCUA 1IL0A 5J23A 1ZIDA 3GG2A 1N5DA 1NXQA 5EESA 5ENVA 4E30A 3D1LA 5IDYA 3ZWWA 1MB4A 1ADFA 1UXHA 5CEEA 3KV3O 1DC4A 3NX4A 4E21A 2BGMA 3ZGYA 1E7WA 5C3MA 2VWGA 4LGVA 5DDIP 5HWSA 2DQ4A 2Q50A 4CLEA 3MJTA 3JYQA 4XDYA 4QO7A 1HLDA 4HKTA 1ZK4A 1EMDA 1XYGA 1EE2A 3PXXA 2BD0A 1ZJYA 2Y67A 3LC1O 3ZU4A 4KUHA 3NTQA 3PHHA 4BNJA 1QKIA 3TZCA 5IDXA 1GTMA 3Q1LA 3KYCB 1E3SA 3MJCA 3BTSA 4ZA2A 3CXRA 3RROA 4YT5A 1DC5A 1ENZA 2PR2A 1DSSG 3MJVA 4PVDA 1D1TA 4JCOA 4TZTA 1TXGA 1PJCA 2DBQA 1Q0HA 1YVEI 2FOIA 4YJGA 4FFOA 3GGPA 1PEDA 4HFNA 4J6FA 3D7LA 3ANNA 2Y93A 4RPHA 2GYYA 1Y81A 1F0YA 2HAEA 3FNEA 3Q0EA 4AJOA 1LUAA 4KDEA 4U0KA 3OHSX 5JMPA 2X9GA 5G0VA 1C0IA 4XR4A 1GUFA 3F4LA 1NASA 3KO8A 2NV6A 4GX0A 3JQ7B 2PWZA 1DFHA 2GASA 3TWOA 2FMUA 2NQ8A 3C7DB 1PJ4A 1QR6A 2BFOA 1A9YA 3MZ0A 2HJRA 4RLHA 4XEHA 3WFJA 3UXYA 2PGDA 3DC2A 5C37A 4AJ2A 3RQSA 4ZN6A 3EY4A 2OHXA 3EW7A 2ZYGA 4XD2A 2B36A 2FSVA 4BGEA 4O6VA 5L4NA 1GR0A 2BELA 4N18A 3ZWOA 3A1NA 3K2BA 1P0CA 1E7QA 1X14A 1BVRA 2Y0EA 5LDHA 3EGOA 1A9ZA 3VZPA 3FWNA 3NGLA 3ZWXA 1IYZA 1BTOA 3SC6A 3HDYA 2FSSA 4W9NC 1ZXBA 8ADHA 5IFLA 3E9QA 4YT2A 4MOWA 4EEZA 1GYRA 4EZBA 3HE3A 2Y05A 4BNUA 1GCUA 5JDCC 1IZ9A 3GPIA 4IXTA 1YBAA 3NYWA 4XX0A 2QW8A 4CPDA 1NAIA 3AI2A 1P74A 4XJTA 3K2EA 2E4AA 3OEWA 4IJUA 2OGUA 2EG9A 2JAPA 2HK7A 2PA3A 4WASA 4WJZA 3BHJA 3GFGA 1WMBA 3U9LA 2E82A 2PH3A 2O3SA 3TZHA 5AYVA 3FF4A 3DBVO 3L6EA 2IYOA 5JDIA 2RH4A 2HLPA 1ISJA 2B83A 3KYDB 3VPXA 3VHRA 5G0TA 3PZRA 3MWEB 2E48A 1BSVA 4E33A 3GHYA 2EP5A
chains in the Genus database with same CATH superfamily
1RJ9B 5CYOA 1AK1A 1C14A 2EHJA 5CVDA 2W2KB 4JWTA 4KFSA 3RLFA 2JLRA 3C48A 2GT1A 4HX2A 5A7GA 1OJ7A 5JQWA 3EPLA 1G3QA 4IO0A 1GNSA 4PBSA 4DMMA 1TTPB 3LQRA 3PDIB 4ZJZA 1JEYB 3SBEA 3PEUA 4U3JB 2FY8A 1OYWA 2H1CA 3C7CB 3BTUA 3G0OA 3N74A 1R9MA 4GMHA 1P3Y1 4PG5A 4QJBA 3SX0A 4HNVA 5BWMA 5JWRA 3KLNA 2ZWVA 2IE8A 4V0OA 4IDQA 3M6WA 2G3YA 1T3HA 3SQXA 1G5HA 2IY8A 2IX3A 4MX8A 3KSBC 2XMZA 4TMXA 3K70D 1DC3A 5CGZA 2C94A 2XD9A 5BPFA 2NU7A 4LEIA 3JPWA 4Q4JB 1IAVA 3MC1A 5CAEA 1QB8A 3F8SA 3LCRA 2I22A 1POXA 3CEHA 3R5HA 4L0DA 3SQLA 4AF6A 2DUJA 2P6UA 3BDIA 3DBHA 3NUGA 1U0SY 4IFBA 3OFKA 1Q84A 3OZXA 4FOTA 3DT6A 4IIXA 3NW9A 2EKPA 3QW2A 4MA4A 2VP9A 4QUAA 4Y18A 3RU9A 2Y1EA 5JSZB 1VSUA 3FCUB 1JG1A 3DDZX 3Q3GE 1IOLA 4IDDA 1FVHA 4H7PA 5DB4A 4TTVA 2HA7A 2JIRA 1R4AA 2XTJA 2VJOA 5FLEX 5K4HA 3G2MA 4GVXA 3T15A 3PNOA 3DEZA 4O63O 1WD7A 3ORQA 1RCFA 5EJ5A 4DB2A 1CZKA 4YH1A 1Q91A 1Z7BA 2W6PA 5CVJA 2JG3A 5MN4A 4Q9JA 5EQTA 4JENA 4Q00A 4JB3A 5LVAA 4W5RA 1AUVA 2C8KA 1WDWB 2N0SA 1YB4A 2PX8A 4FD3A 3RUCA 5K0SA 5DSTA 4FWTA 3B1XA 2HRZA 2OFPA 1PEAA 1M76A 2JGMA 3DS8A 1U0LA 3HGTA 4TTAA 5E38A 5HE8A 2QY9A 5SYMA 2O7RA 1QFSA 3LC2O 5JZMA 3SC4A 2MWMA 2XZPA 2EBWA 1E63A 2ECOA 3ELUA 4FIDA 1S02A 1NN1A 1C1DB 1NM5A 3UG7A 4DWWA 4Y8VA 5EPEA 5BSUA 3B9RA 4FILA 1TVKA 5IH7A 2O19A 4OHCA 3CRZA 1ZISA 4JOCA 3BMCB 1RRPA 2OGTA 3BF7A 1VG9B 1XDZA 3N8IA 5AFSA 2VPQA 4P93A 3N2YA 5B1DA 1SEPA 5CJJA 2BF7A 3BAFA 4P38A 1J00A 2IITA 1RLUA 4Z1MA 3FUXA 5AW1A 4JR0A 5IKXA 5K8LA 1RMQA 1XNHA 2GUWA 4S1OA 2BFCA 4NABA 3DLTA 4B6JA 1KFBB 3RGWS 4TV9B 1FCJA 1XU4A 2IHUA 1OC4A 4NV0A 4DY6A 3OMLA 5BW4A 4CMJA 3UJAA 4AZ3B 2Z1MA 4WXPA 2MMCA 2EKZA 2OBMA 2QOEA 2JGAA 4EPVA 2VBFA 2AG5A 1TCCA 3LH5A 1EFLA 2BI4A 5EXSA 4NG5A 3OJEA 3STYA 4GT1A 5ALYA 1RM0A 4TUYB 3VMMA 5I4BA 1LTQA 3CLVA 4NOJA 1CETA 1N6PA 2XAAA 2Z58A 4JEIA 1IJFA 2EGHA 2YZ2A 3N07A 1FFYA 4MMYB 1YBFA 1WUIS 4JJ6A 1G4HA 4AQ7A 1SQSA 2IQ5A 3PL5A 3FFBA 1BFUA 1ZGJA 2QAJA 3D2BA 4KQEA 4MRVA 3DOIA 3W90A 1AU9A 1ODSA 2TMKA 1HFEL 1OFUX 4GEGA 1S8FA 1WB6A 3C6KA 4QDUA 3VU3A 4MKGA 2DERA 1M75A 2CFOA 1YD7A 3CW2A 4GECA 2GEJA 3VR6D 1UIRA 4EPRA 3OOYA 5HSGA 1TYEB 3LCMA 3P52A 3R5JA 2Y66A 5MFZA 5K6TA 5A7FA 2GS9A 1BXKA 2PMEA 4BX3A 1M8KA 3F6PA 2ZAGA 3U7GA 4GZ5A 4XB6B 1OUMA 4WL0A 1CZRA 3FBWA 4YUWA 3UJ9A 1QRUA 1N6RA 1BC5A 5PGMA 4WKCA 2R87A 2WUDA 1IY9A 3IE1A 2I3GA 2C20A 1IU9A 4KQHA 3TZKA 1EUCA 2YICA 3E9ZA 1RRFA 2IYVA 1GU0A 3I9V6 1KTIA 2G0NA 2JFHA 5EWLA 1DTSA 5DX1A 5HKKA 1TA4A 3K7EA 2B82A 1B8OA 2P9TA 1F17A 3KEQA 1ZPDA 3VKGA 1H9AA 2PDAA 3MTDA 3HCEA 3OZSA 4IO1A 1SUSA 2AQHA 2X0RA 1I4LD 4LY6A 3I2FA 4ZU1X 4HD8A 4OD0A 5FBVB 1M6YA 1SA0A 2VYNA 4M87A 5SY6A 4X20A 2J7PD 3AEUB 1O7JA 1Q57A 4HB4A 4U8GA 4XOIA 2AJDA 5B2FA 4EB6B 4ZO4A 1UPCA 2WD9A 5JUWA 1YHYA 5KX5A 3DYBA 4PLHA 1GG9A 1SXHA 3C14C 4OMCA 3TFWA 3RRFA 4NMLA 2D2VA 3U48A 3TG8A 3Q9LA 4E4YA 3T99A 4FSHA 4C20A 1TCBA 3H2GA 4M22A 4S12A 3EX7C 3GG9A 2P1RA 1DPFA 3NDIA 3OPVA 1HDRA 4YCLA 2VTBB 4FFVA 5LCXA 4P58A 3ZUPA 1H8ED 4EMBA 1GCOA 3KALA 3VJKA 1NFFA 3OQPA 2FR1A 2IYNA 4MW0A 5A4AA 1I33A 3ABRB 2YDXA 4MGZR 3T61A 3QWHA 5F1PA 4B73A 1NQTA 3LT5A 2POQX 3K0CC 2RAFA 5HOQA 3NTVA 1RBQA 1UBNA 4OLBA 4YP7A 3TK1A 1MQSA 2ORED 3GN2A 3IR6A 1T3SA 4CQLB 3EQ7A 4DIOA 1L8AA 2WVJA 4W1RA 2A5FA 1FNDA 3DHEA 2IXTA 2PWYA 1M73E 2J48A 4N8EA 1W5BA 1P62B 4J90A 2GXQA 2OCXA 3F9CA 2O2HA 2QMEA 4NBVA 3A32A 3WZ2A 4NZOA 2GRJA 1I6KA 4NBKA 2KSQA 4TKVB 4ND8B 4ZXFA 3BXPA 1EHCA 1DG3A 3TVYA 1RWNA 1XP8A 2PJUA 3OCUA 1O94A 1EVIA 2AMYA 5EIBD 3JQ6A 1JNYA 5FBQB 4WE3A 3UN1A 3WZLA 5K01A 5ALTA 4MKFA 3FW1A 1KGSA 3QJ5A 4TLAA 3ZBPA 4DCUA 2CL6X 3D0OA 3BFPA 2W70A 3HDGA 3A6ZA 3KHSA 1U1IA 2W43A 1MW9X 1OAAA 5A4IS 1DC7A 5L7TA 4AWXA 2GEBA 2FA9A 1S9HA 2I6FA 5BR7A 4PM4A 4Q3OA 1MVLA 5KU7A 1H22A 2KQUA 4EHFA 3KU4A 3EGDB 4TL7A 1B15A 1EJ2A 1LPAB 2XMGA 2MTBA 5D6OA 5B6PA 2XZDA 4EKYA 1SUAA 3P4UA 5DYGA 4TMFA 3TZBA 4IDGA 4A27A 2ZRHA 4J03A 3UWOA 2GK4A 1TJ3A 1U63A 1GTJ1 2X3YA 2WINI 1Y34E 1MG0A 2YDYA 3EBPA 3JQ9C 4H0FA 4YVFA 5BSTA 5JTTA 1EHIA 1WULS 2QG9A 2F4VB 3THSA 4R68A 4DLBA 2RC6A 3FRHA 3JASA 4Q01A 4D44A 4Z9XA 1WABA 1XXHB 3H99A 2I4IA 1H5UA 1W96A 5EHIA 1KDTA 1NI4B 4RIGA 2VK8A 1CLEA 1VIVA 4D9GA 4EATA 5HVNA 3UT6A 4D7AA 1R4NA 3NP7A 3U17A 1N0HA 2ZVPX 1PSWA 2FG6C 5CFRA 4AICA 1OXVA 2GRAA 1NG1A 4II2A 3ZQKA 2FX2A 4KQWA 5DEIA 5EHNA 3I9NA 3WGTA 3S2IA 5F9MA 3ZOZA 4YAGA 3K6SB 2CZQA 2WKQA 4E5SA 2FZEA 1UMBA 1A7JA 3EG9A 4ITUA 1G8MA 1GTVA 1ECBA 3N58A 4QRHA 3GIWA 4LRYA 1GPBA 2WYOA 2G07A 4JN6B 4QPNA 4ZPJA 1PFGA 4YCCA 3S2ZA 2YTZA 4EGCB 3KFVA 4IIDA 1SBTA 4M1EA 1HT2E 2O2JA 4JP3A 4D43A 5TEWA 3PPVA 4WFJA 1QK5A 4PAMA 5SYNA 5LQKA 3CKMA 1JR2A 1NQXA 3CRQA 1CCWA 1MG5A 4Q3EA 4IKPA 2QMOA 1NT2A 2E1PA 4MV4A 2HZBA 2XVZA 3EFHA 4UCFA 1R5BA 2IVFA 3DHNA 4YAJA 1Z5OA 1JVNA 4LDJA 4XSGA 5I7VA 3H2SA 2Q6KA 3E18A 4G1VA 1BWPA 3I1FA 1MJGM 5GZ1A 3IODA 4HWKA 4URUR 2HF8A 1PBTA 3D8UA 2VOEA 4B2LA 1MGPA 4OQ4A 4DNXA 4B2PA 4B84A 1PZFA 4IZIA 4KRGA 1GA1A 4JT2A 4EUEA 2P8SA 4DR3B 1JXOA 1E1YA 1QV9A 5FWAA 1KI6B 1XALA 2A2ZA 3UF0A 3AUUA 3SN6A 5I7HA 1VCIA 1N6NA 2BKAA 1NBOA 2RJ3A 4I81A 2GBIA 3UK7A 1L8OA 3ACBA 4X1KA 4YRBA 3BT7A 2Y9PB 1KH2A 4GO1A 2C4TA 1FUIA 4QVKA 3PNBA 3SS8A 1RWOA 3DMTC 3H2YA 4KN5A 4M4SA 2I2XB 1AURA 2XOKD 4IGIA 4RV4A 3ZJYA 1QGAA 3JXEA 4RVHA 2XCIA 3JCZA 3VXKA 4AMBA 1XTRA 2ZVJA 3W5HA 4IUCS 4BO4A 2L82A 3B3QA 3X44A 1ZITA 1PAUA 4XYMA 4B5KA 1T4DA 1CQWA 1VL5A 4MP8A 4ALNA 4KTTE 1E2MA 2ETVA 5ALKA 4OAQA 3SFVA 2DQSA 1MA3A 3TLBA 3B1FA 3HPRA 2X0DA 2CGEA 3IRUA 2BBWA 2O14A 4EEKA 1BE0A 2RI1A 1B6TA 1AOXA 2X7XA 3BHMA 4L95C 4NF2A 4FFRA 3L7JA 1DQYA 2Q1WA 3GUZA 1Q0SA 4YECA 5L7YA 4PLPA 4K3VA 5KNBA 3FN4A 5TMEA 1QHNA 3VR4H 5KYWA 4FFNA 4E88A 2H59A 1TB4A 4DT1A 1GRNA 3AFHA 4TRNA 4GI7A 5TGTA 1JP7A 1VQ1A 1I13A 1ZUHA 2LD4A 1N6LA 1SPXA 1TF2A 3P9SA 2I7VA 2PX4A 4UUNA 1MC1A 1TQ8A 1XRJA 1ECJA 3I2YX 5CLHA 4MUMA 5IVDA 5CB8A 1Z6GA 3ME5A 7ABPA 2AOXA 2PD6A 2Y27A 3DJFA 4J3NA 2DT5A 2ZIGA 4HWSA 4XUDA 5L3QA 1C9MA 1CUHA 1BE6A 3PDCA 4LYEA 1SD1A 1SIBE 1JHZA 1HE3A 1WSBA 3KYCA 3SBXA 3QPAA 1MJNA 2A58A 2SHKA 4CMCA 4DG9A 3K70C 1Z8DA 2OOSA 1NPDA 5ICGA 1A1VA 4DR4B 4Y6OA 5IF3A 2HIMA 2JFWA 2WDZA 1T9ZA 3AY7A 2X8JB 4L85A 5F21A 1IN7A 3RSCA 4RZHA 1JECA 4ATNA 1XVTA 1C81A 5DLDA 4BNZA 4F3KA 3WQQA 3KDSE 4PSUA 4F91B 3HR4A 2WTMA 1FMCA 2DLDA 1KOGA 2BFPA 3Q87B 3MMSA 1G6Q1 1WNTA 2IH4A 4BXOB 2VJCA 2ZYWX 2R8PA 1NVKA 1Q3HA 1Y8ZA 2DTXA 4AVYA 2EFEB 3FWPA 9LDTA 1YS6A 3WDKA 2C9MA 4L9SA 3AESB 3OTQA 3AFMA 1W0JD 3P2OA 1UF9A 4IIGA 1S96A 2HSZA 4F92B 3GHHA 3HEAA 4N8SA 3SS7X 3AFIA 3GC6A 4IBOA 1K08A 4CM8A 4U2CA 4A10A 3C3WA 4BQFA 2V7WA 2FZGA 1XTZA 3NASA 4H3HB 4MV8A 4DMKA 1GSHA 2RB4A 1QVRA 3BOSA 3PDJA 4JGGA 3S44A 2GEFA 4ER6A 1YA8A 3WRWA 4DKXA 4MUJA 1T4MA 1EVQA 3K4PA 5IVIA 4EA7A 4R71A 4KR9A 1UQRA 3SX2A 5KBYA 2VK2A 3V7WA 3DHYA 3OCXA 2GSWA 1IUPA 1DAKA 3WISA 2VCEA 1BROA 4C2TA 1FW6A 4B7UA 2ZWPA 5AJVB 4KR2A 3W8DA 2JEYA 2ZDHA 5FTWA 3QFFA 3O8QB 3E1SA 3EH1A 4XH9B 1OLSA 2AS0A 1Q1NA 4MV6A 3FLBA 2XNJA 1ZCBA 4J7UA 4AZSA 2VJMB 2XXJA 3NVDA 4MAAA 1HTTA 2ZVQX 4Y2RA 5ERYA 1SXJB 4WFQA 1E5TA 5CB0A 1X1BA 3K0CA 1SUWA 1H2RS 3THXB 1KYZA 3F96A 4XJSA 3QLJA 2JVJA 1JQDA 3FMGA 4O4HF 3M8KA 5GAJA 4BMDA 2AEMA 2X6QA 4JROA 1YOBA 5CVEA 3M9XA 3STHA 3DOOA 1ODJA 1J7JA 4I5IA 3B8HA 3IURA 2QQGA 3KEMA 2WTXA 3NDPA 3MB5A 4DLTA 3N0RA 5KHLB 1YIDA 3K9LA 4FDMA 2VK1A 3FDZB 2R6FA 4X6LA 2FE4A 3QXJA 5EP1A 3V1MA 4CETA 1TYAE 5JSUA 3W8RA 4DCMA 1WL8A 1THGA 3SR4A 4XLLA 3LF1A 4PX5A 4B3BA 3M5CA 2EZUA 3GLIE 3R44A 1SBZA 3HI6A 4KACA 4AWBA 5LJLA 5AK3A 2PUVA 2RGAA 3U7FB 4Z9AA 2W7TA 2VYVD 3QVXA 5EIWA 4N5DA 4CIYA 4BP9A 3E3LA 1KJ8A 1F4PA 4Y7DA 5JU6A 2DETA 2G9VA 3I28A 1AMOA 2PRSA 3CVOA 4HNUA 1FFXA 2JI8A 2OGSA 3D2LA 3OD5A 1FYXA 3P0EA 4KREA 1AGNA 3GFOA 2XCLA 4UTNA 5MF6A 4MV1A 4GX2A 2VZEA 4HMPA 1CQIB 3AVPA 1CTQA 1Z9BA 3LQYA 1LLDA 3IUNA 1KDPA 3JQGB 2NTJA 3OT4A 4X8LA 2GWRA 5DU2A 5ICFA 1I9GA 1HGXA 2BKLA 1L5NA 1KL7A 1XCBA 4IIUA 3UYKA 1RI4A 3VO8A 2J1LA 2OZLA 2RH5A 4Q7LA 4R69A 5HDQA 5K6RA 1J8DA 1R88A 2PRJA 4IZOA 2L17A 1I2DA 4E46A 3DL0A 1JL3A 1G21E 2AN1A 4KGDA 1X2BA 4EB8A 2ZRBA 2NU8B 4RPLA 5K6AC 1V16B 1ADYA 3ZY5A 3IB6A 1QFZA 1FNSA 1I4DD 5C46F 1A69A 2HSDA 2IL1A 2OCYC 1BJTA 2Q4RA 1G38A 4RXMA 1NBEA 5TEVA 5CD1A 3HADA 2VP3A 4JNCA 1EUDB 1XRSB 4TTQA 1SO8A 2IIPA 2IU6A 3EZLA 3OCWA 4EJSC 1QDEA 4LHYA 3U6BA 1KRHA 3BRWA 5GWXA 1HT3A 4ASUD 3EA5A 2FR8A 3LQFA 3OKAA 2A9PA 4QQRA 4Z3KA 1P4GA 2ORVA 3O2SB 2ID8A 2PWAA 4FNAA 2C2ZA 3V42A 3X2EA 2JH3A 3QEKA 2OM6A 5EINA 3PNKA 4RCVA 4H6PA 4UBIA 2GLTA 3MSCA 3EQ9A 5EZSA 1QYRA 1VM6A 2XKJE 1FXWA 1GP2A 5EQDA 4KZKA 3BTVA 4FFMA 4MMXB 4DJJA 1Z4NA 3CX3A 1O03A 1C9EA 1RQXA 2GD2A 2JGIA 2P9CA 2QIOA 3AHFA 3GAMA 4QTXA 3RC3A 5CFOA 5EYPB 3QV2A 3CIFA 3KP1A 1CR2A 3P9PA 2I78A 5EIHA 3U4DA 1NN5A 1QV7A 3K05A 2R6HA 1WDKA 4MB2A 1JEAA 2FK8A 1X13A 3DGFC 4K0RA 1AXRA 1D03A 2CMKA 2J3LA 3KZVA 3WS7A 1KJIA 3UGTA 1JR3D 3ZYZA 3B78A 5KJEA 4PLVA 3TOSA 3JD3A 3N7AA 3NHYA 3VJRA 3O7WA 4N8DA 4AO6A 3H6KA 2JAWA 2WAMA 5JYDA 3DCYA 3EASA 3EN0A 3I30X 4EQZA 1N77A 1PR5A 1ZLXA 5D3MB 1D3AA 5FOXA 4RC9A 1PJQA 3A2KA 3QPCA 2ZKLA 3DCJA 5C52B 1JKFA 5D87A 1RXYA 3CCCA 2OY0A 3VV2A 4A0GA 4RL6A 2EKQA 3IQIX 5T5QA 4X1IB 3G1UA 1XLUA 2QYHA 1CRLA 2O2YA 4DA4A 3AUFA 3U80A 2CV0A 1OFUA 2HWYA 3D81A 3QYAA 5I9MA 3A4TA 3TW6A 3BL6A 5EIBC 1EBUA 1N6IA 4HPXB 4UEKA 1DGQA 1G2OA 4EKIA 1CW2B 2OBLA 3MTBA 3D2AA 4L07A 2ZPAA 1X7XA 4G4IA 2GXSA 3KFXA 1OXXK 1M34B 4OG2A 5BV0A 4JX9A 4YREA 1ZX1A 3VSEA 3DDUA 5K9ZA 4DV3B 3I2KA 4QXPA 2Z9BA 5DLPA 2GDZA 3TW8A 4LV8B 1R4MB 3HKEA 3OEYA 1YS9A 2JLCA 4AG6A 1X1RA 4NONA 3B36A 4I36A 1DIBA 4D9JA 4YX9A 4NCBA 5KU1A 2CVPA 3GGGA 3MMXA 3MAAC 3R5TA 3C70A 3ROPA 3T5DA 1NXPA 4EQ6A 2ORYA 5CEJA 4QG3A 3ADBA 3D54D 4S1VA 1LJ8A 1SCIA 2FFHA 3LGAA 2AXPA 4PZLA 3SKXA 3FSGA 2PUEA 3AVUA 3GYBA 2VO1A 3HN7A 4MJXA 4W6QA 1B2RA 4EBBA 2AGVA 2QD4A 2DWOA 1MOPA 4JB2A 1GY8A 4YFVA 2RK6A 3TIFA 1OI2A 1X8KA 4CNBA 3HBLA 3S1LA 4DUGA 3T3OA 3DPIA 2B8EA 3W3AA 2F3RA 3BREA 4XD7D 2UXBB 4JLOA 3DO8A 4MDHA 1XSEA 3CE9A 2ZULA 2OCDA 1E64A 3B7GA 3O83A 4I19A 3GLIA 3VUEA 1O96A 2A9VA 2H48A 1X19A 3EF0A 5ALOA 4EPXA 1WZEA 1OZAA 4RGQA 1EIWA 3PNYA 1SBQA 1BWRA 5I7RA 4PWZA 2J6BA 3FTFA 2PZMA 1RQLA 3K0BA 1C2YA 4HK4A 3SXJA 3KPJA 2RK3A 2Q0HA 1UOQA 3U09A 1PWZA 1FYWA 1GADO 4NX2A 3O8RA 2C1ZA 4EVIA 2HQ1A 4N0PA 1HE8B 1KJQA 2WJAA 2O2SA 3DM5A 3FPKA 5JO9A 3TPFA 2IU4A 4KIWA 3ED5A 3RRZA 1E9CA 5T4HA 5JCOC 3WBJA 1PQPA 1IG0A 4UQOA 1KEVA 5I5GA 1UMCA 4UHBA 2QZ4A 2BN4A 4BJ1A 1K5PA 1QHHA 1UXKA 2C2KA 2ZYSA 4FWBA 5C3UA 3EVEA 3RVSA 3PUHA 4X91A 3SDSA 3UFXA 3OPQA 1W9MA 2H3EA 3Q8WA 4MI1A 3AFNA 1HMYA 3BSWA 1IZ7A 2ODBA 1K4YA 1H3FA 2YCBA 3PFHA 2NVWA 4G4SP 4AZVA 3K9FC 2W22A 1EK5A 1EK1A 1G21A 3GJTA 4KQ2A 2J9FB 3ZNOA 3UJDA 1BS2A 4EA8A 1LLQA 4TWRA 4KVAA 2IYAA 4YK7A 3TLGB 3TOVA 3TDMA 1HDCA 2IEIA 1FDTA 2O0LA 3LRXA 4QIHA 3S68A 2QN1A 2VKTA 4IP0A 4HB2A 4KGZA 4ZCPA 4A16A 5DNVA 2ZJ7A 1KHHA 1X7WA 2WKSA 5T4FA 1GL7A 4TMTA 4QKQA 4JUBA 4ZAYA 3U7RA 2NUTA 4KO2S 4U7GA 3U13A 1IWPB 4DSOA 3AP1A 1WCXA 3FUTA 1IOWA 4RWEA 2QJRA 2IU0A 2J3QA 4ZVSA 3RVRA 3C5CA 5FWNA 4MQ5A 2EQBA 4AJEA 4B4DA 3EEOA 2PX5A 3JQBA 4RF4A 2PANA 5I7AA 2EFDB 2XBLA 2AJLI 4Z9YA 4PYOA 2VUIB 2I2WA 3Q6NA 1DX9A 1F0KA 4M60A 4QDKA 3C16C 4HDMA 4LUCA 2XIJA 2ZUDA 1JJAA 2BE7A 1JKIA 1T5DX 1ZC4A 3CE6A 2YN2A 1G20E 2Z3VA 3H86A 3PDWA 5ARCA 2IIQA 3OKFA 1NVUQ 3OQ1A 2GFIA 4HXEB 4Q1AA 3VDRA 3VR2A 1R12A 1M0EA 1W36B 4P83A 2GMWA 4F5WA 2OP1A 2Q99A 1XZJA 1DCTA 4M0UA 5LJIA 3OZEA 2GEVA 1RYMA 4B3GA 3AI1A 5T41A 2QQEA 4PZZA 4R1TA 5HX7A 2DR2A 1QHSA 4MIEA 1RVDA 4ZI7B 1PR0A 3FKQA 2YH2A 4F1KA 4EG4A 2FWAA 4EW2A 1ZG3A 2QRZA 1BKDR 1JDJA 1S01A 5AOVA 3LO5A 1SVWA 3S2GA 4BQNA 3HYRA 2E18A 5KNCD 5K0JA 5CDGA 2Q5OA 4L5YA 2D1RA 2EAUA 4FK8A 1DAEA 4DDKA 1LTKA 4RY9A 2WTBA 3WRYA 3VQTA 3KB8A 1I7NA 2W2OA 5KB3A 5CYFA 5FPQA 1N2BA 4EVRA 3D2CA 2R8ZA 4S24A 1SCNE 2O8BB 3G1WA 2PSEA 1KVSA 1YB7A 2Q2VA 2KB0A 1AKTA 4FNGA 4KN6A 2AKAB 1OZGA 3HO1A 3P0IA 5IARA 2B99A 4LNHA 4CKBA 2ZR0A 4PSAA 4UHHA 4O02B 3C3CA 1OWOA 3K09A 4MEJA 5CFMA 5K6AA 3K3PA 3RU7A 1DKNA 2CBZA 2XQKA 3N9IA 4X54A 3FF1A 2VQ3A 5IUKC 1QVVA 1YDMA 2BPOA 4QPDA 3MF4A 5KTSA 2O8DA 4KWCA 5LA6F 3OQJA 2NP7A 1QB7A 3AEKA 1IEWA 1G8HA 2V9ZA 1LX7A 1VJDA 4KXQA 4PN3A 2DUMA 1FX1A 1NBHA 1FMJA 3B82A 3DGEC 3LBHA 2O6HA 2XVAA 2XNHA 2CUNA 1JPUA 2X41A 3PFGA 3PRJA 2JFOA 5FBLB 4EJSA 4JI0B 4NNPA 2YWRA 2WF6A 4PO9A 2IX9A 3ZVRA 1XZQA 3SJZA 2E55A 3CF2A 4US1R 1V1MB 1ZC3A 4DSAA 4F5ZA 4KJZA 1IMJA 2R1TB 3C5WP 3DXZA 3WOHA 1VPVA 3L8CA 5YASA 4FLMA 1RPNA 1T25A 1DNPA 1S2NA 1W19A 4JJGA 5JJLA 2YBEA 4LW8A 1EXWA 4L75A 4OHVA 4NMMA 4IIJA 5LXTF 2WQ7A 2QRGA 2VJLA 2WHEA 2IIVA 2QZ9A 3D7KA 5H68A 5F76A 1JJ7A 3RS3A 3WWDA 3ICCA 3FIJA 3WTCA 2WSSD 2OHIA 1A76A 1DBQA 3WNCA 1J1ZA 1H9CA 1OZFA 3L1VA 1MJFA 4O29A 1NUQA 1MO5A 3UKJA 1JIVA 3AX6A 5THQA 2GPJA 5B3KA 2ZRJA 3V8VA 4M9ZA 2NU7B 5C35A 4HHEA 2FHPA 3DQPA 5CAEB 1PL8A 2Q3MA 3A2LA 2AOUA 2NSDA 2H9AA 3DBHB 2JRLA 4KK3A 2Y0DA 3HJTA 2B7LA 4OHBA 2BBTA 3G02A 4GXNA 4DPMA 3C6BA 5EJ7A 4BX0A 5FBZA 1KMQA 2R25B 4CG1A 2CF5A 1ACLA 3UKDA 4D82A 3CINA 4AT1A 2DKOA 3BTOA 3ONDA 3U7QA 4FNOA 1LW7A 4I7EA 5BWNA 1CX9B 2GJ4A 4Q1VA 3GUVA 3GVXA 1HDYA 2YHBA 4LJYA 1ZRMA 4L73A 3B9PA 4OU4A 3C6MA 4F3CA 5M2QA 2DE0X 4IJ5A 1G8PA 3FCAA 2Z6VA 3UHOA 5F73A 5CFNA 2B37A 1YR3A 2WBLC 3P4XA 3OEEA 4G0OA 3RRXA 4PX2A 4OKSA 2AJ8A 3NBQA 2IEDA 4ZODA 1L1RA 1DWQA 1T8TA 2V5UA 3DL7A 4MJLA 3BORA 4R7GA 1OQAA 1ZUNA 4OXYA 1ONPA 2B2CA 3CF6R 3AONB 1V43A 3BWEA 4ME6A 4NCHA 2IE0A 1KEEA 1QG2A 4DCCA 3K6RA 2C2XA 5IN5A 1NQVA 5JBNA 3GBPA 1DKLA 3T6KA 4A3SA 2PSFA 2BFNA 1EFPB 3E0QA 4TYPA 8GPBA 4UM5A 1OTHA 3E9EA 5E6SA 5GJBA 3ND7A 1OV4A 3IIEA 4KO3S 4LV6A 4M0MA 4HCJA 2FMFA 4X00A 4ZMBA 1TVKB 2R751 4C78A 2C2GA 1A4RA 3GEPA 1UODA 2PKQP 1XMIA 2YOFA 3MQFA 4J9VA 4LHWA 1PI3A 4O4IB 4GYJA 4YQEA 1RM4A 1B6RA 1VXRA 1CUAA 2RHBA 2VQSA 5A5VA 2RH9B 1ADGA 1G20A 1P7VA 5G0UA 3FDFA 4XFKA 3UK6A 3VC1A 3CUTA 2HNAA 3JSXA 3OPNA 4I2VA 3LZDA 3R7LA 4UARA 4ZOCA 2AFIE 1N25A 3DMYA 3BMOA 2P6PA 4PWYA 1DAFA 4G0QA 1EDZA 1KE1A 1QPGA 4NBTA 4KL8S 4IXNA 4M1MA 1FS6A 4IILA 5CDFE 3B48A 1HF3A 2PVSA 3CH7A 3V8QA 4GLLA 2IXBA 2C9ZA 1MPTA 3DDCA 4M38A 2YYZA 4MJ3A 2HJ9A 3RV3A 4EYEA 4PNPA 1RADA 4MGEA 4BIMA 4O3FA 3W2GA 1CY8A 1I3NA 2XT0A 4UHDA 1IATA 3V33A 4ZHQF 5F3WB 3DE4X 2R6R1 4YPOA 2E4WA 2XWBF 3NUZA 4YXWD 1HYBA 1KI1A 1Y4AE 2HMUA 3LVFO 4MO9A 4UEOA 4P08A 1E4YA 2H8KA 3NIFB 1G7TA 2GZRA 4PYIA 3R9KA 1A50B 2JFQA 2X4IA 4LOJA 3A31A 3CBGA 5JCZA 2UXCB 1ZM4A 3A4YA 3F7NA 3OO0A 1JIXA 1GGVA 2TMYA 4G1EB 4CV2A 1PZGA 4ZEMA 3NS7A 4WOPA 1MQAA 3P9RA 1QONA 2YWJA 1V8ZA 3PI6A 1POWA 3CGGA 3IV9A 4IUYA 4UOQA 5JXIA 1Q12A 1FQWA 2O2CA 4UAJA 2BFDA 4JI4B 3EZ2A 5LWHA 2WWVD 1H8HA 1XQ6A 2HFJA 3H8JA 1P2GA 1XHFA 2HGZA 3I32A 3M1YA 1E5QA 2Q07A 4RESA 1F8UA 3JQFA 3NM5A 2WZDA 4R1LA 5CBPB 3QG1A 3LU1A 4XCVA 4KXUA 3PIIA 4JB8A 1AF7A 3I6IA 1CKEA 1VBKA 3WMXA 1T9CA 4DJFC 2WK1A 1T5SA 2PQ2A 2Q1TA 5D85A 5DT2A 3SCZA 1C0KA 1CLUA 1KEWA 2H2IA 4DV5B 2PZBA 1P81A 1E1CA 2OHVA 4P22A 4ZV7A 3ZWMA 2ZJAA 4CTJA 5KSOA 1DKRA 4RFSA 1MJGA 1FVXA 2IYYA 1MB2A 2ZSBA 4NFSA 1LF0A 5AW9A 4A2PA 2CLLB 2XWJI 4HEHA 3UBTA 3FJOA 3GQVA 5HXAA 2RIPA 5JASA 3UAWA 4MS4B 1Z0DA 4BB5A 3NIGB 3H2ZA 4MWCA 4RKQA 2NZYA 2PMCA 5JSQA 2YL2A 5AKKA 3H9BA 3R41A 3IDFA 3X3HA 2DFNA 1SUDA 1X94A 2P3SA 3BK2A 4UEWA 2Z6UA 1PNVA 1SB8A 2DUNA 3ZL9A 2AWNA 2GBFA 1NF3A 1QFXA 5JIBA 4HTFA 1MKYA 3MB8A 4ZVKA 3PPXA 6YASA 1H3EA 2ZIAA 1E2QA 1U9IA 2XD4A 3HZHA 3PU6A 3R0XA 4J2HA 4KQGA 4QAQA 5D2CA 3KUDA 5HNKA 4AYWA 4XRGA 1WBDA 1H0RA 3RUHA 1B43A 4NOKA 4C4PA 4F38A 4QU0A 4MNTA 1NF8A 3PFWO 2I8AA 1X1SA 1C7JA 1XEFA 3WLMA 1TMOA 3AETB 4AXXA 1XRRA 2X5NA 1XGKA 3OECA 2GCIA 4LRTB 4DTIA 4I8XA 1OTYA 1F3LA 4G5YA 4A2WA 2QN9A 3CUEF 4E22A 1Z38A 2FZ5A 2J59A 4M89A 4J2OA 3E8SA 2BHRA 2DM6A 1MLDA 3PB3A 1C4XA 2BCEA 1L1FA 1CK4A 5C5DA 2CLCX 3AVXA 5U4XA 2QN3A 1YQGA 1DEXA 3EOZA 4JL5A 3UHAA 4GMXA 1V5WA 1CYEA 2H9IA 3I9FA 3JRWA 2D8MA 3T5BA 2BGIA 3C85A 4KWEA 4DLKA 2RGRA 3LD9A 4HQOA 2WAAA 4M1YA 1YRYE 3O4VA 4UBNA 3ZY3A 1KK1A 5LP1A 3KOWA 1E3QA 3KR1A 4P3XA 1ST3A 3NHMA 3FDIA 3KKOA 3NHRA 3E9YA 3RRYA 4PIPA 1S3IA 2XQFA 1SOVA 5E3HA 5H7XA 3G8CA 2VH2A 3HFGA 5LZ8A 3KOXA 4MUHA 2XUJA 3T3HA 4E1AA 3MS7A 3TRDA 1JU3A 3FNHA 1AB5A 2NU9B 4BQEA 5IJ0B 3DV2A 3P9ZA 1Y3AA 4PSCA 1J0XO 4W1SA 1QZXA 3W1WA 2RGWA 4YC7A 3DF9A 4KBGA 4FM9A 5GVSA 4OP3A 4JI2B 2D06A 2XQIA 4YAWA 1I6LA 2GAAA 3DLPX 3U60B 4N7JA 5ESRA 4EB0A 4BVEA 4F4FA 5EJEA 2P3QA 4CCWA 4GQBA 1MOQA 2AFIA 9ATCA 2C88A 3FPJA 3NQ41 5AK0A 5TS2A 1TFRA 1NDUA 2WU8A 5JNSA 1KP2A 2CJWA 4D92A 2MT9A 2YV2A 3TTYA 5CDFA 1EM8A 1X80A 2DC1A 1AXEA 3LBAA 2C4VA 1DRKA 1V4BA 3ASVA 4MARA 3AHJA 3A7DA 2R6ZA 4BV8A 3P5SA 4R0VA 3IJEB 1NOKA 5BW6B 4RE5A 4GG1A 4PG8A 4S0ZA 5TPZD 4XQGA 1NDQA 3K1JA 4XAQA 4GLBA 1M3SA 4RK0A 2ZANA 3QFCA 2AL7A 5J2UA 4L22A 4YRCA 5AOAA 1T1RA 1LSSA 3GRZA 4LQCA 3H7IA 4RNCA 5KC8A 3DAPA 3LBYA 4X5OA 4ZOLF 1ZL2A 2H00A 1KYQA 2C4NA 1CRQA 1G291 2ZAYA 1FRFS 3EG9B 5F12A 1SOAA 1YULA 2CDNA 3CIOA 2JGDA 1E3LA 3HKCB 3LL7A 3EXG2 3FYSA 4AQDA 1Z2AA 1T1EA 3MJ4A 1E4EA 4M98A 1CRPA 2IGTA 5ERXA 2R8XA 5DNAA 2ZB3A 3U5TA 3QXCA 4F46A 2IYWA 1R27A 3Q7QA 3CB4A 1PO7A 5BSEA 1SJ9A 5IT0A 2XUGA 4AIIA 1B1CA 4CTOA 1E4VA 4JL6A 4PR0A 2YZ7A 1EWRA 1WXWA 4O4LF 3RJ9A 1LJUA 1Z18A 1Q0ZA 4NZYA 1CBUA 3ZIUA 1CU1A 1JDPA 2CNKA 4RMJA 3FY4A 4ZTZB 5FNZA 5AKIA 1PWEA 5D3ZA 5A3RA 3B53X 2ODAA 3GLHB 4HDSA 3PUZA 4O2BB 4AS3A 2EW1A 1F1JA 4E5UA 3T3EA 1IEVA 4MKXA 5ITZA 1V37A 1W4ZA 2ZWMA 5TMDA 4E94A 1BVHA 1FYFA 1T6ZA 4ACBA 1MRSA 4MVJH 1CY7A 1IZYA 4ILKA 5IAJA 2R5NA 4BWYA 1I3LA 1KEPA 4UOZA 3WL6A 2ONZA 2J5RA 2QQ0A 1NXOA 4P3PA 2VAMA 1ULTA 3WDSA 4EO7A 1XZKA 2FX3A 4GXRA 2I2BA 4QYSA 2FKNA 1EZZA 2VOJA 1RP7A 3GRUA 4BIIA 2ZZMA 3QA3E 1IZZA 5HTKA 2J9YB 4EABA 3EWSA 1BMFD 1KETA 4NZNA 1JTVA 3LY5A 1IQ0A 1GGNA 4PYQA 3CW9A 3QWAA 1QIEA 2UDPA 5AR1A 4DCTA 4EHDA 4TL9A 1RI5A 1X1CA 2WUVA 3DWFA 2W6JD 4HS9A 1DCKA 1SY7A 4OQZA 1HURA 4CIAA 3ZG6A 3UJPA 5AJUA 1FRNA 4YO8A 3T12A 3WKCA 1TF5A 3RFVA 3IKMB 4OI2A 2UYOA 5CMLA 2DHQA 3OIUA 2F1JA 3GW8A 5KSWB 4CKEB 4FOSA 2Q45A 2FZ4A 5FUXA 1QTQA 3BH7A 4ZP1A 1U02A 1PRYA 1GRRA 1N5JA 2WFAA 4J1TC 5TQVA 1DFGA 3NNDA 1GZHB 3I83A 4BLPA 3GN1A 2XJ4A 3K5WA 1T3LA 1XAJA 1Z8FA 1I0ZA 3A9RA 1X1EA 3EY9A 1UCFA 1GNTA 1WW2A 3VHXA 4AL4A 3IXMA 3L8ZA 4CG3A 1PCXA 5AW0A 5KYWB 1H4TA 5LQNA 4MA0A 3UW1A 3ENVA 3O8OA 2ODNA 2PFSA 1XDBA 4RHEA 4W9RA 1W7AA 2H1HA 3B51X 2FW7A 5FUMA 1D2GA 2SCUA 4ENSA 3HDQA 4LJ7A 1WSDA 3Q6IA 2Y1GA 3MCZA 1QYIA 3C39A 3DDNA 3QLTA 4X97A 2AEFA 4GMKA 3D64A 2X40A 2C99A 4WI1A 4JYAB 2WVGA 3NHLA 3QF4A 4YP9A 5JH7A 8AT1A 5AH0A 4AXBA 1H6AA 3KOOA 3TMKA 1J07A 4B34A 4NQZA 4JXJA 4LYDA 4I3GA 1HTBA 4ZHSA 4HWPA 3I73A 4G97A 2V7BA 1D09A 1HORA 1BDIA 1EUZA 4WWHA 4PZPA 1ZGZA 4ZTUB 1X86B 1U3WA 2WRZA 4J1SA 4LBVA 4QWMA 2J3IA 3JYHA 4LFCB 5IBQA 4MLCA 3TGPA 5CHYA 2P2LA 1V4NA 3BGSA 3HDVA 5DSXA 2V65A 1J0EA 1RP1A 4QULA 4X7BA 3KLMX 5AM3A 5JW6A 1ELOA 4OHXA 4XB1A 1YRWA 3DP7A 5TMPA 2HIGA 4ZCLA 3V4PB 1Y63A 3H87A 2FEPA 1P9LA 1JDBB 3AYXB 1I5OA 4QBIA 2LKCA 5FADA 2F3SA 3CZ9A 4AKEA 4CNQA 3RJ5A 3NAQA 5ER9A 3QUTA 5L4LA 1TU0A 3OQOA 2NIPA 4IH4A 3EGXB 2BZ1A 4JX8A 4WKBA 3ZGOA 4CM8B 2R8EA 4E1VA 1H2WA 1TVEA 2PSDA 2Q3LA 2YJ6A 1HE5A 3EEQA 4KNWA 3OU2A 1A96A 1G3IA 3VYSB 3FE2A 4RYLA 1CDOA 4DVJA 4NESA 4IOMA 2EJVA 2Y1FA 5CXXA 1JTFA 2W00A 4F06A 1XT6A 3DBRB 5MGBA 4WLEA 1ZMBA 5H16A 2P2GA 5B4TA 1OXUA 1I2ZA 5CLQA 3H13A 4JQCA 2E21A 1DO8A 1Z8NA 2DR0A 4W9MC 4GX1A 2R4UA 1E20A 1I01A