3SXPA

Crystal structure of helicobacter pylori adp-l-glycero-d-manno-heptose-6-epimerase (rfad, hp0859)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
324
structure length
310
Chain Sequence
b'MRYIDDELENQTILITGGAGFVGSNLAFHFQENHPKAKVVVLDKFRSNPSSLGHFKNLIGFKGEVIAADINNPLDLRRLEKLHFDYLFHQAAVSDTTMLNQELVMKTNYQAFLNLLEIARSKKAKVIYASSAGVYGNTKAPNVVGKNESPENVYGFSKLCMDEFVLSHSNDNVQVGLRYFNVYGPREFYKEKTASMVLQLALGAMAFKEVKLFEFGEQLRDFVYIEDVIQANVKAMKAQKSGVYNVGYSQARSYNEIVSILKEHLGDFKVTYIKKHTQAHIEPTILDLDYTPLYDLESGIKDYLPHIHAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-L-glycero-D-mannoheptose-6-epimerase
publication title The crystal structure of ADP-L-glycero-D-manno-heptose-6-epimerase (HP0859) from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Isomerase
total genus 111
structure length 310
sequence length 324
chains with identical sequence B, C, D, E
ec nomenclature ec 5.1.3.20: ADP-glyceromanno-heptose 6-epimerase.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sxpA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3sxpA02
1F14A 4G81A 4EUFA 4FJ1A 4IDFA 3VC7A 5J23A 5BSGA 1IPFA 5JLAA 3PPIA 3VDQA 4CM4B 3RROA 1JDJA 2X5JO 3KYDB 1Z7BA 3ZCXA 2B4TO 1QLJA 5EQDA 1ISFA 1NFFA 3NX4A 3QLJA 4NBTA 5A03A 1T26A 1T1SA 1O5IA 1DFIA 4RVSA 3JQ7A 4B4VA 1MA0A 5JAQA 4YPOA 2B83A 5CDUA 4L74A 5G0UA 3FWZA 1NFRA 3F6YA 1CDOA 1HRDA 1SOWA 3VH3A 3JTMA 1U5CA 3WYCA 2HK9A 5HBRA 1UP6A 4IDEA 2VHXA 2JFHA 1GZ6A 3ZWAA 5DOVA 4TRRA 1ZK0A 4NDNE 4DPLA 1NWCA 5FWNA 2PZKA 2Q2WA 1LRKA 3E48A 3FR8A 1TT5B 3JQAA 1QXSA 4PLGA 4QTZA 4ND2A 1ZFNA 2B0JA 3ZNPA 4K6CA 4UVDA 1H94A 4J1SA 3PJEA 5IFLA 4BNKA 4KDFA 4HNGA 3WICA 4HBGA 1JAYA 5L53A 3FR7A 3ZWXA 3EY4A 4MVJF 4Y9DA 4OSOA 3QVXA 3RFXA 2D8AA 4ALJA 4EDFA 4PZEA 3HB4X 4NBRA 5A06A 1U4OA 1PQWA 2EKLA 1L7EA 5I9LA 4J9VA 4NFYA 1YDWA 1RM3A 2HQ1A 1MP0A 3KXDA 4RORA 2P5YA 3FTPA 2C7VA 3WBFA 2IXAA 3LC7O 4YJHA 4DUPA 3HDJA 5F1KA 1E3LA 3DQPA 4WK6A 4EYEA 4R5MA 3PFWO 4BB6A 5CEEA 2UDPA 1E7SA 4JX8A 4WEOA 3O9ZA 3QWBA 2Y0DA 2C20A 4DTIA 2OBYA 1XYGA 1Z73A 3NV9A 4XB1A 3VTFA 4BKOA 3T7EA 9LDBA 4IDBA 2BI8A 1Z6ZA 2GSDA 5LDGA 1R0LA 2HMTA 3ROQA 4Y6RA 1JLLA 4KDEA 4PG8A 5A02A 4A10A 5F1PA 2ZTLA 4KZPA 4GVLA 1PL7A 4XQCA 3RUIA 2WSBA 4HKTA 4FFLA 5A5FA 4NJMA 3AM4A 5CFZA 1QYCA 4LGVA 2UV8A 2NACA 3DMTC 4OL9A 3H2SA 3L0DA 4WOJA 1Q1NA 4I1IA 1EE2A 4R51A 3FN4A 5DOZA 3WIDA 2WYVA 4JP3A 1R4NA 3P19A 1O6ZA 3MJSA 1FDTA 4S1VA 1ZK3A 1E7YA 5CEJA 5KJEA 4WNCA 1HL3A 2VZ0A 3NTQA 3E8XA 2VNAA 4AJPA 5IJZA 2V6BA 4WE3A 2XF8A 1V3VA 2IZ1A 3R1IA 3HJAA 4BNYA 1NX6A 1H6BA 1Q7BA 1HF3A 3GMDA 4W99A 4EI2A 4E12A 3GGGA 1H93A 4BNWA 4AJOA 2YV2A 3R6DA 4HNHA 4HV4A 1Q0HA 1A4IA 2HDHA 1KC1A 2YZ7A 5B37A 3GT0A 5T5QA 3V2GA 4BS9A 5GZ3A 3JD1A 1WVGA 4II3A 4BV8A 3KETA 2Z95A 5CAEA 4GQAA 4IM7A 3K9QO 4UUNA 1I33A 4TRNA 5T6BA 3L6EA 4MP8A 4PFJA 3TOZA 2QX7A 1T2AA 3DZIA 1LRLA 2O3QA 4U0JA 4CLRB 3H7AA 4NJOA 1BSVA 2E37A 2PD6A 2VYVD 3RU9A 3UUWA 4YJGA 2X9NA 5F5LA 1QYXA 2VYVA 3JQBA 2OMEA 3RUEA 1SB8A 4AJ4A 3UOGA 3HE3A 2PH5A 1K6IA 5A9TA 2BELA 2GUGA 2X0RA 4XRRA 5DULA 3GFBA 1A7AA 4R3WA 1LJ8A 2UYYA 4E5KA 1LI4A 4YYZA 4FIZA 1TXGA 3PHGA 2X4GA 3PP8A 1CERA 1TEHA 2ZTVA 3F5QA 1ENOA 1FDWA 1VM6A 1YO6A 3KOUA 5IZCA 3G79A 4PG7A 4YTEA 3KV3O 1GAEO 9LDTA 1G0OA 5ITWA 4QO7A 3M2PA 4B3JA 5JYDA 2VN8A 2Y93A 4WLEA 2Q50A 3PQEA 4JBHA 5I8WA 2XAAA 4A5OA 1DJQA 1MFPA 2XPCA 1G0NA 4BMNA 3GDFA 1WP4A 3PVZA 4L73A 5JAMA 2GZ3A 4J1TA 2PLAA 2FR8A 1HZZA 3HG7A 1UZMA 3JYOA 4QUKA 2DKNA 4FOSA 3U3XA 4B7CA 4RL6A 3ROPA 3L4BC 4DC0A 3DOCA 3AOEA 4UVHA 3JQ8B 1IZ0A 2H5LA 3UGKA 2Q1SA 4H3VA 3ITKA 4E5MA 3LZ6A 4JIGA 3RUAA 3GPDG 3W4JA 4BGUA 4GI2A 4N18A 1MG0A 3ULKA 5KVCA 4QX6A 4FOOA 3E5RA 3GEMA 2P91A 2VWPA 4WLFA 1UUFA 4FN4A 4K26A 4OJNA 4WLNA 3EK2A 1ENZA 3C1OA 4GKBA 3C7AA 3BMOA 4GX5A 3ZN2A 3F1LA 2QQ5A 3ASUA 2WD7B 3F3SA 3PHIA 4R68A 4A7PA 2X0NA 3AFMA 1KC3A 2GDZA 2OFPA 3E82A 4XYGA 1CQJA 5I9NA 3WSWA 3GZNA 5JYEA 3GVHA 1X7GA 3U5TA 2J3KA 5K9ZA 2Z1NA 5L7TA 2BF7A 1QORA 3OA0A 4NBWA 4WPGA 4Z9FA 4D7AA 3MJ4A 2GPTA 1UZLA 1Z74A 3U62A 2EV9A 3D3EA 5CHEA 1Y8RB 5IN4A 3JQ9C 2FSVA 3D0OA 4D44A 1G1AA 1DIBA 2HCTA 1P45A 3S1LA 3WLEA 4E3ZA 2JCVA 3C3XA 4GSLA 5IDYA 3JQGB 1OMOA 1XKQA 1SCUA 1HE3A 1VI2A 3M2TA 4XB2A 1XLTA 2X0IA 4DIFA 2X58A 2V6MA 4O5OA 1JVSA 1XSEA 4CLOA 2AQ8A 1GCUA 4YT5A 2IEBA 6LDHA 1KVUA 4CMGA 1YWGO 1ZMTA 2R2GA 3OIGA 2O3UA 5JSFA 4A2CA 1ZK4A 4L4SA 2WDZA 2J3JA 4EEXA 4RGBA 5TIIA 2GR9A 2VHYA 3NT5A 4W7IA 4L8VA 4BO7A 4BNGA 4E6PA 2GRAA 4F46A 3TNLA 1KVQA 3OMLA 2GZ1A 1V35A 4M54A 1T1RA 2O4UX 1GYQA 1J0XO 2OO5A 4DWVA 5G2OA 4LK3A 3WB9A 5U1PA 4MIYA 1GCOA 4J4TA 2OP0A 1IB6A 2JL1A 1T2CA 3L6OO 3PZRA 4DQVA 1OI7A 4ND5A 3WOHA 2VWQA 3GMSA 2NSDA 3EZLA 3SLGA 3UXYA 2I3AA 4F6LA 1P1IA 3NTRA 2EW2A 1FK8A 2FRDA 3FPCA 5DT9A 3ZV5A 1OAAA 3QW2A 1U7HA 3OICA 4YT4A 1ZZEA 2D59A 3DONA 4PLFA 3U9LA 3VZPA 4E5PA 4AJLA 1CETA 4XWYA 4B8WA 4Q3AA 4YT2A 4CPDA 5CEFA 1BG6A 1QP8A 5CDYA 2DBZA 3KSZO 3RUFA 4CMCA 1T24A 5ICSA 3OQBA 2Q3EA 2O48X 4IDCA 1NM5A 1PS0A 4UVIA 3SX2A 1PX0A 2GNAA 3DO5A 3KBOA 3RC7A 2YFHA 1ZEMA 3JSAA 3VPGA 1LU9A 3IOYA 4IJKA 2P9GA 2W4QA 1YJ8A 2JAPA 3PDJA 5JE8A 4CQLA 4CV2A 5KJFA 1K5HA 1NFQA 1GUZA 3GDGA 4OH1A 3M1AA 3LLSA 1UDCA 4IGEA 1K2WA 5F5NA 1I36A 1B14A 3PHLA 3ZHYA 3OH8A 2P5UA 5B4UA 3A4VA 1EUDA 8LDHA 1F06A 1HT0A 2G82A 4IGFA 1NP3A 1E77A 4CMBA 1PJLA 5IDWA 3EAGA 4OOEA 5MDHA 3KVOA 2X5OA 4EJMA 4BMVA 2EWMA 4D43A 4BKRA 1YB1A 2B5VA 3AI1A 3TQHA 3EZYA 2Q2QA 4WECA 3MJTA 2IYPA 3CKYA 1ISHA 3HFGA 3LYLA 1BVUA 4E5NA 1PGQA 3QA9A 2HSDA 2ZQYA 2C07A 5H82A 3IL2A 1YL5A 4KQXA 2G5CA 4DBZA 4DPMA 3A28A 4OQZA 4B3IA 1M66A 2WE7A 3RASA 3ZNOA 4INAA 1EK5A 3C1AA 1CIVA 3JV7A 4CLXA 3UW3A 3PWZA 6ADHA 2Q4EA 4IS2A 2CY0A 3GK3A 4TVBA 4RVGA 5L51A 1N9GB 3L9WA 2O7QA 3I9LA 4FFOA 5CP8A 3QWAA 3NGXA 2RCYA 2ZTMA 3TL2A 5JC8A 3DBLA 1O95A 5EINA 1K3TA 3FNEA 3GQVA 1BXGB 3GHYA 2CVQA 1WDKA 3ZWOA 4GBJA 3MWEB 1M2WA 3E1KA 1D1TA 3Q11A 3TZ6A 1R12A 4IIVA 1BHSA 1E1MA 2A35A 2YHUA 3L4BA 4CUKA 4Y6PA 1LNQA 3GN2A 1M67A 3W4KA 5TGDA 1FDUA 3WX0A 3IIEA 1YVEI 4RF4A 3WWYA 5DCUA 3W8EA 2WJPA 2GGSA 2WYUA 3SJ7A 3WMWA 5BNTA 1HE5A 3VTZA 3S55A 4J16A 3ZV3A 4Q3DA 5KJ6A 1BXGA 3CXRA 3IP3A 4D41A 3GOHA 3TL3A 2FPIA 4UREA 2ZATA 2C54A 2VRCD 4ZA2A 4RVDA 3S2EA 3H4VA 1QLHA 2VRCA 4BO5A 1HZJA 4N5MA 1JWBB 2O3SA 4HFMA 2E48A 2VUSA 3KYCB 5ES3A 2JHFA 4OXKA 4WLUA 3KSDO 3STHA 4CL8A 1HDGO 4BO2A 3EDMA 2I6TA 2YHIA 1OFGA 4I9HA 4OSPA 3WFIA 4U8GA 3GVXA 3UICA 4J1NA 1U1IA 4RPKA 2F1KA 4RQUA 3AM5A 3ZWMA 2HRZA 1AGNA 3JQ9A 1YJQA 1DHRA 4CQMA 1BXZA 4WGGA 4PZCA 4BNXA 3OJLA 4IZHA 1EVZA 3PK0A 2O7SA 4J0FA 3HN7A 2XXJA 4FC6A 4IDGA 2HMSA 4P4NA 4NH4A 2PFGA 1HTBA 3ABIA 1QV7A 1S6YA 4FW8A 4Q3EA 4ROSA 4CV1A 1DEHA 1PL8A 1NPDA 2VHWA 1PJQA 3WJAA 3ANMA 1E3JA 5FYDA 1WXDA 2ZB7A 2I65A 3ZW9A 1CJCA 4BQRA 1YDEA 2P4HX 3RUDA 3WR5A 1ENPA 3K73O 2A4KA 2FR1A 4CUJA 1ISJA 1YQXA 3RI3A 5JS6A 4I8XA 4MP3A 3QWHA 4XZ3A 4YDRA 3K8ZA 2NLOA 3IS3A 1JA9A 1NQAO 3B70A 4I5GA 3NKLA 5G4KB 1A72A 4RF5A 5A3VA 3ZU3A 1FF9A 1E1NA 2O2SA 2ZQZA 5JPIA 4MDHA 1QYWA 3NEPX 4GH5A 3I5MA 4IJUA 3IJRA 4CMIA 3KSUA 1B0AA 1NTOA 2P2SA 2CDBA 2HRBA 1UXGA 2FY8A 1VRWA 3FNGA 3LF1A 4HFJA 4J7CA 4IXTA 1V0JA 4N54A 5I9MA 5L3ZA 1C0PA 2HAEA 3S8MA 1XIVA 2C82A 1YS4A 2VHVA 3BMQB 3SC4A 4U7WA 1PJ2A 3JQ6A 1QKIA 3KTDA 1HSZA 2BFMA 1N7HA 4PLYA 4BO8A 2NADA 3NDRA 4XRGA 3I9KA 3HB5X 3P5SA 4CM1A 1GY8A 2Y68A 2AQIA 4IMPA 2HMVA 3R3JA 1U8FO 1ZIDA 4HX5A 4WJZA 4CMAA 3HDYA 2FMUA 3G1UA 4CM3A 2FHSA 2EGHA 2HK7A 4XCVA 2AEMA 1DIAA 2BKAA 3QJ5A 1UZNA 3FPLA 4TKMA 5JBIA 3D4PA 4R1TA 1R15A 2UUPA 3KO8A 2BI7A 3BMNA 5JCJD 4YAJA 2H6EA 3IKTA 2X0JA 1P0FA 1PGOA 1R66A 1I0ZA 4GX0A 1U3TA 3QIVA 4K28A 4Z3DA 4BO9A 5G0SA 5COBA 3H5AA 1N1GA 5EIOA 4J0EA 3B1JA 4BO6A 4BGVA 3EMKA 5T67A 2ZYAA 3U4HA 1DO8A 1MC4A 3DBHA 2ET6A 3JQ7B 3I9NA 2NVBA 3KEQA 1OC2A 1ZSVA 4Y98A 1GUYA 2JD1A 2PZLA 2BGKA 4ZQGA 4E31A 1X0VA 1SC6A 2D4AA 1I30A 1BGVA 4J7XA 4CMKA 4TRJA 1R6DA 4PLWA 4B7UA 3LDHA 2NWQA 2Y1DA 2VNSA 4LVUA 2I67A 2QHXA 3JQAB 3GC6A 4DPKA 5BT9A 3L4SO 3WQSB 1SO8A 1HWYA 4EGFA 4AJKA 2QYTA 3OA2A 4CMEC 2IRWA 4CLDA 3T4XA 5I8ZA 3WWZA 3MCVA 3RAJA 2EXXA 3VZQA 2FN7A 3JYNA 4AFNA 1T2DA 3BMCA 3K5PA 5U9CA 1E3EA 2R00C 3ST7A 4CMJA 4OYRA 1LSOA 3W6ZA 1TI7A 4BNHA 1BTOA 3OP4A 1HLPA 1HDRA 2DVMA 1KEVA 1DRUA 3RKRA 1CWUA 3SJUA 1I3KA 1NAIA 3GRKA 4L76A 1CEQA 2EHDA 1C1DA 1CRWG 3PQFA 8ADHA 4YJHB 3D7LA 4MINA 1BVRA 4GLLA 4OO3A 4QXMA 4O1MA 4J6FA 4UUOA 1VE9A 2HO5A 1JQBA 3V2UA 1PGNA 4BMSA 2YW9A 3F46A 5I7VA 3T4EA 4CM5A 5KKCA 1A9ZA 3MJCA 3X2FA 3DZGA 4PVCA 3TWOA 2VRBA 4W9NA 4CR6A 5A4DA 2PGJA 5I7EA 4GGOA 2J8ZA 4LMRA 2EP5A 1ZJZA 4O0LA 1B3BA 4J3FA 1Z82A 4XGIA 4Z0TA 3ZWNA 1O9BA 1IY8A 3UAGA 4ZHSA 2VOJA 2FZEA 3IAHA 4D0SA 2AE2A 4BB5A 1E3WA 1AHIA 5CPBA 4GGPA 1SZJG 1W73A 1ZXLA 4NJMB 3QWIA 1WPQA 5C3MA 2D2IA 4IQ8A 5IF3A 3G1TA 1SEPA 2NV6A 2HKIA 3L6DA 1R4NB 3DXFA 3DTYA 4GL4A 3AUAA 2JAHA 2VUUA 3NTOA 4BQPA 1ARZA 4E0BA 1KOLA 1HDYA 1P77A 2GN6A 4FD3A 3UVEA 4FJ0A 1IYZA 4RVUA 1DIHA 4L9RA 4U5QA 2CNBA 2OP1A 2RHRA 4QECA 2JHGA 2YQ4A 3ENKA 4BNIA 5A5EA 3IDSA 1PGPA 5BSHA 4JK3A 1I3MA 1ISMA 1V3TA 5A9RA 3H6KA 4PLZA 4MPDA 1HKUA 2G76A 1XHLA 1V3UA 3NYWA 1DRVA 4MKRA 2JD2A 4R9RA 1LQUA 1EDOA 4RPGA 3BHIA 4ZGWA 2RH8A 4C7JA 3OIFA 5ICMA 1LBEA 4NG5A 3OJOA 4MVJE 1V8BA 5IXYA 3OM9A 3C1TA 4LCJA 2X22A 4KWHA 1BRMA 4RVFA 3EGOA 1I24A 1ZH8A 1SNYA 5DBFA 3WYEA 2OBNA 4NZ9A 2PR2A 4R4JA 2PK3A 4YJGB 2H1SA 5CDSA 2ZJ1A 1BWSA 4EITA 1NQTA 4OXNA 2NTVA 1EBFA 3FSRA 3BAZA 3KYBA 2DFVA 4UEOA 1EUCA 3BZUA 1MGOA 3DMYA 3RD5A 3IUSA 1OC4A 4LRTB 3BTOA 2WD8A 2FWMX 1EE9A 1PGJA 4JXKA 4BO1A 4AJJA 3CIFA 3C24A 2DTEA 3OJEA 2DT5A 3EVNA 2CF6A 1EZ4A 1SB9A 4OM8A 1ZSYA 3AM3A 4E21A 1Y1PA 3DHEA 1KEUA 1SOVA 5ADHA 1TT7A 3FI9A 2YFQA 3JYQA 4RF3A 5BNFA 1ONPA 3GDOA 3ZGYA 5TT1A 4BGEA 3CZMA 2C0CA 3NT4A 1BW9A 1P1KA 1EVIA 1QYDA 1XDWA 2B5WA 1IE3A 3WMXA 3I6QA 1RM5A 4ALIA 3ZWCA 4FGWA 4AJNA 4IDDA 3UH1A 3ROMA 5C5IA 5EL0A 1LLQA 3P2OA 4ESOA 5FI3A 1MFZA 5KJCA 1PR3A 3KEOA 2BLLA 2FR0A 4YVFA 4E4YA 1XQ6A 3QVTA 4HWKA 3PFFA 3ADOA 4PCVA 2CDCA 3ZU4A 5BNIA 3V2HA 4LW8A 1N92A 3E5MA 4UULA 3WSVA 4DREA 4UEKA 1LA2A 1H5QA 4Z6KA 1GU7A 4EEZA 1HLDA 4GLOA 4WCFC 5C7IO 4J1QA 3CPSA 2C2YA 1QSGA 1M6HA 2NTNA 4PG4A 3TSCA 5KCZA 1XCBA 3L07A 4BKUA 2DUUA 4U6SA 4ALNA 3C8MA 2A92A 4QO8A 2CVOA 1H0KA 4AJEA 1ULSA 3D3WA 4E2YA 1D3AA 2PGDA 1ONOA 1ADBA 1YB4A 1A7KA 2FOIA 3FNHA 4WCDA 1DDOA 4CJXA 4YBZA 3E9MA 3BMOB 4JNKA 4ZD6A 2V6FA 4BUCA 1B7GO 3AU9A 5KWEA 1GEGA 1YE3A 2Q99A 3E9NA 3DAGA 3LVFO 4FQ8A 4F45A 3K31A 4Z9XA 4CR7A 5K0ZA 3VPHA 1ZBQA 5FF9A 3HN2A 1Q2XA 2C5AA 4IUYA 5MGBA 3GZNB 4XQEA 2BMAA 2Y99A 4ND3A 4D3FA 4CV0A 4JROA 5AQ1A 2XOXA 5EMHA 4U0KA 4ZQBA 4H7PA 4E30A 1XR3A 1G6KA 2O3RA 1E7WA 5LCXA 5TX7A 2AMFA 4TQGA 4ONEA 5EJ2A 2QZ9A 3HADA 3OQ1A 3B1KA 1B15A 4M87A 3FBTA 2B37A 4E33A 1LSUA 1I2BA 4XR4A 1PJ3A 1UH5A 4DYDA 1P1HA 3I9OA 2Q1WA 1U8XX 5G0VA 1Y5RA 2GN8A 2GD1O 2OOSA 2QIOA 3GUCA 4WUVA 3WNQA 2AQKA 3S2FA 1LDBA 2PKRA 1KVRA 2WEKA 1P9LA 5JW6A 2I76A 3OIDA 1KBZA 2B4RO 4YCAA 5DN9A 1LDYA 3WGGA 4CLOB 3VKVA 4D45A 3PWSA 4PRKA 3UF0A 3ITDA 5T64A 3D4NA 4CR8A 3ZWBA 3AUTA 2P68A 1Z45A 5AXBA 3ZWVA 1YBVA 1UDAA 4P4GA 1ZKMA 2Y1FA 3ANNA 4XDZA 2AW5A 5DDIP 1NQ5A 4CL3A 3CMMA 1H2BA 4W6ZA 1MUUA 4Q3NA 2ZCVA 2Y05A 5JY6A 1UP7A 3TOXA 1I3LA 2WWRA 4M86A 4UAGA 1DLJA 1KY4A 2NVUA 5IXSA 2A9FA 4LISA 3WS7A 1WLYA 1DIGA 3ZZNA 2DQ4A 1TVEA 4TMFA 3WYBA 3QVSA 1GR0A 3UCXA 2HJRA 2PKQO 4P4LA 3CTMA 4AJHA 4PG6A 5TJHA 2PTGA 3RC1A 3WG9A 3R0IA 4XQGA 2W8ZA 4Y8VA 3K92A 4G65A 1PSDA 1VLLA 1P1RA 4FC7A 5IAAA 5L45A 4CLEA 2UAGA 2HMWA 3IMFA 3VH2A 3AOGA 1C3VA 1P0CA 1QMGA 5CPFA 3BXXA 1XQ1A 2J5QA 3GEDA 2YJZA 5ILOA 4J43A 3S2GA 3Q2KA 3U4DA 4IS3A 2Y1EA 3FRJA 4D3SA 1B8VA 5ER9A 3CMCO 4J49A 2EKQA 5KVQA 4ZN6A 3ZWWA 3PJGA 1IHYA 4LN1A 5HRUA 4YAIA 3UN1A 3DMTA 4E5YA 3P2YA 3GPIA 1C0LA 3WGIA 3I3OA 1YH3A 1ENYA 1ZK2A 5JO9A 1KS9A 3O8QA 5TF4A 4D3DA 1O8CA 2I99A 4CQLB 1QRRA 1HDCA 3L77A 1U9JA 4BV9A 3RVDA 1NAHA 3QP9A 2GERA 4WEQA 1H6DA 3IUPA 4QT0A 1VC2A 1BMDA 4AL4A 4YT8A 4YRDA 1DC6A 1GYRA 2I9PA 3DOOA 1VSVA 4YXFA 2AHRA 2HK8A 3PJDA 1XEAA 4MOWA 1NYTA 4HY3A 4F6CA 1M6WA 1ZXBA 5L7YA 4FFRA 1K0UA 4OAQA 1PIWA 5TSDA 1U2GA 4S3MA 4BKPA 2NU6A 3NDJA 1YBMA 1X15A 4ZICA 3ADPA 1JU9A 4OGWA 5B12A 1DC4A 1WMAA 2CFCA 4RPLA 4ALMA 2IE0A 2OUIA 2QRJA 1B26A 3ZU2A 3ZI0A 4C7KA 1PR9A 7ADHA 4MO2A 1HDOA 1K6XA 3OFSA 1GDHA 1Q0QA 3B1FA 1LTHR 4BNTA 1PZGA 2J5RA 4DLLA 4YR9A 1R4MB 3AUSA 4RPHA 1QV6A 3TFOA 1UJMA 2NU9A 1IULA 3JYPA 3I4CA 3DBLB 2JJYA 2HLPA 4GWKA 1U2DA 4BO0A 4PGFA 2Q1UA 2GO1A 1T4BA 3E18A 3HDQA 4DQUA 3JD2A 3UKOA 3SBOA 3VZRA 2VOEA 2W90A 2X1HA 5IZ4A 3K96A 2QZZA 4GWGA 1R4MA 1CYDA 3MJVA 4Y67A 2AQHA 1JTVA 3H3JA 3GY0A 2P9EA 1I5RA 4WCFA 2NU8A 4XA8A 3U4IA 4J4HA 1UXIA 3VH1A 3DFUA 1NPYA 1X14A 2DPHA 3GHHA 5HA5A 1CQIA 5HS6A 1Q7GA 1DPGA 4ID9A 5IDXA 3DWFA 5LDHA 2X7HA 1E92A 3HSKA 5A05A 3S2IA 3TRIA 3GZ4A 2AEFA 4DGSA 4DLBA 4N7RA 1YL6A 3A06A 2D5AA 4IXWA 4YAGA 3DZKA 4R1SA 5AYVA 1E5LA 4I5FA 2X9VA 1E7RA 1IUKA 1U5AA 3EC7A 3IKVA 4BNFA 1HETA 2YHIB 1LSSA 3B20A 3PYMA 2NQ8A 4IDAA 5JY1A 3JQFC 4DC1A 2EKPA 4ZJUA 1N7GA 4CQMB 4FPXA 4MKZA 1E7MA 2BRUA 2Q2VA 3G3EA 1K6JA 1PU2A 3FNFA 1UXKA 3PRJA 1GEEA 2O3JA 4ZRNA 2YDXA 2YV3A 4IPTA 4M55A 5TNXA 3RFVA 1Y8QA 4BNLA 2VHZA 4JQCA 3DFZA 3RIHA 4R69A 3GAZA 1HE4A 2PGLA 4GKVA 4RF2A 4YA6A 1DFGA 7MDHA 5DP2A 2W2KA 2Q46A 3U0BA 1EFLA 3VZSA 1E6WA 1LDMA 1O94A 3PWKA 3BTVA 1ADFA 1FMCA 4NPCA 3X2EA 4I5DA 2GCGA 1L1FA 2EGGA 1A5ZA 1HDXA 1RYEA 2V6GA 3A14A 4XQ9A 1PJBA 3ZW8A 1GPJA 3CH6A 3V1TC 2EIHA 5C7OO 3SC6A 4X54A 4ALLA 1C1XA 2PV7A 1GL3A 3WQQA 1I10A 3EHEA 4TKLA 5GMOA 3QHAA 2O4CA 5KTKA 2EP7A 3RBVA 3IC5A 2CD9A 4E2XA 3H9QA 1P1JA 1TLTA 4MVJD 4BKQA 2BFOA 3TDKA 3TZCA 5TT0A 3TZHA 2H63A 2OZPA 3DR3A 3NJ8A 3NUGA 1FJHA 2VYND 1I2CA 4A73A 2JKVA 5EQFA 4NBUA 1EQ2A 4TWRA 4JJGA 5G0TA 4CMIB 3I6IA 4P38A 2IZZA 4W82A 2JD0A 1VL0A 5AXDA 4NU5A 5L9AA 1NVTA 2AG5A 3QRWA 3CEAA 4R16A 4RZIA 1EDZA 1LQTA 2BFAA 3D5TA 3JQDA 4NFHA 4N5NA 1H2HA 1XA0A 3PGJA 3W4IA 4NI5A 1B2LA 1X7DA 1VKOA 3F9IA 1V9LA 1GTMA 3IP1A 3MEQA 5CG1A 1GV0A 5HWSA 3LT1A 1YOVA 5GZ1A 4G5HA 3B6ZA 1BXKA 4NK4A 2RAFA 4J2OA 5JMPA 4PLTA 1EMDA 4L75A 4BHTA 3PYXA 4PZDA 4WLVA 2WYWA 1U3UA 1ZK1A 1PEDA 4PLPA 3SVTA 2EG9A 2DAPA 1K89A 3JQCA 4XJTA 4YJFA 1D7OA 4GAEA 4NQZA 1I32A 2P9CA 1H9BA 1T25A 2JFFA 4XGNA 1GZ3A 3DBRB 4DVJA 2C2XA 3PYLA 4CUZA 2RIRA 1E3SA 1Q0LA 1WDMA 3G17A 3PIIA 4QQRA 4RJTA 2IEDA 3ZV6A 3HNPA 4WOKA 3OEYA 4MIEA 1GFSA 3BMNB 1HYHA 1ZCJA 4PLHA 4RPJA 1A9YA 2X23A 4BNVA 4PN3A 5B1YA 2YV1A 1KERA 4UUMA 4QFDA 2CMDA 3DDNA 2C7GA 1RPNA 4CM7A 4O63O 3GG2A 4RDIA 4RO0A 4L4RA 2JCYA 3FD8A 5ENVA 2IXBA 2O50A 3RKUA 1ID1A 4IMRA 3DBHB 3DBRA 4FDAA 3C7DB 2G1UA 5KJ1A 1NPTO 3OF2A 1E1LA 2FZWA 5AXCA 1I8TA 5JCXA 5GY7A 3INTA 1TA4A 4U6QA 1WWKA 4PVDA 3TZKA 1ADCA 3O4RA 4DIOA 4MVJH 3WTBA 4QEDA 1MG5A 2B4QA 3P7MA 5JCJA 1PWZA 1IL0A 1DSSG 4M8SA 4FB5A 1NVGA 1HYEA 4YEDA 1PZEA 3TJRA 3VPFA 1PQUA 1LUAA 3A1NA 3LK7A 3EW7A 1YONA 4FFNA 1X13A 3W1VA 3JYLA 4BNMA 4YQYA 5KVSA 2PZMA 4XYEA 2ZB8A 4BNUA 1DB3A 2ILTA 2VT2A 5H81A 1RM4A 2NU7A 1ONNA 2VTDA 2OL4A 2AEJA 3Q9UA 1VJ1A 4FSHA 4LCEA 2UUOA 1NQOA 3BMCB 4RDHA 3D5QA 3N74A 1YL7A 3D4OA 2TMGA 1L7DA 2ZJ0A 5AVOA 4NIMA 3W8DA 4DLAA 1LDEA 2NVWA 1UP4A 2LDBA 1HSOA 3DHNA 3DZHA 3NJ4A 3PIDA 4M1QA 5F1OA 5GZ6A 5IG2A 3BHMA 1B16A 3K2BA 4IZIA 4LSMA 1GV1A 3NAQA 5TC4A 2VUTA 3KHUA 1C1DB 4J9UE 2CF5A 3AW9A 2CUKA 1WDLA 3KZVA 3LLVA 4NBVA 4AJ1A 4XYLA 1H6AA 3WGYA 4I08A 4BL5A 1QYVA 2OGUA 1IPEA 1YRLA 1NR7A 1D8AA 2AXQA 1MXHA 3AOEC 3N58A 4YQZA 5L4NA 3QY9A 4KWIA 4GX1A 2NM0A 4HFRA 3WJ7A 5L40A 2PKQP 2W2LD 5COAA 1Y9AA 4B4OA 1T2FA 1M76A 3DHYA 1DHTA 5THKA 2W2LA 5T8KC 3CE6A 2BD0A 2GLXA 3GVIA 1P3DA 1D4FA 2SCUA 2ZTUA 4CM8A 2C5EA 2I66A 4B79A 3BA1A 2OHXA 4Q9NA 2P4QA 3OHSX 4KUHA 1E3WB 3EUWA 1P74A 5KNLA 3JQFA 2V7PA 1M75A 1FXSA 2BGLA 4KUGA 3JQAD 3EVTA 3WLFA 3ZHBA 4CM4A 2Q4BA 3GR6A 3KYDA 2AA3A 4GPD1 4HADA 3RUCA 3PLNA 3WGTA 4ZQFA 1EK6A 1TB4A 5T57A 1U3WA 1O0SA 1JVBA 4D42A 1LX6A 4NR0A 4XYBA 4NHEA 2ZCUA 2PNFA 2Y1CA 3OSUA 3AY7A 1JAXA 3WDSA 1DLIA 1GQYA 3HDHA 3IQDB 1NNUA 3WNVA 3RCBA 3OETA 3Q9NA 3BYZA 5CDGA 2G0TA 2DC1A 2IDZA 1TT5A 4Q3BA 1Y6JA 4BNZA 4MVJI 3F4BA 4M49A 5I7SA 2YYYA 1XELA 2D1YA 3H65A 3RBXA 5A1TA 5JXWA 4TRMA 2NNLD 1PQPA 4FJ2A 1WNTA 2GASA 3WBBA 2DBVO 5BSFA 3W6UA 2Y0EA 3PQDA 4MVJM 4B4UA 2VCYA 1X0XA 4HXYA 3Q1LA 3WFJA 1Z75A 3AI2A 5B4TA 4I9NA 1AN9A 2Y1GA 4Y6SA 4Z0PA 4AVYA 4OOFA 3F4LA 4XJSA 3KRTA 2DUWA 1HDZA 1A27A 2B35A 5L95A 4QSMA 5FFFA 2X86A 4DXHA 1ZMOA 4R3NA 2RHCA 4KTTE 1E7QA 2HU2A 1I3NA 4UEJA 3CINA 3Q6IA 4O59O 3GAFA 1P31A 5U4QA 1UAYA 3SEFA 2ZYGA 4E2ZA 4EJ0A 4N5LA 3K30A 3EYWA 5DP1A 1OOEA 5CDTA 2BGMA 1MX3A 4I9UA 4BIIA 4CV3A 1B8UA 2Q1TA 3Q3CA 2GN9A 3RUHA 3E9QA 4IQGA 5L4SA 4FCCA 1O89A 3FTNA 3ENNA 2CZCA 2GN4A 1DRWA 3Q0EA 1BW9B 2F00A 3KB6A 3SLKA 3CSDA 3Q2IA 1P33A 4XKJA 3RQSA 3O38A 4R01A 3LF2A 1GADO 1VSUA 3RBZA 3WTCA 3LC1O 4BO4A 1YXMA 1F12A 2HMUA 3DZBA 1U3VA 5DNAA 1EVYA 1PJTA 1YQDA 3PDUA 4BNNA 3U09A 2WMDA 3ZU5A 3I83A 3BTSA 4PLCA 1W6UA 2AE1A 2RH4A 3RU7A 5TJ9A 1LC3A 2DU8A 3LT2A 1SAYA 2D5CA 4UUPA 4B8ZA 1ZSNA 3NT2A 4OHUA 2E4AA 2AG8A 1OZAA 3ROKA 1VPDA 3H9GA 1A71A 5AOVA 5A3JA 1QR6A 3I23A 1NBOA 2OXIA 3CUKA 2R6JA 2VWHA 3VDRA 3QSGA 4OQYA 3TFQA 3D3WB 2WE8A 5JFOA 5KOIA 1HXHA 2VQ3A 2XXBA 2YUTA 3RJ9A 2FSSA 5IDQA 3K2EA 3G0OA 4RV9A 3SXPA 1DOHA 3NGLA 4ZRMA 3VPXA 4CMHA 1UAGA 3PHJA 2DM6A 1NVMB 4A03A 1XWFA 2ZB3A 4EUHA 1NHGA 3ANLA 1ZVMA 4LRSB 2D0IA 3GG9A 1XU9A 4J91A 5JO0A 1IHXA 1DBVO 4CLRA 1WZIA 1XG5A 1WZEA 4HFNA 3I9MA 4XDYA 3VVBA 1T4DA 3ORFA 3V8BA 4D79A 1IZ9A 3KLMX 4R41A 4K1LA 3ZWYA 4RVHA 1PWXA 1ML3A 3VOSA 4K6FA 1E6UA 2NUAA 3ETGA 3FF4A 4YAKA 1LXCA 3FWNA 4DMMA 3K6JA 4JBIA 4OIMA 4K9DA 1R0SA 3PLRA 3DZJA 2NQTA 4I5EA 1SEVA 3RC2A 1KYQA 4L4XA 4DMLA 4C4OA 5BR7A 2H9IA 1HEUA 4H15A 1DC5A 4CMEA 4J90A 3VHRA 1KY5A 5G4LA 1NR1A 5I7FA 1C0KA 2R00A 1DAOA 3VH4A 1YBAA 1W0CA 3AK4A 3GNSA 2X9GA 1VL6A 3I52A 1LC0A 2V65A 3AU8A 2NVUB 2BFPA 4DQXA 4KUEA 3MZ0A 5EPOA 1ULUA 4WLOA 1KIFA 5T8KA 3FBGA 4YJDA 5ILGA 2UVDA 2DTXA 3WIEA 3DC2A 5LC1A 3PEFA 1JWAB 5ITVA 3F1KA 2IODA 3E03A 3OJ0A 2VWGA 4CLHA 1J4AA 4HP8A 5TRTA 3BIOA 2ZB4A 1SMKA 2JFGA 5F3RA 3JQ8A 1GQ2A 4ZU3A 4HUJA 2WM3A 3ETEA 1RJWA 3KUXA 4XEHA 5K6AC 4Z3KA 3ASVA 1KVSA 2JCXA 3VPSA 4DL9A 3TPCA 3JD3A 1UXJA 2G17A 2Y67A 2ZIZA 3QVWA 4GMFA 4B3HA 1NXQA 1BDBA 3AY6A 3HHPA 5JAZA 2POQX 2HJSA 1DIRA 4H16A 1ZJYA 2GF2A 1R0KA 4YACA 3VVCA 3QVOA 5L7WA 1MC5A 2Z1MA 3GNTA 1GYPA 3ONDA 3ZV4A 2WD7A 4ITUA 4R54A 4XR9A 3ZNNA 1ZO8A 3ZHZA 3RSHA 4JGBA 2DLDA 1ZUD1 3O26A 3MOIA 3FCOA 4EUEA 3WGQA 3O8QB 4JJIA 2CVZA 2YY7A 4R9SA 4BNJA 5DBGA 4CODB 4EW6A 3MOGA 1LLDA 4YWJA 4FGSA 4E32A 4IY1A 1UR5A 5DF1A 4B7XA 1AXGA 1Y8RA 3PZBA 1EEHA 3H9UA 3ICPA 1MB4A 3D1LA 1SBYA 5KKAA 4A26A 3JQGA 4ALKA 3HZZA 1KEWA 1U28A 4P22A 1PS9A 4MVJP 2OORA 1SPXA 3V1YA 1E6EA 2X5KO 3F5SA 1GQQA 3IJPA 1X1TA 1N5DA 3TZQA 3H2ZA 4ZVVA 1PS8A 2LDXA 2YQ5A 1WMBA 3MTGA 5C37A 3TF5A 1F8GA 1DJNA 1GUFA 4MIOA 3INGA 4FFMA 4WASA 3D64A 3L9XA 4DA9A 4TVOA 5JDCC 3GVCA 3GN1A 4JJFA 1AHHA 4TZTA 2W98A 4DYVA 4YRAA 4O6VA 4R1NA 5ER6A 1IOLA 3ETDA 4YAEA 4Z9YA 1ADGA 4MJLA 1BDMA 1PJSA 4XX0A 1LRJA 2DBRA 3H9EO 1Y7TA 3GFGA 3H3FA 2Q45A 5EERA 5TLSA 2A94A 2E49A 1E3IA 4NMHA 3FHLA 1MLDA 1X7HA 3OBBA 3GRPA 1RWBA 1W8DA 4PRLA 4Z0HO 4F3YA 1NWHA 4BGIA 3GF4A 2DBQA 3PXXA 4ILKA 5F21A 3TN7A 5EESA 4DRYA 1JKJA 4CM6A 4KP7A 1ZEJA 2EF1A 3O03A 4JLWA 5G0WA 1WW8A 1HE2A 2IZ0A 4WCFB 1Y81A 3RFTA 2ZYDA 5JMWA 4IBOA 5HS4A 3DB2A 4FS3A 5JDIC 2PZJA 1NHWA 3N7UA 2E82A 4NNJA 2VTEA 3DBVO 4KMSA 5H83A 4LMPA 3WGOA 2Q49A 2C59A 2EW8A 1EFKA 1GD1O 5AXAA 1CF2O 5FI5A 3DAFA 3I1JA 3LT4A 4BVAA 2FPPA 1DFHA 3MWDB 1PTJA 2Y0CA 3PTZA 5JAIA 4II2A 4JN6B 2CSUA 3H9JA 1J49A 2B69A 4RCVA 1OBFO 3GNQA 3GLQA 2DFDA 3JD4A 2X6TA 2Y66A 3OEWA 3LQFA 4RLHA 2QW8A 4OMUA 4AICA 2Z5LA 2I3GA 1Y8QB 3GUYA 4ZQEA 3RWBA 1I2ZA 1Y9EA 2D3TA 3AUUA 4R5HA 4AG3A 4RQTA 4JP2A 1EVJA 4OKNA 2W2KB 3KM0A 2VZ9A 1AUPA 2C29D 2VT3A 5FEUA 5ENDA 2O23A 3COSA 3E6AA 4W4TA 5DZSA 4URFA 1XGKA 3U4CA 3QE3A 2EEZA 4TSKA 1PJCA 3NDIA 2E6UX 1J5PA 1YGYA 3HWRA 1R16A 4KTVE 4QFCA 3ZH2A 1QG6A 1J6UA 4RZHA 4A0SA 3GEGA 1N9GA 3U49A 3GA0A 3INRA 4D0RA 4UVGA 2GYYA 2PD4A 1WAMA 3I9JA 4RLSA 3DEYX 2CDAA 5THQA 1C1XB 1UXHA 2PH3A 1ORRA 4IJVA 1XU7A 4IINA 3HUDA 4AJIA 4KQWA 3ON5A 3ZWPA 3MJEA 3M6IA 4FFPA 1AXEA 4PIVA 1P44A 2PA3A 1A4UA 1E1KA 3GH3A 4BO3A 1JW9B 4TZKA 4W9NC 2J6IA 5L4LA 5K6AA 3JD0A 3QQPA 4P8RA 5KVVA 4G2NA 1R37A 4NU6A 3OECA 3UCEA 1ISGA 1F0YA 3UFXA 1P1FA 3AI3A 3W8FA 4CQMD 5BSEA 5C7LO 3WGHA 4Q39A 3UHAA 5B4VA 4IJWA 3AJRA 1B8PA 3T7CA 1C0IA 4D46A 1LLUA 1YOVB 1LDGA 1YB5A 4MVJA 2PWZA 3G49A 3H5RA 2Y1OA 1EBUA 4XGKA 3DOJA 2VYNA 4OXYA 4GVXA 3VAZA 5CG2A 1PZFA 4WKGA 3KYCA 1F8FA 3ICCA 3LT0A 1Z7EA 1PL6A 1T2EA 4J4BA 3WXBA 1GPDG 4NK5A 4YJFB 1ZW1A 3QV1A 2QRLA 2YDYA 4W7HA 1KEPA 2EERA 2PY6A 1NASA 2WTBA 1Y5MA 2FPGA 3HQ4O 4GSKA 1S7CA 1H6CA 2O3TA 3PJFA 2TMDA 3BHJA 4L0QA 4ZQHA 1MXFA 4NFSA 2FP4A 4Q3CA 1MV8A 3BTUA 3GVPA 5HM8A 1C14A 3H5NA 4IQ0A 3C85A 2B36A 1W4ZA 5DCYA 3VKUA 2I5PO 4EBFA 3I4FA 3DTTA 3OQ6A 2QG4A 1N8KA 1RYDA 2X8LA 2ZK7A 3DAPA 4ND4A 4PLVA 4EJ6A 4GX2A 5DCWA 1HYGA 1B3RA 2O2YA 4XIYA 1LDNA 1Q7CA 1LSJA 3GGOA 4YRBA 3DZFA 4WNIA 3RC9A 2PD3A 3QWFA 4LVCA 1YQGA 3ZHXA 4XIJA 2EJWA 3HFSA 4E13A 1EUZA 4EZBA 4UVEA 3JCZA 3UCFA 3V1UA 1KVTA 1JKIA 3AFNA 1VKNA 1VJTA 2J5KA 4E2WA 4KOAA 5JDCA 3LSYA 1ISIA 4JBGA 5A9SB 3GGPA 5G4KA 4MVJG 4R1UA 5BQFA 5IN5A 1FDVA 3R3SA 4A27A 4FR5A 1YKFA 4JCOA 3CZRA 2J3HA 1LEHA 3AWDA 1FDSA 2NTJA 1RM0A 1X1EA 4GMGA 1E0DA 1ZNQO 4J7UA 1KETA 4B4WA 1F17A 4M89A 1D1SA 3OJFA 3ONFA 3ONEA 1VL8A 4XYMA 1DAPA 1N2SA 2RBEA 3JQBC 4MKXA 5A04A 1V6AA 1H9AA 3M1LA 4BOYA 5A9SA 3LU1A 3LC2O 4MP6A 1E5QA 2BHLA 4J2HA 5TQVA 1AE1A 3A9WA 4OKIA 1PJ4A 1U7TA 2ZKLA 4FBGA 1VJ0A 4YB8A 3ZDFA 2IYOA 3DL2A 1U4SA 1EQUA 3AY3A 2VZ8A 3WQRA 4LSWA 3BMQA 4AJ2A 2BH9A 3PGXA 5COQA 5JDIA 5IZCC 3RJ5A 3KLPX 3F47A 5DBIA 1PZHA 3NRCA 5EN4A 3V5NA 4DBVO 3PI7A 4TROA 1I01A 3H8VA 1DC3A 3JQEA 3ZNQA 2J3IA 1JKFA 5JC1A 2DPGA 3WGZA 4CM9D 2EJVA 1DXYA 1LLCA 2DTDA 4DIBA 3C7CB 1N1EA 1GZ4A 4IIUA 4CM9A 5JNLA 3PHHA 4PG5A 1UDBA 3MTJA 5KIAA 4CM8B 1RKXA 2HUNA 4ND1A 5HTOA 1JN0A 4XD2A 5TS3A 2GZ2A 2QYSA 2QRKA
chains in the Genus database with same CATH superfamily
1UEIA 3FOWA 4N49A 1QFXA 2NYVA 4B3CA 1I1QB 4PSKA 5LWQA 3LK6A 1IAVA 1IPFA 1NUSA 1RU3A 4OP2A 3ZJ5A 2X1LA 3PPIA 3VDQA 2ZBDA 1BVYF 3RC3A 4W8GA 2Y3IA 3SXUA 1FFWA 1CUXA 4K9KA 4HGNA 4LYGA 4CM4B 1JDJA 3KYDB 4GVPA 3WJ2A 2UYQA 5KBYA 2EJTA 2FSFA 3IP6A 3TW0A 1T1SA 4RVSA 4B4VA 4YPOA 1TCAA 3DPIA 2ZOSA 2NTYC 4M2LA 2B83A 5LMZA 3K0CC 5FPTA 1Q6YA 4R2LA 2ICAA 3F6YA 1CDOA 3MUNA 2J3EA 3AZPA 1DXQA 3C6KA 4M8KA 1Y37A 2RIPA 1V1JA 2X14A 3D7NA 3JTMA 1Z34A 4L6IA 3ZKWB 4LF6B 3WYCA 1P61B 4LJ6A 3P1JA 1N0VC 3AERB 4DR3B 2PVSA 3II6X 4WWHA 3DUFB 4D8UA 4JZYA 5DOVA 2PQ2A 1ESZA 2E4WA 2JDID 2W8BB 4B84A 2VSYA 1NZDA 4WNAB 3JQAA 1LRKA 2H54A 1MOZA 2AOVA 2H00A 1TEXA 2YNMC 5FLKA 3RVKA 4K6CA 3U26A 5JXHA 4MI3A 5ALZA 5FPKA 3HV2A 5FOVA 4BNKA 4KDFA 5F76A 1CE8B 1NXWA 4RNCA 2BFCA 2QN3A 3QF7A 5H0IA 4BATA 3DTVD 3KOOA 3FR7A 3OKCA 3WE7A 4AG6A 2MYNA 1IQRA 4EDFA 4WDRA 2H92A 3BICA 3VUFA 1TRHA 2GJKA 2QVXX 2CFTA 3LUAA 4U1RA 5ESRA 3BGOS 1INLA 4WX2B 1JQLB 2JRCA 3EN0A 1RM3A 3DMRA 3ZWQA 2C0QA 2HQ1A 1X3LA 1NVBA 1MP0A 1W76A 2WF5A 4HDCA 3EISA 4UMEA 1ST3A 3T35A 2C7VA 3HS3A 1QDUA 2AFHA 4YJHA 1VGQA 1G8YA 3I42A 5E6SB 5G40A 4WK6A 3DQPA 4I9FA 1NJ5A 5CEEA 1J0AA 3I5AA 1E7SA 2VA9A 4K1XA 4P3KA 1JYFA 1IY9A 2AYXA 2Y0DA 3A9UA 3NBXX 4OBXA 2FZGA 3O8DA 4KFTA 4Q6WA 1RPZA 2OBYA 1RKQA 4W7SA 3X1KA 3EG5A 1Z73A 2O5VA 2QNIA 3T7EA 3N2KA 2WTNA 1JB9A 4HNVA 1RWQA 2HMTA 3VGJA 2HFKA 3FWKA 1AK9A 3RABA 2HRCA 3G5UA 2XQKA 1FP6A 1CV2A 2Q3FA 1KEKA 1E9EA 4NAUA 4WERA 5DWDA 4P4SA 1L4NA 4BZQA 1PJAA 4KZPA 1UBNA 2VKTA 1V11B 2R8RA 2X9LA 4YRFA 1H4TA 4HKTA 1WCIB 1MB3A 2BMFA 4FFLA 4NJMA 4UHCA 2WHPA 2UVQA 3T7DA 3ZBTA 1DRJA 1FTNA 1M34A 4I1IA 4WN3A 2E1RA 1SUWA 1L9KA 3AQ4A 1MJFA 5EZYB 4BX9A 5KYGA 4LWPA 1P7VA 4B87A 1NL3A 1VLZA 1S2DA 3D4LA 4EG1A 1LNSA 1NMQA 3DAYA 2APJA 2BTEA 2J1LA 1E7YA 5CEJA 4WZAB 5IJ0B 1HQYE 4HEHA 4AJPA 1V4NA 1JDZA 1XX6A 1SU7A 4RWEA 1KKUA 1RXVA 1KP2A 3K0SA 5BV1A 4GECA 4L72A 3QLVC 3HJAA 3IAEA 3W1EA 2ZT5A 3OLVA 1RWXA 1Q7BA 2SECE 4WKBA 5GONB 1I7PA 2WIBA 3I39X 1N2OA 4QPDA 4UHJA 3AF4A 1H93A 4URHA 1JR3A 1Z33A 3K7EA 2YV2A 3R6DA 4QARA 4ARUA 4BNWA 3Q8WA 5C46F 5JSHA 1CRPA 4HVTA 4FTWA 1MRSA 3K70C 1KC1A 4KYVA 4RABA 3GT0A 1FYWA 1YDFA 4KU4A 5GZ3A 1HFEL 3JD1A 1WVGA 4II3A 2Q4OA 3EC2A 3DC7A 4F85A 1O9GA 1ZUIA 2QM0A 4LQLA 1NIPA 4IM7A 4TWIA 4KYIB 4O4JF 4BP8A 4TRNA 4XW2A 2FPKA 3A1CA 1G6OA 4PFJA 3TOZA 1R00A 1T2AA 1C4OA 2QX7A 3DZIA 4M9QA 4CLRB 3LM8A 4CKZA 1T43A 1M1YE 4CKWB 4X1IA 4IIHA 4YJGA 1AMNA 2VK2A 1ZHOA 4F11A 2VYVA 4LZNA 2OMEA 4P33A 1K4KA 1SB8A 1ZWLA 2OTCA 3RTEA 3U4GA 4QG3A 4D9GA 1Z07A 3HE3A 4P36A 4DLTA 3DVLA 1G5QA 2BELA 1OE0A 5F51A 4JT2A 1C3EA 2OGWA 4R3WA 1YZKA 1QE3A 2O9JA 2R1TB 3C3DA 2FKNA 2VJKA 2FCAA 2F3UA 1Z0SA 2A5LA 2NUBA 4ACAA 1TXGA 2NT3A 1QRAA 2X4GA 1TEHA 1YD7A 4JI8B 3HCFA 3IQGX 1V1MA 3F5QA 2FAXA 3I01A 4DCNA 5IZCA 2F9FA 3C6YA 3A25A 1GAEO 4X64B 4B7AA 4D4IA 4POAA 4TKZA 2VDMB 2AWNA 4M0EA 5ITWA 2B3DA 1KMIY 3VU0A 7MHTA 3M2PA 1M7HA 4B3JA 4EM6A 2V0GA 2Y93A 4WLEA 2Q50A 2RGXA 1RZRA 3TK1A 5I8WA 3ZQ4A 2CXRA 1QWSA 1Z2EA 4JD5A 5F77A 3WYGA 4A5OA 1EIWA 2VRNA 3L7YA 4JLDA 1MFPA 1VI6A 3H19A 2AN4A 2XPCA 3HNRA 4DOMA 3Q72A 3GDFA 4N03A 3PVZA 4QU9A 2ZWMA 4C4YA 4L73A 5JAMA 1I7DA 3RS2A 4IGIA 2GD6A 1C4WA 3H5OA 5FULA 1FUEA 4KQJA 4D25A 4N0DA 3U3XA 1SM4A 4B7CA 1O87A 3L4BC 1NULA 4UVHA 5AJHA 1ORTA 5B7QA 1IZ0A 1RS0A 3ABRB 3AUJB 3TAXA 3TO5A 3VNAA 2H5LA 4Y1RB 5HKLA 2Q1SA 4DE5A 2OV6A 4G4SP 3ITKA 4GXQA 4PM4A 2HRDA 3O73A 1K9VF 3PFHA 3FH0A 1VHQA 4GI2A 4TL8A 1F2TA 1HRKA 1USIA 3EIWA 3I53A 1MG0A 2ZSBA 3EIEA 5KVCA 1TQHA 4QX6A 2XD4A 1H0HA 1T4GA 2WP0A 3E5RA 1OFHA 1L5VA 2VEDA 3GEMA 4FGJA 5FOUA 2P91A 2VWPA 5FR2A 2ZSHA 1O4WA 3MC1A 3U7JA 1NQUA 3AKYA 1TZCA 5EPUA 5J58A 5HKAA 3C1OA 1TQ6A 3C7AA 3K9FC 2YY5A 3AVYA 2BRUC 1KZ9A 1JLSA 2C8VA 2GCEA 4PWZA 4R0MA 3LT5A 1N3LA 4LKOA 3ASUA 5I9BA 1EFTA 5D51S 1BQ3A 1DBIA 1V8PA 3L5KA 4MJXA 3AFMA 1U94A 3IPYA 4NJEB 4E09A 4G97A 5FPSA 4IIEA 4GS5A 3E82A 1CQJA 4FN5A 3WSWA 2FFBA 4OLAA 4AZVA 1Q1EA 2FWBA 1ZRNA 4O4HA 3SZOA 3U5TA 3VR5A 5K9ZA 4ZT3A 5C8ZA 5L7TA 1P7PA 2X76A 4NBWA 1QHHB 2JIQA 4D7AA 4MWZA 3N1UA 5BR1A 3BIXA 1GSHA 5LA6F 1ODTC 1Y8RB 1ZZGA 2UZAA 4C01A 3JQ9C 1O6BA 2FSVA 3O3MB 5DK6A 5KQMA 1KQPA 3AKEA 2WU1A 2TS1A 1KP3A 4HDNB 2H2HA 2HCTA 3EUFA 4H18A 5BVGA 5LLSA 3C3XA 1DKNA 1NVEA 2XE7A 3ZS9A 5KYWA 3ER9A 3JQGB 3KXKA 3PL1A 1SCUA 2IUSA 2YRXA 1HE3A 3OIWA 4G84A 3QKRA 5HKBA 4RKYA 4XB2A 3K9WA 3PE3A 4FMCF 5ICCA 1E63A 1LS6A 1U7ZA 1NUAA 2FVYA 2LRHA 2BY4A 3EA0A 1XLTA 1GZ7A 3IVGA 4R98A 2V6MA 3DNPA 3I37X 1VYTA 4OA5A 5LB4A 1JVSA 1NVKA 2HBQA 2FQYA 3B7GA 4JUCA 2AQ8A 1PX2A 5B7GA 1MHTA 3EXG1 3EXAA 3MTBA 6LDHA 4PS1A 2IVZA 3R6TA 2PUGA 1OROA 4TN1A 1Q0RA 4UMFA 2GA9A 2WF9A 2XDQB 4L4SA 3PQ2A 3VUEA 1WD7A 3NG1A 5DM4A 4DY6A 4F0JA 3KU4A 2Q3DA 2UYOA 4W7IA 4Y2XA 3ZE2B 2IT1A 2Z4TA 3RGWS 1E61A 2GRAA 3BXOA 2Z2KA 4LF9B 4F46A 3KVYA 4GR4A 4PTYA 4TL9A 3H1PA 5KNBH 3K9LA 1GGKA 2RHDA 3CW2A 3HY3A 3IERA 1GYQA 1DJLA 4GDFA 2O8DA 4DWVA 3W3AA 3GL9A 3G1WA 5U1PA 1XDSA 4MIYA 3HUFA 4U7DA 4DQVA 1T2CA 3I6YA 1CB7A 4INOA 4ND5A 4YUVA 2VWQA 3ABZA 5FBHA 1SCDA 2QW0X 4GI7A 3Q6NA 1CP3A 3BHNA 3F49S 3N53A 3SLGA 4FYMA 4WCVA 4ZJPA 1SQGA 4F6LA 1C7EA 1G5RA 2GHIA 1QHGA 2C1EA 1L5HA 2EW2A 2IOFA 2FRDA 2YFYA 5DT9A 3L0OA 5TMEA 2C7QA 3LYUA 3ZV5A 1OAAA 3NIBA 3QW2A 4F9TA 4LJLA 3AYXB 4YT4A 3DONA 4X3OA 3VZPA 3U9LA 3B9PA 1RYMA 4EZEA 2EIXA 1CETA 4XWYA 2CYBA 5DRTA 5CB4B 5UKDA 2R62A 3BORA 1DDGA 4LTDA 2GLTA 2ACKA 1BG6A 2J0UB 4Q3AA 1QP8A 3EQZA 3G2MA 3KSZO 4UEWA 3RUFA 1Z5OA 4KAXA 5ICSA 1YT5A 3K0EA 4DMGA 1CF9A 5AI0A 2Q3EA 2YX1A 4RXTA 4P3NA 4IDCA 1PS0A 4UVIA 2QXYA 2VYQA 3KOMA 4DJJA 2FZCA 5JIBA 1RABA 3WLPA 4MHSA 4RHCA 3KBOA 4JMPA 4OBWA 3PEYA 1IN5A 4IIDA 4XLLA 4ZDJA 1G3RA 4E5VA 1DQZA 1EBBA 2JEYA 2FPPB 4G67A 2PNJA 4DMKA 5KWIA 1PFWA 1VJRA 1VYUA 3D6VA 3EEYA 2RARA 3PDJA 4M3NA 5JE8A 3EOZA 2XRMA 5IC4A 4FWTA 1SOUA 3KS9A 3VI3B 3HJHA 4ZOCA 3LLSA 3CZAA 4MW0A 5JR3A 3C5HA 1B14A 5IUJC 2WTAA 3OH8A 4DCCA 1ABBA 5ICGA 1K8ZB 1KYIA 3A4VA 1YR7A 5AVXA 1Z3IX 1F06A 2JRLA 2PUVA 1QLWA 5BUQA 1NI4B 3NASA 3N0WA 2IS1A 4V2IA 4O2AB 4CMBA 1PJLA 2A9OA 2VF4X 4HDQB 4TV9B 4HDSA 2W2TA 5H4HA 4RFVA 4XFDA 4EJMA 5ES4B 4BMVA 1XFAA 5A6VA 2EWMA 4BKRA 1YB1A 1T5OA 2B5VA 3AI1A 1K5PA 3HKCA 1JKMA 3F5MA 3SZMA 4WECA 4EYOA 2VSXA 5E1DA 2IYPA 1ZD4A 3WK4A 5AVVA 3LYLA 4E5NA 2V96A 3JRXA 3BJIC 1PGQA 1MABA 4IIJF 2GF9A 2HSDA 3GFRA 4WDQA 3KR2A 5H82A 4BAUA 1DE0A 1NJ8A 2A0KA 3C6XA 1SXHA 2EP8A 4DBZA 2VTBB 3ER6A 2BN4A 5A71A 3W06A 4DPMA 2CNDA 4GHWA 4Z7OB 1DCMA 1IEVA 1R0YA 3CG4A 3G7NA 1M66A 4IYRA 1KXZA 1IQUA 1DELA 3DOIA 5TQ0A 3WDMA 4C29A 3ZNOA 1CR4A 1ZYUA 4BV2A 1EK5A 3WL4A 1QO0A 1U0GA 1CIVA 2PVPA 5LQMA 4J8PA 6ADHA 4JI7B 2CY0A 3NYRA 1PT6A 2IHJA 4O25A 3WGUA 4TVBA 5JZBA 5KTOA 1N9GB 3L9WA 2GFHA 2O7QA 3KE9A 4MYUA 1IWBB 3WLJA 2VPPA 3QWAA 3L2OB 1QH8A 1Z5PA 2ZTMA 3TL2A 221PA 5CK5A 1O95A 3HL0A 3LCMA 4MW7A 5EINA 4PY2A 3NTLA 3DDOA 4Q0MA 4J0KA 3GHYA 5EZQA 4BU1A 1NN0A 3NANA 1BMFA 1PAUA 3ZWOA 3GW8A 1XEFA 1K8QA 2A0YA 4XQ0A 3E1KA 1D1TA 4KXNA 4PYQA 1MJGA 1R12A 4R6XA 4QDJA 4CUKA 2YHUA 4YN3A 3TMYA 3FMIA 2JAQA 4MVWA 4NZNA 2C03A 3GN2A 1M67A 2PWAA 5AKGA 1Z37A 4Z86A 2XOEA 5DNEA 5IULC 2XMPA 1KJYA 1FYDA 2GGSA 2WYUA 4PQYA 5B53A 5TVKA 3F78A 4QQ8A 5BRAA 2O8CA 2AXNA 1X7WA 1A9RA 2JIOA 2IYQA 1AKTA 1P2TA 3L0SA 4B6PA 4DNFA 1J2RA 4LJ7A 4MW5A 2OLEA 3CXRA 3IP3A 1J1IA 2A0WA 3GOHA 3TL3A 4UREA 4D41A 4Q7QA 1GNPA 5A3SA 5JT1A 4UXHA 1TJ3A 5HF5A 3H4VA 2P78A 2WMNB 1VL5A 3DXXA 3QVLA 4BO5A 1FDOA 1DUSA 2QRVB 2G36A 4YI5A 3R5SA 2OGTA 2VUSA 3D02A 3L0YA 1G55A 2L19A 3KQMA 3KYCB 3RK1A 4OXKA 3SIRA 3IEUA 4EI7A 4IUDS 4MQMA 1E8DA 1MZVA 2OD2A 3AG5A 3WI7A 4QHYA 1OFGA 1T8WA 1YVUA 2FFAA 2PCJA 2YJ3A 4LVOA 4MKIA 2JFOA 4D82A 3RARA 3C3WA 1PYDA 4W1QA 2C97A 4L50A 3ZWMA 2GNPA 1MB2A 5K3BA 2PXCA 1DHRA 4TYNA 3IUNA 3KIPA 4PZCA 4M7OA 2FP4B 4BNXA 5KINB 1B42A 3IIMA 3OCCA 4GMKA 1EVZA 4IZHA 3ZCPA 4B44A 4J0FA 1XZHA 2YWFA 4NU0A 3EAFA 2H2GA 1AKNA 1IRXA 1DIOB 1RNLA 2LPMA 4NH4A 1E79A 2MR5A 4XPZA 3S7ZA 1QV7A 1S6YA 1VE6A 2AL7A 2OD9A 3H1AA 4RZXA 2VHCA 1SHLA 1TM4E 4MW4A 2QD5A 4UPDA 5FO1A 1PEKE 2FVXA 4CV1A 4L22A 4BVBA 1SRRA 1ZM7A 3AETA 3WJAA 4WW0A 2QX8A 1ZJ4A 1MNAA 3ANMA 3LW8A 3EJ6A 4JFAA 5FYDA 4F92B 1ZQ9A 3I09A 3WDLA 5MN6A 3ZDXB 1P7WA 3IRUA 3AUXA 1CQZA 2W2QA 1SUIA 5BYJA 1GOTA 3RUDA 5ALXA 1QIGA 1XEWY 1Y1QA 3ZVNA 1PN3A 2AJ8A 3N9IA 2F1OA 1GNSA 1ENPA 2IUYA 3C74A 3K73O 3PGKA 5IAJA 3FUCA 3RYFB 2A4KA 4JLBA 5KOHA 3QBDA 4CUJA 4R81A 1TIBA 1V2HE 1VQ1A 1ISJA 2VLIA 2Z4SA 5FT9A 2GYVA 3TINA 1OFUX 3QE2A 1XD9A 3IAUA 3QWHA 4V2UA 4PZYA 2JFWA 1R7RA 4LDRA 2QVYX 1WEHA 4ZEWA 4ARZA 1KAHA 4O02B 3EIFA 1Z4NA 1DEXA 2ZYWX 1IZZA 1GIAA 1VA4A 2XMSA 3AHGA 3NKLA 4FLFA 4YP0A 3ZIDA 3PA6A 1IXYA 4RF5A 1GGJA 1NMZA 3PENA 4PAGA 2DWCA 4PBSA 1KZHA 4A1FA 2R65A 1DOAA 4Y6LA 2EL7A 2ETXA 1NT2A 3MS7A 5H70A 1I5EA 2OCXA 3EEBA 4Y0AA 2O2SA 1G5HA 2ZQZA 3ER8A 3K5IA 1HY3A 5JSZA 1F20A 4LHVA 4MDHA 3A9VA 3PC7A 1QYWA 5D5HA 3SZGA 4ON9A 5HX7A 1ZVVA 3R09A 3I5MA 1NBEA 3AR6A 3IJRA 2AHOA 4WZBA 2BHRA 4WBNB 3VKHA 4D5EA 1ZGAA 1NTOA 4M1WA 2DOKA 4E94A 4Y2TA 4GR5A 2QQ0A 3ZY6A 3PDIA 1YJAA 1OXXK 1QVAA 3VR6D 4IDUA 3O93A 4TV8A 1V0JA 5L3ZA 3V2IA 4JLAA 4B1FA 5ALJA 5E8JA 3S8MA 4M9RA 1M6NA 3THYB 2A14A 2EHJA 3TUIC 2C82A 1F0NA 5CVJA 2QLBA 3LC0A 4FHFA 1Q1GA 3DV2A 3BMQB 1MTOA 3E3MA 4LJ4A 3H4MA 2FE1A 5C52B 1HSZA 1IK6A 3AVWA 3HCNA 2AMLA 2NADA 4BO8A 4BTLA 1LKZA 3OZBA 2WSSA 3I9KA 3WKEA 4REOA 1M8FA 1ZQ1A 1GY8A 2GPAA 4JOSA 3EIOA 3GFVA 5EWJB 4D0NA 3A3KA 1PUXA 4HX5A 1CRZA 2ID4A 4BIMA 3U44B 4MGYR 1OAOC 1R3UA 2QSYA 4L9AA 3VYVA 1A8PA 4ASUD 2D74A 1W0JA 1JSZA 4TTSA 1SD2A 2EGHA 4XCVA 3WGMA 2Q27A 2RKBA 3CLHA 3ICEA 2BKAA 3QJ5A 2J45A 1C9KA 3ONWA 4KZKA 2G08A 4NMMA 5AR1A 4YRQA 4D80A 1X6VA 1L5GB 5JBIA 1NBHA 3NMUF 4R1TA 3W2FA 3IAAA 1BFDA 2UUPA 1CDZA 1ZGJA 4LZLA 4D74A 2QJOA 3ZD6A 2XCQA 2JJQA 1GGEA 4YAJA 1QMPA 3IKTA 3LTNC 2X0JA 4HH3C 3VHXA 1QK3A 3WAKA 1HNXB 1PGOA 3FMVA 5DLEA 3SXUB 2XGOA 2XB4A 3PVCA 4HO1X 4KKVA 4BO9A 5EE3A 4FFWA 4JR2A 3IJEB 4POOA 3BJRA 4BO6A 3C5WP 3B1JA 5H68A 4BGVA 4DW8A 3FMGA 3U4HA 1UT5A 1DO8A 2HGZA 2AB0A 2Y92A 3DBHA 2NVBA 5A7HA 1OC2A 1QVZA 5MHTA 3PUJA 4G2TA 5D86A 1ZSVA 2ECKA 1KDTA 4HWRA 4Y98A 5IWAB 5BQ3A 4BXOA 4MPJA 1E9RA 2YZMA 1SC4A 1Q1AA 1V8DA 2PZLA 4XASA 4E31A 4OQFA 5ILQA 4ZZ1A 2QLJA 1PR2A 3QU5A 2R2AA 2BLNA 3L43A 5CX1A 4KHZA 1GNQA 2ZRJA 1XLWA 1R6DA 4PLWA 1QX4A 4EPTA 2Y1DA 3HO6A 4FMDB 5H5JA 1Q0TA 1YZYA 3EGXA 3JQAB 4MITA 3B9BA 4DPKA 2GBCA 4AZTA 3PVSA 4FYYA 3SQDA 1QB7A 1HWYA 2HQSA 4WI1A 4YIHA 2VF8A 2ODBA 1QM5A 2HCJB 3OMWA 4OHFA 2IRWA 2Z08A 3BC1A 3EXHC 4CLDA 4KQ9A 5FO0A 3WWZA 3MCVA 5EHXA 5DM0A 3GJSA 2FN7A 2Z6VA 1DNPA 3EQ2A 3JYNA 2F1RA 2Q7OE 2HHCA 4OI4A 3T38A 1E1RA 3VOBA 2BFCB 3ELBA 2NSHA 5FR1A 3PNPA 1E3EA 1FLNA 5ALMA 3GXBA 3DS8A 3M6MD 1ODKA 2XKAA 5E3HA 5LJIA 4JGGA 5EKTA 3EDYA 3NDBB 1N1MA 1TA9A 2H16A 2W43A 3H5VA 2QLMA 2DVMA 3IURA 2FUCA 2D8MA 4M9ZA 3LIPA 2GK6A 4Q12A 2A4MA 4S2EA 3SJUA 1OXTA 3ELYA 1REQB 3HBLA 4IJQA 1CEQA 2EHDA 1N25A 4RXMA 5GM1A 3A27A 4BY9E 2J6CA 3B7WA 1C4KA 8ADHA 5ITZA 2AFHB 4YJHB 3D7LA 4OO3A 3S8YA 2Z2YA 4X84A 2RGRA 2EJBA 2NZJA 4J6FA 1VE9A 4RJLA 1PGNA 1DCKA 2W71A 2SICE 4XVRA 3IAS6 3T4EA 1TYZA 5DVZA 3KT6A 1XROA 4OF4A 5DISB 2ZRDA 5HIJA 1KL7A 6REQA 1A9ZA 2HHLA 5I7HA 4YJ3B 4BN4A 2IYZA 5EMJA 4KPEC 2PO7A 3A26A 2LCQA 2E2WA 2Z6QA 3OO1A 1RZUA 3OOEA 4JU9A 2VRBA 3AL2A 3N2KB 2WAMA 4TTTS 3BD9A 1VG9B 5EUBA 2L18A 4M22A 4AF8A 1G8GA 4CR6A 5A4DA 5I7EA 5T4BA 4LMRA 3UV7A 1ZJZA 4XGIA 2H29A 1DG1G 3L8ZA 1LFAA 2IHBA 2QD1A 5ALKA 5LMUB 3FHTA 5C2JB 2QWXA 1O9BA 4IMJB 4ZODA 4C0SA 4F1KA 4D0SA 1V7ZA 2CL6X 3A11A 4P4SB 4DDHA 1H2EA 1SXJC 5B57C 2V4ZA 8OHMA 4GGPA 4PN7A 5E1OA 1EH5A 1SZJG 4X65B 4NJMB 1CYEA 2ZJ2A 2O05A 3LBHA 4K9QA 1QH0A 5C3MA 3KZOA 4IQ8A 3DBOB 5IF3A 2VKQA 1Y6GA 1A2KC 1M34B 1VP9A 4JWTA 1XTVA 4OA8A 3C98A 3JY6A 2XSZD 3OWXA 4KVGA 4MKFA 4P08A 3VZDA 4MXDA 5ADWA 3KPJA 1JKXA 3KTOA 4FK8A 3VNRA 4GLFA 3OOSA 4DXDA 2R47A 3TW8B 3MD9A 2ATCA 2JAHA 4UU7A 1BE6A 5DBEX 1S2LA 4EAAA 4E0BA 2C4WA 5AP9A 4ZMRA 1V8FA 3HUEA 1ZAKA 3UVEA 4DEYA 3O8BA 5GJCA 4DV6B 1SIWA 1DIHA 4L9RA 3IQEA 1OR8A 1SG6A 1DC8A 1VKZA 3UK6A 4BNIA 4ZVPA 5A5EA 3IDSA 5JNLA 4FGUA 5BSHA 3KQLA 3ENZA 2HWXA 3IT2A 3AP1A 1YCFA 3GRCA 4XE5A 1NMYA 4MWBA 1CFZA 2ZBGA 4JEHA 16PKA 1U28C 4PLZA 3FDJA 1HKUA 3K1TA 2OORC 1AKEA 1RADA 4COKA 3NYWA 3L4JA 3PC8C 3QU2A 4PZ0A 3RFFA 4ZYXA 4ZIRA 3OLQA 1EDOA 3OLCX 4Y30A 4ZT5A 3EZ6A 2BW0A 4WACA 5C4MA 1R18A 3P9ZA 1N0HA 2RH8A 1NVUQ 4B3MB 3BSSA 4C7JA 1NVXQ 1R8SA 4EL5A 3HYNA 1TC1A 3GJ6A 5JQGA 3OM9A 5CNIA 2YTZA 4FQ7A 2HTFA 5AJUA 3GLVA 2W6CX 3EGOA 4YPVA 3QA3E 2BZSA 3NTUA 2AWOA 1JEQA 4GG1A 4B2YA 3IILA 4X1IB 2PK3A 1E5DA 4YJGB 5CLFA 1U2SA 4ZAWA 2AOUA 4OV6B 1NQTA 3RAFC 1CSEE 1MO2A 5K0CA 3VMFA 2R4UA 1U2GC 4YDHB 3RSOA 3IMGA 1EGAA 1T8TA 4MW6A 2W5UA 2HSZA 3IT0A 1C8LA 4Y2SA 3W5VA 5EE0A 1EUCA 3BZUA 4D56A 1OC4A 4HTAA 2PRJA 5JCOC 1NRIA 4MGEA 1Z0AA 4PC2A 1UWCA 1MVLA 1AA6A 3CLSD 5CDFA 5JG7A 1EAYA 2FWMX 1AKUA 1PGJA 1OTYA 2OAGA 1V1MB 3C24A 3CIFA 3OOWA 4JXKA 3OJEA 4D92A 2PX4A 1H4QA 4CQNA 1T3SA 2F3RA 2V6JA 2Q9UA 1Y1PA 5B30A 2L0XA 1T4CA 5CIYA 1TK3A 3A4LA 1BKYA 2YFQA 4RF3A 5BNFA 3U1BA 1ONPA 4EY6A 2Z2XA 1PWEA 4M21A 5F5XA 3CZMA 3ORHA 2C0CA 3NT4A 1SKQA 1WMEA 3TSAA 4DUGA 2VSQA 3WIVA 4A6PA 1G21A 4CF6A 1IE3A 1W19A 3GLIA 3WMXA 4LQDA 2MR6A 4X8LA 2OWDA 3GLHE 2WYIA 4W1RA 4UEQA 3V4SA 4FGWA 1TQ4A 1NXPA 2WY2D 2J5XA 1ODLA 3D54D 4PRYA 5EL0A 4ESOA 4Q02A 3LXMA 1KEZA 1NW6A 3SKXA 1SU8A 1QP0A 3O1LA 2WT4A 3GFTA 1XQ6A 3LOPA 3ZE1B 1TPYA 3ADOA 1Q0UA 1XJ0A 5SZJA 1QKJA 1JIUA 3UJBA 1CJMA 1I6MA 5T41A 3RREA 1IH8A 3ZE0B 3BK1A 3ACBA 2R96A 1A2OA 4ISBA 1LA2A 1H5QA 4P2GA 4EEZA 4WCFC 3CRVA 5IKOA 1F2TB 1ZJ5A 2YOGA 5ALTA 3VNUA 1TX4B 1J8QA 3LP8A 2XGMA 3W2EA 1XCBA 521PA 2RI0A 1FXWF 3H3XA 5TDHA 5L3QA 2VJAA 4RY9A 2DUUA 3NFYA 1JZTA 3NBFA 4H31A 4JWKA 3C8MA 4Q05A 3HJBA 3P0JA 4QO8A 1C2YA 1CG6A 2FUG6 3QVJA 4GD3Q 2YH2A 4RUKA 4ECAA 1ADBA 3A1DA 3FNHA 1A7KA 1KSGA 1U9IA 3IQWA 5FPPA 5J4YA 4OLFA 2BYTA 3MGGA 1YNOA 3AU9A 1CJUC 1GEGA 1KNXA 2VH1A 4CT0A 1TCVA 1TZKA 3E9NA 4L0MA 5DBHX 4B3RB 4JHXA 1H2ZA 3Q0IA 4FQ8A 3UMFA 4Z9XA 2IYAA 2MOKA 5FF9A 2J41A 2P2DA 1CQJB 2C5AA 5MGBA 2BDEA 2VQFB 2IXEA 4ND3A 5AQ1A 4O4HB 4ZQBA 5BP7A 5H8WA 2ZTHA 5I7WA 1E7WA 4ND8A 3PD0A 1X80A 5TX7A 4MO9A 4OD0A 3DO6A 2IZ5A 3MMNA 5FTKA 2IV3A 5M2QA 3P9QA 1GP2A 4KBGA 1JHRA 1NRJB 1B15A 1DVRA 1RQPA 3OQ1A 4G9EA 4FSDA 1LSUA 1I94B 5BVGB 3I28A 1PJ3A 5JXJA 5KYWB 4DYDA 2Q1WA 1U8XX 2MJLA 3HEAA 1FTSA 1SCUB 2GD1O 2QIOA 2WBLC 3IQFA 3C43A 1AIPA 2XMDA 3A9RA 4PYNA 3QKRB 4WUVA 1LDBA 3S2FA 1KJ8A 4A4DA 4BVKA 1KVRA 4KX5A 5JW6A 1C4XA 1FUUA 1BS1A 2YNMA 2ZBPA 2GS9A 7AT1A 3H84A 4IOJA 4TQUS 4ZQCB 1EDDA 3PWSA 5SY9A 3D81A 3ITDA 1E4EA 4NE9A 1LPNA 4WK4B 4QPJC 5T64A 3UF0A 4L16A 4NCHA 3EZGA 2B1RA 5AXBA 3ZWBA 1UPAA 1YNSA 4P4GA 3L0BA 4CL3A 4YRJA 1AO3A 1D04A 1JBEA 1MUUA 4Q3NA 4O2BF 4FMBB 2Y05A 3AJDA 4AZSA 3T3MB 1UP7A 3TOXA 3WLSA 4LJYA 5C4GB 4BWGA 1OH5A 2V45A 3B5EA 3HHEA 1G59A 2NVUA 1UDRA 3WS7A 3N7AA 4LY0A 2JFXA 3ZZNA 2ZYSA 2DQ4A 1TVEA 3KV1A 3ZTWA 4DLKA 2GN0A 3VISA 3L6BA 1BJTA 2HJRA 3CUYA 3WNZA 2O8DB 5T4HA 2KLHA 4L4YA 3WLTA 2F2TA 3WG9A 2F3PA 4L28A 2ZRAA 4Q9KA 5JASA 2ECFA 3ZQKA 2FTKE 2QEQA 3QJGA 2FXVA 3QUSA 1TK2A 1PTKA 4DJFC 2F67A 3CR8A 3NYQA 4HR7A 1LBSA 2AFVA 2R6FA 1F2UA 2NZ2A 1DADA 2HMWA 3E70C 3RAGA 4RY8A 1L5HB 1T0HB 2Y76A 3LQRA 4HLQB 5TGZA 3MW8A 5CPFA 3KD3A 4Q1FA 3WA6A 2WVAA 2Z6UA 3V4RA 3P0EA 1JG4A 3G8YA 1C81A 1KZ1A 3IBTA 4J43A 4NDAA 4NE7A 4URXR 3WA7A 3G8CA 1YKSA 3NBZC 4IKEA 1UBKS 4NOKA 1QCDA 2KJQA 1SVUA 5IVIA 4KN9S 3RS0A 3CMCO 4J49A 5KTPA 4DLZA 2WUFA 3ZWWA 5IXJA 3PJGA 3AW8A 1YR1A 2FWJA 2QV0A 4IKOA 5HRUA 2UUBB 2IPNA 4RD6A 3UN1A 1Z25A 4L4ZA 2VP4A 5AJWA 5GIPE 2IYLD 3K3PA 2I2DA 1T9DA 4LFCB 1AQLA 1ZK2A 2NXCA 3TGLA 5TF4A 1O8CA 3H87A 2OD7A 3PUZA 3S2SA 4FNMA 1FS6A 4O4LF 2ECPA 4BV9A 2YIDA 3ZVMA 4BMOB 3AJ8A 4WEQA 3THOA 2YN2A 1H6DA 2VPWA 1JDUA 4FM9A 4BEVA 1DPFA 2I9KA 4G89A 1M2OA 2W6IA 3I0NA 4M83A 4IOMA 1BKSB 1VECA 1YR8A 3QLVA 1ZRHA 4QEKA 1K6EA 2I9PA 1E1YA 1XTSA 4Y9UA 4YRDA 5IP5A 2OXTA 5EKUA 2ZUVA 1G9XA 1TFUA 1NYTA 2QAJA 4MOWA 5FOXA 1M6WA 2XUHA 1ZXBA 4DG5A 1W59A 1MEOA 1NG1A 2OM2A 4HDSB 3UMSA 3TYXA 1S0UA 3ML1A 1XMXA 3PC3A 1G8MA 3HKCB 5ELLA 5EEHA 5FORA 3NIFB 4X24A 5TSDA 4S3MA 4BKPA 3G88A 1EE1A 1OWPA 2PPVA 2RK3A 4UM7A 3NDJA 1YBMA 3ADPA 2ONJA 3ZEIA 1MABB 1WMAA 1GG2A 2B7LA 2WJ3A 4IH4A 4IWNA 4MNTA 4QVGA 1X3SA 4RPLA 4XWAA 4DDVA 3QW4B 2QRJA 3I8SA 3ZU2A 4TMZA 3A8TA 1BCRA 2D2EA 4LBVA 2IVFA 5TQ0B 3KQYA 3CLUD 1PR9A 1NDQA 4FDLA 4BGDA 2EFHB 1P0MA 3C7TA 1RLOA 4RACA 4ZALA 5A6SA 1GDHA 5AW8A 5A4FS 1WZNA 2W6PA 3RTCA 3QEMA 1LTHR 1JXQA 1PZGA 1Q3TA 3CEPB 3DKKA 3QFCA 4B85A 1R4MB 2G9ZA 2H5IA 2CNWD 2O2CA 1T3LA 3AUSA 3SYNA 4QFBA 4RPHA 4PO3X 1QV6A 2X1MA 3TFOA 1BN6A 4EFNA 3IQZA 1QH8B 3IAM6 1PE0A 4HDAA 3I4CA 3NM6B 4M1ZA 2WJHA 1UBRS 4NP6A 3W0LB 4GSYA 5AIAA 2HLPA 3FG9A 1JQAA 2CDRA 3EIHA 3KDSE 4PGFA 4H7IA 2P11A 5DEIA 4KL8S 4KQ6A 3E18A 7REQA 3TG2A 3IT1A 3U7EB 4O3MA 4WA8A 2CXNA 3JD2A 3SBOA 3H9BA 1MRNA 3LBAA 1JQJC 2VOEA 4WOPA 5F4ZA 1GPYA 2P9QA 4BE4A 1R6UA 2WD9A 1H8HD 4EYGA 2OYSA 4HEJA 4LJ9A 3R23A 4QNRA 2YIMA 1P3JA 3VTAA 1QNFA 3TCKA 1U5BA 4N0MA 3ZEAA 3RSFA 2PS9A 2AF4C 1XLUA 2PUTA 2IEYA 1G98A 4LRWA 2O8CB 1X7WB 1X14A 1PT9A 5H1YA 3LDFA 3SSOA 1AK1A 2OCYC 4EPVA 5EJEA 5ALLA 4MWSA 4RTRA 4Q9IA 4H4EA 4S1PA 3N0RA 3P9IA 4V1CA 3QYAA 4UOQA 1O08A 4LXQA 5JCZA 3T7RA 1WETA 3HSKA 5BV2P 3FOAA 4MYSA 5I45A 2AEFA 4DGSA 3H2HA 4DLBA 3M7IA 5EY5B 1C7FA 3H5WA 4N5DA 4AY4A 2VJMA 3ZR4B 5IMBA 2DQKA 2D5AA 4IXWA 4W1PA 2C9DA 3AGPA 3RT1A 3ZGOA 4R1SA 4YAGA 2Q3JA 3D8NA 1E5LA 2C2GA 3GLUA 4DVGA 4RTJA 2G04A 3L7JA 4BGPA 1E7RA 1WXXA 3IKVA 3MPUA 1HETA 5TR9A 3FSJX 1YRAA 3P20A 4H1UA 4RANA 1WUKS 3B20A 3GELA 1E59A 5HK8A 2XVZA 3PYMA 2NQ8A 4IDAA 3OSZA 4JS0A 1XJ5A 4NYIQ 1R1DA 3JW8A 3OTHA 2F9MA 4EABA 5FTJA 2QP9X 3RHSA 5KTMA 3CXUA 1BO6A 1GGFA 2AZ4A 2BRUA 2Q2VA 3G3EA 4DQ0A 1EUYA 4LNUA 5HTKA 4ZRNA 1L5OA 2YV3A 5TNXA 1DV2A 4PAOA 3UFBA 3N5KA 2L82A 3QU4A 3FPHA 2RHOA 3GAZA 2PMCA 1HE4A 2ZSEA 4UMDA 3EGIA 2IY7A 5J4KA 7MDHA 2C2KA 3OM0A 2W2KA 4HX9A 3AETB 4DUZB 3VZSA 1MO3A 1SHKA 4M0MA 1II9A 3PWKA 3TW6A 2X8BA 1TM2A 3BTVA 1ADFA 1A5SB 1B0PA 3G9QA 4G5YA 1OGYA 2PZAA 2PUCA 3W90A 1G3QA 3QKWA 5KOHB 5CT4A 2AMYA 4IX9A 4QBFA 1ESDA 4R8RA 1WB9A 2G28A 4YASA 2MSKA 4YCMA 2R4QA 1PJBA 2PWBA 3ZW8A 1GQRA 2IS6A 3V1TC 4ARZB 1Q15A 1TK9A 1IZ7A 4M0DA 5C7OO 4IV0A 2CXUA 2XNDA 3HVRA 1K0FA 3U7GA 2W0MA 4EYSA 2ZIVB 5DJ5A 1ZGCA 3EHEA 4G4SO 3QTTA 4OJYA 1V39A 1CUAA 2CVPA 5KTKA 3EZ2A 1ZNXA 3R5KA 5TV2A 3SE0A 2IQIA 2XYVA 2I55A 2ZWVA 5IKPA 2XT9A 4KXQA 3UV3A 2BPOA 2RJNA 1NBMD 5JSZB 2COEA 1Q83A 2AN5A 1A95A 2CBXA 3MS2A 1J9EA 3EXEA 5K3EA 4MV4A 5EQFA 5FAXA 3M81A 1JG1A 4N47A 1SELA 3ILYA 4LE1A 4WZBB 5G0TA 4F9FA 4D9EA 2C4NA 2IZZA 4I4CA 4QTTB 4R9UC 4W82A 2VS1A 5IW8A 4UQOA 5FYQA 3BK7A 4EO9A 1H2AS 1L5NA 1ZCFA 2I7XA 1C9JA 3BF8A 3PDIB 3BS4A 4I6GA 4IDUB 3K1AA 1EDZA 3OHMA 4IQ4A 4TV8B 5P8WA 3RSQA 4Q3LA 5J43A 1F7UA 1EHCA 1O6GA 3EZ9A 2ZRIA 4YJ2F 2QTAA 4OHCA 4I4NA 5C1IA 1SZPA 4EG3A 4I19A 3NEJA 1X7DA 1O0BA 3PT9A 3MEQA 4X45A 4P31A 1AXRA 1R10A 4OHBA 3KSBC 3B3AA 3ESDA 5BSRA 4Q1DA 5L6LB 4WN9A 1S5PA 3KAJA 4CG1A 1OTXA 2Y4OA 4IR7A 1J24A 5JMPA 4BMYA 1EMDA 1WA5A 1F60A 4BHTA 1T5LA 4LRQA 2QZJA 4CR8A 1U3UA 5K3AA 1PEDA 3SVTA 1WBDA 3FSGD 5FTWA 1B6SA 3UK0A 2RD2A 1POXA 1I32A 2ECQA 4ML3A 1H9BA 3GRVA 1QZXA 4XGNA 2V5VA 4C03A 3JZMA 1JEYA 1L4MA 5CVDA 3RS8A 1K3FA 5HKKD 5DNYB 1E3SA 1QX3A 2JGEA