3SXSA

Crystal structure of bmx non-receptor tyrosine kinase complexed with pp2
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
264
structure length
264
Chain Sequence
GHMELKREEITLLKELGSGQFGVVKLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKMPYDLYTNSEVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structure of bone marrow kinase in the x chromosome: a Tec family kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Cytoplasmic tyrosine-protein kinase BMX
total genus 86
structure length 264
sequence length 264
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3sxsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3sxsA01
1QPEA 2UW0A 2CPKE 5K4JA 4UV0A 2WZJA 2ETKA 3PIYA 4IZYA 1STCE 5EYKA 3VUTA 2QOLA 3PXKA 4MD7E 5EOBA 2BKKA 1ZWSA 3QCXA 4ACMA 2P2HA 2BHHA 5A4QA 5CEQA 4ORKA 3RALA 2XK6A 2XIZA 2J51A 2WQNA 3IG7A 4GK4A 3D2IA 4RX8A 2BRMA 3SXSA 3UOKA 1L3RE 3F7ZA 3C7QA 4EUTA 5LMKA 4LUDA 3ZZWA 2CKEA 3CIKA 5AUUA 5LMKC 4JAIA 1YWRA 4WSYA 4DITA 4WNPA 3WZKA 3IGGA 3FMDA 4H1JA 3SGCA 2O65A 4BR3A 4D1ZA 4EI4A 5DWRA 5EM6A 2B0QA 4JQ7A 5DVRA 4CFWA 2O64A 1PKGA 3AC1A 3DBQA 3TACA 2XYNA 3V04A 5M4IA 4KBAA 4IE9A 2NRYA 1RJBA 3LXNA 1H0VA 2JBOA 4BI0A 1XBAA 5DMZA 3A60A 3WZUA 5AAGA 4ACCA 3PA5A 3F61A 4FEVA 4L43A 4B99A 3JY0A 4FL2A 4EH6A 4I1ZA 4KKGA 2PE2A 2C6EA 3ENMA 5TF9A 4BZNA 3CTHA 3H9OA 4FNZA 4CZTA 2XK8A 3QGWA 2C6OA 2PVNA 3BU6A 3EQPA 4N0SA 3V5QA 2X7OA 2FGIA 2CSNA 4BGQA 2Q0NA 4PL5A 2NNWB 4EONA 4H36A 3QC4A 2W0JA 4I22A 2IW9A 2XM8A 4FYNA 2XNPA 4J8MA 4KNBA 4YURA 4C61A 5HNIX 4F9AA 4CXAA 1XH7A 1LEZA 1Q97A 2LGCA 3OP5A 4I21A 4I5HA 4TNDA 4QMWA 5T6KA 1VYWA 2X2KA 5CS6A 5DA3A 3LCTA 4S34A 4IH8A 4U3ZA 5AUYA 3A2CA 5AWMA 3V5PA 1WBVA 4AWIA 2F49A 3I6WA 4QPAA 3F5UA 3CY2A 2A19B 2W1ZA 3LJ2A 4EL9A 2UZWE 2ESMA 4XUFA 2W1DA 3E8CA 4ASDA 2R4BA 3BYSA 2X81A 2UZVA 3FKLA 4JAJA 5DT0A 4GU6A 4ZLYA 2PTKA 4RIOA 2Y6MA 4DTAA 3GCVA 4KBCA 2JKKA 4PX6A 1Q62A 4RX7A 1WBOA 3A7JA 3L8VA 5AR4A 3V51A 2QOFA 4YR8A 3HRBA 4FV3A 4G5PA 4PDPA 5E8ZA 3U54A 1VZOA 3ODZX 4NYEA 4U45A 3MA6A 2PULA 4X2KA 3RAIA 4FVQA 4IWDA 4IHPA 5GIPE 4EJNA 5M51A 4IDTA 3ROYA 2FYSA 2Y9QA 4O84A 2WNTA 4CNHA 2NPQA 4ZS4A 4MEDA 4UN0C 4C33A 2B52A 3DKOA 5HCYA 1Q41A 4H3QA 2ZB0A 4QOXA 4U97A 2ZMDA 2YCRA 3QQUA 3Q4TA 4D2VA 1OL6A 5JT2A 4EOJA 3PPZA 4Y8DA 3Q4ZA 4I6BA 3B8QA 3HV4A 4TYHB 3NLBA 5AR3A 3ZOSA 4I0TA 4WRGA 2WTKC 1OIYA 2VGOA 2CLQA 4YJPA 3D5XA 4FKOA 4BZOA 4RFMA 4EOLA 4EZ5A 4GKIA 1YW2A 1H24A 4M8TA 3JVRA 2YACA 3G51A 2W1GA 4CTBA 3H3CA 3UVQA 4AGDA 4C58A 5AA8A 4BHNA 2WMQA 1ZYLA 3IPHA 4DFBA 1ERKA 5C03A 4RSSA 2J90A 3LQ3A 3ORTA 5HTBA 5E8XA 1V0BA 3QF9A 1JQHA 4RIXB 4CCUA 4UBAA 4F0IA 5IMXA 1KOAA 2OBJA 3BLRA 4WRSA 3HMPA 1OBGA 3IQ7A 5EDPA 1IA9A 3CXWA 4AXAA 2QR7A 1KWPA 4KD1A 4BTKA 2G9XA 3PJ8A 4RQVA 4OLIA 3UVRA 3H0ZA 2XMYA 3P0MA 3UO4A 2PVMA 3ZDUA 1AQ1A 4LOPA 4ZJIA 2ZYBA 4X2JA 2EXCX 2VTQA 4E73A 1OKVA 4CFMA 3RNIA 1XH5A 4TL0A 3BYOA 3TN8A 2CLXA 4ANOA 1SM2A 3QRTA 4CT2A 3PG1A 5CT7A 3VUHA 1U5RA 4PNIA 2W9FB 4XMOA 5FP5A 1JPAA 1Q8YA 2YN8A 3PJ2A 4YJSA 5I3OA 4LGHA 2ITQA 2J6MA 2C3LA 2EB3A 2V55A 3IOPA 4V0GB 4ZP5A 4PMPA 4QTEA 4I6HA 2J4ZA 3CTQA 4PTGA 4RT7A 1YHVA 1RE8A 2BAJA 4B7TA 4W8DA 5AUVA 4E6DA 2YLEA 2OJGA 1JKSA 1ZOEA 5FLFA 5J5TA 3KXMA 4YHJA 4AA4A 1XBCA 5ITAA 1GIJA 3L9PA 5IQDA 4XLIA 4NT4A 4W9WA 3WZEA 3FKOA 4F65A 4ENYA 3E7OA 4A7CA 4F0FA 5HO7A 3DTWA 4JI9A 3R0TA 4O7WA 4O81A 4XOZA 3KY2A 3PSCA 4EZ7A 3I60A 1YKRA 4QPSA 2QLQA 3DOGA 3FC2A 4GH2A 2WEVA 5LVLA 3R7OA 4AW0A 2Y4PA 3VS5A 4X6QC 4IAYA 3L8PA 5JGDA 5FXRA 4FIGA 3EFWA 4AGWA 2R5TA 3FKNA 1ZMWA 4JR7A 5K5NA 4R7HA 5FM2A 4WUAA 3UNKA 5FWKK 2Q83A 3MGYA 3R8LA 3RAKA 2QU6A 3NUYA 4L7FA 2R3QA 4U6RA 4Y72A 4AZVA 1JSTA 4MBLA 3ZRLA 5J9LA 5F4NA 3BE9A 2ERKA 4FSZA 3N4UA 5E8WA 3RP9A 1RDQE 1REJA 5BYLA 2X8EA 4FKGA 4WOVA 4M84A 4Q9SA 4X7QA 5DPVA 1BLXA 1OUYA 2GSFA 2OIBA 2VO0A 2RFSA 4LRKA 4FI1A 4MXZA 3ZSGA 4BCNA 4E7WA 2R3LA 1OUKA 4FR4A 4N6YA 4R1VA 5H8EA 4UZHA 5C01A 3VF9A 4A9YA 3TL8A 5AUWA 2PVJA 3R7UA 3NUUA 1OITA 2J5EA 2OWBA 3QXOA 5A46A 4DFUA 2VTHA 4GIIA 4IJ9A 5D9HA 3KXZA 3D0EA 3KF7A 2KULA 4I5PA 3PWDA 4TZRA 3UZRA 3NR9A 2WTWA 3C5UA 1ZOHA 2HXLA 3DBEA 3QL8A 4XG7A 3VUGA 4BCQA 5IUGA 2Q0BA 3KMWA 4FKTA 5M06A 3RZBA 1R1WA 3VNTA 4D1SA 3ORIA 2ZM4A 4CRLA 4HOKA 5E7RA 4U7ZA 3FYJX 1FBNA 4QMUA 3W8LA 5AP2A 4NJ3A 4RIYB 4CMOA 1NA7A 2WQMA 3EN9A 4JXFA 4YZNA 4BWPA 4DTKA 3PJ1A 1FVTA 4CEGA 1MRUA 3FPQA 2R3PA 3OHTA 5M56A 4ZZOA 5EK7A 5DOSA 4RGJA 2ZAZA 3MFRA 3VBYA 3O7LB 5CU0A 4JQEA 2G01A 2VX1A 1IRKA 3HP2A 2HY81 2YJRA 2GMXA 4JDHA 5J8IA 4DEBA 2GU8A 5CU3A 3R8UA 4NSTA 5L8LA 3VN9A 4ZAUA 3UYSA 2RFNA 5IA2A 2VTOA 4ZIMA 5CSVA 5E8UA 3JXWA 1M7NA 3LM5A 5IMEA 1H1PA 4QMVA 3FZ1A 3QQKA 4MXOA 4TPTA 3BGZA 2H6DA 2GHGA 2JAMA 3GC7A 3GGFA 5TR6A 1PXOA 4KIPA 4QMQA 3TUBA 3NS9A 3NVKI 4O7RA 4YHTA 4WNMA 3OC1A 2YM6A 4EWQA 3NNUA 1SVEA 3IW7A 4HCTA 4CG9A 3QKLA 3H9RA 2BPMA 3NSZA 1ZZ2A 4FV6A 4KABA 4F63A 4PDOA 2E9NA 4FV2A 3VRYA 4C4GA 5J1WA 3R8PA 1XH4A 2JKMA 1W82A 4JX7A 5F95A 2ITZA 3TNQB 2FVDA 3W16A 2F7EE 3LQ5A 3PDTA 2ITWA 2R0IA 2R3IA 4K6ZA 4A9UA 3E7VA 5DHJA 2XZSA 3P79A 1L8TA 4ENXA 3ACKA 3U8WA 4XG9A 3GU8A 1O6KA 1TVOA 5A4LA 1AD5A 5GHVA 1S9IA 3R7GA 5DT3A 4K11A 5IQAA 5CEPA 4CGAA 4YJTA 1IAHA 5FDPA 4BIEA 1WBPA 4QYYA 4EKLA 3DAKA 3OWPA 3ZEWA 4DHFA 4BICA 5I5ZA 5CU6A 4FIIA 2I7QA 2QHMA 2BHEA 2I0EA 3A8XA 1FVVA 4L3JA 5BMMA 4KS8A 3UYTA 4BCFA 3MPAA 1U4DA 2GNLA 4FT9A 2UW4A 3P78A 3PZEA 5CY3A 4UWCA 3GBZA 4E5WA 4OBOA 4WD5A 2ZOQA 4ASEA 3C9WA 3CTJA 2EVAA 4EBWA 3RBWA 2PVKA 2C5NA 4MD9E 4O0RA 4A4XA 3WF8A 1R0EA 1QMZA 2JDVA 3R1NA 2IPXA 1OIQA 5M4UA 4U40A 2ZDTA 5IQGA 2WFYA 5CX9A 4BDIA 3VBXA 2VUWA 5DE2A 4HGSA 5JFVA 3QCYA 4NL0A 3ZO2A 1JBPE 1B6CB 3IGOA 2BRBA 3BHVA 5M09A 4P5QA 3GCUA 5J79A 3AT4A 1CTPE 4CLJA 4BRXA 3QQHA 4NM7A 3D5WA 2QOOA 4BF2A 2HW7A 4OT6A 4WIHA 4USFA 5HE3A 4XBRA 3AGMA 4XG3A 3UIBA 4FKIA 2Y6OA 4H58A 3QX4A 3FLNC 4QT1A 4JOAA 4BIBA 1CMKE 3JPVA 2GQGA 1OKZA 3E63A 4X3JA 4NW6A 4C36A 5AR2A 1ZAOA 4G2FA 3RJCA 4QP8A 2YHVA 1SMHA 1YXXA 3A4OX 2JDOA 1YOMA 3II5A 4FV8A 5EKOA 3RM6A 4D4RA 5J1VA 4WSQA 4M12A 4I24A 5HESA 4BWKA 4O0SA 2Y8OA 1Q8UA 5EFQA 1AGWA 2WMRA 5EHOA 4RFZA 4U8ZA 3LXKA 5LMAA 4RC4A 2HXQA 2VWZA 4X0MA 4W8EA 4YLKA 2BILB 2VO6A 4FIEA 1Q24A 2J9MA 5HO6A 4Z7GA 5CXZA 5C8MA 2WMXA 3EN6A 4MAOA 4OTWA 5DLSA 2ITOA 4KWPA 4IZ7A 5L8KA 2FA2A 4MBIA 2XKFA 1PMNA 3O96A 3QD4A 4H05A 2YIQA 4NTSA 2OO8X 1Z57A 2UZTA 3LVPA 4O91A 3O8PA 4KAOA 4I3ZA 3SW7A 1PXKA 3OTVA 1B38A 4O7YA 4GT5A 3I0OA 3R04A 2QOQA 5FGKA 4O7LA 4FSMA 5AM7A 3QRJA 4FSNA 5CNNA 4H3BA 4D28A 4E4NA 3WI6A 2BALA 3GCQA 3GXLA 4HPUE 3MY5A 3QC9A 4WNOA 4HVGA 2XP2A 3HV5A 3QZIA 5LMBA 2P2IA 4DFNA 5IA5A 2W1HA 1KV2A 3MTFA 3NIZA 3P08A 3OT8A 4O21A 4QTCA 5I9WA 1MRVA 1J1CA 5H8GA 3DFCB 3MVLA 3K3IA 4J8NA 2J2IB 4O0XA 3A7FA 5L2IA 4PQNA 5BVKA 4BTFA 3PTGA 3LFNA 4O2PA 4EWHA 3GU5A 3ZO3A 2OZAA 1WMKA 3JYAA 4L44A 2GS7A 5CAUA 5D7VA 4FV4A 4A4LA 3R8ZA 3R02A 2XVDA 5BVEA 3OBJA 4EOSA 4IBMA 4TTHB 5EM7A 3A7IA 3AMBA 4ZMFA 5KMIA 2ZV7A 4HCUA 4JIKA 3OWJA 4O0TA 5IEYA 4RG0A 4EOOA 3C4CA 3MA3A 4IVAA 4IX4A 5EQPA 4J71A 5L6OA 2W05A 5HX8A 2B53A 1H28A 3DGKA 4O6EA 3W2RA 4MYGA 4PWNA 1TQIA 1P14A 4TN6A 4RPVA 1LP4A 4GSBA 4YO6A 4MNEB 4YSMA 4AZFA 3IW8A 1RQQA 3QHRA 4FYOA 3ENHA 5FXQA 1OPKA 3UC4A 4CFFA 2WMSA 2W1FA 5HTIA 3C5IA 3NAXA 3G6GA 3N9XA 5IDNA 1O6LA 5AUTA 4O38A 3CPCA 5KKRC 1H01A 5KNJA 5LVMA 3NMUF 1QPDA 2ITXA 3WOWA 5DG5A 3ANQA 2H96A 2XS0A 4D5KA 3DDPA 5BVDA 2WMTA 1YOLA 5J9YA 3ZFYA 4ZTQA 4JJRA 4FVRA 1PKDA 1XO2B 4XG4A 3HNGA 5BPYA 1LEWA 3OW3A 4QO9A 3ZLWA 4C4HA 4CKRA 4IX3A 2BFYA 3UMWA 3L9LA 3ZCLA 5L4QA 3SOAA 2XUUA 3F3UA 2YDJA 2V0DA 1BYGA 4RWIA 5JH6A 2YERA 2ZV9A 4RRVA 3ATTA 3CJGA 3TZMA 2IWIA 3PJ3A 2WQOA 2F7XE 1M14A 4USDA 1UA2A 3TZ8A 5L6PA 2OSCA 4U42A 4C4JA 4FX3A 2VNWA 3D15A 3FXWA 3W2QA 3C4XA 5EQEA 1SNXA 2GNGA 3IW4A 2JGZA 1NW1A 3Q2JA 1BI7A 1ZRZA 5AP1A 4ZTRA 2PMNX 2V5QA 4I0RA 3QGYA 1H4LA 5CT0A 5CTPA 3PA3A 4DG2E 5JFXA 3UDBA 4AT3A 4O7SA 3BE2A 5GIOE 4XOYA 3OXZA 4J97A 3FZTA 4CFNA 4EK5A 3BHYA 3C4ZA 5H2UA 1FMKA 4MNFA 3KN5A 2C6LA 2JC6A 3WYYA 2PZPA 4RZWA 4AFEA 1ZYCA 2ZVAA 5HG5A 4BKYA 4BYJA 5DEWA 4Y85A 4C37A 4O6LA 2QONA 4GVJA 5AAFA 2YDIA 1BMKA 3O71A 4XCUA 4L7SA 4AZSA 3QZHA 4JVGA 4BDGA 2C68A 4R7IA 4C34A 4DINA 2C0TA 1YI6A 4ZZMA 3QWJA 2X6EA 3GCPA 4NU1A 3KMUA 4EORA 5IQBA 2R3OA 4IAKA 4UY9A 3D7ZA 4F9CA 3FMEA 4CG8A 4WG5A 1WAKA 5AP7A 3PE1A 3VUIA 5EI2A 1PXPA 2OJ9A 2OXYA 3ZLYA 4MXYA 4CKJA 5AADA 3DFAA 1OB3A 4AAAA 5BX0A 2ZM1A 5EYDA 5LVPA 2JD5A 2I6LA 4ZSJA 2VO3A 5ACBC 3A8WA 3KF4A 2JDTA 3LAUA 3EJ1A 4IAIA 4IFCA 4Y83A 3UPXA 3CP9A 2RIOA 4FZ6A 4FSTA 3SDJA 1YVJA 5FEDA 4F7JA 1OL2A 4DC2A 1ZXEA 4QMSA 2XIKA 4A9SA 2GNHA 3KXGA 3NRMA 3F3WA 3Q9ZA 3ORZA 4Z9LA 2P4IA 5KUPA 4TT7A 2J0LA 2VWBA 3PIZA 3G9LX 5DI1A 4IMYA 5HG8A 5HICA 4EYMA 2R3HA 3EFJA 4L67A 3DAJA 3P23A 5AX3A 3SG8A 3SA0A 3VHEA 2JKQA 4TYIA 4MH7A 4FKRA 4TRLA 4QQTA 3COIA 3MH2A 2BIYA 5TT7A 3RMFA 4TWCA 4L01A 4MHAA 2CKQA 4NW5A 5HHWA 2VTMA 4FTLA 4BC6A 5FEQA 4GU9A 4GG7A 4G6NA 2C3IB 4FTKA 3QTSA 4I4EA 3E87A 4GK3A 4MWHA 3LOKA 3FSKA 4IAAA 4MBJA 4F09A 3P7AA 1XH6A 3DV3A 2DWBA 2WPAA 4GCJA 4GIHA 4RC3A 5IKWA 4HVHA 4QYGA 4IAZA 1UVRA 4EK3A 4FTIA 4I4FA 1ATPE 4FKSA 1PJKA 1GY3A 3NYXA 5GNKA 4BCKA 4DLJA 4FSWA 4OAUC 5FRIA 1Q3DA 2VGPA 4V01A 4DG0E 2FSOX 4EEVA 4U43A 2YIYA 4FNWA 3FSFA 5IA4A 3DQWA 3GUBA 1UNHA 3F3ZA 4ITIA 3OZ6A 3DB6A 5CSXA 4LI5A 3VBQA 3WARA 4L3PA 3PVGA 4WKQA 3VF8A 3E93A 2WAJA 4BDKA 2ZJWA 4C0TA 4CT1A 4EHGA 4ONAA 4F7SA 4FSYA 3KULA 2QCSA 5AX9A 4IACA 5AIKA 4FSQA 1R3CA 3HL7A 3QD0A 3ZLSA 3AC2A 5JEBA 3NCGA 3VS0A 5HQ0A 3BV2A 5J9ZA 3U4WA 3QQLA 4BDBA 2JIVA 4RFYA 4F1OA 3N51A 3VVHA 2VWYA 5AR5A 3PP0A 4EHZA 3M42A 5C1QB 3Q9XA 5BNJA 3E92A 2HENA 3MH0A 4L00A 5D10A 3R8MA 3ALNA 5DR6A 3AC5A 2R3RA 2RG6A 3R73A 1GNGA 2R3JA 4WNKA 4JG6A 2X1NA 3R21A 2EUFB 2WELA 5JN2A 2BDFA 1NVSA 3ZZEA 4L42A 5FUTA 2QODA 1E1XA 2YWVA 2UZOA 4KUJA 4FKUA 3DKGA 1YRPA 4FUYA 5ETAA 4AQCA 3KFAA 3DXQA 3UQCA 2ONLC 3Q4CA 3AMAA 4RVMA 3S4QA 1KE7A 4HNFA 4BCJA 2NP8A 5J5SA 3GC8A 4BL1A 2VTAA 1IAJA 2W1CA 1Y8YA 3BKBA 5BVNA 4IFGA 5L3AA 1A48A 2CNQA 2I1MA 3FY0A 3RPRA 2YM5A 3OBGA 4HZSA 4OTIA 2IW6A 4FZFB 2VTNA 5B2LA 3MB7A 4L68A 1PXMA 5L2QA 5HOAA 5LCKA 4BKZA 2B54A 1PMEA 2XCKA 3NYNA 3A99A 4KINA 5JK3A 4AP7A 5IH6A 3DQXA 3K5UA 4MF0A 4JS8A 2PUUA 2C6KA 3AOXA 3DXNA 3IDPA 3P4KA 3BV3A 4FT5A 4RJ7A 4TYEA 5FBNC 3QA0A 2XNMA 4AZWA 4OGRA 3FZSA 3UIUA 2VV9A 5EW3A 3EZVA 2R2PA 4R8QA 2BZHB 1XBBA 1OKYA 4AW2A 3FLYA 4EHVA 3NZ0A 2J0JA 1SVHA 3V6RA 3M2WA 4ZXTA 3PY3A 3A7HA 4AA5A 5ANIA 3TNIA 4TKSA 4PPBA 3FMHA 4YGAA 5GZ8A 2WU7A 2PHKA 3D5UA 4IDVA 4K8AA 4MWIA 4Q2AA 1IEPA 3HKOA 2GCDA 3FQHA 4LUEA 4BGGA 4F99A 4IW0A 4NFNA 4FIHA 4G3CA 2XB7A 2GQRA 2G2FA 5JFWA 3KRWA 3LMGA 3U9NA 2YJSA 3AQVA 3C4WA 3KK8A 2RGPA 5EG3A 4EK8A 5JKGA 5IQHA 5C8KA 3DZOA 3ZBXA 1M2PA 1JKLA 2IVSA 3DK7A 3QZFA 5KHXA 4EKKA 5AA9A 3K54A 4M68A 4K18A 4BY9E 3EWHA 1YDRE 4C8BA 2C47A 3P1AA 5CI6A 2PUIA 1HOWA 5DNRA 4E5BA 3OS3A 3UOJA 1APME 4BCOA 5JGBA 3U6IA 4Y5QA 3TI1A 2YLFA 4II5A 3TZ9A 3QD3A 3EHAA 5DIAA 1YWVA 4I6FA 3OT3A 2UZUE 2WIPA 3DY7A 2W7XA 2XRUA 4FL3A 5HNBA 2Z8CA 5DN3A 1H27A 1ZOGA 2IVUA 2B9JA 3ALOA 2X4FA 3EYGA 3FWQA 3EFLA 4FSUA 4RC2A 3KRXA 2WKMA 1PYXA 3CQUA 3IO7A 1G8AA 2P55A 2VTLA 3VULA 4P2KA 3FMJA 3A4PA 4X2FA 3HA8A 3PJCA 4J98A 4OBQA 4I20A 4W4YA 1URCA 2R7BA 3Q60A 5AM6A 4BBEA 5M4CA 2DYLA 3POOA 3HX4A 4JG8A 4U5JA 2VWVA 1UWHA 1OIRA 4U0IA 3MFTA 4OTPA 4MKCA 2QLUA 4AW1A 5EQYA 2YABA 2BIKB 2G15A 3EFKA 3TT0A 3WE8A 2W4KA 2JIIA 4IQ6A 4QYEA 3U9CA 4CVAA 3DNEA 4KS7A 3FLQA 2OI4X 3I7CA 4PNKA 3FUPA 1P4OA 3ZONA 2BAQA 3ZUTA 4AFJA 2ZV8A 4DEEA 1W8CA 4JRVA 3H10A 5BUEA 3DDQA 1K9AA 3GFEA 4Y95A 1OZ1A 2RFEA 5LCJA 3NGAA 4NCTC 4ALUA 5C26A 2QO7A 4EJ7A 4IC8A 1FPUA 2XK4A 4M13A 4WG3A 4PP9A 2WEIA 3HV7A 2Y7JA 2WQBA 3PPKA 4FKJA 1PY5A 3MVHA 4QTDA 4RA4A 5ANJA 3TEIA 4UZDA 4CFUA 4D55A 5J7HA 3Q96A 5J95A 4IX5A 3LIJA 4I5MA 3KVWA 3FPMA 3DJ6A 3EQGA 3LJ0A 4FK6A 2UVXA 5AP6A 2PY3A 3ZBFA 4BDAA 2ITVA 1X8BA 4CCBA 3Q3BA 4ANNA 4KKEA 3R2BA 5ANDA 4F9WA 5HX6A 4D2TA 4ZEGA 3CPBA 4GFGA 2C1AA 5K3YA 3NUPA 4BGHA 1J7UA 1O9UA 3RKBA 1CDKA 3CCNA 1V0OA 3NW5A 5I4NA 4C35A 2X7FA 4PPCA 4C4EA 4J53A 2IVTA 2EWAA 4AE9A 5E4HA 3EQRA 4L45A 4CZUA 3P7CA 2W17A 4NKSA 3RVGA 2P3GX 4UMRA 2EXEA 4HGTA 2YAKA 5FG8A 3IKAA 2CGXA 2HZ4A 2R3KA 3WIKA 4CYJA 1UU7A 3MYGA 2FUMA 1UU3A 1SVGA 4JL9A 1B39A 4YTFA 2R9SA 5E1EA 4EQUA 4B8MA 3UIMA 3TTJA 4JDJA 5K5XA 1H25A 5CWZA 2QD9A 3FMMA 3CR0A 4G34A 2SRCA 4PUZA 4BDCA 4FKVA 1DAWA 3QQFA 4O0VA 4UYNA 3VS6A 2PUNA 1EH4A 4JBQA 2XA4A 4N6ZA 4OTDA 1YDSE 3OWKA 4NWMA 5LVOA 3VW8A 5HBJA 5TOZA 3SD0A 1H8FA 2XEZA 4GYIA 2R3GA 4XRJA 1VJYA 2O0UA 4XJ0A 2YFXA 5DYJA 2A27A 5E1SA 5M07A 1VEBA 3PWYA 4ZTHA 3ZSIA 4PY1A 2P33A 4O7NA 4IB3A 1K2PA 3HMMA 4M0ZA 1DI8A 3HAMA 2XH5A 5CU2A 4D4SA 3OOMA 4J95A 3D4QA 4FV0A 3RCDA 3MH3A 2YIRA 4ANQA 4F6WA 5BUIA 1E1VA 5KKRB 4DEIA 1Y57A 2BTRA 3QUEA 4AUAA 2VTSA 1Q5KA 3KGAA 3DLSA 2C4GA 2QG7A 2YM3A 3HYHA 3O0GA 3HMNA 4GRBA 4H3PA 5E8SA 4DGNA 3GENA 5B7VA 2VZ6A 3R6XA 4HGEA 4ALWA 3VW6A 1IASA 5CF8A 4FBXA 3BX5A 1DAYA 4LMUA 3RAHA 1YDTE 3V5LA 4BDJA 1Q8TA 3BLHA 4APPA 3FEGA 5HKMA 5B0XA 2OJJA 5E92A 3DA6A 4BIDA 1JOWB 2XJ2A 2VU3A 1R39A 3ET7A 2QO2A 5HD7A 4FNYA 3WYXA 4DBXA 3DCVA 3LFEA 2B1PA 4QPMA 2WHBA 1YHSA 3QYWA 2PK9A 2QOKA 3DTCA 4KSPA 3KVXA 4BI2A 4D9UA 3EZRA 2C5XA 2QOCA 3OW4A 4P5ZA 5IA0A 3AT3A 2UVYA 3W2OA 4FF8A 5HI2A 5IQIA 5KZIA 1PXJA 2VD5A 3EYHA 5FBOA 4DCAA 3EIDA 4KB8A 2O5KA 3PPJA 4QTAA 3LFFA 3ZC5A 4Z3VA 1HCKA 3AT2A 5CSWA 4DEDA 3OG7A 4FTOA 3EQDA 4YJVA 1YXSA 2HAKA 5FTGA 5AV3A 4IWPA 3ZU7A 5IDPA 5IG1A 1UV5A 1R78A 3R22A 4J96A 1FINA 5ANKA 5C27A 4X6RA 3MVJA 4XH6A 1QCFA 3M11A 4M3QA 5I9XA 4DT9A 4JDKA 2ZDUA 4KIKB 2BFXA 4LV5A 3HA6A 4X2NA 4YNEA 3GNIB 5E90A 3UIXA 4GFMA 4NM5A 3VUMA 4QP7A 3F66A 1U54A 2C6TA 2JFLA 2UUEA 5CQUA 5BYZA 3QZGA 4XP3A 3SAYA 4RWJA 3AMYA 4G6LA 4E26A 4QP9A 3DK6A 3EH9A 2E9VA 3SOCA 3WBLA 3GEQA 3BQRA 4C2VA 3UQGA 4AOJA 1IG1A 2J7TA 3PSDA 2GPHA 3BYVA 4TWOA 4FT3A 4HYUA 3CE3A 2B4SB 5DBXA 3ZDIA 5AFVA 4G1WA 2QU5A 3EL7A 2JFMA 2G1TA 2OH4A 3RK5A 2B55A 2CGUA 4AA0A 1H1RA 4ZK5A 4R7BA 5CU4A 1J7IA 5CNOA 2XBAA 3NNWA 4QMNA 3LFCA 3I7BA 4CMUA 2PYWA 3NCZA 3PIXA 3NUXA 2GNIA 2YEXA 3CJFA 5A4EA 2GFSA 3REPA 3LJ1A 3ORLA 4HVIA 5CXHA 4FA2A 1OECA 1TQMA 3QHWA 4YZBA 5E8YA 3V5TA 2HY0A 1GIIA 1H08A 4FVPA 4FOBA 4R1YA 2OU7A 3TUCA 3DJ5A 2VTPA 3BHUA 1OL1A 3V5JA 2PPQA 4IC7A 4FTMA 4O27B 4ZLOA 3UOHA 3O8UA 1W84A 2WTCA 3QWKA 4MVFA 4XG8A 2BAKA 4YC6A 2R3FA 4AT5A 3G0EA 3QCSA 1YOJA 5IF1A 2PUPA 5I0BA 3F5PA 3U4UA 5AV4A 2OJIA 3BZ3A 5HLWA 3G15A 2XIYA 3BHTA 4NK9A 1JSVA 3H4JA 2PMIA 3ZEPA 4NTTA 5FXSA 3KB7A 4BCHA 4C02A 3Q32A 1A06A 4O7TA 2UZNA 4JX3A 4XHKB 3M1SA 4U81A 3V01A 3ZRMA 4E1ZA 3R30A 4Z16A 5A4CA 3E64A 2OXDA 5K0XA 2XIXA 4W4VA 1WVWA 2V22A 2XKEA 5EKNA 3NUAA 2X8DA 4OTFA 3TTIA 5K4IA 3NX8A 4DEGA 4EBVA 4BBMA 1OPLA 5CENA 3G9NA 5CF4A 5AJQA 2PMLX 2ACXA 1J1BA 4G9RA 4B8LA 3EQBA 3GC9A 3MPMA 4CSVA 3OROA 3H9FA 3BLQA 2EB2A 4GFOA 2O8YA 4LRJA 2CCIA 3MFSA 4B6LA 3VJNA 1TKIA 3NW6A 3KXHA 3TIZA 3C13A 4G6OA 1OKWA 3RPVA 4PDYA 2YZAA 3ZO1A 4S31A 3MIAA 4KKHA 4CQGA 5BUJA 4G3DA 4FV9A 2F2CB 4MXAA 4OW8A 4QP2A 5EHLA 2C5VA 5L6WL 3F88A 4C3PA 4ZY5A 2XK3A 4UXLA 5A9UA 3AG9A 4YBJA 4GS6A 2W4OA 3GQLA 3R1YA 3MJ1A 3IS5A 5GJDA 5G6VA 3KREA 2OFVA 2UW9A 4XV9A 3I79A 3E88A 5IH5A 2BDWA 3UNZA 2JDSA 3SQQA 4DFZE 3Q9WA 4G5JA 5KBQA 4O82A 3U87A 3F5GA 4ZZNA 3W33A 4EOPA 5KBRA 2W5AA 2UZDA 3L8SA 4F9BA 3EB0A 4PTCA 4IB0A 5CASA 3BI6A 3R9NA 3MV5A 1ZYSA 4XYFA 3LM0A 3ORKA 3CSVA 5CEIA 5F20A 2WB8A 2CHLA 2ITPA 3QALE 4FEQA 4NIFB 1YQJA 4R6VA 4X3FB 4M69B 5AR8A 3IW6A 3PY1A 4YP8A 5BMSA 4L6QA 2WTJA 1XQZA 4JT3A 4TWNA 3EN7A 3PFQA 5DT4A 5HIBA 4O7ZA 4FG9A 3ZXTA 1LR4A 5FD2A 4EHEA 1OVEA 3BBWA 3TCPA 2E9UA 4OBPA 5D41A 3DLZA 5A54A 5CEKA 4YJQA 3DB8A 4XP0A 4IIRA 2CNVA 2WXVA 2RF9A 2UW5A 3NNXA 2C1BA 4AE6A 1J91A 3I5ZA 4GUBA 3V8WA 1VR2A 2E2BA 1XH8A 3PRIA 2V62A 3SKCA 5KX8A 5M55A 4F08A 5J7BA 4GT4A 2JBPA 5BVWA 4LGDA 2HZIA 4CFXA 1YI4A 3IW5A 2HWOA 4N57A 4YPDA 3OY1A 1XH9A 4IVBA 4O7VA 3FE3A 3Q53A 3E3PA 4C3RA 4YUQA 5TO8A 3MWUA 3ZS5A 3LCOA 4Z55A 3T3VA 2YISA 2ONLA 2QC6A 5EOLA 3MY1A 1Y6AA 5HNGA 2VO7A 5T3QA 4BBFA 4EH9A 4OAVB 4FEUA 5A6NA 4FKWA 5CF5A 3P9JA 3PVBA 3QXPA 1Q3WA 4J52A 4J7BA 2XF0A 3MY0A 2OLCA 2PE1A 1O6YA 4RQKA 3FXZA 5KMNA 3WF9A 4UMTA 3OOGA 4FGBA 4XG6A 4DGGA 4L46A 4XBUA 4TWPA 4BKJA 2PU8A 4CMTA 2VTRA 3OWLA 4EC9A 5CAVA 2YCFA 3R01A 5HVJA 3C1XA 2PWLA 3F7WA 4U80A 4DH5A 2GTMA 5H3QA 4JG7A 4O83A 3U6HA 4QMTA 4EC8A 2BZJA 1Y91A 3TZ7A 3BQCA 4OUCA 4E4MA 3EOCA 4M7IA 4MF1A 2G2IA 2AYPA 1OL5A 2JLDA 2FSLX 3FY2A 5LXMA 3TKHA 3ID6C 3ORPA 4C62A 3BGPA 4G3FA 3A61A 4JQ8A 4DN5A 3COKA 1KE9A 4ZMEA 4QD6A 2F2UA 2IZRA 5CQWA 4TW9A 5JRSA 1CM8A 3AXWA 3FLSA 4WT6A 4CKIA 4G16A 1UWJA 4O1OA 4ZTNA 4I5CA 2VRXA 3CY3A 2BROA 1PXLA 3HEGA 2W1IA 1H00A 4JBOA 2P0CA 4P4CA 1JSUA 3F82A 5CI7A 3GFWA 4GUEA 1KE6A 3RTPA 1KE5A 4FKLA 3K3JA 5BYYA 4FEWA 1QL6A 4F7NA 4AZEA 3GU7A 2O63A 3VC4A 4DH7A 2I40A 4Q5EA 4GL9A 3KCFA 3LFAA 3QUPA 3UP7A 4RJ4A 4F7LA 3LMIA 4L8MA 4FSRA 2HK5A 3IONA 5HE1A 3PA4A 5M57A 2XNEA 3EL8A 1MQ4A 3RWQA 3F5XA 4HYSA 4IVCA 5E8VA 5C9CA 4C4FA 4CYIA 4PP7A 5KCVA 3LE6A 4FMQA 3FZPA 5FM3A 4EOIA 3KRJA 2AC3A 2JITA 3VQUA 1PF8A 4DFLA 3R7VA 3FC1X 4ALVA 5EW8A 3DT1A 3H0YA 5JZJA 3EQFA 2HIWA 4UMPA 2CKPA 3W2PA 3IOKA 4BI1A 5IPJA 4I0SA 2Y4IC 3S3IA 3MFUA 3LZBA 2C3JA 5LVNA 3BWFA 2WMUA 3Q5ZA 4Q5HA 4MXXA 5HCXA 3VBTA 3QYZA 4PRJA 3TJCA 4J1RA 3UMXA 1QPCA 2E9OA 3AGLA 3ANRA 3CKXA 5CVGA 5CZHA 4HYIA 3QQGA 3RI1A 1W98A 4L9IA 1M52A 4YTCA 3VUDA 4DYMA 3VS2A 3MW1A 3NEWA 3WIGA 4IZAA 4AG8A 1J7LA 4GJ2A 2CCHA 5AIRA 3BU5A 2PMOX 1PXIA 4RLKA 4GK2A 4E3CA 2ERZE 3FXXA 3D2KA 3HVCA 3ZTXA 2BR1A 3E62A 4EOMA 3ZLXA 3V3VA 3UZTA 4IWOA 2BZKB 2QQ7A 2W5BA 2WTDA 4D4YA 3DXPA 4DG3E 2XNNA 2QKWB 4K1BA 5HE2A 4UMQA 5C4LA 2F7ZE 3C50A 4NCTA 3DJ7A 2QO9A 3NIEA 3CLYA 3RCJA 3T3UA 5GINE 1WBWA 3VS7A 2REIA 5HTCA 3QCQA 2X4ZA 3BEGA 2W99B 3HLLA 3ODYX 4W4XA 5L2SA 4LGGA 3GU4A 3QLFA 4DT8A 1P5EA 2Z2WA 3DKCA 3R71A 4M66A 3BELA 5DGZA 3TKUA 3FZOA 3R63A 5LJJA 5M44A 4XS2A 5I9YA 3RNYA 2Y0AA 1DI9A 2YM4A 4E20A 2CN5A 2XBJA 4NH1A 3HRFA 3SV0A 3SHEA 3TV4A 3U51A 4I93A 4BN1A 4QRCA 1NVRA 4IAFA 4IM3A 3EQIA 3ZM9A 2VTIA 3RHXA 4F1MA 2BRHA 3QTRA 4DGMA 1JKKA 4YO4A 5EYMA 3EQCA 2QURA 3B2WA 2C0OA 3G6HA 3SRVB 3KU2A 4B4LA 2ZM3A 2ZV2A 3FHRA 4A9TA 3QD2B 4E6AA 2OF2A 2W5HA 5BVOA 3VWAA 1T46A 3PLSA 3Q6WA 3R1QA 4OTHA 3BYMA 2OIQA 3PXYA 4U79A 2H9VA 4KIQA 2PVHA 4LMNA 3C4FA 2IZTA 4M69A 4YZMA 1CKIA 2PZIA 3WF5A 1WZYA 4DEHA 4FTAA 4K2RA 4CV8A 4XG2A 3D83A 3FI3A 3KXNA 1PMVA 4NFMA 2DUVA 3FLWA 3Q9YA 2BRNA 4LM5A 4AX8A 3ROCA 4GT3A 3ZSHA 3IK3A 2KTYA 3S0OA 3D14A 1MP8A 2Z7SA 1Q8WA 1M2QA 1SZMA 2YAAA 4D2WA 1P4FA 1YHWA 4C38A 5C8NA 2XNOA 3UGCA 2PZRA 1ZY5A 1UNLA 4S33A 4UYAA 3NYOA 2WU6A 4FV1A 2LAVA 1FMOE 4FKQA 4O2ZA 5EHYA 2BVAA 1KOBA 4E6CA 2XYUA 4HJOA 4ZJJA 3DNDA 4UB7A 3UODA 3S95A 4N4SA 2GHLA 2HELA 4RVTA 4MNEA 2IW8A 3SVVA 2XNGA 1BL7A 3NWWA 2NRUA 2V7OA 3QLGA 4JIAA 2HOGA 3COMA 4APCA 2BZIB 4FKPA 2EXMA 5AP0A 3RK7A 4EOKA 5AAEA 2DS1A 3G5DA 3P5KA 2ZB1A 5B2MA 3BEAA 4QQJA 3QBNA 3D7TA 2J0KA 2XJ0A 4V04A 1J3HA 4IVDA 4E6QA 3ZYAA 3EMGA 2OGVA 2UW7A 2X7GA 3R9OA 1ZY4A 2B9FA 5JRQA 2I0HA 4AF3A 4ERKA 4KIOA 4U44A 2R64A 4D2PA 5HU3A 3TNHA 4UWBA 3OUNB 3MS9A 4ZY4A 4YZDA 2Z7LA 2F4JA 3TWJA 1Y8GA 3GC0A 3RPYA 1OIUA 4LRMA 3W1FA 2RL5A 4CZYB 2JEDA 5ICPA 4YJOA 3QFVA 3RPOA 3KC3A 5HIDA 4R77A 3E5AA 3FYKX 5HORA 1Q61A 3Q52A 4IM2A 3ZH8A 2BTSA 3LCDA 1GZKA 5DH3A 5EI6A 1PYEA 4A9RA 3POZA 4F6SA 4DGOA 2PZ5A 5EW9A 1XJDA 2XJ1A 2W1EA 4K77A 3MN3A 3Q04A 5IQEA 3DBCA 4YHFA 4ZSEA 3R9DA 4AU8A 4NM3A 4C4IA 2VWXA 4WUNA 3FMNA 4IZ5A 5IUIA 4I6QA 3PP1A 4BVUA 3LLAA 3I5NA 5HBEA 4NEUA 4QMOA 1U5QA 1JWHA 3S00A 4C7TA 4D0XA 3Q2MA 2ITNA 1FQ1B 4AS0A 5F9EA 3QX2A 5CALA 5FEEA 3HP5A 1G8SA 4XP2A 4IADA 3FAAA 4TNBA 3HZTA 4AW5A 4CQEA 4O86A 2W4JA 2GTNA 3FQEA 5HG7A 3EN4A 2QHNA 4GEOA 4QNAA 5IEVA 2YZLA 2I0VA 3UOLA 4EH7A 4IANA 4QP4A 5CAQA 3ZO4A 4E5AX 2JKOA 1KE8A 4EQCA 4MQ2A 4M15A 4O0WA 3FL4A 4UWYA 4FTJA 3ZC6A 3D94A 3L8XA 4RVKA 4JLCA 3VUKA 2A4LA 5JQ8A 1FOTA 2C6DA 3E3BX 4XLVA 5CVFA 4B0GA 3I0QA 2VWUA 3BGQA 5AP4A 2XKDA 1E9HA 1WBSA 1XHAA 2OW3A 1ZMUA 3OFMA 4FV5A 2IZSA 4HYHA 1BI8A 4NM0A 5HZNA 3OD6X 2X2MA 4ZTSA 1YXVA 5JQ5A 5D11A 2XNBA 4LL0A 3ZXZA 4ASXA 2WOUA 4BTMA 2HZ0A 2JIUA 3FDNA 4DFXE 3NAYA 4QMYA 5EI8A 4YPSA 2WQEA 2UW3A 4QQCA 1K3AA 3KL8A 2HWPA 4Y73A 4KBKA 4YNOA 3UC3A 4I94A 3UTOA 5CAOA 4BCMA 4LQMA 3NDMA 3HECA 3G33A 1G5SA 2X39A 3HDNA 3OVVA 3PXRA 3I6UA 3R1SA 4GV1A 3TIYA 2FSMX 1NVQA 3QTXA 2QNJA 5AV0A 5IU2A 2E9PA 3FV8A 3D9VA 3L9NA 2A1AB 4GVAA 3PY0A 4MK0A 4C3FA 3NVMB 4R78A 3MIYA 2XIRA 4AGUA 3W8QA 3F69A 4KRDA 4FTRA 5H8BA 3VIDA 2FO0A 3VO3A 3I81A 2WD1A 3G90X 3C0IA 2X9FA 3WE4A 2BKZA 5CYIA 5L8JA 3E8EA 3R9HA 2GHMA 2RSVA 4ASZA 5M08A 4BDDA 3KKVA 4RJ8A 4YC8A 4J99A 4CTCA 1W7HA 2QKRA 3CD3A 4RIWB 4M97A 3UP2A 3CEKA 5DRBA 4BWXA 4EH4A 4DA5A 4FG8A 1WFCA 4GMYA 4O1PA 1U54B 3ZFMA 4K9YA 4BFMA 4E4XA 3RZFA 3F2NA 3Q4UA 3BYUA 4FT0A 5F1ZA 1SNUA 5IQFA 3ZHPC 2WO6A 4UEUA 2A0CX 1M7QA 3OCBA 4XV3A 3QA8A 3D5VA 3EN5A 4V05A 3RPSA 3LFSA 4X3FC 2XCHA 2VAGA 1PRYA 4M0YA 3R8VA 4XV1A 3SC1A 3ZMMA 2BCJA 3FI2A 2WGJA 4HNIA 4YZ9A 5AR7A 1HCLA 3UO6A 4DH1A 5EDRA 2AUHA 4F9YA 5E8TA 3F2RA 4D2RA 5BQ0A 1UKHA 3QU0A 4N70A 4FTTA 1OI9A 2YM7A 3DS6A 4LFIA 4G9CA 4XEYA 1DM2A 3PXQA 4PF4A 3SG9A 3HRCA 2QR8A 4ID7A 3F6XA 4JRNA 1KSWA 1F5QA 5H9BA 3R9RA 3NUNA 1NXKA 1UKIA 4RX9A 2OH0E 5KZ0A 3TKIA 3CBLA 3TXOA 3KK9A 5FTOA 5T68A 1F0QA 3FZRA 2VWWA 3R2YA 5K9IA 5TE0A 2CN8A 4HCVA 3LPBA 2FSTX 5HIEA 1XR1A 3OEFX 4M14A 2V7AA 2HW6A 3V5WA 4PPAA 2C0IA 3DZQA 4GKHA 5CZIA 4Z7HA 3RK9A 1SYKA 4RWKA 3DBDA 5I9UA 5FP6A 3JVSA 2BDJA 4GYGA 1Q99A 3MI9A 3ORNA 2X9EA 2GQSA 3W32A 3RM7A 3KA0A 4C2WA 2X2LA 2J0MB 4K33A 4YZCA 1YI3A 2ITUA 2R3MA 5CAPA 5D12A 2ETMA 4RJ5A 4EH8A 4ZSGA 1IR3A 1JAMA 4ITJA 4JBVA 5JZNA 5IZFA 4ACGA 4OTGA 4AN3A 4XX9A 1Q8ZA 4JDIA 1MRYA 2PL0A 4JBPA 3T9TA 4BDHA 2VTJA 4UMUA 2WOTA 4ANBA 4DF3A 2PVYA 2GS6A 4BYIA 3F9NA 4I92A 4EK4A 5CEOA 3WILA 2UZEA 4AOIA 4G3GA 4BZDA 4QYHA 3MESA 3FL5A 4EOQA 2C5YA 5EM5A 4Q9ZA 2XM9A 2QOBA 5D1JA 5E9EA 4BCGA 2UW6A 4XNEA 3A7GA 2YCQA 3DU8A 3GQIA 3OCGA 4LL5A 3WZDA 2Y4IB 4DGLC 1I09A 4QMXA 2BRGA 2GNJA 2A2AA 3DAEA 2YA9A 4FICA 4YU2A 4FNXA 2VX0A 3OCTA 4FTUA 1OMWA 4U9AA 5DR9A 1P2AA 3PZHA 3F3VA 4F6UA 1ZARA 2ITTA 5KMKA 5KHWA 4AGCA 3HMOA 3TG1A 4FTCA 5JMSA 4FTQA 2RKUA 1PHKA 4B9DA 2CNUA 1MUOA 1Z5MA 3TV6A 1ND4A 3ERKA 1NY3A 1F3MC 4V0GA 3FJQE 2XKCA 4DH3A 3PSBA 4BCPA 2WTVA 4ZOGA 3AC3A 5DFPA 2JDRA 2ITYA 4R3RA 4NZWB 1QPJA 2OFUA 3KMMA 4FOCA 4RVLA 3VS4A 1WVXA 2ETRA 3TJDA 3DKFA 2CDZA 4GW8A 3VQHA 4YJRA 2CJMA 1FGIA 3QUDA 4YC3A 2H34A 5DR2A 3VBWA 4FIJA 3ULZA 1JKTA 2XEYA 3BBTB 4FEXA 2R0UA 3C0GA 3OUKA 5ETIA 3BCEA 3EQHA 3AD5A 4YBKA 4F70A 2OXXA 5HG9A 2O3PA 2Z7QA 3EKKA 4KIKA 3R83A 4FGRA 4ANLA 3BWJA 2R3NA 5L2TA 4QYFA 3UBDA 5AV1A 3W2SA 2XK7A 3ITZA 2C5OA 1W83A 2R7IA 3NNVA 1DS5A 3JUHA 4TY1A 3G0FA 1CKPA 3PE2A 3VAPA 4F64A 3IECA 4R3PA 4NIFA 4X3FA 2HCKA 1GOLA 3R7YA 3S2PA 3GP0A 1GAGA 3R7EA 3PUPA 4ZTMA 4DH8A 4PDSA 1ZYDA 2I0YA 3S1HA 2VX3A 3I1AA 5JGAA 4AN2A 3N4TA 5TKDA 1KV1A 3W55A 3UVPA 3HGKA 3LFDA 4EUUA 4KA3A 4DE4A 2UZLA 4M67A 3NW7A 3MB6A 4WO5A 4FODA 3UG1A 1ZYJA 2FH9A 4RJ3A 2OIDA 4IM0A 5HD4A 2IN6A 5HLPA 1UNGA 2B7AA 2OG8A 3TNWA 5KMMA 1FGKA 3Q6UA 3QQJA 1W0XC 4PMSA 5D7AA 5DEYA 4D5HA 3FBVA 5A6OA 3GOPA 5CSHA 4BCIA 1ZZLA 3W2CA 4RA5A 3OY3A 1WBNA 3ELJA 1ZMVA 3NPCA 3G2FA 4FZ7A 5CLPA 5F94A 3VHKA 4D0WA 4QMZA 3Q5IA 2CGWA 2RFDA 5FDXA 4S2ZA 4HW7A 4WG4A 4EQMA 2PVLA 3KN6A 2GDOA 4D58A 4WA9A 3TDVA 3MDYA 3UNJA 3LXLA 3ZUUA 1GZOA 3IDBA 4U41A 1V0PA 3PXFA 5KMLA 5J87A 3E8DA 1YWNA 1OPJA 2J50A 5GJGA 5HEZA 4D9TA 1CSNA 4ZS0A 3VBVA 4FZAB 4Y5HA 1RW8A 5AP3A 4DCEA 3OXIA 1JNKA 2VNYA 3QTWA 4LG4A 4ZSLA 3TDWA 2C6MA 4QMLA 4XRLA 4AT4A 5LWMA 4PMMA 4O0YA 2WTKB 2OJFE 4FV7A 3NYVA 5E91A 3GOKA 2XK9A 4RMZA 5A3XA 5LARA 5HBHA 3MSSA 1OBDA 3JY9A 1BL6A 1XWSA 2QOHA 2OZOA 3BPRA 1FVRA 3PG3A 4FUXA 4QNYA 3U55A 5AV2A 1JLUE 3K2LA 5EM8A 4LOOA 3OTUA 2OICA 4KSQA 4E4LA 5AUXA 5IUHA 2B9HA 5HCZA 4RBLA 4FG7A 4QMPA 4IB1A 4ARKA 1GIHA 3WF6A 4D2SA 4WBBB 1GZ8A 3CGOA 4U3YA 4P90A 4JR3A 4A4OA 3PYYA 2UW8A 2GNFA 4MQ1A 4C59A 3DK3A 4ZTLA 2X0GA 3QTIA 4ITHA 5I3RA 5ACKA 3AC4A 3WZJA 4EH5A 4E93A 2G2HA 2XRWA 3AD6A 4CFVA 1PXNA 1PW2A 3K5VA 1ZLTA 2YWPA 3FMKA 4MD8E 4QP1A 2C69A 4GG5A 4HGLA 2GFCA 4YJNA 1Y6BA 3GI3A 2OKRA 4USEA 2W9ZB 3CQEA 5DRDA 4BDFA 4EZ3A 5C4KA 3U6JA 4YLLA 1H1WA 2GS2A 2VWIA 3FMLA 3GT8A 3SXFA 3ATSA 4FIFA 4QTBA 4TXCA 5GJFA 3KULB 3PRFA 4F1TA 3R00A 3UG2A 3GB2A 1BUHA 2YIWA 5IA1A 3OMVA 4UX9A 1WCCA 4YTIA 3GU6A 3C51A 4TYGA 4AN9A 3V8TA 4IB5A 5A14A 3L1SA 2YIXA 3LLTA 2EU9A 3P7BA 4OTRA 4PTEA 5IISA 3SLSA 4BHZA 3QTQA 2YDKA 5FTQA 5EYCA 3DPKA 4HZRA 4TYJA 1I44A 3RINA 3KQ7A 3QTUA 4EH3A 4MCVA 5ETFA 3RAWA 2W06A 1YXTA 4DEAA 4YSJA 2C30A 3CKWA 5LOHA 5B2KA 2HZNA 3HUBA 1LPUA 2C3KA 4DFYA 3QKKA 5FQDC 3OCSA 4OTQA 4RIXA 4O22A 3HUCA 3C4EA 3LHJA 4ERWA 3ULIA 5AMNA 1H26A 2PZYA 2X6DA 2AC5A 1R0PA 5JSMA 3B2TA 3UJGA 2IG7A 3H30A 3O50A 2FB8A 1BX6A 2Z60A 3KRLA 1Q4LA 3TV7A 4O0UA 4IJPA 3O51A 5JFSA 3AC8A 1U46A 3E8NA 3VJOA 4ZJVA 1OM1A 1UU9A 2NO3A 2PVRA 4RLLA 3R7IA 3THBA 5IH4A 2CMWA 2VN9A 3MH1A 5GZ9A 4L52A 3F2AA 4YJUA 3QTZA 3UPZA 2X8IA 5L2WA 3BHHA 1OL7A 4LYNA 2HYYA 2Z7RA 4LOQA 1MQBA 4PL4A 4FTNA 4OT5A 3JS2A 3VRZA 3F3TA 3PLAE 4H1MA 3MVMA 2IJMA 3O7LD 3BIZA 4NJDA 4UXQA 1YXUA 3UQFA 2YCSA 4UALA 4AZTA 4YLJA 1S9JA 3LXPA 4D1XA 3LW0A 1GJOA 3CS9A 4IEBA 2YM8A 1IA8A 3ZUVA 3SRVA 2C6IA 3RHKA 2F9GA 4RIWA 2WMBA 5BVFA 2QOIA 1LUFA 3ZFXA 3FQSA 3WF7A 1Z9XA 4W4WA 3O2MA 4YMJA 3ORXA 4L3LA 4MX9A 3UZPA 1H1QA 2PE0A 2VTTA 4ANSA 3N4VA 2IVVA 2WMWA 5HE0A 5GZAA 4C57A 4L53A 3SX9A 3KRRA 3R28A 5ETCA 3QAME 1CKJA 5HU9A 3O23A 3L9MA 1A9UA 4FL1A 3OF0A 5HVYA 4DTBA 4RX5A 4HVSA 3KCKA 2IZUA 3PVWA 3UO5A 4QMMA 1UU8A 4G3EA 1H0WA 4K0YA 4ZSAA 1PMUA 4MTAA 4RZVA 4Y46A 5ANGA 5HO8A 4AOTA 4QP3A 3ACJA 3LMHA 3ORMA 4A07A 3BU3A 4I23A 4EYJA 5KMJA 3TUDA 2B9IA 4XV2A 4NKAA 5I9VA 1GZNA 5AEPA 4S32A 3HV3A 5LWNA 4H39A 4RWLA 3LFQA 5LQFA 4FZDB 4R5SA 2QI8A 3FI4A 3OXTA 3TM0A 3LQ8A 4PL3A 4CD0A 4RIYA 5CVHA 5I9ZA 3GCSA 3W18A 3GVUA 4P7EA 2IO6A 5HGIA 5AUZA 3VS1A 3ZM4A 3B8RA 3O17A 4EH2A 3OEZA 5AP5A 2Z02A 1VYZA 4DBNA 3QRKA 5IEXA 5HVKA 2J0IA 1JVPP 3AD4A 3PXZA 1G3NA 4WHZA 5EDQA 4CV9A 2CKOA 5KE0A 4F0GA 2WMAA 3CGFA 3P86A 4ANMA 2QVSE 3COHA 3CD8A 4S30A 4QP6A 3VS3A 1BKXA 3EKNA 2H8HA 3QRUA 5CEMA 3RWPA 4W9XA 4R5YA 4RJ6A 2UZBA 5HLNA 3MBLA 4TYHA 2BUJA 3PVUA 2W96B 4FC0A 4CLIA 4X2GA 4D4VA 4ZLZA 3FLZA 1T45A 4EK6A 5CF6A 4BTJA 4GJ3A 1V1KA 4FE2A 1REKA 2UVZA 3QRIA 2DQ7X 2YITA 2WIHA 4A06A 4IX6A 1URWA 5IA3A 3KEXA 5KMOA 1M17A 4BB4A 2OK1A 3KXXA 4O96A 4R3CA 2OZAB 4IWQA 4DAWA 4PV0A 3FI8A 4YTHA 4ZY6A 3JR1A 4HVDA 5ANOA 3V6SA 4KRCA 4WBOA 4DLIA 1M2RA 3D7TB 4MXCA 3LCKA 3MPTA 3SXRA 4F4PA 3FHIA 4FT7A 5G1XA 5M4FA 1NT2A 1H07A 4CRSA 4NUSA 5CANA 2RG5A 1H1SA 2ZMCA 3O8TA 3V8SA 5A4TA 2WTIA 2OF4A 5M53A 3HV6A 3W10A 2BMCA 2J5FA 2QG5A 5KO1A 2PSQA 3QKMA 4AACA 2WMVA 3UE4A 3TNPC 3NUSA 3RGFA 4QQ5A 4G31A 1KUTA 2JAVA 2UV2A 4X21A 3LFBA 2F57A 4LV8A 4OR5A 3MJ2A 4PMTA 3LKMA 3T9IA 3MTLA 1OGUA 4BDEA 4I41A 4JNWA 4ACHA 3HMIA 3HDMA 4ACDA 3IDCA 3C0HA 5CSPA 4G17A 1TQPA 2PVFA 3ZRKA 3T8OA 3I4BA 1WVYA 1WBTA 5K0KA 3CC6A 2O2UA 4FK3A 4E8AA 5IQCA 3HAVA 3DBFA 1XKKA 3LCSA 2CGVA 4HPTE 3ETAA 3SW4A 1U59A 5EH0A 3BRBA 5ANEA 3CQWA 4IXPA 3A62A
chains in the Genus database with same CATH superfamily
1QPEA 2UW0A 2CPKE 5K4JA 4UV0A 2WZJA 2ETKA 3PIYA 4IZYA 1STCE 5EYKA 3VUTA 2QOLA 3PXKA 4MD7E 5EOBA 3UDTA 2BKKA 1ZWSA 3QCXA 4ACMA 2P2HA 2BHHA 5A4QA 5CEQA 4ORKA 3RALA 2XK6A 2XIZA 3W0QA 2J51A 2WQNA 3IG7A 4GK4A 3D2IA 4RX8A 2BRMA 3SXSA 3UOKA 1L3RE 3F7ZA 3C7QA 4EUTA 5LMKA 4LUDA 3ZZWA 5BV3A 2CKEA 3CIKA 5AUUA 5LMKC 4JAIA 1YWRA 4WSYA 4DITA 4WNPA 3WZKA 3IGGA 3FMDA 4H1JA 3SGCA 2O65A 4BR3A 4D1ZA 4EI4A 5DWRA 5EM6A 3P5JC 2B0QA 4JQ7A 1TFFA 5DVRA 4CFWA 2O64A 1PKGA 3AC1A 3DBQA 3TACA 2XYNA 3V04A 5M4IA 4KBAA 4IE9A 2NRYA 1RJBA 3LXNA 1H0VA 2JBOA 4BI0A 1XBAA 5DMZA 3A60A 3WZUA 5AAGA 4ACCA 3PA5A 3F61A 2XANA 4FEVA 4L43A 4B99A 3JY0A 4LV7A 4FL2A 4EH6A 4I1ZA 4KKGA 2PE2A 2C6EA 3ENMA 5TF9A 4BZNA 3CTHA 3H9OA 4FNZA 4CZTA 2XK8A 3QGWA 2C6OA 2PVNA 3BU6A 3EQPA 4N0SA 3V5QA 2X7OA 2FGIA 2CSNA 4BGQA 2Q0NA 4PL5A 2NNWB 4EONA 4H36A 3QC4A 2W0JA 4I22A 2IW9A 2XM8A 4FYNA 2XNPA 4J8MA 4KNBA 4YURA 4C61A 5HNIX 4F9AA 4CXAA 1XH7A 1LEZA 1Q97A 2LGCA 3OP5A 4I21A 4I5HA 4TNDA 4QMWA 4BJJB 5T6KA 1VYWA 2X2KA 5CS6A 5DA3A 3LCTA 4S34A 4IH8A 4U3ZA 5AUYA 3A2CA 5AWMA 3V5PA 1WBVA 4AWIA 2F49A 3I6WA 4QPAA 3F5UA 3CY2A 2A19B 2W1ZA 3LJ2A 4EL9A 2UZWE 2ESMA 2ZFYA 4XUFA 2W1DA 3E8CA 4ASDA 2R4BA 3BYSA 2X81A 2UZVA 3FKLA 4JAJA 5DT0A 4GU6A 4ZLYA 2PTKA 4RIOA 2Y6MA 4DTAA 3GCVA 4KBCA 2JKKA 4PX6A 1Q62A 4RX7A 4DHIB 1WBOA 3A7JA 3L8VA 5AR4A 3V51A 2QOFA 4YR8A 3HRBA 4FV3A 4G5PA 4PDPA 5E8ZA 3U54A 1VZOA 3ODZX 4NYEA 4U45A 2XARA 3MA6A 2PULA 4X2KA 3RAIA 4FVQA 4IWDA 4IHPA 5GIPE 4EJNA 5M51A 4IDTA 3ROYA 2FYSA 2Y9QA 4O84A 2WNTA 4CNHA 2NPQA 4ZS4A 4MEDA 4UN0C 4C33A 2B52A 3DKOA 5HCYA 1Q41A 4H3QA 2ZB0A 4QOXA 4U97A 2ZMDA 2YCRA 3QQUA 3Q4TA 4D2VA 1OL6A 5JT2A 4EOJA 3PPZA 4Y8DA 3Q4ZA 4I6BA 3B8QA 3HV4A 4TYHB 3NLBA 5AR3A 3ZOSA 4I0TA 4WRGA 2WTKC 1OIYA 2VGOA 2CLQA 4YJPA 3D5XA 4FKOA 4BZOA 4RFMA 4EOLA 4EZ5A 4GKIA 1YW2A 1H24A 4M8TA 3JVRA 2YACA 3G51A 2W1GA 4CTBA 3H3CA 3UVQA 4AGDA 4C58A 5AA8A 4BHNA 2WMQA 1ZYLA 3IPHA 4DFBA 1ERKA 4AXDA 5C03A 4RSSA 2J90A 2AEGA 3LQ3A 3ORTA 5HTBA 5E8XA 1V0BA 3QF9A 1JQHA 4RIXB 4CCUA 4UBAA 4F0IA 5IMXA 1KOAA 2OBJA 3BLRA 4WRSA 3HMPA 1OBGA 3IQ7A 5EDPA 1IA9A 3CXWA 4AXAA 2QR7A 1KWPA 4KD1A 4BTKA 2G9XA 3PJ8A 4RQVA 4OLIA 3UVRA 3H0ZA 2XMYA 3P0MA 3UO4A 2PVMA 3ZDUA 1AQ1A 4LOPA 4ZJIA 2ZYBA 4X2JA 2EXCX 2VTQA 3UDZA 4E73A 1OKVA 4CFMA 3RNIA 1XH5A 4TL0A 3BYOA 3TN8A 2CLXA 4ANOA 1SM2A 3QRTA 4CT2A 3PG1A 5CT7A 3VUHA 1U5RA 4PNIA 2W9FB 4XMOA 5FP5A 1JPAA 1Q8YA 2YN8A 3PJ2A 4YJSA 5I3OA 4LGHA 2ITQA 2J6MA 2C3LA 2EB3A 2V55A 3IOPA 4V0GB 4ZP5A 4PMPA 4QTEA 4I6HA 2J4ZA 3CTQA 4PTGA 4RT7A 1YHVA 1RE8A 2BAJA 4B7TA 4W8DA 5AUVA 4E6DA 2YLEA 2OJGA 1JKSA 1ZOEA 5FLFA 5J5TA 3KXMA 4YHJA 4AA4A 3NFFB 1XBCA 5ITAA 1GIJA 3L9PA 5IQDA 4XLIA 4NT4A 4W9WA 3WZEA 3FKOA 4F65A 4ENYA 3E7OA 4A7CA 4F0FA 5HO7A 3DTWA 4JI9A 3R0TA 4O7WA 4O81A 4XOZA 1ST0A 3KY2A 3PSCA 4EZ7A 3I60A 1YKRA 4QPSA 2QLQA 3DOGA 3FC2A 4GH2A 2WEVA 5LVLA 3R7OA 4AW0A 2Y4PA 3VS5A 4X6QC 4IAYA 3L8PA 5JGDA 5FXRA 4FIGA 3EFWA 4AGWA 2R5TA 3FKNA 1ZMWA 4JR7A 5K5NA 4R7HA 5FM2A 4WUAA 3UNKA 5FWKK 2Q83A 3MGYA 3R8LA 3W0MA 3RAKA 2QU6A 3NUYA 4L7FA 2R3QA 4U6RA 4Y72A 4AZVA 1JSTA 4FRFA 4MBLA 3ZRLA 5J9LA 5F4NA 3BE9A 2ERKA 4FSZA 3N4UA 5E8WA 3RP9A 1RDQE 1REJA 5BYLA 2X8EA 4FKGA 4WOVA 4M84A 4Q9SA 4X7QA 5DPVA 1BLXA 1OUYA 2GSFA 2OIBA 2VO0A 2RFSA 4LRKA 4FI1A 4MXZA 3ZSGA 4BCNA 1XMMA 4E7WA 2R3LA 1OUKA 4FR4A 4N6YA 4R1VA 5H8EA 4UZHA 5C01A 3VF9A 4A9YA 3TL8A 5AUWA 2PVJA 3R7UA 3NUUA 1OITA 2J5EA 2OWBA 3QXOA 5A46A 4DFUA 2VTHA 4GIIA 4IJ9A 5D9HA 3KXZA 3D0EA 3KF7A 2KULA 4I5PA 3PWDA 4TZRA 3UZRA 3NR9A 2WTWA 3C5UA 1ZOHA 2HXLA 3DBEA 3QL8A 4XG7A 3VUGA 4BCQA 5IUGA 2Q0BA 3KMWA 4FKTA 5M06A 3RZBA 1R1WA 3VNTA 4D1SA 3ORIA 2ZM4A 4CRLA 4HOKA 5E7RA 4U7ZA 3FYJX 1FBNA 4QMUA 3W8LA 5AP2A 4NJ3A 4RIYB 4CMOA 3TMOA 1NA7A 2WQMA 3EN9A 4JXFA 4YZNA 4BWPA 4DTKA 3PJ1A 1FVTA 4CEGA 1MRUA 3FPQA 2R3PA 3OHTA 5M56A 4ZZOA 5EK7A 5DOSA 4RGJA 2ZAZA 3MFRA 3VBYA 3O7LB 5CU0A 4JQEA 2G01A 2VX1A 1IRKA 3HP2A 2HY81 2YJRA 2GMXA 4JDHA 5J8IA 4DEBA 2GU8A 5CU3A 3R8UA 4NSTA 5L8LA 3VN9A 4ZAUA 3UYSA 3W0SA 2RFNA 5IA2A 4BJJA 2VTOA 4ZIMA 5CSVA 5E8UA 3JXWA 1M7NA 3LM5A 5IMEA 1H1PA 4QMVA 3FZ1A 3QQKA 4MXOA 4TPTA 3BGZA 2H6DA 2GHGA 2JAMA 3GC7A 3GGFA 5TR6A 1PXOA 4KIPA 4QMQA 3TUBA 3W0OA 3NS9A 3PFYA 4O7RA 4YHTA 4WNMA 3OC1A 2YM6A 4EWQA 3NVKI 3NNUA 3BL9A 1SVEA 3IW7A 4HCTA 4CG9A 3QKLA 3H9RA 2BPMA 3NSZA 1ZZ2A 4FV6A 4KABA 4F63A 4PDOA 2E9NA 4FV2A 3VRYA 4C4GA 5J1WA 3R8PA 1XH4A 2JKMA 1W82A 4JX7A 5F95A 2ITZA 3TNQB 2FVDA 3W16A 2F7EE 3LQ5A 3PDTA 2ITWA 2R0IA 2R3IA 4K6ZA 4A9UA 3E7VA 5DHJA 2XZSA 3P79A 1L8TA 4ENXA 3ACKA 3U8WA 4XG9A 3GU8A 1O6KA 1TVOA 5A4LA 1AD5A 5GHVA 1S9IA 3R7GA 5DT3A 4K11A 5IQAA 5CEPA 4CGAA 4YJTA 1IAHA 5FDPA 1W2CA 4BIEA 1WBPA 4QYYA 4EKLA 3DAKA 3OWPA 3ZEWA 4DHFA 4BICA 5I5ZA 5CU6A 4FIIA 2I7QA 2QHMA 2BHEA 2I0EA 3A8XA 1FVVA 4L3JA 5BMMA 4KS8A 3UYTA 4BCFA 3MPAA 1U4DA 2GNLA 4FT9A 2UW4A 3P78A 3PZEA 5CY3A 4UWCA 3GBZA 4E5WA 4OBOA 4WD5A 4DDIA 2ZOQA 4ASEA 3C9WA 3CTJA 2EVAA 4EBWA 3RBWA 2PVKA 2C5NA 4MD9E 4O0RA 4A4XA 3WF8A 1R0EA 1QMZA 2JDVA 3R1NA 2IPXA 1OIQA 5M4UA 4U40A 2ZDTA 5IQGA 2WFYA 5CX9A 4BDIA 3VBXA 2VUWA 5DE2A 4HGSA 5JFVA 3QCYA 4NL0A 3ZO2A 1JBPE 1B6CB 3IGOA 2BRBA 3BHVA 5M09A 4P5QA 3GCUA 5J79A 3AT4A 1CTPE 4CLJA 4BRXA 3QQHA 4NM7A 3D5WA 2QOOA 4BF2A 2HW7A 4OT6A 4WIHA 4USFA 5HE3A 4XBRA 3AGMA 4XG3A 3UIBA 4FKIA 2Y6OA 4H58A 3QX4A 3FLNC 4QT1A 4JOAA 4BIBA 1CMKE 3JPVA 2GQGA 1OKZA 3E63A 4X3JA 4NW6A 4C36A 5AR2A 1ZAOA 4G2FA 3RJCA 4QP8A 2YHVA 1SMHA 1YXXA 3A4OX 2JDOA 1YOMA 3II5A 4FV8A 5EKOA 3RM6A 4D4RA 5J1VA 4WSQA 4M12A 4I24A 5HESA 4BWKA 4O0SA 2Y8OA 1Q8UA 5EFQA 1AGWA 2WMRA 5EHOA 4RFZA 4U8ZA 3LXKA 5LMAA 4RC4A 2HXQA 2VWZA 4X0MA 4W8EA 4YLKA 3VONA 2BILB 2VO6A 4FIEA 1Q24A 2J9MA 5HO6A 4Z7GA 5CXZA 5C8MA 2WMXA 3EN6A 4MAOA 4OTWA 5DLSA 2ITOA 4KWPA 4IZ7A 5L8KA 2FA2A 4MBIA 2XKFA 1PMNA 3O96A 3QD4A 4H05A 2YIQA 4NTSA 2OO8X 1Z57A 2UZTA 3LVPA 4O91A 3O8PA 4KAOA 4I3ZA 3SW7A 1PXKA 3OTVA 1B38A 4O7YA 4GT5A 3I0OA 3R04A 2QOQA 5FGKA 4O7LA 4FSMA 5AM7A 3QRJA 4FSNA 5CNNA 4H3BA 4D28A 4E4NA 3WI6A 2BALA 3GCQA 3GXLA 4HPUE 3MY5A 3QC9A 4WNOA 4HVGA 2XP2A 3HV5A 3QZIA 5LMBA 2P2IA 4DFNA 5IA5A 2W1HA 1KV2A 3MTFA 3NIZA 3P08A 2IF8A 3OT8A 4O21A 4QTCA 5I9WA 1MRVA 1J1CA 5H8GA 3DFCB 3MVLA 3K3IA 4J8NA 2J2IB 4O0XA 3A7FA 5L2IA 4PQNA 5BVKA 4BTFA 3PTGA 3LFNA 4O2PA 4EWHA 3GU5A 3ZO3A 2OZAA 1WMKA 3JYAA 4L44A 2GS7A 5CAUA 5D7VA 4FV4A 4A4LA 3R8ZA 3R02A 2XVDA 5BVEA 3OBJA 4EOSA 4IBMA 4TTHB 5EM7A 3A7IA 3AMBA 4ZMFA 5KMIA 2ZV7A 4HCUA 4JIKA 3OWJA 4O0TA 5IEYA 4RG0A 4EOOA 3C4CA 3MA3A 4IVAA 4IX4A 5EQPA 4J71A 5L6OA 2W05A 5HX8A 2B53A 1H28A 3DGKA 4O6EA 3W2RA 4MYGA 4PWNA 1TQIA 1P14A 4TN6A 4RPVA 1LP4A 4GSBA 4YO6A 4MNEB 4YSMA 4AZFA 3IW8A 1RQQA 3QHRA 4FYOA 3ENHA 5FXQA 1OPKA 3UC4A 4CFFA 2WMSA 2W1FA 5HTIA 3C5IA 3NAXA 3G6GA 3N9XA 5IDNA 1O6LA 5AUTA 4O38A 3CPCA 5KKRC 1H01A 4DHZA 5KNJA 5LVMA 3NMUF 1QPDA 2ITXA 3WOWA 5DG5A 3ANQA 2H96A 2XS0A 4D5KA 3DDPA 5BVDA 2WMTA 1YOLA 5J9YA 3ZFYA 4ZTQA 4JJRA 4FVRA 1PKDA 1XO2B 4XG4A 3HNGA 5BPYA 1LEWA 3OW3A 4QO9A 3ZLWA 4C4HA 4CKRA 4IX3A 2BFYA 3UMWA 3L9LA 3ZCLA 5L4QA 3SOAA 2XUUA 3F3UA 2YDJA 2V0DA 1BYGA 4RWIA 5JH6A 2YERA 2ZV9A 4RRVA 3ATTA 3CJGA 3TZMA 2IWIA 3PJ3A 2WQOA 2F7XE 1M14A 4USDA 1UA2A 3TZ8A 5L6PA 2OSCA 4U42A 4C4JA 4FX3A 2VNWA 3D15A 3FXWA 3W2QA 3C4XA 5EQEA 1SNXA 2GNGA 3IW4A 2JGZA 1NW1A 3Q2JA 1BI7A 1ZRZA 5AP1A 4ZTRA 2PMNX 2V5QA 4I0RA 3QGYA 1H4LA 5CT0A 5CTPA 3PA3A 4DG2E 5JFXA 3UDBA 4AT3A 4O7SA 3BE2A 5GIOE 4XOYA 3OXZA 4J97A 3FZTA 4CFNA 4EK5A 3BHYA 3C4ZA 5H2UA 1FMKA 4MNFA 3KN5A 2C6LA 2JC6A 3WYYA 2PZPA 4RZWA 4AFEA 1ZYCA 2ZVAA 5HG5A 4BKYA 4BYJA 5DEWA 4Y85A 4C37A 4O6LA 2QONA 4GVJA 5AAFA 2YDIA 1BMKA 3O71A 4XCUA 4L7SA 4AZSA 3QZHA 4JVGA 4BDGA 2C68A 4R7IA 4C34A 4DINA 2C0TA 1YI6A 4ZZMA 3QWJA 2X6EA 3GCPA 4NU1A 3KMUA 4EORA 5IQBA 2R3OA 4IAKA 4UY9A 3D7ZA 4F9CA 3FMEA 4CG8A 4WG5A 1WAKA 5AP7A 3PE1A 3VUIA 5EI2A 1PXPA 2OJ9A 2OXYA 3ZLYA 4MXYA 4CKJA 5AADA 3DFAA 1OB3A 4AAAA 5BX0A 2ZM1A 5EYDA 5LVPA 2JD5A 2I6LA 4ZSJA 2VO3A 5ACBC 3A8WA 3KF4A 2JDTA 3LAUA 3EJ1A 4IAIA 4IFCA 4Y83A 3UPXA 3CP9A 2RIOA 4FZ6A 4FSTA 3SDJA 1YVJA 5FEDA 4F7JA 1OL2A 4DC2A 1ZXEA 4QMSA 2XIKA 4A9SA 2GNHA 3KXGA 3NRMA 3F3WA 3Q9ZA 3ORZA 4Z9LA 2P4IA 5KUPA 4TT7A 2J0LA 2VWBA 3PIZA 3G9LX 5DI1A 4IMYA 5HG8A 5HICA 4EYMA 2R3HA 3EFJA 4L67A 3DAJA 3P23A 5AX3A 3SG8A 3SA0A 3VHEA 2JKQA 4TYIA 4MH7A 4FKRA 4TRLA 4QQTA 3COIA 3MH2A 2BIYA 5TT7A 3RMFA 4TWCA 4L01A 4MHAA 2CKQA 4NW5A 5HHWA 2VTMA 4FTLA 4BC6A 5FEQA 4GU9A 4GG7A 4G6NA 1G8KA 2C3IB 4FTKA 3QTSA 4I4EA 3E87A 4GK3A 4MWHA 3LOKA 3FSKA 4IAAA 4MBJA 4F09A 3P7AA 1XH6A 3DV3A 2DWBA 2WPAA 4GCJA 4GIHA 4RC3A 5IKWA 4HVHA 4QYGA 4IAZA 1UVRA 4EK3A 4FTIA 4I4FA 1ATPE 4FKSA 1PJKA 1GY3A 3NYXA 5GNKA 4BCKA 3NFGB 4DLJA 4FSWA 4OAUC 5FRIA 1Q3DA 2VGPA 4V01A 4DG0E 2FSOX 4EEVA 4U43A 2YIYA 4FNWA 3FSFA 5IA4A 3DQWA 3GUBA 1UNHA 3F3ZA 4ITIA 3OZ6A 3DB6A 5CSXA 4LI5A 3VBQA 3WARA 4L3PA 3PVGA 4WKQA 3VF8A 3E93A 2WAJA 4BDKA 2ZJWA 4C0TA 4CT1A 4EHGA 4ONAA 4F7SA 4FSYA 3KULA 2QCSA 5AX9A 4IACA 5AIKA 4FSQA 1R3CA 3HL7A 3QD0A 3ZLSA 3AC2A 5JEBA 3NCGA 3VS0A 5HQ0A 3BV2A 5J9ZA 3U4WA 3QQLA 4BDBA 2JIVA 4RFYA 4F1OA 3N51A 3VVHA 2VWYA 5AR5A 3PP0A 4EHZA 3M42A 5C1QB 3Q9XA 5BNJA 3E92A 2HENA 3MH0A 4L00A 5D10A 3R8MA 3ALNA 5DR6A 3AC5A 2R3RA 2RG6A 3R73A 1GNGA 2R3JA 4WNKA 4JG6A 2X1NA 3R21A 2EUFB 2WELA 5JN2A 2BDFA 1NVSA 3ZZEA 4L42A 5FUTA 2QODA 1E1XA 2YWVA 2UZOA 4KUJA 4FKUA 3DKGA 1YRPA 4FUYA 5ETAA 4AQCA 3KFAA 3DXQA 3UQCA 2ONLC 3Q4CA 3AMAA 4RVMA 3S4QA 1KE7A 4HNFA 4BCJA 2NP8A 5J5SA 3GC8A 4BL1A 2VTAA 1IAJA 2W1CA 1Y8YA 3BKBA 5BVNA 4IFGA 5L3AA 1A48A 2CNQA 2I1MA 3FY0A 3RPRA 2YM5A 3OBGA 4HZSA 4OTIA 2IW6A 4FZFB 2VTNA 5B2LA 3MB7A 4L68A 1PXMA 5L2QA 5HOAA 5LCKA 4BKZA 2B54A 1PMEA 2XCKA 3NYNA 3A99A 4KINA 5JK3A 4AP7A 5IH6A 3DQXA 3K5UA 4MF0A 4JS8A 2PUUA 2C6KA 3AOXA 3DXNA 3IDPA 3P4KA 3BV3A 4FT5A 4RJ7A 4TYEA 5FBNC 3QA0A 2XNMA 4AZWA 4OGRA 3FZSA 3UIUA 2VV9A 5EW3A 3EZVA 2R2PA 4R8QA 2BZHB 1XBBA 1OKYA 4AW2A 3FLYA 4EHVA 3NZ0A 2J0JA 1SVHA 3V6RA 3M2WA 4ZXTA 3PY3A 3A7HA 4AA5A 5ANIA 3TNIA 4TKSA 4PPBA 3FMHA 4YGAA 5GZ8A 2WU7A 2PHKA 3D5UA 4IDVA 4K8AA 4MWIA 4Q2AA 1IEPA 3HKOA 2GCDA 3FQHA 4LUEA 4BGGA 4F99A 4IW0A 4NFNA 4FIHA 4G3CA 2XB7A 2GQRA 2G2FA 5JFWA 1OGYA 3KRWA 3LMGA 4AXCA 3U9NA 2YJSA 3AQVA 3C4WA 3KK8A 2RGPA 5EG3A 4EK8A 5JKGA 5IQHA 5C8KA 3DZOA 3ZBXA 1M2PA 1JKLA 2IVSA 3DK7A 3QZFA 5KHXA 4EKKA 5AA9A 3K54A 4M68A 4K18A 4BY9E 3EWHA 1YDRE 4C8BA 2C47A 3P1AA 5CI6A 2PUIA 1HOWA 5DNRA 4E5BA 3OS3A 3UOJA 1APME 4BCOA 5JGBA 3U6IA 4Y5QA 3TI1A 2YLFA 4II5A 3TZ9A 3QD3A 3EHAA 5DIAA 1YWVA 4I6FA 3OT3A 2UZUE 2WIPA 3DY7A 2W7XA 2XRUA 4FL3A 5HNBA 4I6LA 2Z8CA 5DN3A 1H27A 1ZOGA 2IVUA 2B9JA 3ALOA 2X4FA 3EYGA 3FWQA 3EFLA 4FSUA 4RC2A 3KRXA 2WKMA 1PYXA 3CQUA 3IO7A 1G8AA 2P55A 2VTLA 3VULA 4P2KA 3FMJA 3A4PA 4X2FA 3HA8A 3PJCA 4J98A 4OBQA 4I20A 4W4YA 1URCA 2R7BA 3Q60A 5AM6A 4BBEA 5M4CA 2DYLA 3POOA 3HX4A 4JG8A 4U5JA 2VWVA 1UWHA 1OIRA 4U0IA 3MFTA 4OTPA 4MKCA 2QLUA 4AW1A 5EQYA 2YABA 2BIKB 2G15A 3EFKA 3TT0A 3WE8A 2W4KA 2JIIA 4IQ6A 4QYEA 3U9CA 4CVAA 3DNEA 4KS7A 2NYAA 3FLQA 2OI4X 3I7CA 4PNKA 3FUPA 1P4OA 3ZONA 2BAQA 3ZUTA 4AFJA 2ZV8A 4DEEA 1W8CA 4JRVA 3H10A 5BUEA 3DDQA 1K9AA 3GFEA 4Y95A 1OZ1A 2RFEA 5LCJA 3NGAA 4NCTC 4ALUA 5C26A 2QO7A 4EJ7A 4IC8A 1FPUA 2XK4A 4M13A 4WG3A 4PP9A 2WEIA 3HV7A 2Y7JA 2WQBA 3PPKA 4FKJA 1PY5A 3MVHA 4QTDA 4RA4A 5ANJA 3TEIA 4UZDA 4CFUA 4D55A 5J7HA 3Q96A 5J95A 4IX5A 3LIJA 4I5MA 3KVWA 3FPMA 3DJ6A 3EQGA 3LJ0A 4FK6A 2UVXA 5AP6A 2PY3A 3ZBFA 4BDAA 2ITVA 1X8BA 4CCBA 3Q3BA 4ANNA 4KKEA 3R2BA 5ANDA 4DDGA 4F9WA 5HX6A 4D2TA 4ZEGA 3CPBA 4GFGA 2C1AA 5K3YA 3NUPA 4BGHA 1J7UA 1O9UA 3RKBA 1CDKA 3CCNA 1V0OA 3NW5A 5I4NA 4C35A 2X7FA 4PPCA 1ST4A 4C4EA 4J53A 2IVTA 2EWAA 4AE9A 5E4HA 3EQRA 4L45A 4CZUA 3P7CA 2W17A 4NKSA 3RVGA 3UDSA 2P3GX 4UMRA 2EXEA 4HGTA 2YAKA 5FG8A 3IKAA 2CGXA 2HZ4A 2R3KA 3WIKA 4CYJA 1UU7A 3MYGA 2FUMA 1UU3A 1SVGA 4JL9A 1B39A 4YTFA 2R9SA 5E1EA 4EQUA 4B8MA 3UIMA 3TTJA 4JDJA 5K5XA 1H25A 5CWZA 2QD9A 3FMMA 3CR0A 4G34A 2SRCA 4PUZA 4BDCA 4FKVA 1DAWA 3QQFA 4O0VA 4UYNA 3VS6A 2PUNA 1EH4A 4JBQA 2XA4A 4N6ZA 4OTDA 1YDSE 3OWKA 4NWMA 5LVOA 3VW8A 5HBJA 5TOZA 3SD0A 1H8FA 2XEZA 3KIOC 4GYIA 2R3GA 4XRJA 1VJYA 2O0UA 4XJ0A 2YFXA 5DYJA 2A27A 5E1SA 5M07A 1VEBA 3PWYA 4ZTHA 3ZSIA 4PY1A 2P33A 4O7NA 4IB3A 1K2PA 3HMMA 4M0ZA 1DI8A 3HAMA 2XH5A 5CU2A 4D4SA 3OOMA 4J95A 3D4QA 4FV0A 3RCDA 3MH3A 2YIRA 4ANQA 4F6WA 5BUIA 1E1VA 5KKRB 4DEIA 1Y57A 2BTRA 3QUEA 4AUAA 4QEBA 2VTSA 1Q5KA 3KGAA 3DLSA 2C4GA 2QG7A 2YM3A 3HYHA 3O0GA 3HMNA 4GRBA 4H3PA 5E8SA 4DGNA 3GENA 5B7VA 2VZ6A 3R6XA 4HGEA 4ALWA 3VW6A 1IASA 5CF8A 4FBXA 3BX5A 1DAYA 4LMUA 3RAHA 1YDTE 3V5LA 4BDJA 1Q8TA 3BLHA 4APPA 3FEGA 5HKMA 5B0XA 2OJJA 5E92A 3DA6A 4BIDA 1JOWB 2XJ2A 2VU3A 1R39A 3ET7A 2QO2A 5HD7A 4FNYA 3WYXA 4DBXA 3DCVA 3LFEA 2B1PA 4QPMA 2WHBA 1YHSA 3QYWA 2PK9A 2QOKA 3DTCA 4KSPA 3KVXA 4BI2A 4D9UA 3EZRA 2C5XA 2QOCA 3OW4A 4P5ZA 5IA0A 3AT3A 2UVYA 3W2OA 4FF8A 5HI2A 5IQIA 5KZIA 1PXJA 2VD5A 3EYHA 5FBOA 4DCAA 3EIDA 4KB8A 2O5KA 3PPJA 4QTAA 3LFFA 3ZC5A 4Z3VA 1HCKA 3AT2A 5CSWA 4DEDA 3OG7A 4FTOA 3EQDA 4YJVA 1YXSA 2HAKA 5FTGA 5AV3A 4IWPA 3ZU7A 5IDPA 5IG1A 1UV5A 1R78A 3R22A 4J96A 1FINA 5ANKA 5C27A 4X6RA 3MVJA 4XH6A 1QCFA 3M11A 4O4EA 4M3QA 5I9XA 4DT9A 4JDKA 2ZDUA 4KIKB 2BFXA 4LV5A 3HA6A 4X2NA 4YNEA 3GNIB 5E90A 3UIXA 4GFMA 4NM5A 3VUMA 4QP7A 3F66A 1U54A 2C6TA 2JFLA 2UUEA 5CQUA 5BYZA 3QZGA 4XP3A 3SAYA 4RWJA 3AMYA 4G6LA 4E26A 4QP9A 3DK6A 3EH9A 2E9VA 3SOCA 3WBLA 3GEQA 3BQRA 4C2VA 3UQGA 4AOJA 1IG1A 2J7TA 3PSDA 2GPHA 3BYVA 4TWOA 4FT3A 4HYUA 3CE3A 2B4SB 5DBXA 3ZDIA 5AFVA 4G1WA 2QU5A 3EL7A 2JFMA 2G1TA 2OH4A 3RK5A 2B55A 2CGUA 4AA0A 1H1RA 4ZK5A 4R7BA 5CU4A 1J7IA 5CNOA 2XBAA 3NNWA 3W0NA 4QMNA 3LFCA 3I7BA 4CMUA 2PYWA 3NCZA 3PIXA 3NUXA 2GNIA 2YEXA 3CJFA 5A4EA 2GFSA 4F78A 3REPA 3LJ1A 3ORLA 4HVIA 5CXHA 4FA2A 1OECA 1TQMA 3QHWA 4YZBA 5E8YA 3V5TA 2HY0A 1GIIA 1H08A 4FVPA 4FOBA 4R1YA 2OU7A 3TUCA 3DJ5A 2VTPA