3SXSA

Crystal structure of bmx non-receptor tyrosine kinase complexed with pp2
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
264
structure length
264
Chain Sequence
b'GHMELKREEITLLKELGSGQFGVVKLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKMPYDLYTNSEVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytoplasmic tyrosine-protein kinase BMX
publication title X-ray crystal structure of bone marrow kinase in the x chromosome: a Tec family kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 264
sequence length 264
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3sxsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3sxsA01
2NP8A 4Y5QA 3EN6A 5LVLA 4Y46A 4QP8A 4ZTSA 4C2WA 3PE2A 5JRQA 2G2IA 3QXPA 2GFSA 4OBPA 3CR0A 3D94A 3FE3A 2WTKB 3OCTA 4HYUA 2ZM4A 3NEWA 5FGKA 4GSBA 2QO2A 4HW7A 2XS0A 3W8LA 1ZMWA 3VF8A 3AQVA 1XJDA 2VTLA 3A99A 3PUPA 3Q6UA 2OJ9A 4BDJA 3ORXA 2BRHA 4BKYA 4BIDA 1OPKA 1XH4A 2PVKA 4QMNA 2AC5A 3M1SA 3MVJA 4O7WA 4QP3A 4M0ZA 5CF4A 4C4EA 3KXHA 3ZO2A 4IAFA 2XUUA 3GU5A 4FBXA 3W16A 3EWHA 2XK7A 5CAUA 4MQ1A 3VQUA 3GP0A 4MXCA 5IEXA 4FKOA 5B7VA 4U41A 3U51A 2HZNA 5AUXA 2PMIA 2BRNA 3FY2A 3SD0A 3RAHA 3DK7A 3QF9A 5BQ0A 4D0XA 4WNOA 3BQRA 2WPAA 4I23A 5G6VA 3MH1A 2XJ2A 3R9RA 4P5ZA 3ZSHA 2WTJA 3IGGA 4GCJA 5E8VA 3UIBA 3ZRMA 4Y73A 4CG9A 3PY0A 3E3PA 3HEGA 3QD2B 4I5MA 1RJBA 3RPSA 4MYGA 4CFUA 2G2FA 2C1AA 4ERWA 3KGAA 5FG8A 3WF8A 3ZO4A 4EZ5A 3F69A 3VN9A 2OICA 3SV0A 3DFAA 3BBWA 4ZTLA 3ALOA 3TZ7A 2WMRA 4NT4A 3MW1A 4Z55A 2YZLA 3DOGA 4H05A 4FE2A 3ZBFA 1ZLTA 1DAWA 4O2PA 4ASZA 3LMIA 1CKIA 4CTCA 4D58A 3OEFX 3HV4A 3LMHA 1H07A 2PVFA 3HMMA 3QCYA 3F9NA 1Q24A 4G5PA 4JXFA 3GCPA 4EH3A 4FA2A 5C4LA 4S31A 5CEIA 3R1SA 4D1XA 4DGGA 4X0MA 2PL0A 2W17A 3D2IA 3KY2A 5AR7A 3IW7A 4NJ3A 1MP8A 2HELA 4XG8A 5BMMA 3CBLA 4AX8A 4TRLA 3SAYA 4FEWA 1H27A 4C0TA 3Q2JA 2HIWA 3FMJA 3ROCA 4O0WA 3NYXA 4GIIA 3ANQA 1YDSE 4ANBA 4FG8A 5EDRA 4CKJA 1PRYA 1U4DA 4GMYA 3QTXA 3U9CA 4F08A 2Z7QA 3UP2A 4JL9A 4G3EA 4JBOA 3OWPA 3C0IA 3P1AA 5CVGA 5HCYA 2ONLA 5GZ9A 4EUTA 3VNTA 5CVFA 4DTAA 3ZC6A 2J0KA 1YRPA 3HA6A 2E2BA 2QOIA 1OBGA 4OAVB 4C34A 1BYGA 4OAUC 3S95A 3EN5A 1PXOA 5T68A 2ZMCA 4BDDA 3LJ0A 4JX7A 2JKOA 3OF0A 4FV1A 3F3TA 5C9CA 3B2TA 2UW8A 1VYWA 4WO5A 3LCTA 4IX4A 4HJOA 5E8SA 4ZY4A 5AUTA 4MTAA 2IZTA 4AGCA 4PL5A 2IVUA 3WE8A 2ETRA 5E7RA 2BZJA 2CGVA 2F7XE 3MH2A 4MD7E 5AAGA 1U46A 2W1FA 1WFCA 2BDJA 2J7TA 2IZRA 3QRKA 5CEPA 3WI6A 3G51A 3RHXA 3V5QA 3KRWA 2KULA 4UYAA 4RX5A 3GCVA 2QHMA 3G0FA 1ZMUA 4JS8A 2CNUA 2QOOA 4HPTE 4BGHA 3PLSA 3ZOSA 2W1IA 4K33A 2B4SB 4ZOGA 4S32A 2XBAA 4MF0A 5L6PA 4UXLA 3GOKA 1UU3A 2XNBA 2ZDTA 5DGZA 5L4QA 2R3JA 1P5EA 2B53A 2UZLA 3DLSA 4AG8A 4O82A 3B2WA 2Y4IC 4C36A 4ALUA 2J6MA 4RJ8A 4E8AA 5ETCA 3C4XA 1R39A 5FDXA 4PX6A 3TZ9A 1SNXA 2PMLX 2VNWA 2XNMA 3DK3A 4BDGA 4DFZE 3ZEWA 5HD4A 4J52A 4U97A 4BBMA 4QQ5A 4II5A 1F0QA 3I5NA 5BUIA 3VUIA 3WE4A 1NVSA 4YLLA 2YAAA 3QQFA 2O5KA 3F82A 4H3BA 4CQEA 5HLNA 5FEEA 3TKIA 4EH6A 3PDTA 2UW4A 3Q3BA 2Q0NA 3TNHA 4MBIA 2W0JA 2O3PA 3WZEA 4EC8A 5HE2A 2X2MA 3BLHA 2HYYA 2UZOA 4ITJA 3MB7A 1WBOA 4YBKA 2IJMA 4AN3A 3QWKA 2PWLA 3DNEA 4G3CA 2QKRA 4WG5A 3R8PA 3ATTA 4FIHA 3IO7A 5AEPA 4O7ZA 2WTWA 4PUZA 4RFZA 2JIIA 4UWYA 2EXCX 3DS6A 2XCHA 3VWAA 4FKGA 4LQMA 1XWSA 5LCJA 3VS2A 3JUHA 3QGWA 2XNNA 3QALE 4O7YA 2QO7A 5HTIA 1OUKA 2C0OA 2GHGA 3EZVA 3FLNC 3LFDA 2EXEA 3R22A 3TXOA 2F4JA 4O0RA 2HZIA 2UZEA 4FSYA 5EW8A 2UW3A 5HE3A 3AC4A 3V8SA 3ZUVA 4E3CA 5EYCA 3MH3A 4GFGA 4BCPA 3AOXA 4YR8A 5KKRC 4L68A 3LE6A 3FLSA 4Z7GA 2CKEA 3QFVA 5CQWA 5J95A 4XP2A 4IEBA 2A1AB 1CDKA 1ZY4A 2ZVAA 3OY1A 4GYGA 4EKKA 3GFEA 3L9MA 3LW0A 4FKQA 5IA3A 3CE3A 4E4LA 1H1QA 2BROA 2YJRA 5CEKA 4O7LA 4EHGA 4GRBA 4QTDA 1IAHA 4EH9A 4M7IA 3GCSA 5D9HA 3F3WA 5C27A 5CYIA 3GBZA 2WGJA 4HYSA 3ERKA 4ARKA 3UQGA 4LV5A 5D41A 4OTWA 4FTUA 3UMXA 1B6CB 1W0XC 2VTPA 1OKWA 4ACMA 5D7VA 4DFXE 1VR2A 3S2PA 4BTKA 4MAOA 1GIJA 4QMYA 4EI4A 3KQ7A 3BZ3A 4CV9A 3OFMA 1MUOA 2W9ZB 3RI1A 4HVIA 2ZYBA 3F5PA 3ZFMA 4LGHA 5HNGA 4K8AA 4FT3A 3W33A 4JLCA 4XG6A 4AE6A 1ZRZA 1FVRA 2XIRA 3FMDA 3NUYA 3UVPA 1JBPE 3CJGA 2R3LA 3LFSA 3I7BA 4O0YA 5IH5A 5IH4A 3A7FA 1W8CA 4CMOA 3TZ8A 2C1BA 4I0TA 4YUQA 3R7EA 3VBYA 3R8VA 3F3ZA 4YJRA 4FKRA 2OSCA 4IZYA 2QOQA 1URCA 3B8QA 3H0YA 4FTTA 3R21A 4QMMA 3DB8A 3NUUA 1FGKA 5HE1A 2ITNA 3UO6A 3GCQA 2JITA 2XEYA 1GOLA 4L7FA 4C8BA 1H0VA 4FKPA 1OZ1A 3MPAA 3LFFA 3Q04A 4EH4A 3PP1A 2ZM3A 3R1NA 4IVCA 3JS2A 4M8TA 4BB4A 2W96B 5CAOA 3EQFA 4XV3A 4BICA 1TKIA 1KE9A 3COMA 1UKHA 3DTWA 4QP1A 4QO9A 4B9DA 5I3OA 3VS5A 2XIZA 4F09A 4CGAA 1J1CA 3CS9A 3RCJA 4CYIA 3W2RA 3LQ3A 3MDYA 5HG5A 1Y6AA 3BE2A 3UOLA 4CFFA 3CSVA 5IISA 5TO8A 3IK3A 2HWOA 2PZYA 4BCMA 3T3VA 1PXLA 5EW3A 4C3FA 4HVHA 2YWVA 3PTGA 4ZS4A 4X2NA 4DT9A 3BQCA 5H2UA 4FSZA 4A4OA 4AA4A 3S00A 3E8NA 1UNGA 1V0BA 3UZPA 3R00A 1Y91A 1WBPA 4E6AA 5LVPA 2W1HA 5HBHA 1G8AA 2VX1A 3JYAA 3W1FA 4F0IA 4A06A 1UV5A 4YO6A 5JQ5A 3D5XA 4ANLA 4BCGA 3NUPA 5LVNA 3MA3A 2H34A 3DBQA 4FSRA 4JNWA 2R3HA 3IW6A 4FNWA 4WRSA 5H8EA 4JG7A 4Q5HA 3PA5A 3BGPA 2HW7A 3Q4TA 3DKCA 3DJ7A 2OI4X 5CF8A 3PJ2A 4FICA 2WEVA 1LR4A 2WEIA 3PWYA 4RVMA 1OL7A 2XKDA 3WF7A 3FZPA 2XEZA 3O50A 1YOMA 3COHA 2VTTA 4IC7A 2BZIB 2A2AA 4B8LA 3R9NA 2W7XA 4JR7A 4RJ7A 5BVWA 4QMPA 3BYMA 3VHEA 4D5HA 4DEHA 1AQ1A 4CTBA 1JOWB 1KE5A 4DH1A 3BELA 3RPOA 2B9HA 4MWIA 4QMUA 2YDJA 4I41A 4FYOA 3OCBA 3ZXTA 4NIFA 3RP9A 4QQCA 4Z7HA 2O8YA 3AMYA 1SYKA 3U6IA 3VUDA 2IWIA 2W1CA 1XH7A 3BKBA 3R7GA 4IWPA 1YKRA 4R1VA 5IA1A 4R6VA 4OUCA 5M57A 3KRRA 1YOJA 4QPSA 5I9VA 2BHEA 1U59A 3ACJA 3FXXA 4C33A 4IAZA 5KMOA 3OOMA 2ZAZA 2VO3A 4IB3A 2PU8A 3HMIA 3WF5A 4ZZNA 3BV2A 5E8UA 5BVDA 4K11A 2UZTA 2RG6A 2I0YA 5AX9A 4KA3A 5J79A 2XKFA 4MKCA 4L43A 2J5EA 5D10A 1Q99A 1YQJA 3Q2MA 4ZSAA 3LKMA 3CQUA 1H1WA 3GFWA 3HRBA 2PZ5A 4L6QA 4IZ5A 3FMMA 1OVEA 3KXMA 2YISA 1ZYJA 3OS3A 4PDSA 3P78A 3FXWA 1BKXA 3NNWA 4XRLA 5CSVA 4D28A 3POOA 2BTSA 2XJ1A 3O71A 4FMQA 3RMFA 1YDRE 2REIA 3F3UA 4M0YA 4E5BA 2OXDA 1ATPE 1F5QA 3OXZA 5A4CA 1Q8ZA 3Q52A 3DBFA 3FZ1A 4O6EA 4YJQA 4DH7A 5IQBA 4CCBA 4FZAB 4XMOA 4BRXA 5D12A 2P3GX 1V1KA 1GIIA 1SNUA 4FSMA 4C2VA 4UN0C 3AT3A 3K3IA 4AA5A 2PUIA 4AW0A 2PUNA 3BI6A 3R7OA 5H9BA 2IW8A 4AZWA 2JBPA 2VNYA 1DI8A 4A9YA 4BCQA 2CJMA 1GZOA 3LFQA 3QA0A 5AM7A 3F2RA 1AD5A 3A7JA 3LFBA 1H4LA 4R5YA 4USFA 5KMKA 1A48A 3OHTA 4ZTNA 3KCKA 4Z9LA 4ACGA 2Q83A 2C3KA 4O1PA 2C5VA 4FNXA 1REJA 2CGWA 2W1EA 1GZ8A 3TUDA 4ITHA 4EYMA 4F1MA 4I5PA 5JT2A 4IFGA 4I20A 3KB7A 2UW9A 4RBLA 5JGDA 3IW4A 4PMMA 4BDEA 4DEDA 4C37A 2H6DA 3CGOA 2V22A 4AS0A 5HI2A 4FC0A 2VN9A 3QA8A 4NL0A 3H9OA 4DEAA 3MBLA 5DLSA 3O7LD 2ACXA 2LGCA 4RWIA 2HW6A 3KKVA 4O83A 5HORA 2EVAA 4F1TA 2H8HA 4HZRA 4JDIA 5HIDA 3HRFA 5AUWA 5KE0A 4FTNA 2VWVA 3QTIA 4JAIA 5HOAA 3VUKA 4F63A 2WAJA 4DC2A 1BMKA 4JG6A 4BI1A 5L2IA 4TYIA 1RQQA 3C0HA 3FEGA 3WZUA 3QCQA 3P0MA 5BUJA 4XBRA 3RK7A 2XNOA 5EKNA 5TKDA 2OIBA 3AG9A 2OJFE 3PXQA 5K3YA 4TYGA 2J51A 2ESMA 3PXRA 4KABA 2R9SA 1BL7A 1OL5A 5DT3A 2R3NA 2RFEA 3EOCA 4JIAA 1OECA 4B4LA 2BDFA 2J0IA 4I6QA 3UIXA 3OT8A 4CKIA 4BBEA 1PMEA 3NWWA 4W8DA 3OP5A 4X3FC 4C02A 1IA9A 1V0OA 4O0XA 4QMVA 3VUMA 4NIFB 2CCIA 2G9XA 4LUDA 2QR7A 4Y72A 1OUYA 5CSWA 5JSMA 4ORKA 4PNIA 3QU0A 1J7LA 2QU5A 4YJNA 3NGAA 4F6WA 3FUPA 4FKTA 5E8WA 3FY0A 3TT0A 4N6YA 2JC6A 3R7VA 4XV1A 3NDMA 3G6HA 5AM6A 3PVGA 3NYOA 3E63A 2ZV9A 3FLZA 3F2AA 4DAWA 3RPRA 2FVDA 1PMUA 4FIFA 4X6QC 5M08A 4EK8A 3E5AA 4AXAA 2X6DA 3NIEA 4NWMA 2VX0A 4MHAA 4J8NA 3EZRA 3TKUA 2VTJA 4MXXA 3R63A 1OL2A 3KVXA 4L7SA 4DT8A 3DAKA 4RX8A 3PZHA 4BDHA 4AQCA 3JPVA 4AZVA 2JKMA 4YNOA 4O0TA 2FUMA 4Q5EA 4EHEA 3NUAA 4H1JA 3UC3A 1GAGA 2OBJA 3QL8A 5FP6A 3C9WA 5BVNA 5ANOA 4A4LA 4BBFA 2EWAA 2YWPA 2XJ0A 3C4ZA 3RCDA 1H26A 1NT2A 5A4TA 3PFQA 4IVDA 3R0TA 1WZYA 3V5LA 4F7LA 1XH9A 3L9LA 2WTVA 2XKCA 3P79A 1KUTA 3NCZA 2VWYA 4YTCA 4NTSA 5L3AA 1M17A 3MVMA 4V04A 3CCNA 3B8RA 4NK9A 4U42A 3K5VA 4RWJA 2VUWA 3VBTA 2UW5A 4TWPA 5JGAA 2H9VA 5KMIA 1NVRA 2YIRA 4APPA 4RVKA 3RM6A 3MVHA 5HD7A 1S9JA 2YDIA 2VWUA 3KXXA 1F3MC 3M42A 4U3YA 5IUGA 5L8LA 2R3PA 4ASDA 2QG7A 2VTNA 1YHWA 3V5WA 2VD5A 1PXJA 2BIYA 3ZFXA 3R7UA 4DTBA 3FAAA 2GTNA 3G9LX 2YN8A 2ZDUA 5AP2A 4D4RA 4FKSA 4CFXA 1KWPA 2UVZA 5FTQA 3ZONA 3DXPA 4M66A 5EG3A 2FSLX 3FQEA 3PG1A 1W82A 3HGKA 5DE2A 5CASA 4BR3A 1O6LA 5HX6A 2YIQA 2WTKC 4IQ6A 5EH0A 2B54A 3PWDA 5BUEA 4S2ZA 4FKUA 4L8MA 2O63A 4NJDA 5DG5A 3TV6A 3JVRA 4G16A 4GJ3A 4U80A 1K9AA 1BUHA 5HG7A 2CLXA 1YHVA 2XK9A 3NW6A 4OTIA 4QP4A 4UWBA 4EH5A 5HTCA 2OZOA 4BI0A 4C4FA 4FUYA 1MQBA 2GNGA 3TTJA 2XMYA 4OTGA 3W55A 3VRZA 4AZFA 3FSKA 4H39A 4J98A 3POZA 4AN2A 4D2VA 3GOPA 4HGTA 5TE0A 3VW8A 3FI8A 2CCHA 3OW3A 5HESA 4BCJA 4NYEA 3NUXA 5IQDA 2YEXA 3RWQA 3EQPA 4RFYA 3FI3A 2OO8X 3LVPA 4B0GA 2VU3A 3AMAA 4RRVA 3II5A 4TZRA 2R4BA 3KEXA 4H36A 3VJNA 3QTWA 2QO9A 4CFVA 4FZFB 5F9EA 5JFXA 2GU8A 4FV7A 4FGBA 3V5TA 3O2MA 3ZXZA 5IZFA 5IEVA 3EMGA 4X6RA 2BPMA 2I6LA 3CTQA 4E93A 3UIMA 3CKWA 5BMSA 4YZNA 3E88A 4KIKA 2WU6A 3DQWA 4MXAA 3R8ZA 1IASA 3DDQA 5BPYA 4F1OA 4UBAA 5IUHA 4IB1A 1PYEA 2WQNA 4RVTA 3FKNA 3UOJA 3IECA 4TYHA 3R1YA 5EDPA 5M4FA 4K6ZA 4EH2A 2WQEA 2PVMA 3I6WA 5EW9A 3P08A 2UW6A 4F4PA 2CSNA 1SVHA 4FG7A 4P2KA 3NR9A 4BGQA 1PKDA 4EOKA 5LMKA 3SA0A 2WTIA 2QCSA 4EOSA 3QX4A 2W05A 3G0EA 3MWUA 4APCA 2X4FA 3OG7A 5HBJA 5EQEA 2X0GA 2YZAA 4RIWA 4DFUA 2UZWE 3C7QA 5CU6A 2O0UA 2ZB1A 3NAXA 4WG3A 1UNHA 3QQLA 1L3RE 5EM6A 4I0RA 3TL8A 4U8ZA 2WMAA 4D9TA 5F4NA 3ULIA 3AD6A 3O8TA 1M7QA 1STCE 2XH5A 4YPDA 4AZEA 5FRIA 5C8KA 3C4EA 2F2UA 2JDOA 4IHPA 4BDAA 2XB7A 4Y8DA 2VWXA 4HNFA 4MH7A 2YM6A 4ZTRA 4CCUA 2VX3A 3UTOA 4DFLA 4PP9A 4XG2A 3EQDA 1H28A 3ORNA 3PPKA 3HV5A 4O27B 4AFEA 3SDJA 4D4VA 3Q5ZA 4RG0A 4QD6A 5AR2A 3UIUA 4UWCA 4TW9A 4L46A 4CFWA 2W06A 5EOLA 5J8IA 2W4KA 2WHBA 2W5HA 2WMWA 3E92A 2WNTA 4GJ2A 3LXPA 3QWJA 3QRIA 3SG8A 5HCZA 4DFNA 1SVGA 2HZ0A 1OIQA 3HX4A 4JRVA 2PZIA 3ZMMA 3RZBA 4UB7A 3VUGA 2VTRA 3DKFA 3H4JA 3A8WA 4GYIA 4XH6A 4AW5A 4EYJA 3IG7A 4IX5A 4OW8A 4UMQA 2OWBA 4AW1A 2YCSA 3PXKA 3KXNA 3PVUA 2V7OA 3BYVA 1TQPA 2OG8A 4E26A 2JGZA 3ZYAA 5CEMA 5KO1A 1DM2A 3W2PA 4J95A 2BTRA 2XZSA 4G5JA 4OTPA 3FXZA 5CAPA 3GQIA 4UZDA 4F6SA 4OR5A 4BKJA 4GFMA 3BU5A 3DBEA 3QGYA 5C8MA 3EL7A 1CKPA 3CP9A 4JQ7A 4J97A 4GU6A 3GC7A 4BTMA 4LI5A 1G3NA 4PRJA 5FLFA 2W4OA 3ZSGA 4XV9A 4DN5A 5DRBA 2WMXA 1KV1A 1SVEA 5I0BA 4L67A 3UVRA 4FV9A 4LL0A 2VTIA 5M06A 4UV0A 4ZZOA 3QQUA 1M2RA 2VV9A 1ZOGA 2C5OA 3T9IA 2C6LA 3LXKA 4GK4A 4I5CA 4ZK5A 5JKGA 2BAJA 1VEBA 3A2CA 2FH9A 4X2JA 3MB6A 3MIYA 1PJKA 3H9RA 3CTHA 2PHKA 1PW2A 4TPTA 1IG1A 3TIZA 3V04A 3CQWA 3PA3A 4G34A 2PE1A 5FXSA 5K4JA 1KSWA 1Y57A 3O7LB 4AP7A 2GNHA 2WQOA 4F9AA 3P7AA 5IA0A 2UZBA 2J4ZA 3BEAA 5AP7A 2Y7JA 3AC3A 3DT1A 1OKYA 4HVGA 1U5RA 1WBSA 1ZZLA 3RM7A 4FSNA 3EH9A 5HNIX 4RJ6A 4BCOA 3SLSA 5IA4A 3NVKI 4ENXA 5M4CA 3RAWA 2VTHA 4KIKB 2J50A 1CKJA 3GVUA 4LOQA 1YI6A 3RINA 4JRNA 5KZ0A 3G90X 4PDPA 4WA9A 4PQNA 5JMSA 5J5TA 3R9HA 4D2PA 1OPJA 2FSOX 4TYHB 5GHVA 4J53A 4UMUA 5GZAA 4WUAA 2AUHA 4FI1A 5HE0A 2PMOX 2YIXA 3IW8A 4NUSA 2IVVA 3BYOA 1REKA 4XG4A 2F49A 1FOTA 3DJ5A 5DFPA 5J1WA 1JKSA 3KA0A 5M09A 5IMEA 3SGCA 3ZTXA 4HGSA 2WMSA 3CY2A 4EWQA 5C1QB 3S4QA 4JQ8A 2G01A 4EOOA 2IVSA 2QONA 5L2TA 3D15A 4I3ZA 4FEXA 4QP2A 4RIWB 4TXCA 3DAEA 3KF4A 1IRKA 3PSCA 1E1XA 4MNFA 4WOVA 1NXKA 5E8TA 2C5NA 3R8UA 3R9OA 3IDPA 5DPVA 4FTQA 3RALA 4JIKA 5H8BA 4IE9A 4R5SA 2FSTX 2ZV2A 3R9DA 4D1ZA 3KK8A 3TJCA 4HZSA 2QVSE 4OTRA 5CAQA 1W7HA 3PIYA 1Q61A 1WBNA 1T45A 4LRKA 3RAIA 3A4OX 1Q41A 3ORIA 4HNIA 2RG5A 4WBBB 5IKWA 4IWQA 4QYHA 5HIBA 1PXPA 4OBQA 1FBNA 2ITUA 4B7TA 2RL5A 4TKSA 3CD3A 4ONAA 3BHVA 2R3IA 3BGZA 3H9FA 4TNDA 2BIKB 1WVYA 5CZHA 2VZ6A 5TR6A 5KHWA 2VTMA 1VJYA 1LP4A 2ONLC 4BY9E 3K3JA 5HBEA 5KMNA 4FIGA 5DEYA 3EHAA 5EOBA 5LARA 3VBVA 2OW3A 4WNMA 2IPXA 4KS8A 4I94A 1XQZA 2OFVA 1X8BA 3IOKA 4PTEA 2GQRA 3O8UA 2YDKA 5A46A 2JD5A 3U54A 1J7IA 2YCQA 4UEUA 4R7IA 1YXSA 4G1WA 4QP7A 3K5UA 4DGMA 2ITVA 3L8XA 4QYYA 3QQGA 4WNKA 3MESA 5EKOA 2Y6OA 2QC6A 3NCGA 4R3CA 5F94A 3GC9A 3L9NA 3L9PA 4EL9A 4ANOA 3VS3A 2PSQA 4LFIA 3EFJA 3ORKA 4C7TA 3ULZA 3GI3A 4ANNA 4F7SA 2BAQA 3EYHA 3QHWA 3HMPA 3DKGA 3UNZA 5AV0A 4O21A 3HV7A 2GSFA 1YXTA 2NRUA 4MD9E 5M51A 5J9LA 4WSYA 2ERKA 2SRCA 4PMPA 4U9AA 2E9NA 3UO5A 4AWIA 1CTPE 4EHVA 5LWNA 3F7ZA 2ZB0A 2CMWA 3CY3A 4QMLA 4FKJA 1DI9A 3WZDA 2JBOA 2R3GA 3HV3A 4KRCA 3O23A 1LUFA 4N6ZA 1Y6BA 3IPHA 4XG7A 4NKSA 3EFLA 4YTFA 3BWFA 4FT7A 5CI7A 3A60A 2GTMA 5IA2A 3LXLA 3PSDA 4QRCA 3A7IA 3PA4A 2IW9A 2CGUA 2GS7A 1W98A 2PVHA 2G15A 4O2ZA 4O96A 3N4UA 5CNNA 2F7EE 3T9TA 3W2QA 4D4SA 4FOCA 2JIUA 5CLPA 2QURA 2OZAA 3RNIA 2C6TA 2CPKE 3ZC5A 2GQGA 2RGPA 3BGQA 1KE8A 4JBPA 3PPZA 5EYMA 3RJCA 4N4SA 3BHYA 5B2KA 4O22A 4BGGA 3PJ8A 3HYHA 5DI1A 3NW7A 4D1SA 4LMUA 3V3VA 2WB8A 3QXOA 4YNEA 3TDVA 2BAKA 2XF0A 3D7TA 4L3PA 4EEVA 2YCRA 3HP5A 3HV6A 4J71A 2R3OA 5CI6A 3R02A 1GZNA 3UG1A 4FSQA 5ETFA 3ZO3A 1OBDA 4LL5A 4ZZMA 1P14A 1Y8YA 3FBVA 3HMNA 3PSBA 3ITZA 3PXYA 4BIBA 1WVXA 5KUPA 2XRUA 3H10A 5DR2A 3Q9ZA 1SMHA 4W9WA 2OH4A 2J0JA 4FIJA 1JQHA 4LUEA 2CHLA 1NVQA 3R04A 3KMUA 4DFYA 4I24A 3QLGA 5E1SA 1FMOE 5AAEA 4CNHA 2QD9A 3Q9XA 4J1RA 4O1OA 3FZRA 2OH0E 3VS7A 3U6JA 4EOQA 2RFDA 4A9SA 5K9IA 4YC8A 2JAVA 4AOJA 2VTQA 5JH6A 4JAJA 3RAKA 5FXQA 3KRJA 3SRVA 1OKZA 4RJ5A 4U5JA 3GEQA 4DH8A 5AA9A 5BYZA 5EHLA 2UZNA 3EQGA 3BBTB 2UZVA 3BLQA 3N4VA 3PY3A 2RFNA 5EI6A 4BHZA 5E8XA 2C47A 3ORLA 2GS2A 3HA8A 4RGJA 3QCSA 5IDPA 5JZJA 3WZJA 2X6EA 2Y6MA 5DNRA 5HLWA 5M53A 2OF2A 3UOHA 3ZRKA 3HDMA 4YJUA 1I44A 3CD8A 3IW5A 2IG7A 1ZYCA 3V6RA 3DB6A 3HKOA 3MY1A 2PVRA 3DNDA 5TT7A 3R83A 3QC4A 2Z60A 3E87A 3SX9A 4B8MA 1FGIA 4FVQA 1YI4A 2B1PA 3MFUA 5IA5A 3ALNA 4IWDA 5I5ZA 4BCKA 4YSJA 4ZLYA 3L8PA 4QOXA 3EJ1A 1WBWA 1YWVA 3LXNA 4OTQA 4CV8A 3I4BA 4EOPA 4L52A 4CMUA 3QZFA 2C68A 4Z3VA 4DGNA 3VO3A 1JKTA 2XRWA 5CNOA 4O7NA 1BL6A 1UNLA 4K2RA 5E4HA 2P2IA 3UO4A 3KN6A 5JRSA 2WQBA 3JY0A 4IB0A 4M13A 1UWJA 5HZNA 3HUCA 5L2QA 3GNIB 4U44A 3LFCA 3UNJA 4NM7A 3MFSA 3FKOA 2UZDA 3MPMA 3OW4A 4GT3A 2JDRA 2PUUA 1JKLA 4FKIA 4IX6A 3PXFA 3FPQA 3ZCLA 4E4MA 2OGVA 4FV6A 3EIDA 3LQ5A 2PE2A 1KE7A 2XA4A 4MEDA 3VBWA 4KBKA 3WYYA 3R30A 3FZTA 1OIYA 3EB0A 4MXZA 5JN2A 5J5SA 2FA2A 5CSPA 4R3RA 5J7HA 4I4EA 4CEGA 3E8EA 2OZAB 3LFEA 1JWHA 4BZDA 2JKQA 2R3MA 4D2WA 1J3HA 3OBGA 2OU7A 3OCGA 2BRGA 1H1SA 3GT8A 4X7QA 2JFMA 3FL5A 5DT4A 3TEIA 3VBXA 4E7WA 3ROYA 1CSNA 1GNGA 2UZUE 1APME 4GUBA 4IXPA 3ZBXA 4JDJA 4DEBA 1Q8UA 4QMSA 4MF1A 4O0VA 3IQ7A 4EQMA 3D7TB 5HVYA 4FT0A 5GJGA 3LOKA 3NNVA 4ACHA 2JLDA 3FJQE 3FMLA 2BUJA 5C03A 2J0LA 4E6QA 3ZRLA 4PY1A 2ETMA 5KMMA 5KMLA 1XBCA 2B9JA 5E8YA 1OPLA 3I1AA 1FPUA 1T46A 4NCTA 4NFNA 3D9VA 3A8XA 3QHRA 3VVHA 2CGXA 3DDPA 3BX5A 4NTTA 2RF9A 2Z8CA 3Q9YA 5CVHA 3NYNA 3QZHA 4PMTA 3OWKA 4CT2A 2W5BA 4L00A 5EHOA 2CN8A 2GFCA 4EK5A 3QRUA 5IEYA 4C4GA 3G15A 4ZAUA 2P0CA 3OD6X 3QTRA 4RC3A 1XO2B 4AF3A 2QOHA 1OL1A 4DH5A 5AUVA 4WIHA 4HCVA 3AD5A 4P5QA 4G3GA 4CLIA 3OT3A 4DG2E 3QTQA 4I6HA 5AP1A 4RX7A 4L01A 4PL3A 3T8OA 3QUPA 3G2FA 5FTOA 4ZY5A 5AADA 5FXRA 4W4YA 4L44A 4GT5A 3RK5A 4KD1A 4MQ2A 4FTRA 3SRVB 4DGOA 3GU7A 2DQ7X 5AR8A 3C4WA 3RBWA 1YOLA 3WARA 3NUNA 4TYEA 3MS9A 4RQVA 3F3VA 3GC8A 4YC6A 3V01A 4AZTA 4ZP5A 1P4FA 4KBCA 3NYVA 3LJ1A 3M2WA 4QMTA 4PF4A 3ETAA 4O7SA 3Q32A 3PY1A 4PMSA 1JSUA 4XP0A 4QPAA 3R7YA 3HNGA 2R2PA 2QOBA 3FC2A 4XEYA 4F9BA 4DCAA 4BYIA 4FG9A 1M2PA 5GINE 2C6DA 1BLXA 2JDVA 4EOJA 5A6NA 3O0GA 3MVLA 4FSTA 4LMNA 3BYSA 4KUJA 3GENA 4G17A 1K2PA 2ITTA 3SG9A 1M52A 3ZFYA 4ANMA 5AA8A 1EH4A 5KCVA 3KC3A 3ENMA 4NM5A 3TV4A 4ZSEA 2AC3A 4BZNA 2VTOA 3EKNA 4W4XA 2X8DA 3N51A 5IQGA 1HOWA 1G5SA 1WBTA 2XBJA 2A19B 3R2YA 5KX8A 3EN9A 2QOKA 4IFCA 4ZMFA 5AP5A 2OJIA 2E9VA 2XYUA 4IACA 3VIDA 3FLYA 1XKKA 3BEGA 4IAKA 3ACKA 3SKCA 5F95A 4F0FA 3TNIA 3WZKA 1YI3A 3S3IA 3DBCA 2HK5A 3HP2A 2A0CX 3KMMA 4C3PA 4EK4A 3IGOA 1GY3A 5H8GA 4DLJA 3HAVA 4FK3A 3VRYA 2WZJA 3VUHA 4R78A 4ACCA 1PF8A 3ZU7A 4FVPA 1TQIA 2GNFA 1UU8A 4QNAA 1MRUA 3BHHA 3CEKA 5HG8A 3FZOA 4NU1A 3DBDA 4WSQA 1DS5A 4ZJVA 5FQDC 4O0UA 1A06A 3VAPA 3W2SA 4DH3A 3H30A 4ENYA 2YIWA 2BHHA 1Q3WA 1RDQE 3KF7A 2QU6A 1XHAA 3MIAA 4K77A 4XLVA 3LFAA 3KXZA 5DA3A 4R7BA 5T3QA 5EM5A 3SXSA 1H01A 5C8NA 5M07A 3NVMB 3C51A 1ND4A 1JNKA 2XKEA 5GJDA 3W2CA 3HL7A 3LCOA 4ZY6A 4EOLA 4QTEA 5L2SA 4LOPA 3WYXA 1ZOEA 1PXKA 4GG7A 2CKPA 3RTPA 4QTCA 2CKOA 4DF3A 4FVRA 1OI9A 4RJ3A 3UODA 3FKLA 3NZ0A 3I0QA 1Y8GA 3DZQA 3LPBA 4GW8A 4I6FA 4KKHA 3R01A 1U54A 2VRXA 5EHYA 2XP2A 1MQ4A 4IVAA 3EFWA 1ERKA 3VS4A 4X2GA 3A7GA 4AFJA 3LFNA 1A9UA 2XK3A 4C3RA 1J91A 2YERA 4LGDA 3P7CA 4C59A 2R0UA 3TUCA 2C3LA 4K9YA 3EQBA 4RA5A 3WILA 2GQSA 3BU6A 1E9HA 4ITIA 4UXQA 3H0ZA 3PPJA 5CANA 4B99A 4RMZA 2WIPA 4HCTA 2VWIA 5KBQA 1Q5KA 2I1MA 2YM8A 3TTIA 3IOPA 2ERZE 4D2SA 4KNBA 1M7NA 3D0EA 3DKOA 4IDTA 4QMXA 1KE6A 3AD4A 4J7BA 3UZRA 3FMHA 4U45A 4D55A 4CT1A 2EB3A 4KSPA 3PVBA 5DEWA 4RC4A 3QC9A 2V62A 2J9MA 5AX3A 3SW4A 3WBLA 4IAAA 3NUSA 1ZOHA 2JIVA 3A62A 3E93A 3H3CA 5DR9A 5AWMA 3U4WA 1R78A 4M14A 3QQJA 3FMNA 4H58A 5BVOA 5AMNA 3ODYX 3QRTA 3VUTA 4YZDA 4F9YA 1FMKA 3GB2A 3PVWA 1QPJA 3FDNA 2ITZA 4IM0A 1PY5A 4U40A 4AU8A 3QTZA 4PTGA 5BYLA 2WMTA 3EQCA 3OCSA 3GUBA 4I22A 3V8TA 3SXRA 3Q4CA 4IW0A 4ACDA 4E6DA 3MSSA 4LOOA 3MA6A 3UYSA 3EN7A 4N0SA 5HLPA 4X21A 3MPTA 3UOKA 4FYNA 5JZNA 4BCIA 3F5GA 2OK1A 3D5VA 3QCXA 4U43A 1TVOA 3MV5A 4YJOA 4ZJJA 3F88A 5JFWA 1R0EA 4WD5A 4X2KA 3FLWA 4TL0A 1Q3DA 5JEBA 3LQ8A 5FTGA 4UMPA 5F1ZA 5BX0A 1O6YA 4M84A 5D11A 4LM5A 4DBXA 5ACKA 2VO7A 2YHVA 3HMOA 5ANKA 3P5KA 3WIKA 3E62A 4LYNA 2C3JA 5DHJA 1GZKA 2XYNA 3MFTA 2ZMDA 4BIEA 5IU2A 4FV8A 3P9JA 5CS6A 1GJOA 4IADA 2E9UA 4YJSA 4D4YA 2OXXA 5CX9A 3GU4A 3MJ1A 3QYZA 2G2HA 4RWKA 4MXOA 1SM2A 3KXGA 4USDA 4Z16A 3DU8A 4UMRA 1UVRA 2HXQA 4S33A 1Q62A 2NNWB 4PP7A 1OITA 2OJGA 4MD8E 4XOYA 4MWHA 3DPKA 3UE4A 5KZIA 4F7JA 5M44A 3DV3A 4IX3A 2QI8A 2JDSA 2V7AA 1XBBA 4ASEA 2X8IA 3W2OA 5C26A 1FQ1B 4KB8A 4ZJIA 2YFXA 4G6OA 4HGLA 4BWPA 4QQJA 5L8JA 1WBVA 2R64A 2X39A 1PXNA 3QZIA 1Q4LA 4ANSA 3THBA 4F64A 2BFYA 4YZCA 3PG3A 2WOTA 3RWPA 4F99A 5HCXA 1E1VA 3S0OA 1SZMA 3WIGA 2J2IB 5GIPE 3C1XA 5CQUA 4QYEA 1YVJA 5DN3A 2W99B 5DIAA 4YZBA 2YM3A 4OTHA 4FX3A 4BFMA 1U54B 2B7AA 4TWNA 3TV7A 3ZLSA 4BL1A 3RPYA 4W4WA 4FGRA 3O17A 4C57A 3C5IA 2QLUA 3NSZA 4CRSA 1OIUA 2X7OA 2WMQA 2ZOQA 1XBAA 3PE1A 2GMXA 4H3PA 4O91A 3ENHA 4WNPA 4Y83A 4B6LA 5CALA 2J5FA 5HU9A 2C4GA 3GQLA 4FK6A 3R71A 2EXMA 4FV3A 3BHUA 3EQIA 4A9UA 4FEQA 2WMVA 4I92A 1Q8TA 1NY3A 1W83A 3LM5A 2I40A 3G33A 4FTJA 4IVBA 5AP3A 4Y85A 4AT5A 3NNXA 3NPCA 4WBOA 3FI4A 5CU2A 2PZPA 4IJ9A 2HENA 4W8EA 1JPAA 2X2LA 4XP3A 5AP0A 5EM8A 4ALWA 4D5KA 1P2AA 2PYWA 4RX9A 4C35A 4OT5A 4MCVA 5F20A 4D2RA 5GJFA 3BWJA 5CSHA 3A7HA 4MX9A 5HHWA 4XX9A 3VQHA 5LXMA 2R3QA 5A54A 1LEWA 2B9IA 3DXQA 2GCDA 3KU2A 3OWLA 4DBNA 3U6HA 3KREA 4Q9ZA 2NPQA 3V51A 2WOUA 4QTBA 3O8PA 4I5HA 3TKHA 3VS6A 2XM9A 4RZWA 3ZLYA 1WMKA 2EUFB 2W1GA 2YACA 3FL4A 2W1ZA 5LMKC 2ZV8A 4F0GA 3AC2A 2HXLA 5CU4A 2OLCA 5ETIA 3V8WA 3NRMA 2BKZA 3V6SA 5CT7A 3LLTA 3A4PA 2UW7A 2JEDA 3JXWA 4M15A 1M14A 4MVFA 4G3DA 4QMWA 2WMUA 3NS9A 3R1QA 4HYHA 3IDCA 4XG9A 3TCPA 4NW5A 2PVLA 2ZV7A 4EORA 4PTCA 3E7OA 4GT4A 3UG2A 3QYWA 2HOGA 2VWZA 2WTDA 1ZYDA 4BKZA 3E8DA 2JFLA 3ZHPC 4D0WA 3MY5A 3CPCA 3E8CA 2PMNX 4OLIA 5DRDA 4BDIA 1PKGA 3E7VA 2EB2A 3I6UA 4ALVA 5KMJA 3NMUF 4U81A 4FL3A 2C0TA 2X7FA 4EBVA 1H0WA 4BC6A 4UMTA 3C0GA 3ZLXA 5JFVA 3O51A 4GFOA 2C6OA 4MNEA 5EQPA 4BCHA 4JBVA 1O6KA 3DY7A 1G8SA 5LCKA 2FO0A 3COKA 3EQRA 2PTKA 4NH1A 4C4HA 4F70A 1ZWSA 2Q0BA 4JDKA 1UWHA 3AGLA 4TTHB 2YAKA 5M4UA 5E8ZA 2NRYA 4EJ7A 5FP5A 4AOTA 2P33A 3EQHA 3MTFA 2RKUA 5ICPA 3C4FA 4U6RA 2ZM1A 4E4XA 3UBDA 5AUUA 3RVGA 2YA9A 4DE4A 3KL8A 1JSVA 5FBNC 5FWKK 4FTCA 3OMVA 4FTIA 4CFNA 5M4IA 4WT6A 4RLLA 1WVWA 2FYSA 4FTKA 4M67A 1UU9A 4EH8A 3IDBA 3FPMA 4PDOA 5K4IA 4IAYA 3TM0A 4FKLA 2X9EA 3MY0A 4JX3A 5CXZA 4KRDA 4C58A 2BILB 4FV0A 3COIA 4UY9A 2XIXA 3R28A 3ZUUA 2I7QA 4O84A 4AOIA 3F7WA 3DLZA 4QTAA 4R3PA 3C4CA 3UC4A 1B38A 2BZKB 3QQKA 4BF2A 3VHKA 4AACA 5FBOA 2CKQA 4EOIA 5A3XA 1BX6A 2W4JA 1LPUA 3FQSA 4P90A 3MTLA 3KRLA 2C5YA 3LLAA 5CEQA 3OTVA 5E91A 4Q2AA 4KIQA 4A4XA 4MBLA 4BTFA 3G9NA 1Z57A 3EYGA 4N57A 2HWPA 5HVKA 5GZ8A 3FSFA 4PPAA 2R0IA 5FEQA 4A9TA 5EQYA 5ITAA 4A9RA 1QPCA 5LQFA 3ELJA 3TN8A 4TN6A 3PP0A 1UU7A 3CTJA 3FYJX 3AC1A 3FZSA 4FZDB 4RZVA 1B39A 3GXLA 4JOAA 2Z2WA 4CRLA 3PRIA 1PMVA 4E6CA 3GCUA 5DOSA 4RFMA 5EK7A 1YXVA 5IQEA 2X2KA 2Z7RA 3QZGA 4IM3A 3RHKA 4F7NA 5HO7A 4BVUA 1BI7A 4EUUA 4GVAA 5EYKA 1P4OA 1H25A 4O0SA 4FZ7A 4YLKA 4FEVA 1ZYLA 2CDZA 3WF6A 4FSUA 4XYFA 3SC1A 5FDPA 5JFSA 4L3JA 3TNQB 2C6EA 4N70A 5E90A 3D7ZA 3S1HA 3OROA 4U7ZA 5HU3A 4GKHA 4GUEA 2FGIA 2P4IA 4YJVA 4P7EA 4AA0A 4IC8A 1H00A 5AIRA 4ZSJA 3W8QA 3NX8A 5B2MA 1PXIA 5ETAA 3VBQA 3RNYA 5IPJA 4CG8A 4RPVA 3MJ2A 4OBOA 4LRMA 3V5PA 3ZSIA 1UKIA 4CLJA 1JAMA 3GC0A 3LCSA 4ZXTA 4FTLA 1O9UA 2QHNA 5K5NA 1H24A 2WIHA 5A4LA 3TACA 1WCCA 4FZ6A 4I1ZA 4EQCA 3OC1A 5JQ8A 1KOAA 5AIKA 2YIYA 4IAIA 3G5DA 4CD0A 2F7ZE 3DXNA 4M12A 5AV4A 2W1DA 4D9UA 4YC3A 2GNIA 4ZTMA 4YPSA 4GEOA 1QL6A 2B52A 2PY3A 3BYUA 3D83A 3FQHA 5EI2A 1QMZA 1JSTA 3EL8A 4M69A 2WU7A 4O7RA 1J1BA 4KKGA 3U4UA 4F9CA 3EN4A 4EONA 2WD1A 1ZYSA 4CKRA 2IW6A 3NIZA 5AAFA 5EI8A 3BPRA 4KAOA 4MNEB 3PLAE 3W32A 3HDNA 2HZ4A 3K54A 3OEZA 4FL2A 4G9CA 4I93A 4DFBA 4A07A 1Q8WA 5HX8A 2C6KA 4RQKA 5DT0A 4Y5HA 4XNEA 2FB8A 2PK9A 1Z5MA 3FYKX 4E1ZA 2X7GA 3OOGA 3P86A 5A4EA 2W9FB 4UX9A 2BCJA 4BZOA 2PPQA 4JQEA 3MI9A 1J7UA 3ZDUA 4F65A 2UVYA 1ZY5A 4KSQA 2P2HA 4NW6A 4TNBA 3BCEA 3PIZA 1URWA 4OGRA 4IANA 4CZUA 3DTCA 3KVWA 4G6NA 4RSSA 3L8VA 2IZSA 3P4KA 3TZMA 3UZTA 5DBXA 1IEPA 3UJGA 1YW2A 4U0IA 2Y4IB 3HLLA 5CTPA 2R5TA 1H08A 1R0PA 3OWJA 5E1EA 4HPUE 3LIJA 5BVKA 1PHKA 4KWPA 4DGLC 3DAJA 5IDNA 5IH6A 1YHSA 2DWBA 3OZ6A 3R8MA 3TI1A 2WELA 3ATSA 4X2FA 2QLQA 2R7BA 3PZEA 3SHEA 4C62A 3D5UA 3ZLWA 2YCFA 3AT4A 4S30A 2Y8OA 3MH0A 4JR3A 2GNJA 4V01A 5TF9A 3F5XA 4RIOA 3V5JA 3DQXA 2A27A 4KIOA 5ANIA 3UDBA 2J90A 2RSVA 3E64A 4ZSLA 2BZHB 5HKMA 2I0HA 2YM7A 4GKIA 2O65A 3OBJA 4EZ7A 5AV2A 2XIYA 3LAUA 4LGGA 4X3JA 5D7AA 3L8SA 4GVJA 5HEZA 4BDCA 2YM5A 3KN5A 3QKMA 4UALA 3IS5A 5DVRA 1ZZ2A 4YBJA 3QTSA 1MRYA 4I4FA 4IBMA 4EC9A 5HIEA 1I09A 2X1NA 4ZTHA 4E4NA 2B0QA 2WFYA 2ITWA 2YLFA 4PNKA 4YZMA 4WRGA 4V05A 4FNZA 4JBQA 3ZM4A 2A4LA 2XK6A 4G2FA 4WHZA 4CZTA 5AR3A 3Q53A 4FV2A 4XLIA 3UVQA 4BI2A 1IR3A 5IQFA 4AGWA 3QRJA 3CPBA 5DH3A 3QUDA 4C4JA 5FEDA 3AMBA 4CFMA 4ASXA 2UW0A 3VS0A 4PV0A 3C5UA 2WMBA 1ZAOA 4FTAA 1NA7A 3PIXA 4QMZA 5DWRA 3GU6A 4GU9A 2RFSA 2GHLA 2WQMA 2DYLA 2R3RA 4IZAA 5KKRB 2Z7SA 5C01A 3Q4ZA 1Q8YA 1S9IA 2FSMX 3OUKA 4QMOA 2XVDA 3JY9A 1Z9XA 4QPMA 3UMWA 2WKMA 1PYXA 5IUIA 5KHXA 2QODA 4W9XA 5E92A 5IG1A 3UNKA 3CQEA 4H1MA 4OTFA 2ITQA 3QQHA 4DYMA 2ITXA 4DA5A 2XIKA 4AW2A 4CMTA 4S34A 3PJCA 3BV3A 4AE9A 3VS1A 3Q9WA 4YLJA 2C6IA 3SQQA 1QPEA 1YXXA 4RWLA 3QKKA 5HQ0A 2RIOA 2X81A 3N9XA 4XG3A 5HICA 3Q6WA 3HZTA 3ODZX 5HVJA 5GIOE 5BVEA 4BN1A 5A14A 2X9FA 5LWMA 4J96A 4K0YA 4NSTA 3I7CA 4CYJA 3MYGA 3UYTA 4M69B 4P4CA 4PPBA 4JVGA 4ANQA 4OTDA 5B0XA 4FOBA 3NLBA 4AGDA 4EQUA 2OF4A 2CLQA 2JAMA 1PMNA 3RKBA 5AFVA 2PZRA 1QPDA 2OIQA 4NZWB 1H1PA 2VGOA 3TNWA 4C4IA 2VTSA 4IIRA 2WO6A 4IH8A 5AP6A 3R8LA 4FTMA 4CVAA 3Q5IA 1TQMA 4GK2A 4PWNA 3CKXA 2C69A 5AJQA 2XCKA 5LMAA 4LV8A 1ZARA 1IAJA 4FL1A 2G1TA 4AUAA 2OJJA 4YO4A 4ZLOA 2HY81 5IF1A 4NM0A 3W10A 1FINA 3C50A 2UVXA 4YMJA 4RVLA 4FV5A 5ANEA 5BVFA 5I9YA 2VTAA 2CN5A 3ZH8A 1V0PA 2QOCA 2B55A 1OM1A 5ANGA 3VW6A 4U3ZA 4RC2A 4H3QA 3DJ6A 5HG9A 4RIXA 3D5WA 2O64A 2JDTA 2NO3A 2Y9QA 3LCDA 3ORPA 3TWJA 3ZZEA 1KV2A 4K1BA 3QKLA 3FMEA 2H96A 4HOKA 4FODA 4TWOA 5T6KA 5H3QA 3VC4A 2PVNA 2V5QA 4M68A 4DITA 4EZ3A 4F6UA 3SW7A 3RZFA 2C6MA 4JG8A 4PPCA 4YJTA 1W84A 3AC5A 4G31A 1R3CA 5CWZA 4IZ7A 1RW8A 2Y0AA 5IMXA 4E5AX 2OFUA 3LM0A 2F57A 3AGMA 4XUFA 4O86A 5CF6A 1QCFA 4ZMEA 3EFKA 3R7IA 4AGUA 3OXIA 4MBJA 3AC8A 5DMZA 3U87A 1U5QA 5GNKA 5C4KA 3ANRA 5I4NA 2YLEA 5AUYA 2ITYA 3CIKA 3NW5A 3N4TA 3DK6A 4YU2A 3F66A 4L45A 5AR5A 5LMBA 4XHKB 4DEEA 1VZOA 4XOZA 3ZM9A 4BDKA 3I0OA 3P23A 5IQIA 2PUPA 4KBAA 5CT0A 2VWWA 1OB3A 3ZO1A 3CXWA 5LJJA 2UV2A 4BDFA 3G6GA 2PULA 4EOMA 3DA6A 2BRBA 2R3FA 5LVOA 4GL9A 2F9GA 4FT9A 4HCUA 5HGIA 1DAYA 4EK6A 4GIHA 5LVMA 4OT6A 4V0GA 4G9RA 4YP8A 4FKWA 3IONA 2W5AA 4L42A 4TY1A 3CGFA 2YABA 4HVSA 5ACBC 1YDTE 3KMWA 3ZZWA 3OTUA 5CU0A 3FHRA 2F2CB 3KFAA 3LJ2A 4YTHA 5AV1A 4E5WA 1BI8A 3F5UA 3DZOA 5J9YA 2GNLA 3ORTA 4HVDA 1H8FA 3FC1X 3QD3A 4Y95A 1HCLA 4X3FA 3ET7A 4ZS0A 3VULA 3W18A 4CZYB 2C30A 2O2UA 4GK3A 3BU3A 4NCTC 5TOZA 3FI2A 3RPVA 4ERKA 4YHTA 1ZMVA 4E73A 4JT3A 2LAVA 2QQ7A 3EKKA 2QOFA 4L3LA 2ITPA 2JKKA 4FIIA 4RA4A 3LHJA 3SOAA 5I9ZA 3QAME 3D4QA 5EYDA 2BVAA 3CJFA 4BCFA 1AGWA 5IQCA 3KULA 2XNPA 2XNGA 4I21A 3MGYA 4XBUA 4R77A 2EU9A 2VO0A 1Q97A 4HYIA 1ZXEA 3QD0A 1IA8A 1H1RA 3LZBA 3R73A 4DEGA 3TUBA 5J1VA 3I60A 2CNQA 4J8MA 2VO6A 5A9UA 5EFQA 4EJNA 4AT3A 4TT7A 1OKVA 1RE8A 2R7IA 3F61A 5J9ZA 4RJ4A 3TJDA 4IJPA 2B9FA 2IZUA 5CEOA 5M56A 2OIDA 3MFRA 4O7VA 5L6OA 4YGAA 3SOCA 2VWBA 3NNUA 5L6WL 5K5XA 5FD2A 4XJ0A 4EH7A 4YHJA 3Q60A 3QX2A 3ZEPA 4FT5A 2C3IB 2ITOA 1L8TA 2DS1A 3GU8A 3ORZA 3Q4UA 4YHFA 4I6BA 5IQAA 4NEUA 4DCEA 2QG5A 2J0MB 3FMKA 2DUVA 3UQFA 4ZIMA 2Z02A 5M55A 4O6LA 3ZUTA 1HCKA 3AXWA 1XR1A 4HGEA 4BWXA 4DINA 3LCKA 4FF8A 2VGPA 2R3KA 4BWKA 2Z7LA 1JLUE 2XK8A 4NM3A 3RK9A 4RIXB 4I0SA 4RIYA 3DFCB 2HCKA 3TG1A 3P7BA 3NAYA 1XH8A 2XNEA 5J7BA 4C38A 2KTYA 2C5XA 3JR1A 3PRFA 3FHIA 1YWRA 5ANDA 3MN3A 3R2BA 4L9IA 5AR4A 3OVVA 2WTCA 1CM8A 2OXYA 5HTBA 4EK3A 2C0IA 4J99A 2AYPA 4AAAA 1OMWA 4C61A 3U55A 4DG3E 4FKVA 4IM2A 5HO6A 4R7HA 1R1WA 2E9PA 3UPZA 5AUZA 1WAKA 5CENA 4KINA 2GHMA 4A7CA 4UZHA 3TDWA 2HY0A 2VAGA 1OL6A 3R6XA 4M3QA 4W4VA 2P55A 3T3UA 3ZS5A 5B2LA 4D2TA 4NFMA 3I81A 4UYNA 3BHTA 3UPXA 2YITA 4AN9A 2ZJWA 1JVPP 3LMGA 4KS7A 4RT7A 2IO6A 3KK9A 2Y4PA 4LG4A 4Q9SA 5L2WA 5DR6A 2YM4A 5DYJA 1VYZA 2GS6A 1XH5A 4V0GB 4ZSGA 3O96A 5CU3A 5EDQA 3U9NA 4QYFA 3A61A 1OGUA 3QD4A 4FUXA 4ZTQA 3UQCA 4K18A 3PXZA 4GG5A 5K0KA 4G3FA 4G6LA 5BNJA 5CF5A 4ZEGA 1KOBA 4XV2A 2BFXA 5AV3A 3DCVA 5FM3A 4USEA 5BYYA 5LOHA 4EKLA 1UA2A 2GDOA 3WOWA 1XH6A 5FUTA 4DTKA 3ORMA 4XCUA 3BRBA 4EWHA 4YJPA 1OIRA 3HECA 4R8QA 4BDBA 4X3FB 4CXAA 4MK0A 4JDHA 5EM7A 4KIPA 2ETKA 3TNPC 3VJOA 1NW1A 2PE0A 3UGCA 3AT2A 2QR8A 5G1XA 2BRMA 4DLIA 3PYYA 4WUNA 3SXFA 3L1SA 4IWOA 3REPA 3FV8A 4QNYA 4MXYA 4AZSA 4YZ9A 4EHZA 5A6OA 3HUBA 3CLYA 5E9EA 2BR1A 5JGBA 1K3AA 3JVSA 5D1JA 3KULB 3M11A 4EBWA 4GS6A 4M97A 1FVVA 4E20A 3VF9A 3HVCA 5J87A 2BALA 4F9WA 3DGKA 2BDWA 1YWNA 3QUEA 3OUNB 1MRVA 4IB5A 5CAVA 3QTUA 3F2NA 3PJ1A 2X4ZA 2UUEA 2YJSA 4QYGA 4QMQA 3BLRA 4FV4A 4NKAA 5K0XA 4FIEA 4QQTA 2QKWB 5FM2A 1FVTA 1PXMA 5HNBA 4LRJA 4ZLZA 4FEUA 3C13A 3KRXA 5I9XA 2V55A 2XK4A 4IMYA 4ID7A 2V0DA 1LEZA 3OXTA 2PVYA 3KCFA 4KKEA 4QP9A 4CQGA 3I79A 3CC6A 2I0VA 2IN6A 4GH2A 4QP6A 5CY3A 2WXVA 4DEIA 4YURA 4DHFA 5IQHA 2IVTA 2I0EA 4R1YA 4YTIA 1YXUA 4BTJA 5I3RA 2HAKA 4U79A 2CNVA 4RLKA 3PJ3A 1CMKE 5CZIA 4BCNA 3E3BX 3RGFA 1GIHA 3TIYA 4JI9A 4BYJA 5KNJA 5CXHA 2E9OA 3SVVA 4O81A 3HRCA 4QT1A 3BIZA 3FLQA 4FR4A 3UP7A 4GV1A 5CSXA 4RIYB 3D14A 3K2LA 4CSVA 4O7TA 4TWCA 4XRJA 3Q96A 5I9UA 3BE9A 3ZDIA 3D2KA 3I5ZA 5KBRA 4FSWA 4TYJA 4FNYA 4BHNA 4PDYA 2XM8A 3WF9A 5ANJA 1JKKA 4IDVA 3QLFA 4XS2A 5HO8A 5JK3A 1M2QA 4YSMA 5A4QA 3F6XA 3IKAA 3HAMA 3FWQA 3U8WA 2BMCA 3ID6C 4DG0E 4AT4A 3QBNA 2OKRA 3OY3A 4O38A 4PL4A 4FTOA 4WKQA 5AP4A 5I9WA 5L8KA 2QNJA 2GPHA 2QOLA 2X8EA 4JJRA 3GGFA 4L53A 2PVJA 4WG4A 2BKKA
chains in the Genus database with same CATH superfamily
2NP8A 4Y5QA 3EN6A 5LVLA 4Y46A 4QP8A 4ZTSA 4C2WA 3PE2A 5JRQA 2G2IA 1W2FA 3QXPA 2GFSA 4OBPA 3CR0A 3D94A 3FE3A 2WTKB 3OCTA 4HYUA 2ZM4A 3NEWA 5FGKA 4GSBA 2QO2A 4HW7A 2XS0A 3W8LA 1ZMWA 3VF8A 3AQVA 1XJDA 2VTLA 3A99A 3PUPA 3Q6UA 2OJ9A 4BDJA 3ORXA 2BRHA 4BKYA 4BIDA 1OPKA 1XH4A 2PVKA 4QMNA 2AC5A 3M1SA 3MVJA 4O7WA 4QP3A 4M0ZA 5CF4A 4C4EA 3KXHA 3ZO2A 4IAFA 2XUUA 3GU5A 4FBXA 3W16A 3EWHA 2XK7A 5CAUA 4MQ1A 3VQUA 3GP0A 4MXCA 5IEXA 4FKOA 5B7VA 4U41A 3U51A 2HZNA 5AUXA 2PMIA 2BRNA 3FY2A 2A98A 3SD0A 3RAHA 3DK7A 3QF9A 5BQ0A 4D0XA 4WNOA 3BQRA 2WPAA 4I23A 5G6VA 3MH1A 2XJ2A 3R9RA 4P5ZA 3ZSHA 2WTJA 3IGGA 4GCJA 5E8VA 3UIBA 3ZRMA 4Y73A 4CG9A 3PY0A 3E3PA 3HEGA 3QD2B 4I5MA 1RJBA 3RPSA 4MYGA 4CFUA 2G2FA 2C1AA 4ERWA 3KGAA 5FG8A 3WF8A 3ZO4A 4EZ5A 3F69A 3VN9A 2OICA 3SV0A 3DFAA 3BBWA 4ZTLA 3ALOA 3TZ7A 2WMRA 4NT4A 3MW1A 4Z55A 2YZLA 3DOGA 4H05A 4FE2A 3ZBFA 1ZLTA 1DAWA 4O2PA 4ASZA 3LMIA 1CKIA 4CTCA 4D58A 3OEFX 3HV4A 3LMHA 1H07A 2PVFA 3HMMA 3QCYA 3F9NA 1Q24A 4G5PA 4JXFA 3GCPA 4EH3A 4FA2A 5C4LA 4S31A 5CEIA 3R1SA 4D1XA 4DGGA 4X0MA 2PL0A 2W17A 3D2IA 3KY2A 5AR7A 3IW7A 4NJ3A 1MP8A 2HELA 4XG8A 5BMMA 3CBLA 4AX8A 3BL7A 3W0OA 4TRLA 3SAYA 4FEWA 1H27A 4C0TA 3Q2JA 2HIWA 3FMJA 3ROCA 4O0WA 3NYXA 4GIIA 3ANQA 1YDSE 4ANBA 4FG8A 5EDRA 4CKJA 1PRYA 1U4DA 4GMYA 3QTXA 3U9CA 4F08A 2Z7QA 3UP2A 4JL9A 4G3EA 4JBOA 3OWPA 3C0IA 3P1AA 5CVGA 5HCYA 2ONLA 5GZ9A 4EUTA 3VNTA 5CVFA 4DTAA 3ZC6A 2J0KA 1YRPA 3HA6A 2E2BA 2QOIA 1OBGA 4OAVB 4C34A 1BYGA 4OAUC 3S95A 3EN5A 1PXOA 5T68A 2ZMCA 4BDDA 3LJ0A 4JX7A 2JKOA 3OF0A 4FV1A 3F3TA 5C9CA 3B2TA 2UW8A 1VYWA 4WO5A 3LCTA 4IX4A 4HJOA 5E8SA 4ZY4A 5AUTA 4MTAA 2IZTA 4AGCA 4PL5A 2IVUA 3WE8A 2ETRA 5E7RA 2BZJA 2CGVA 2F7XE 3MH2A 4MD7E 5AAGA 1U46A 2W1FA 1WFCA 2BDJA 2J7TA 2IZRA 3QRKA 5CEPA 3WI6A 3G51A 3RHXA 3V5QA 3KRWA 2KULA 4UYAA 4RX5A 3GCVA 2QHMA 3G0FA 1ZMUA 4JS8A 2CNUA 2QOOA 4HPTE 4BGHA 3PLSA 3ZOSA 2W1IA 4K33A 2B4SB 4ZOGA 4S32A 2XBAA 4MF0A 5L6PA 4UXLA 3GOKA 1UU3A 2XNBA 2ZDTA 5DGZA 5L4QA 2R3JA 1P5EA 2B53A 2UZLA 3DLSA 4AG8A 4O82A 3B2WA 2Y4IC 4C36A 4ALUA 2J6MA 4RJ8A 4E8AA 5ETCA 3C4XA 1R39A 5FDXA 4PX6A 3TZ9A 1SNXA 2PMLX 2VNWA 2XNMA 3DK3A 4BDGA 4DFZE 3ZEWA 5HD4A 4J52A 4U97A 4BBMA 4QQ5A 4II5A 1F0QA 3I5NA 5BUIA 3VUIA 3WE4A 1NVSA 4YLLA 2YAAA 3QQFA 2O5KA 3F82A 4H3BA 4CQEA 5HLNA 5FEEA 3TKIA 4EH6A 3PDTA 2UW4A 3Q3BA 2Q0NA 3TNHA 4MBIA 3W0SA 2W0JA 2O3PA 3WZEA 4EC8A 5HE2A 2X2MA 3BLHA 4LDTA 2HYYA 2UZOA 4ITJA 3MB7A 1WBOA 4YBKA 2IJMA 4AN3A 3QWKA 2PWLA 3DNEA 4G3CA 2QKRA 4WG5A 3R8PA 3ATTA 4FIHA 3IO7A 5AEPA 4O7ZA 2WTWA 4PUZA 4RFZA 2JIIA 4UWYA 2EXCX 3DS6A 2XCHA 3VWAA 4FKGA 4LQMA 1XWSA 5LCJA 3VS2A 3JUHA 3QGWA 2XNNA 3QALE 4O7YA 2QO7A 5HTIA 3W0QA 1OUKA 2C0OA 2GHGA 3EZVA 3FLNC 3LFDA 2EXEA 3R22A 3TXOA 2F4JA 4O0RA 2HZIA 2UZEA 4FSYA 5EW8A 2UW3A 5HE3A 3AC4A 3V8SA 3ZUVA 4E3CA 5EYCA 3MH3A 4GFGA 4BCPA 3AOXA 4YR8A 5KKRC 4L68A 3LE6A 3FLSA 4Z7GA 2CKEA 3QFVA 5CQWA 5J95A 4XP2A 4IEBA 2A1AB 1CDKA 1ZY4A 2ZVAA 3OY1A 4GYGA 4EKKA 3GFEA 3L9MA 3LW0A 4FKQA 5IA3A 3CE3A 4E4LA 4DHJA 1H1QA 2BROA 2YJRA 5CEKA 4O7LA 4EHGA 4GRBA 4QTDA 1IAHA 4EH9A 4M7IA 3GCSA 5D9HA 3F3WA 5C27A 5CYIA 3GBZA 2WGJA 4HYSA 3ERKA 4ARKA 3UQGA 4LV5A 5D41A 4OTWA 4FTUA 3UMXA 1B6CB 1W0XC 2VTPA 1OKWA 4ACMA 5D7VA 4DFXE 1VR2A 3S2PA 4BTKA 4MAOA 1GIJA 4QMYA 4EI4A 3KQ7A 4DDGA 3BZ3A 4CV9A 3OFMA 1MUOA 2W9ZB 3RI1A 4HVIA 2ZYBA 3F5PA 3ZFMA 4LGHA 5HNGA 4K8AA 4FT3A 3W33A 4JLCA 4XG6A 4AE6A 1ZRZA 1FVRA 2XIRA 3FMDA 3NUYA 3UVPA 1JBPE 3CJGA 2R3LA 3LFSA 3I7BA 4O0YA 5IH5A 5IH4A 3A7FA 1W8CA 4CMOA 3TZ8A 2C1BA 4I0TA 4YUQA 3R7EA 3VBYA 3R8VA 3F3ZA 4YJRA 4FKRA 2OSCA 4IZYA 2QOQA 1URCA 3B8QA 3H0YA 4FTTA 3R21A 4QMMA 3DB8A 3NUUA 1FGKA 5HE1A 2ITNA 3UO6A 3GCQA 2JITA 2XEYA 1GOLA 4L7FA 4C8BA 1H0VA 4FKPA 1OZ1A 3MPAA 3LFFA 3Q04A 4EH4A 3PP1A 2ZM3A 3R1NA 4IVCA 3JS2A 4M8TA 4BB4A 2W96B 5CAOA 3EQFA 4XV3A 4BICA 1TKIA 1KE9A 3COMA 1UKHA 3DTWA 4QP1A 4QO9A 4B9DA 5I3OA 3VS5A 2XIZA 4F09A 4CGAA 1J1CA 3CS9A 3RCJA 4CYIA 3W2RA 3LQ3A 3MDYA 5HG5A 1Y6AA 3BE2A 3UOLA 4CFFA 3CSVA 5IISA 5TO8A 3IK3A 2HWOA 2PZYA 4BCMA 3T3VA 1PXLA 5EW3A 4C3FA 4HVHA 2YWVA 3PTGA 4ZS4A 4X2NA 4DT9A 3BQCA 5H2UA 4FSZA 4A4OA 4AA4A 3S00A 3E8NA 1UNGA 1V0BA 3UZPA 3R00A 1Y91A 1WBPA 4E6AA 5LVPA 2W1HA 5HBHA 1G8AA 2VX1A 3JYAA 3W1FA 4F0IA 4A06A 1UV5A 4YO6A 5JQ5A 3D5XA 4ANLA 4BCGA 3NUPA 5LVNA 3MA3A 2H34A 3DBQA 4FSRA 4JNWA 2R3HA 3IW6A 4FNWA 4WRSA 5H8EA 4JG7A 4Q5HA 3PA5A 3BGPA 2HW7A 3Q4TA 3DKCA 3DJ7A 2OI4X 5CF8A 3PJ2A 4FICA 2WEVA 1LR4A 2WEIA 3PWYA 4RVMA 1OL7A 2XKDA 3WF7A 3FZPA 2XEZA 3O50A 1YOMA 3COHA 2VTTA 4IC7A 2BZIB 2A2AA 4B8LA 3R9NA 2W7XA 4JR7A 4RJ7A 5BVWA 4QMPA 3BYMA 2X0PA 3VHEA 4D5HA 4DEHA 1AQ1A 4CTBA 1JOWB 1KE5A 4DH1A 3BELA 3RPOA 2B9HA 4MWIA 4QMUA 2YDJA 4I41A 4FYOA 3OCBA 3ZXTA 4NIFA 3RP9A 4QQCA 4Z7HA 2O8YA 3AMYA 1SYKA 3U6IA 3VUDA 2IWIA 2W1CA 1XH7A 3BKBA 3R7GA 4IWPA 1YKRA 4R1VA 5IA1A 4R6VA 4OUCA 5M57A 3KRRA 1YOJA 4QPSA 5I9VA 2BHEA 1U59A 3ACJA 3FXXA 4C33A 4IAZA 5KMOA 3OOMA 2ZAZA 2VO3A 4IB3A 2PU8A 3HMIA 2X0QA 3WF5A 4ZZNA 3BV2A 5E8UA 5BVDA 4K11A 2UZTA 2RG6A 2I0YA 5AX9A 4KA3A 5J79A 2AQXA 4JMQA 2XKFA 4MKCA 4L43A 2J5EA 5D10A 1Q99A 1YQJA 3Q2MA 4ZSAA 3LKMA 3CQUA 1H1WA 3GFWA 3HRBA 2PZ5A 4L6QA 4IZ5A 3FMMA 1OVEA 3KXMA 2YISA 1ZYJA 3OS3A 4PDSA 3P78A 3FXWA 1BKXA 3NNWA 4XRLA 5CSVA 4D28A 3ML1A 3POOA 2BTSA 2XJ1A 3O71A 4FMQA 3RMFA 1YDRE 2REIA 3F3UA 4M0YA 4E5BA 2OXDA 1ATPE 1F5QA 3OXZA 5A4CA 1Q8ZA 1TFFA 3Q52A 3DBFA 3FZ1A 4O6EA 4YJQA 4DH7A 5IQBA 4CCBA 4FZAB 4XMOA 4BRXA 5D12A 2P3GX 1V1KA 1GIIA 1SNUA 4FSMA 4C2VA 4UN0C 3AT3A 3K3IA 4AA5A 2PUIA 4AW0A 2PUNA 3BI6A 3R7OA 5H9BA 2IW8A 4AZWA 2JBPA 2VNYA 1DI8A 4A9YA 4BCQA 2CJMA 1GZOA 1W2CA 3LFQA 3QA0A 5AM7A 3F2RA 1AD5A 3A7JA 3LFBA 1H4LA 4R5YA 4USFA 5KMKA 1A48A 3OHTA 4ZTNA 3KCKA 4Z9LA 4ACGA 2Q83A 2C3KA 4O1PA 2C5VA 4FNXA 1REJA 2CGWA 2W1EA 1GZ8A 3TUDA 4ITHA 4AXDA 4EYMA 4F1MA 4I5PA 5JT2A 4IFGA 4I20A 3KB7A 2UW9A 4RBLA 5JGDA 3IW4A 4PMMA 4BDEA 4DEDA 4C37A 2H6DA 3CGOA 2V22A 4AS0A 5HI2A 4FC0A 2VN9A 3QA8A 4NL0A 3H9OA 4DEAA 3MBLA 5DLSA 3O7LD 2ACXA 2LGCA 4RWIA 2HW6A 3KKVA 4O83A 5HORA 2EVAA 4F1TA 2H8HA 4HZRA 4JDIA 5HIDA 3HRFA 5AUWA 5KE0A 4FTNA 2VWVA 3QTIA 4JAIA 5HOAA 3VUKA 4F63A 2WAJA 4DC2A 1BMKA 4JG6A 4BI1A 5L2IA 4TYIA 1RQQA 3C0HA 3FEGA 3AKLA 3WZUA 3QCQA 3P0MA 5BUJA 4XBRA 3RK7A 2XNOA 5EKNA 5TKDA 2OIBA 3AG9A 2OJFE 3PXQA 5K3YA 4TYGA 2J51A 2ESMA 3PXRA 4KABA 2R9SA 1BL7A 1OL5A 5DT3A 2R3NA 2RFEA 3EOCA 4JIAA 1OECA 4B4LA 2BDFA 2J0IA 4I6QA 3UIXA 3OT8A 4CKIA 4BBEA 1PMEA 3NWWA 4W8DA 3OP5A 4X3FC 4C02A 1IA9A 1V0OA 4O0XA 4QMVA 3VUMA 1XMLA 4NIFB 2CCIA 2G9XA 4LUDA 2QR7A 4FRFA 1OUYA 4O4BB 4Y72A 5CSWA 4PNIA 3QU0A 1J7LA 4ORKA 2QU5A 4YJNA 3NGAA 4F6WA 4AAYA 3FUPA 4FKTA 5E8WA 3FY0A 3TT0A 4N6YA 2JC6A 3R7VA 4XV1A 3NDMA 3G6HA 5AM6A 3PVGA 3NYOA 3E63A 2ZV9A 3FLZA 3F2AA 4DAWA 3RPRA 2FVDA 1PMUA 4FIFA 4X6QC 5M08A 4EK8A 3E5AA 4AXAA 2X6DA 3NIEA 4NWMA 2VX0A 4MHAA 4J8NA 3EZRA 3TKUA 2VTJA 4MXXA 3R63A 1OL2A 3KVXA 4L7SA 4DT8A 3DAKA 4RX8A 3PZHA 4BDHA 4AQCA 3JPVA 4AZVA 2JKMA 4YNOA 4O0TA 2FUMA 4Q5EA 4EHEA 3NUAA 4H1JA 3UC3A 1GAGA 2OBJA 3QL8A 5FP6A 3C9WA 5BVNA 5ANOA 4A4LA 4BBFA 3O5AA 2EWAA 2YWPA 2XJ0A 3C4ZA 3RCDA 1H26A 1NT2A 5A4TA 3PFQA 4IVDA 3R0TA 1WZYA 3V5LA 4F7LA 1XH9A 3L9LA 2WTVA 2XKCA 3P79A 1KUTA 3NCZA 2VWYA 4YTCA 4NTSA 5L3AA 1M17A 3MVMA 4V04A 3CCNA 2XARA 3B8RA 4NK9A 4U42A 3K5VA 4RWJA 2VUWA 3VBTA 2UW5A 4TWPA 5JGAA 2H9VA 5KMIA 1NVRA 2YIRA 4APPA 4RVKA 3RM6A 3MVHA 5HD7A 1S9JA 2YDIA 2VWUA 3KXXA 1F3MC 3M42A 4U3YA 5IUGA 5L8LA 2R3PA 4ASDA 2QG7A 2VTNA 1YHWA 3V5WA 2VD5A 1PXJA 2BIYA 3ZFXA 3R7UA 4DTBA 3FAAA 2GTNA 3G9LX 2YN8A 2ZDUA 5AP2A 4D4RA 4FKSA 4CFXA 1KWPA 2UVZA 5FTQA 3ZONA 3AKJA 4M66A 3DXPA 5EG3A 2FSLX 3FQEA 3PG1A 1W82A 3HGKA 5DE2A 5CASA 4BR3A 1O6LA 5HX6A 2YIQA 2WTKC 4IQ6A 5EH0A 2B54A 3PWDA 5BUEA 4S2ZA 4FKUA 4L8MA 2O63A 4NJDA 5DG5A 3TV6A 3JVRA 4G16A 4GJ3A 4U80A 1K9AA 1BUHA 5HG7A 2CLXA 1YHVA 2XK9A 3NW6A 4OTIA 4QP4A 4UWBA 4EH5A 5HTCA 2OZOA 4BI0A 4C4FA 4FUYA 1MQBA 2GNGA 3TMOA 3TTJA 2XMYA 4OTGA 3W55A 3VRZA 4AZFA 3FSKA 4H39A 4J98A 3POZA 4AN2A 4D2VA 3GOPA 4HGTA 5TE0A 3VW8A 3FI8A 2CCHA 3OW3A 4O4CA 5HESA 4BCJA 3NUXA 4NYEA 5IQDA 2YEXA 3RWQA 3EQPA 4RFYA 3FI3A 2OO8X 3LVPA 4B0GA 2VU3A 3AMAA 4RRVA 3II5A 4TZRA 2R4BA 3KEXA 4H36A 3VJNA 3QTWA 2QO9A 4CFVA 4FZFB 5F9EA 5JFXA 2GU8A 4FV7A 1G8KA 4FGBA 3V5TA 3O2MA 3ZXZA 5IZFA 5IEVA 3EMGA 4X6RA 2BPMA 2I6LA 3CTQA 4E93A 3UIMA 3CKWA 5BMSA 4YZNA 3E88A 4KIKA 2WU6A 3DQWA 4MXAA 3R8ZA 1IASA 3DDQA 5BPYA 4F1OA 4UBAA 5IUHA 4IB1A 1PYEA 2WQNA 4RVTA 3FKNA 3UOJA 3IECA 3UDTA 4TYHA 3R1YA 5EDPA 5M4FA 4K6ZA 4QEBA 4EH2A 2WQEA 2PVMA 3I6WA 5EW9A 3P08A 2UW6A 4F4PA 2CSNA 1SVHA 4FG7A 4P2KA 3NR9A 4BGQA 1PKDA 4EOKA 5LMKA 3SA0A 2WTIA 2QCSA 4EOSA 3QX4A 2W05A 3G0EA 3MWUA 4APCA 2X4FA 3OG7A 5HBJA 5EQEA 2X0GA 2YZAA 4RIWA 4DFUA 2UZWE 3C7QA 5CU6A 3PFYA 2O0UA 2ZB1A 3NAXA 4WG3A 1UNHA 3QQLA 1L3RE 5EM6A 4I0RA 3TL8A 4U8ZA 2WMAA 4D9TA 5F4NA 3ULIA 3AD6A 3O8TA 1M7QA 1STCE 2XH5A 4YPDA 4AZEA 5FRIA 5C8KA 3C4EA 2F2UA 2JDOA 4IHPA 4BDAA 2XB7A 4Y8DA 2VWXA 4HNFA 4MH7A 2YM6A 4ZTRA 4CCUA 2VX3A 3UTOA 4DFLA 4PP9A 4XG2A 3EQDA 1H28A 3ORNA 3PPKA 3HV5A 4O27B 4AFEA 3SDJA 4D4VA 3Q5ZA 4RG0A 4QD6A 5AR2A 3UIUA 4UWCA 4TW9A 4L46A 4CFWA 2W06A 5EOLA 5J8IA 2W4KA 2WHBA 2W5HA 2WMWA 3E92A 2WNTA 4GJ2A 3LXPA 3QWJA 3QRIA 3SG8A 5HCZA 4DFNA 1SVGA 2HZ0A 1OIQA 3HX4A 4JRVA 2PZIA 3ZMMA 4O4FA 3RZBA 4UB7A 3VUGA 2VTRA 3DKFA 3H4JA 3A8WA 4GYIA 4XH6A 4AW5A 4EYJA 3IG7A 4IX5A 4OW8A 4UMQA 2OWBA 4AW1A 2YCSA 3PXKA 3KXNA 3PVUA 2V7OA 3BYVA 1TQPA 2OG8A 4E26A 2JGZA 3ZYAA 5CEMA 5KO1A 1DM2A 3W2PA 4J95A 2BTRA 2XZSA 4G5JA 4OTPA 3FXZA 5CAPA 3GQIA 5JSMA 4UZDA 4F6SA 4OR5A 4BKJA 4GFMA 3BU5A 3DBEA 3QGYA 5C8MA 3EL7A 1CKPA 3CP9A 4JQ7A 4J97A 4GU6A 3GC7A 4BTMA 4LI5A 1G3NA 4PRJA 5FLFA 2W4OA 3ZSGA 4XV9A 4DN5A 5DRBA 2WMXA 1KV1A 1SVEA 5I0BA 4L67A 3UVRA 4FV9A 4LL0A 2VTIA 5M06A 4UV0A 4ZZOA 2IEWA 3QQUA 1M2RA 2VV9A 1ZOGA 2C5OA 3T9IA 2C6LA 3LXKA 4GK4A 4I5CA 4ZK5A 5JKGA 2BAJA 1VEBA 3A2CA 2FH9A 4X2JA 3MB6A 3MIYA 1PJKA 3H9RA 3CTHA 2PHKA 1PW2A 4TPTA 1IG1A 4DHIB 3TIZA 3V04A 3CQWA 3PA3A 4G34A 2PE1A 5FXSA 5K4JA 1KSWA 1Y57A 3O7LB 4AP7A 2GNHA 2WQOA 4F9AA 3P7AA 5IA0A 2UZBA 2J4ZA 3BEAA 5AP7A 2Y7JA 3AC3A 3DT1A 1OKYA 4HVGA 1U5RA 1WBSA 1ZZLA 1W2DA 3RM7A 4FSNA 3EH9A 5HNIX 4RJ6A 4BCOA 3SLSA 5IA4A 3NVKI 4ENXA 5M4CA 3RAWA 2VTHA 4KIKB 2J50A 1CKJA 3GVUA 4LOQA 1YI6A 3RINA 4JRNA 5KZ0A 3G90X 4PDPA 4WA9A 4PQNA 5JMSA 5J5TA 3R9HA 4D2PA 1OGYA 1OPJA 2FSOX 4TYHB 5GHVA 4J53A 4UMUA 5GZAA 4WUAA 2AUHA 4FI1A 5HE0A 2PMOX 2YIXA 3IW8A 4NUSA 2IVVA 3BYOA 1REKA 4XG4A 2F49A 1FOTA 3DJ5A 5DFPA 5J1WA 1JKSA 3KA0A 5M09A 5IMEA 3SGCA 3ZTXA 4HGSA 2WMSA 3CY2A 4EWQA 5C1QB 3S4QA 3BL9A 4JQ8A 2G01A 4EOOA 2IVSA 2QONA 5L2TA 3D15A 4I3ZA 4FEXA 4QP2A 4RIWB 2X0OA 4TXCA 3DAEA 3KF4A 1IRKA 3PSCA 1E1XA 4MNFA 4WOVA 1NXKA 5E8TA 2C5NA 3R8UA 3R9OA 3IDPA 5DPVA 4FTQA 3RALA 4JIKA 5H8BA 4IE9A 4R5SA 2FSTX 2ZV2A 3R9DA 4D1ZA 3KK8A 3TJCA 4HZSA 2QVSE 4OTRA 5CAQA 1W7HA 3PIYA 1Q61A 1WBNA 1T45A 4LRKA 3RAIA 3A4OX 1Q41A 3ORIA 4HNIA 2RG5A 4WBBB 5IKWA 4IWQA 4QYHA 5HIBA 1PXPA 4OBQA 1FBNA 2ITUA 4B7TA 2RL5A 4TKSA 3CD3A 4ONAA 3BHVA 4DHZA 2R3IA 3BGZA 3H9FA 4TNDA 2BIKB 1WVYA 5CZHA 2VZ6A 5TR6A 5KHWA 2VTMA 1VJYA 1LP4A 2ONLC 4BY9E 3K3JA 5HBEA 5KMNA 4FIGA 5DEYA 3EHAA 5EOBA 5LARA 3VBVA 2OW3A 4WNMA 2IPXA 4KS8A 4I94A 1XQZA 2OFVA 1X8BA 3IOKA 4PTEA 2GQRA 3O8UA 2YDKA 5A46A 2JD5A 3U54A 1J7IA 2YCQA 4UEUA 4R7IA 1YXSA 4G1WA 4QP7A 3K5UA 4DGMA 2ITVA 3L8XA 4QYYA 3QQGA 4WNKA 3MESA 5EKOA 2Y6OA 2QC6A 3NCGA 4R3CA 5F94A 3GC9A 3L9NA 3L9PA 4EL9A 4ANOA 3VS3A 2PSQA 4LFIA 3EFJA 3ORKA 4C7TA 3ULZA 3GI3A 4ANNA 4F7SA 2BAQA 2XAOA 3EYHA 3QHWA 3HMPA 3DKGA 3UNZA 5AV0A 4O21A 3HV7A 2GSFA 1YXTA 2NRUA 4MD9E 5M51A 5J9LA 4WSYA 2ERKA 2SRCA 4PMPA 4U9AA 2E9NA 3UO5A 4AWIA 1CTPE 4EHVA 5LWNA 3F7ZA 2ZB0A 2CMWA 3CY3A 4QMLA 4FKJA 1DI9A 3WZDA 2JBOA 2R3GA 3HV3A 4KRCA 3O23A 1LUFA 4N6ZA 1Y6BA 3IPHA 4XG7A 4NKSA 3EFLA 4YTFA 3BWFA 4FT7A 5CI7A 3A60A 2GTMA 5IA2A 3LXLA 3PSDA 4QRCA 3A7IA 3PA4A 2IW9A 2CGUA 2GS7A 1W98A 2PVHA 2G15A 4O2ZA 4O96A 3N4UA 5CNNA 3NFGB 2F7EE 3T9TA 3W2QA 4D4SA 4FOCA 2JIUA 5CLPA 2QURA 2OZAA 3RNIA 2C6TA 2CPKE 3ZC5A 2GQGA 2RGPA 3BGQA 1KE8A 4JBPA 3PPZA 5EYMA 3RJCA 4N4SA 3BHYA 5B2KA 4O22A 4BGGA 3PJ8A 3HYHA 5DI1A 3NW7A 4D1SA 4LMUA 3V3VA 2WB8A 3QXOA 4YNEA 3TDVA 2BAKA 2XF0A 3D7TA 3AKKA 4L3PA 4EEVA 2YCRA 3HP5A 3HV6A 4J71A 2R3OA 5CI6A 3R02A 1GZNA 3UG1A 4FSQA 5ETFA 3ZO3A 1OBDA 4LL5A 4ZZMA 1P14A 1Y8YA 3FBVA 3HMNA 3PSBA 3ITZA 3PXYA 4BIBA 1WVXA 5KUPA 2XRUA 3H10A 5DR2A 3Q9ZA 1SMHA 4W9WA 2OH4A 2J0JA 4FIJA 1JQHA 4LUEA 2CHLA 1NVQA 3R04A 4F78A 3KMUA 4DFYA 4I24A 3PUFC 3QLGA 5E1SA 1FMOE 5AAEA 4CNHA 2QD9A 3Q9XA 4J1RA 4O1OA 3FZRA 2OH0E 3VS7A 3U6JA 4EOQA 2RFDA 4A9SA 5K9IA 1ST0A 4YC8A 2JAVA 4AOJA 2VTQA 5JH6A 4JAJA 3RAKA 5FXQA 3KRJA 3SRVA 1OKZA 4RJ5A 4U5JA 3GEQA 4DH8A 5AA9A 5BYZA 5EHLA 2UZNA 3EQGA 3BBTB 2UZVA 3BLQA 3N4VA 3PY3A 2RFNA 5EI6A 4BHZA 5E8XA 2C47A 3ORLA 2GS2A 3HA8A 4RGJA 3QCSA 5IDPA 5JZJA 3WZJA 1XMMA 2X6EA 2Y6MA 5DNRA 5HLWA 5M53A 2OF2A 3UOHA 3ZRKA 3HDMA 4YJUA 1I44A 3CD8A 3IW5A 2IG7A 1ZYCA 3V6RA 3DB6A 3HKOA 3MY1A 2PVRA 3DNDA 5TT7A 3R83A 3QC4A 2Z60A 3E87A 3SX9A 4B8MA 1FGIA 4FVQA 1YI4A 2B1PA 3MFUA 5IA5A 3ALNA 4IWDA 5I5ZA 4BCKA 4YSJA 4ZLYA 4BJJA 3L8PA 4QOXA 3EJ1A 1WBWA 1YWVA 3LXNA 4OTQA 4CV8A 3I4BA 4EOPA 4L52A 4CMUA 3QZFA 2C68A 4Z3VA 4DGNA 3VO3A 1JKTA 2XRWA 5CNOA 4O7NA 1BL6A 1UNLA 4K2RA 5E4HA 2P2IA 3UO4A 3KN6A 5JRSA 2WQBA 3JY0A 4IB0A 4M13A 1UWJA 5HZNA 3HUCA 5L2QA 3GNIB 4U44A 3LFCA 3UNJA 4NM7A 3MFSA 3FKOA 2UZDA 3MPMA 3OW4A 4GT3A 2JDRA 2PUUA 1JKLA 4FKIA 4DDIA 4IX6A 3PXFA 3FPQA 3ZCLA 4E4MA 2OGVA 4FV6A 3EIDA 3LQ5A 2PE2A 1KE7A 2XA4A 4MEDA 3VBWA 4KBKA 3WYYA 3R30A 3FZTA 1OIYA 3EB0A 4MXZA 5JN2A 5J5SA 2FA2A 5CSPA 4R3RA 5J7HA 3W0RA 4I4EA 4CEGA 3E8EA 2OZAB 3LFEA 1JWHA 4BZDA 2JKQA 2R3MA 4D2WA 1J3HA 3OBGA 2OU7A 3OCGA 2BRGA 1H1SA 3GT8A 4X7QA 2JFMA 3FL5A 5DT4A 3TEIA 3VBXA 4E7WA 3ROYA 1CSNA