3SXTD

Crystal structure of the quinol form of methylamine dehydrogenase in complex with the diferrous form of maug
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
375
structure length
375
Chain Sequence
ETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG
rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
total genus 99
structure length 375
sequence length 375
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sxtD00
3IJ0A 3MKQA 3OTTA 3I89A 2OK6A 4ERZA 3DWLC 2OK4A 2IUVA 5EAMA 5FKSA 5HQGA 5A2Qg 4FA1D 1NR0A 5CYKA 3I8CA 2IAAA 3I7NA 4L9OA 2H6KA 3SVWD 4IMMA 3MKSB 1U4CA 4J8GA 1JOFA 3K27A 4QT8A 1XKSA 3UVMA 1OLZA 2I0SA 2P9PC 3E0CA 2I3SA 3K26A 4A09A 3PVUB 4JXMA 5IGOA 3BG1A 1GP2B 3PE7A 3UVLA 2BBKH 5EM2B 4JSNC 4PNKB 2YBAA 4L3GD 3SFZA 2HESX 3OW8A 3SBRA 5C9ZB 5IJ8E 3RMZD 2HKRA 3EI3B 3VH0A 3DXMC 3J80g 2AH1A 4JSVC 2B4EA 3EWEA 3RSEC 4FB1D 3J81g 2J56H 5TDHB 3SBPA 2Z2NA 4CY5A 3NVQA 5AFU3 5C2VB 4AOWA 3UKUC 1NEXB 2QXVA 2B5NA 4A2LA 3ORVD 4FWWA 1GXRA 4A08B 3C99A 4KFMB 2PM7B 1MG2A 5FA5B 3DSMA 3W15A 2H9NA 3UKRC 4CI3A 3NVNA 4ES0A 3RLMD 4CY2A 4J77A 3JZGA 5HE1B 2H47A 1RI6A 2HJBA 2OIZA 3OKWA 4QL1A 5IJ7E 4GM8A 5CXCA 2I0TA 4R7AB 2IUPA 5IGQA 4U1EI 3OL2B 5AJAA 4K3JB 1L0QA 2P9UC 4O9DA 2I0RA 4LG8A 3SBQA 2J55H 3PXTD 4CI8A 2OVQB 4A0BA 4A2MA 4OZUA 4CZXA 4UI9R 4N14A 3JZNA 4JT6C 2AGWA 3MMYA 4PBYA 2PM9B 4GM3A 3EI2B 4JT5C 3NVXA 2I3TA 3I8EA 4H5IA 5CYKB 4GGCA 4H5JA 3F3FA 4O45A 2PBIB 5B4WA 4U7AA 3AFCA 4LGNA 5FKTA 3OL2A 2W18A 3PXWD 3GREA 4PXWA 5H1MA 4ZOXA 1SQ9A 1GG2B 2P9SC 2H6QA 2YB8B 2CE9A 2P9LC 4ZN4A 2GC7A 4HDJA 2PM9A 1A0RB 3IIYA 4FAND 3MXXA 2Z2OA 4L3HD 1QNIA 2P9KC 5TEEA 4CY1A 2BCJB 1XHMA 4MK0B 3SCYA 4A11B 4AEZA 2CO0C 2AQ5A 5HYNB 3OKYA 2AH0A 2CNXA 4GQBB 2HXCA 4I79A 3VGZA 3CFSB 5CXCB 3C75H 3RRMC 2H13A 5EALA 2XL3A 2XYIA 2H6NA 3C5MA 5K1CC 5GXHA 3F3PA 3DM0A 1FWXA 3RN0D 2CE8A 4PSWB 1N6DA 4ZOVA 3C9CA 3EMHA 4J84A 4Z8LA 4A0BB 2EBSA 4GQ1A 3PVWB 5H17A 3EI3A 3JAMg 4A08A 4GZ8A 3FM0A 4A7JA 2IWKA 4Y7RA 4O3UB 3EG6A 3I2NA 3V9FA 3SMRA 2QC5A 5FKRA 2XL2A 4JSXC 4TZ4A 3RFGA 3EI4A 5TF2A 3P4FA 5EARA 5HE2B 4A0AA 4J8BA 2CN2A 3L4MD 3I7LA 4D6VA 5SXMA 3IJCA 5EMLB 4GMBA 1TBGA 4YVDA 2B5MA 5EAPA 4ZOYA 1K32A 1MG3A 3BG0A 1U2VC 4J79A 1SHYB 4GQ2P 5EMMB 4IA9A 2MTAH 3MZLA 1S4UX 3B7FA 5EM2A 5H14A 3SLED 4ZOZA 4JD2C 4G56B 4E5ZB 3SXTD 4X61B 4XYHA 1P22A 1PEVA 1JMXB 3PSLA 5FKQA 4X63B 3V5WB 2AGXA 3I7PA 3FGBA 5IC7A 4QQEA 3I7OA 2H9PA 2XU7A 1ERJA 4A11A 1PGUA 3UVNA 1R5MA 1PI6A 3CIKB 4BH6A 4J86A 4PSXB 2B5LA 4FA4D 4FHLA 4Y5RD 3JPXA 3AL8A 4A0AB 4J82A 5HE0B 2H14A 3JB9L 4CY3A 4CZYA 5GSAA 2J57G 5KDOB 3IIWA 3SWSD 4X60B 5I5MA 2H9LA 5CXBB 4FA5D 3UVKA 3F3GA 4D0KA 2TRCB 3DXKC 4OWRA 2AGYA 3KRXB 4ERYA 2UZYB 2G9AA 2Q7QA 1Q47A 3IKOA 2HYEA 2YNOA 2HJ4A 4X3EA 3CFVA 2YNPA 5I5IA 5FXYA 2H3XA 4A09B 4NSXA 3ULEC 5FQDA 3KRWB 4ESGA 3IJ1A 5JWZA 1GOTB 3EI1A 2GC4A 2YNNA 4GGDA 4CC9A 5EMJB 5FLXg 2OVPB 2IUQA 3OKYB 4J81A 3SHFA 3JZHA 3MZKA 5HE3B 2Z2PA 3A0FA 4CI2A 4FA9D 5IT9g 2P9NC 4J78A 1MDAH 3RN1D 2IURA 2CN3A 2UZXB 1N6FA 5I5JA 1XIPA 3AH8B 4E54B 4PC0A 4CI1A 2H68A 4BL0A 3HFQA 4L1QD 2G99A 2PM6B 3EI4B 2H9MA 5GMKn 4J87A 4CZVA 3JROA 1B9YA 3U4YA 1JJUB 3BWSA 2YMUA 3N0EA 4GM9A 4JSPC 3FRXA 4J0XA 3VA6A 5THAA 1K8KC 5AMSA 4FAVD 2CO0A 3ZWLB 5TEFA 3EI2A 3N0DA 4ERQA 1B9XA 4XYIA 3EI1B 3PXSD 4LG9A 4EWRA 4O3TB 3ODTA 1TYQC 5GXIA 3AL8B 2O9KA 3UVOA 1N6EA 2P9IC 4J73A 2OVRB 3RFHA 3SJLD 2AGLA 4O1QD 3L4OD 2HKMA 3OKTA 1OMWB 3GFCA 2IWFA 4GGAA 5CXBA 1YFQA 3EU7A 5EMKB 3PSCB 1SQJA 2OJYA 3UR4A 1PBYB 3I7HA 3I7KA 4E54A 4PBZA 1JMZB 4K3ID 3AL9A 2GNQA 4QRJA 4BUJC 5C2WB 2AGZA 4E5ZA 1VYHC 4XEIC 3SN6B 4J0WA 3V7DB 3JRPA 5K19A
chains in the Genus database with same CATH superfamily
3IJ0A 3MKQA 3OTTA 2VDRA 3I89A 2OK6A 4UM8A 4ERZA 3ZE0A 1GOFA 3DWLC 3O4GA 2HU8A 1E8NA 2OK4A 4AN0A 2IUVA 3VI4A 3IUQA 5EAMA 5FKSA 5HQGA 5A2Qg 4FA1D 1NR0A 5CYKA 3I8CA 2IAAA 3I7NA 4L9OA 2H6KA 4DNWA 4IMMA 3SVWD 1A12A 3MKSB 3MUOA 1U4CA 4J8GA 1JOFA 3K27A 4QT8A 1XKSA 4Z7QA 3UVMA 1OLZA 2I0SA 2P9PC 3E0CA 2I3SA 3K26A 4A09A 5HDBA 3PVUB 4JXMA 5IGOA 1JTDB 3BG1A 4NBMA 4BP9A 1GP2B 1E5TA 3PE7A 3UVLA 2BBKH 2VZ3A 1UOOA 5EM2B 1O6GA 1L5GA 3NIDA 1E8MA 2QR5A 4JSNC 1VE7A 4PNKB 2YBAA 4L3GD 3SFZA 2HESX 3OW8A 3SBRA 5C9ZB 5IJ8E 3KCIA 3RMZD 2HKRA 3IUNA 4G55A 3EI3B 3T3PA 4DNUA 3NIGA 3DXMC 3VH0A 3J80g 1C9IA 2AH1A 3MVDK 4JSVC 2B4EA 3EWEA 3RSEC 5M5SA 4FB1D 3J81g 1VE6A 2J56H 5TDHB 4AX4A 3SBPA 2Z2NA 4CY5A 3NVQA 5AFU3 5C2VB 4AOWA 3UKUC 1NEXB 2QXVA 2B5NA 4A2LA 3ORVD 4FWWA 1GXRA 4MMXA 5FFGA 4A08B 3C99A 4KFMB 4Z7OA 2PM7B 1MG2A 5FA5B 1GOGA 3DSMA 3W15A 2H9NA 3UKRC 4CI3A 3NVNA 4ES0A 3K6SA 1H2ZA 3RLMD 2VC2A 4CY2A 4J77A 3JZGA 5HE1B 2H47A 4AMZA 1RI6A 2HJBA 2OIZA 3OKWA 4QL1A 5IJ7E 4GM8A 5CXCA 2I0TA 4R7AB 2IUPA 5IGQA 2EIBA 4O2WA 4U1EI 3OL2B 5AJAA 4K3JB 1L0QA 2P9UC 4O9DA 2I0RA 4LG8A 3SBQA 2J55H 3PXTD 4CI8A 1QFSA 2OVQB 1GOHA 2HU5A 1T2XA 4A2MA 3IVMA 4A0BA 4OZUA 4CZXA 4UI9R 4N14A 3JZNA 4JT6C 2AGWA 1QFMA 3MMYA 4PBYA 2PM9B 2HU7A 4GM3A 3EI2B 3IUMA 3V4VA 4JT5C 3EQ8A 5C92A 2XDWA 3NVXA 2I3TA 3I8EA 4H5IA 4H5JA 4GGCA 5CYKB 3O4HA 3F3FA 4O45A 2PBIB 3GD1I 4QAMA 5B4WA 4NAAA 4U7AA 3AFCA 4LGNA 5FKTA 3OL2A 2W18A 3PXWD 3GREA 4PXWA 1K3IA 5H1MA 4ZOXA 1SQ9A 1GG2B 2P9SC 2H6QA 3FCSA 3K72A 2YB8B 1I2MB 2CE9A 2P9LC 4ZN4A 2GC7A 3IJEA 4HDJA 2PM9A 1A0RB 3IIYA 4FAND 1M1XA 3MXXA 2Z2OA 4L3HD 1QNIA 2P9KC 5TEEA 4CY1A 2BCJB 1XHMA 4MK0B 3SCYA 4D9SA 4AMYA 4A11B 4AEZA 2CO0C 2AQ5A 5HYNB 3OKYA 2AH0A 2CNXA 5E6UA 4GQBB 2HXCA 4I79A 3VGZA 3CFSB 5CXCB 3C75H 3RRMC 2H13A 3GC3B 5EALA 2XL3A 2XYIA 2H6NA 3C5MA 4UM9A 5K1CC 4Z7NA 1UTCA 5GXHA 3QI0A 3F3PA 3DM0A 1FWXA 3RN0D 1TYEA 2CE8A 4PSWB 4BP8A 1N6DA 4ZOVA 3C9CA 3EMHA 4J84A 4Z8LA 4A0BB 2EBSA 4GQ1A 3PVWB 5H17A 3EI3A 3JAMg 4A08A 2QZPA 3MUNA 4GZ8A 3FM0A 4A7JA 2IWKA 4Y7RA 4O3UB 3EG6A 3I2NA 3V9FA 3SMRA 2QC5A 5FKRA 2XL2A 4JSXC 4TZ4A 3RFGA 3V4PA 3EI4A 5TF2A 3P4FA 5EARA 5HE2B 4A0AA 4J8BA 4JHPC 2CN2A 5M5RA 3ZDZA 2EICA 3L4MD 3I7LA 4D6VA 2VDMA 5SXMA 2EIDA 3IJCA 5EMLB 4GMBA 1TBGA 4YVDA 2B5MA 5EAPA 4ZOYA 1K32A 1MG3A 3BG0A 1U2VC 4J79A 1SHYB 4GQ2P 4MMYA 5EMMB 4IA9A 2MTAH 3MZLA 1S4UX 3B7FA 5EM2A 5H14A 3SLED 3OF7A 4ZOZA 4JD2C 4G56B 4E5ZB 5FFOA 4X61B 3SXTD 4XYHA 1H2YA 1H2WA 1P22A 1PEVA 1JMXB 3PSLA 5FKQA 4X63B 3V5WB 2AGXA 3T3MA 3I7PA 4O02A 2JKXA 3FGBA 5IC7A 4QQEA 3I7OA 2H9PA 2XU7A 3IULA 3IURA 1ERJA 4A11A 1PGUA 3K71A 3UVNA 1JV2A 1R5MA 1PI6A 3CIKB 3FCUA 4BH6A 4J86A 2VDNA 4PSXB 2B5LA 4FA4D 4FHLA 4WK4A 4Y5RD 3JPXA 3AL8A 1VZ2A 4MMZA 1UOQA 1VZ3A 5M61A 4A0AB 4J82A 5HE0B 2H14A 3JB9L 4CY3A 3NIFA 4CZYA 4IRZA 5GSAA 2J57G 5KDOB 3IIWA 3SWSD 4JHNA 4X60B 3O4JA 5I5MA 2H9LA 5M5TA 5CXBB 4FA5D 3UVKA 4WK2A 3F3GA 4D0KA 2TRCB 4RE6A 4BCDA 3DXKC 4NC4A 1H2XA 3DDUA 4OWRA 2AGYA 3KRXB 5E6SA 2UZYB 4ERYA 2G9AA 2Q7QA 1Q47A 3IKOA 2HYEA 2YNOA 2HJ4A 4WK0A 4WJKA 3CFVA 4X3EA 2YNPA 5I5IA 5FXYA 2H3XA 4A09B 1U8CA 4NSXA 3ULEC 5FQDA 3KRWB 4BCCA 4ESGA 2VDOA 4NENA 3IJ1A 5JWZA 1GOTB 3EI1A 2GC4A 2YNNA 4GGDA 4CC9A 2EIEA 5EMJB 5M5UA 5FLXg 2OVPB 2IUQA 3OKYB 4J81A 3SHFA 3JZHA 5M5VA 3MZKA 5HE3B 2XE4A 5E6RA 2Z2PA 3A0FA 4CI2A 4FA9D 3IUJA 5IT9g 2P9NC 4J78A 1MDAH 3RN1D 2IURA 2CN3A 2UZXB 1N6FA 5I5JA 1XIPA 3AH8B 4E54B 4PC0A 4CI1A 2H68A 4BL0A 5C86A 3HFQA 4L1QD 2G99A 2PM6B 3ZDXA 3EI4B 2H9MA 5GMKn 4J87A 4CZVA 2WQ8A 3JROA 1B9YA 3U4YA 1JJUB 3BWSA 2YMUA 3EQ7A 3N0EA 4GM9A 4JSPC 2XZGA 3FRXA 4J0XA 3VA6A 5THAA 1K8KC 5AMSA 1C9LA 4FAVD 1UOPA 1YR2A 2CO0A 3ZWLB 5TEFA 3EI2A 3N0DA 4ERQA 1B9XA 4XYIA 4L1MA 3EI1B 3PXSD 4AN1A 4LG9A 4EWRA 4O3TB 3ODTA 1TYQC 2VZ1A 4G1MA 5GXIA 3AL8B 2O9KA 3UVOA 3O4IA 4DNVA 1N6EA 2P9IC 3QHYB 2VDPA 2VDQA 4J73A 2OVRB 3RFHA 1O6FA 3SJLD 2AGLA 4O1QD 3L4OD 2HKMA 3OKTA 1OMWB 3GFCA 2IWFA 4GGAA 5CXBA 1YFQA 3EU7A 2VDLA 5EMKB 3PSCB 1SQJA 3VI3A 2OJYA 3UR4A 3ZE2A 1BPOA 1PBYB 3I7HA 3I7KA 4G1EA 4E54A 4PBZA 4BCBA 1JMZB 4K3ID 3AL9A 2GNQA 3EQ9A 4QRJA 4BUJC 5C2WB 2AGZA 4E5ZA 1VYHC 4XEIC 3SN6B 2BKLA 4J0WA 4RE5A 3V7DB 3ZDYA 3JRPA 5K19A 2VDKA 3ZE1A
chains in the Genus database with same CATH topology
3IJ0A 3MKQA 3OTTA 3I89A 2OK6A 4ERZA 3DWLC 2OK4A 2IUVA 5EAMA 5FKSA 5HQGA 5A2Qg 4FA1D 1NR0A 5CYKA 3I8CA 2IAAA 3I7NA 4L9OA 2H6KA 3SVWD 4IMMA 3MKSB 1U4CA 4J8GA 1JOFA 3K27A 4QT8A 1XKSA 3UVMA 1OLZA 2I0SA 2P9PC 3E0CA 2I3SA 3K26A 4A09A 3PVUB 4JXMA 5IGOA 3BG1A 1GP2B 3PE7A 3UVLA 2BBKH 5EM2B 4JSNC 4PNKB 2YBAA 4L3GD 3SFZA 2HESX 3OW8A 3SBRA 5C9ZB 5IJ8E 3RMZD 2HKRA 3EI3B 3VH0A 3DXMC 3J80g 2AH1A 4JSVC 2B4EA 3EWEA 3RSEC 4FB1D 3J81g 2J56H 5TDHB 3SBPA 2Z2NA 4CY5A 3NVQA 5AFU3 5C2VB 4AOWA 3UKUC 1NEXB 2QXVA 2B5NA 4A2LA 3ORVD 4FWWA 1GXRA 4A08B 3C99A 4KFMB 2PM7B 1MG2A 5FA5B 3DSMA 3W15A 2H9NA 3UKRC 4CI3A 3NVNA 4ES0A 3RLMD 4CY2A 4J77A 3JZGA 5HE1B 2H47A 1RI6A 2HJBA 2OIZA 3OKWA 4QL1A 5IJ7E 4GM8A 5CXCA 2I0TA 4R7AB 2IUPA 5IGQA 4U1EI 3OL2B 5AJAA 4K3JB 1L0QA 2P9UC 4O9DA 2I0RA 4LG8A 3SBQA 2J55H 3PXTD 4CI8A 2OVQB 4A0BA 4A2MA 4OZUA 4CZXA 4UI9R 4N14A 3JZNA 4JT6C 2AGWA 3MMYA 4PBYA 2PM9B 4GM3A 3EI2B 4JT5C 3NVXA 2I3TA 3I8EA 4H5IA 5CYKB 4GGCA 4H5JA 3F3FA 4O45A 2PBIB 5B4WA 4U7AA 3AFCA 4LGNA 5FKTA 3OL2A 2W18A 3PXWD 3GREA 4PXWA 5H1MA 4ZOXA 1SQ9A 1GG2B 2P9SC 2H6QA 2YB8B 2CE9A 2P9LC 4ZN4A 2GC7A 4HDJA 2PM9A 1A0RB 3IIYA 4FAND 3MXXA 2Z2OA 4L3HD 1QNIA 2P9KC 5TEEA 4CY1A 2BCJB 1XHMA 4MK0B 3SCYA 4A11B 4AEZA 2CO0C 2AQ5A 5HYNB 3OKYA 2AH0A 2CNXA 4GQBB 2HXCA 4I79A 3VGZA 3CFSB 5CXCB 3C75H 3RRMC 2H13A 5EALA 2XL3A 2XYIA 2H6NA 3C5MA 5K1CC 5GXHA 3F3PA 3DM0A 1FWXA 3RN0D 2CE8A 4PSWB 1N6DA 4ZOVA 3C9CA 3EMHA 4J84A 4Z8LA 4A0BB 2EBSA 4GQ1A 3PVWB 5H17A 3EI3A 3JAMg 4A08A 4GZ8A 3FM0A 4A7JA 2IWKA 4Y7RA 4O3UB 3EG6A 3I2NA 3V9FA 3SMRA 2QC5A 5FKRA 2XL2A 4JSXC 4TZ4A 3RFGA 3EI4A 5TF2A 3P4FA 5EARA 5HE2B 4A0AA 4J8BA 2CN2A 3L4MD 3I7LA 4D6VA 5SXMA 3IJCA 5EMLB 4GMBA 1TBGA 4YVDA 2B5MA 5EAPA 4ZOYA 1K32A 1MG3A 3BG0A 1U2VC 4J79A 1SHYB 4GQ2P 5EMMB 4IA9A 2MTAH 3MZLA 1S4UX 3B7FA 5EM2A 5H14A 3SLED 4ZOZA 4JD2C 4G56B 4E5ZB 3SXTD 4X61B 4XYHA 1P22A 1PEVA 1JMXB 3PSLA 5FKQA 4X63B 3V5WB 2AGXA 3I7PA 3FGBA 5IC7A 4QQEA 3I7OA 2H9PA 2XU7A 1ERJA 4A11A 1PGUA 3UVNA 1R5MA 1PI6A 3CIKB 4BH6A 4J86A 4PSXB 2B5LA 4FA4D 4FHLA 4Y5RD 3JPXA 3AL8A 4A0AB 4J82A 5HE0B 2H14A 3JB9L 4CY3A 4CZYA 5GSAA 2J57G 5KDOB 3IIWA 3SWSD 4X60B 5I5MA 2H9LA 5CXBB 4FA5D 3UVKA 3F3GA 4D0KA 2TRCB 3DXKC 4OWRA 2AGYA 3KRXB 4ERYA 2UZYB 2G9AA 2Q7QA 1Q47A 3IKOA 2HYEA 2YNOA 2HJ4A 4X3EA 3CFVA 2YNPA 5I5IA 5FXYA 2H3XA 4A09B 4NSXA 3ULEC 5FQDA 3KRWB 4ESGA 3IJ1A 5JWZA 1GOTB 3EI1A 2GC4A 2YNNA 4GGDA 4CC9A 5EMJB 5FLXg 2OVPB 2IUQA 3OKYB 4J81A 3SHFA 3JZHA 3MZKA 5HE3B 2Z2PA 3A0FA 4CI2A 4FA9D 5IT9g 2P9NC 4J78A 1MDAH 3RN1D 2IURA 2CN3A 2UZXB 1N6FA 5I5JA 1XIPA 3AH8B 4E54B 4PC0A 4CI1A 2H68A 4BL0A 3HFQA 4L1QD 2G99A 2PM6B 3EI4B 2H9MA 5GMKn 4J87A 4CZVA 3JROA 1B9YA 3U4YA 1JJUB 3BWSA 2YMUA 3N0EA 4GM9A 4JSPC 3FRXA 4J0XA 3VA6A 5THAA 1K8KC 5AMSA 4FAVD 2CO0A 3ZWLB 5TEFA 3EI2A 3N0DA 4ERQA 1B9XA 4XYIA 3EI1B 3PXSD 4LG9A 4EWRA 4O3TB 3ODTA 1TYQC 5GXIA 3AL8B 2O9KA 3UVOA 1N6EA 2P9IC 4J73A 2OVRB 3RFHA 3SJLD 2AGLA 4O1QD 3L4OD 2HKMA 3OKTA 1OMWB 3GFCA 2IWFA 4GGAA 5CXBA 1YFQA 3EU7A 5EMKB 3PSCB 1SQJA 2OJYA 3UR4A 1PBYB 3I7HA 3I7KA 4E54A 4PBZA 1JMZB 4K3ID 3AL9A 2GNQA 4QRJA 4BUJC 5C2WB 2AGZA 4E5ZA 1VYHC 4XEIC 3SN6B 4J0WA 3V7DB 3JRPA 5K19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IJ0 A;  3MKQ A;  3OTT A;  3I89 A;  2OK6 A;  4ERZ A;  3DWL C;  2OK4 A;  2IUV A;  5EAM A;  5FKS A;  5HQG A;  5A2Q g;  4FA1 D;  1NR0 A;  5CYK A;  3I8C A;  2IAA A;  3I7N A;  4L9O A;  2H6K A;  3SVW D;  4IMM A;  3MKS B;  1U4C A;  4J8G A;  1JOF A;  3K27 A;  4QT8 A;  1XKS A;  3UVM A;  1OLZ A;  2I0S A;  2P9P C;  3E0C A;  2I3S A;  3K26 A;  4A09 A;  3PVU B;  4JXM A;  5IGO A;  3BG1 A;  1GP2 B;  3PE7 A;  3UVL A;  2BBK H;  5EM2 B;  4JSN C;  4PNK B;  2YBA A;  4L3G D;  3SFZ A;  2HES X;  3OW8 A;  3SBR A;  5C9Z B;  5IJ8 E;  3RMZ D;  2HKR A;  3EI3 B;  3VH0 A;  3DXM C;  3J80 g;  2AH1 A;  4JSV C;  2B4E A;  3EWE A;  3RSE C;  4FB1 D;  3J81 g;  2J56 H;  5TDH B;  3SBP A;  2Z2N A;  4CY5 A;  3NVQ A;  5AFU 3;  5C2V B;  4AOW A;  3UKU C;  1NEX B;  2QXV A;  2B5N A;  4A2L A;  3ORV D;  4FWW A;  1GXR A;  4A08 B;  3C99 A;  4KFM B;  2PM7 B;  1MG2 A;  5FA5 B;  3DSM A;  3W15 A;  2H9N A;  3UKR C;  4CI3 A;  3NVN A;  4ES0 A;  3RLM D;  4CY2 A;  4J77 A;  3JZG A;  5HE1 B;  2H47 A;  1RI6 A;  2HJB A;  2OIZ A;  3OKW A;  4QL1 A;  5IJ7 E;  4GM8 A;  5CXC A;  2I0T A;  4R7A B;  2IUP A;  5IGQ A;  4U1E I;  3OL2 B;  5AJA A;  4K3J B;  1L0Q A;  2P9U C;  4O9D A;  2I0R A;  4LG8 A;  3SBQ A;  2J55 H;  3PXT D;  4CI8 A;  2OVQ B;  4A0B A;  4A2M A;  4OZU A;  4CZX A;  4UI9 R;  4N14 A;  3JZN A;  4JT6 C;  2AGW A;  3MMY A;  4PBY A;  2PM9 B;  4GM3 A;  3EI2 B;  4JT5 C;  3NVX A;  2I3T A;  3I8E A;  4H5I A;  5CYK B;  4GGC A;  4H5J A;  3F3F A;  4O45 A;  2PBI B;  5B4W A;  4U7A A;  3AFC A;  4LGN A;  5FKT A;  3OL2 A;  2W18 A;  3PXW D;  3GRE A;  4PXW A;  5H1M A;  4ZOX A;  1SQ9 A;  1GG2 B;  2P9S C;  2H6Q A;  2YB8 B;  2CE9 A;  2P9L C;  4ZN4 A;  2GC7 A;  4HDJ A;  2PM9 A;  1A0R B;  3IIY A;  4FAN D;  3MXX A;  2Z2O A;  4L3H D;  1QNI A;  2P9K C;  5TEE A;  4CY1 A;  2BCJ B;  1XHM A;  4MK0 B;  3SCY A;  4A11 B;  4AEZ A;  2CO0 C;  2AQ5 A;  5HYN B;  3OKY A;  2AH0 A;  2CNX A;  4GQB B;  2HXC A;  4I79 A;  3VGZ A;  3CFS B;  5CXC B;  3C75 H;  3RRM C;  2H13 A;  5EAL A;  2XL3 A;  2XYI A;  2H6N A;  3C5M A;  5K1C C;  5GXH A;  3F3P A;  3DM0 A;  1FWX A;  3RN0 D;  2CE8 A;  4PSW B;  1N6D A;  4ZOV A;  3C9C A;  3EMH A;  4J84 A;  4Z8L A;  4A0B B;  2EBS A;  4GQ1 A;  3PVW B;  5H17 A;  3EI3 A;  3JAM g;  4A08 A;  4GZ8 A;  3FM0 A;  4A7J A;  2IWK A;  4Y7R A;  4O3U B;  3EG6 A;  3I2N A;  3V9F A;  3SMR A;  2QC5 A;  5FKR A;  2XL2 A;  4JSX C;  4TZ4 A;  3RFG A;  3EI4 A;  5TF2 A;  3P4F A;  5EAR A;  5HE2 B;  4A0A A;  4J8B A;  2CN2 A;  3L4M D;  3I7L A;  4D6V A;  5SXM A;  3IJC A;  5EML B;  4GMB A;  1TBG A;  4YVD A;  2B5M A;  5EAP A;  4ZOY A;  1K32 A;  1MG3 A;  3BG0 A;  1U2V C;  4J79 A;  1SHY B;  4GQ2 P;  5EMM B;  4IA9 A;  2MTA H;  3MZL A;  1S4U X;  3B7F A;  5EM2 A;  5H14 A;  3SLE D;  4ZOZ A;  4JD2 C;  4G56 B;  4E5Z B;  3SXT D;  4X61 B;  4XYH A;  1P22 A;  1PEV A;  1JMX B;  3PSL A;  5FKQ A;  4X63 B;  3V5W B;  2AGX A;  3I7P A;  3FGB A;  5IC7 A;  4QQE A;  3I7O A;  2H9P A;  2XU7 A;  1ERJ A;  4A11 A;  1PGU A;  3UVN A;  1R5M A;  1PI6 A;  3CIK B;  4BH6 A;  4J86 A;  4PSX B;  2B5L A;  4FA4 D;  4FHL A;  4Y5R D;  3JPX A;  3AL8 A;  4A0A B;  4J82 A;  5HE0 B;  2H14 A;  3JB9 L;  4CY3 A;  4CZY A;  5GSA A;  2J57 G;  5KDO B;  3IIW A;  3SWS D;  4X60 B;  5I5M A;  2H9L A;  5CXB B;  4FA5 D;  3UVK A;  3F3G A;  4D0K A;  2TRC B;  3DXK C;  4OWR A;  2AGY A;  3KRX B;  4ERY A;  2UZY B;  2G9A A;  2Q7Q A;  1Q47 A;  3IKO A;  2HYE A;  2YNO A;  2HJ4 A;  4X3E A;  3CFV A;  2YNP A;  5I5I A;  5FXY A;  2H3X A;  4A09 B;  4NSX A;  3ULE C;  5FQD A;  3KRW B;  4ESG A;  3IJ1 A;  5JWZ A;  1GOT B;  3EI1 A;  2GC4 A;  2YNN A;  4GGD A;  4CC9 A;  5EMJ B;  5FLX g;  2OVP B;  2IUQ A;  3OKY B;  4J81 A;  3SHF A;  3JZH A;  3MZK A;  5HE3 B;  2Z2P A;  3A0F A;  4CI2 A;  4FA9 D;  5IT9 g;  2P9N C;  4J78 A;  1MDA H;  3RN1 D;  2IUR A;  2CN3 A;  2UZX B;  1N6F A;  5I5J A;  1XIP A;  3AH8 B;  4E54 B;  4PC0 A;  4CI1 A;  2H68 A;  4BL0 A;  3HFQ A;  4L1Q D;  2G99 A;  2PM6 B;  3EI4 B;  2H9M A;  5GMK n;  4J87 A;  4CZV A;  3JRO A;  1B9Y A;  3U4Y A;  1JJU B;  3BWS A;  2YMU A;  3N0E A;  4GM9 A;  4JSP C;  3FRX A;  4J0X A;  3VA6 A;  5THA A;  1K8K C;  5AMS A;  4FAV D;  2CO0 A;  3ZWL B;  5TEF A;  3EI2 A;  3N0D A;  4ERQ A;  1B9X A;  4XYI A;  3EI1 B;  3PXS D;  4LG9 A;  4EWR A;  4O3T B;  3ODT A;  1TYQ C;  5GXI A;  3AL8 B;  2O9K A;  3UVO A;  1N6E A;  2P9I C;  4J73 A;  2OVR B;  3RFH A;  3SJL D;  2AGL A;  4O1Q D;  3L4O D;  2HKM A;  3OKT A;  1OMW B;  3GFC A;  2IWF A;  4GGA A;  5CXB A;  1YFQ A;  3EU7 A;  5EMK B;  3PSC B;  1SQJ A;  2OJY A;  3UR4 A;  1PBY B;  3I7H A;  3I7K A;  4E54 A;  4PBZ A;  1JMZ B;  4K3I D;  3AL9 A;  2GNQ A;  4QRJ A;  4BUJ C;  5C2W B;  2AGZ A;  4E5Z A;  1VYH C;  4XEI C;  3SN6 B;  4J0W A;  3V7D B;  3JRP A;  5K19 A; 
#chains in the Genus database with same CATH topology
 3IJ0 A;  3MKQ A;  3OTT A;  2VDR A;  3I89 A;  2OK6 A;  4UM8 A;  4ERZ A;  3ZE0 A;  1GOF A;  3DWL C;  3O4G A;  2HU8 A;  1E8N A;  2OK4 A;  4AN0 A;  2IUV A;  3VI4 A;  3IUQ A;  5EAM A;  5FKS A;  5HQG A;  5A2Q g;  4FA1 D;  1NR0 A;  5CYK A;  3I8C A;  2IAA A;  3I7N A;  4L9O A;  2H6K A;  4DNW A;  4IMM A;  3SVW D;  1A12 A;  3MKS B;  3MUO A;  1U4C A;  4J8G A;  1JOF A;  3K27 A;  4QT8 A;  1XKS A;  4Z7Q A;  3UVM A;  1OLZ A;  2I0S A;  2P9P C;  3E0C A;  2I3S A;  3K26 A;  4A09 A;  5HDB A;  3PVU B;  4JXM A;  5IGO A;  1JTD B;  3BG1 A;  4NBM A;  4BP9 A;  1GP2 B;  1E5T A;  3PE7 A;  3UVL A;  2BBK H;  2VZ3 A;  1UOO A;  5EM2 B;  1O6G A;  1L5G A;  3NID A;  1E8M A;  2QR5 A;  4JSN C;  1VE7 A;  4PNK B;  2YBA A;  4L3G D;  3SFZ A;  2HES X;  3OW8 A;  3SBR A;  5C9Z B;  5IJ8 E;  3KCI A;  3RMZ D;  2HKR A;  3IUN A;  4G55 A;  3EI3 B;  3T3P A;  4DNU A;  3NIG A;  3DXM C;  3VH0 A;  3J80 g;  1C9I A;  2AH1 A;  3MVD K;  4JSV C;  2B4E A;  3EWE A;  3RSE C;  5M5S A;  4FB1 D;  3J81 g;  1VE6 A;  2J56 H;  5TDH B;  4AX4 A;  3SBP A;  2Z2N A;  4CY5 A;  3NVQ A;  5AFU 3;  5C2V B;  4AOW A;  3UKU C;  1NEX B;  2QXV A;  2B5N A;  4A2L A;  3ORV D;  4FWW A;  1GXR A;  4MMX A;  5FFG A;  4A08 B;  3C99 A;  4KFM B;  4Z7O A;  2PM7 B;  1MG2 A;  5FA5 B;  1GOG A;  3DSM A;  3W15 A;  2H9N A;  3UKR C;  4CI3 A;  3NVN A;  4ES0 A;  3K6S A;  1H2Z A;  3RLM D;  2VC2 A;  4CY2 A;  4J77 A;  3JZG A;  5HE1 B;  2H47 A;  4AMZ A;  1RI6 A;  2HJB A;  2OIZ A;  3OKW A;  4QL1 A;  5IJ7 E;  4GM8 A;  5CXC A;  2I0T A;  4R7A B;  2IUP A;  5IGQ A;  2EIB A;  4O2W A;  4U1E I;  3OL2 B;  5AJA A;  4K3J B;  1L0Q A;  2P9U C;  4O9D A;  2I0R A;  4LG8 A;  3SBQ A;  2J55 H;  3PXT D;  4CI8 A;  1QFS A;  2OVQ B;  1GOH A;  2HU5 A;  1T2X A;  4A2M A;  3IVM A;  4A0B A;  4OZU A;  4CZX A;  4UI9 R;  4N14 A;  3JZN A;  4JT6 C;  2AGW A;  1QFM A;  3MMY A;  4PBY A;  2PM9 B;  2HU7 A;  4GM3 A;  3EI2 B;  3IUM A;  3V4V A;  4JT5 C;  3EQ8 A;  5C92 A;  2XDW A;  3NVX A;  2I3T A;  3I8E A;  4H5I A;  4H5J A;  4GGC A;  5CYK B;  3O4H A;  3F3F A;  4O45 A;  2PBI B;  3GD1 I;  4QAM A;  5B4W A;  4NAA A;  4U7A A;  3AFC A;  4LGN A;  5FKT A;  3OL2 A;  2W18 A;  3PXW D;  3GRE A;  4PXW A;  1K3I A;  5H1M A;  4ZOX A;  1SQ9 A;  1GG2 B;  2P9S C;  2H6Q A;  3FCS A;  3K72 A;  2YB8 B;  1I2M B;  2CE9 A;  2P9L C;  4ZN4 A;  2GC7 A;  3IJE A;  4HDJ A;  2PM9 A;  1A0R B;  3IIY A;  4FAN D;  1M1X A;  3MXX A;  2Z2O A;  4L3H D;  1QNI A;  2P9K C;  5TEE A;  4CY1 A;  2BCJ B;  1XHM A;  4MK0 B;  3SCY A;  4D9S A;  4AMY A;  4A11 B;  4AEZ A;  2CO0 C;  2AQ5 A;  5HYN B;  3OKY A;  2AH0 A;  2CNX A;  5E6U A;  4GQB B;  2HXC A;  4I79 A;  3VGZ A;  3CFS B;  5CXC B;  3C75 H;  3RRM C;  2H13 A;  3GC3 B;  5EAL A;  2XL3 A;  2XYI A;  2H6N A;  3C5M A;  4UM9 A;  5K1C C;  4Z7N A;  1UTC A;  5GXH A;  3QI0 A;  3F3P A;  3DM0 A;  1FWX A;  3RN0 D;  1TYE A;  2CE8 A;  4PSW B;  4BP8 A;  1N6D A;  4ZOV A;  3C9C A;  3EMH A;  4J84 A;  4Z8L A;  4A0B B;  2EBS A;  4GQ1 A;  3PVW B;  5H17 A;  3EI3 A;  3JAM g;  4A08 A;  2QZP A;  3MUN A;  4GZ8 A;  3FM0 A;  4A7J A;  2IWK A;  4Y7R A;  4O3U B;  3EG6 A;  3I2N A;  3V9F A;  3SMR A;  2QC5 A;  5FKR A;  2XL2 A;  4JSX C;  4TZ4 A;  3RFG A;  3V4P A;  3EI4 A;  5TF2 A;  3P4F A;  5EAR A;  5HE2 B;  4A0A A;  4J8B A;  4JHP C;  2CN2 A;  5M5R A;  3ZDZ A;  2EIC A;  3L4M D;  3I7L A;  4D6V A;  2VDM A;  5SXM A;  2EID A;  3IJC A;  5EML B;  4GMB A;  1TBG A;  4YVD A;  2B5M A;  5EAP A;  4ZOY A;  1K32 A;  1MG3 A;  3BG0 A;  1U2V C;  4J79 A;  1SHY B;  4GQ2 P;  4MMY A;  5EMM B;  4IA9 A;  2MTA H;  3MZL A;  1S4U X;  3B7F A;  5EM2 A;  5H14 A;  3SLE D;  3OF7 A;  4ZOZ A;  4JD2 C;  4G56 B;  4E5Z B;  5FFO A;  4X61 B;  3SXT D;  4XYH A;  1H2Y A;  1H2W A;  1P22 A;  1PEV A;  1JMX B;  3PSL A;  5FKQ A;  4X63 B;  3V5W B;  2AGX A;  3T3M A;  3I7P A;  4O02 A;  2JKX A;  3FGB A;  5IC7 A;  4QQE A;  3I7O A;  2H9P A;  2XU7 A;  3IUL A;  3IUR A;  1ERJ A;  4A11 A;  1PGU A;  3K71 A;  3UVN A;  1JV2 A;  1R5M A;  1PI6 A;  3CIK B;  3FCU A;  4BH6 A;  4J86 A;  2VDN A;  4PSX B;  2B5L A;  4FA4 D;  4FHL A;  4WK4 A;  4Y5R D;  3JPX A;  3AL8 A;  1VZ2 A;  4MMZ A;  1UOQ A;  1VZ3 A;  5M61 A;  4A0A B;  4J82 A;  5HE0 B;  2H14 A;  3JB9 L;  4CY3 A;  3NIF A;  4CZY A;  4IRZ A;  5GSA A;  2J57 G;  5KDO B;  3IIW A;  3SWS D;  4JHN A;  4X60 B;  3O4J A;  5I5M A;  2H9L A;  5M5T A;  5CXB B;  4FA5 D;  3UVK A;  4WK2 A;  3F3G A;  4D0K A;  2TRC B;  4RE6 A;  4BCD A;  3DXK C;  4NC4 A;  1H2X A;  3DDU A;  4OWR A;  2AGY A;  3KRX B;  5E6S A;  2UZY B;  4ERY A;  2G9A A;  2Q7Q A;  1Q47 A;  3IKO A;  2HYE A;  2YNO A;  2HJ4 A;  4WK0 A;  4WJK A;  3CFV A;  4X3E A;  2YNP A;  5I5I A;  5FXY A;  2H3X A;  4A09 B;  1U8C A;  4NSX A;  3ULE C;  5FQD A;  3KRW B;  4BCC A;  4ESG A;  2VDO A;  4NEN A;  3IJ1 A;  5JWZ A;  1GOT B;  3EI1 A;  2GC4 A;  2YNN A;  4GGD A;  4CC9 A;  2EIE A;  5EMJ B;  5M5U A;  5FLX g;  2OVP B;  2IUQ A;  3OKY B;  4J81 A;  3SHF A;  3JZH A;  5M5V A;  3MZK A;  5HE3 B;  2XE4 A;  5E6R A;  2Z2P A;  3A0F A;  4CI2 A;  4FA9 D;  3IUJ A;  5IT9 g;  2P9N C;  4J78 A;  1MDA H;  3RN1 D;  2IUR A;  2CN3 A;  2UZX B;  1N6F A;  5I5J A;  1XIP A;  3AH8 B;  4E54 B;  4PC0 A;  4CI1 A;  2H68 A;  4BL0 A;  5C86 A;  3HFQ A;  4L1Q D;  2G99 A;  2PM6 B;  3ZDX A;  3EI4 B;  2H9M A;  5GMK n;  4J87 A;  4CZV A;  2WQ8 A;  3JRO A;  1B9Y A;  3U4Y A;  1JJU B;  3BWS A;  2YMU A;  3EQ7 A;  3N0E A;  4GM9 A;  4JSP C;  2XZG A;  3FRX A;  4J0X A;  3VA6 A;  5THA A;  1K8K C;  5AMS A;  1C9L A;  4FAV D;  1UOP A;  1YR2 A;  2CO0 A;  3ZWL B;  5TEF A;  3EI2 A;  3N0D A;  4ERQ A;  1B9X A;  4XYI A;  4L1M A;  3EI1 B;  3PXS D;  4AN1 A;  4LG9 A;  4EWR A;  4O3T B;  3ODT A;  1TYQ C;  2VZ1 A;  4G1M A;  5GXI A;  3AL8 B;  2O9K A;  3UVO A;  3O4I A;  4DNV A;  1N6E A;  2P9I C;  3QHY B;  2VDP A;  2VDQ A;  4J73 A;  2OVR B;  3RFH A;  1O6F A;  3SJL D;  2AGL A;  4O1Q D;  3L4O D;  2HKM A;  3OKT A;  1OMW B;  3GFC A;  2IWF A;  4GGA A;  5CXB A;  1YFQ A;  3EU7 A;  2VDL A;  5EMK B;  3PSC B;  1SQJ A;  3VI3 A;  2OJY A;  3UR4 A;  3ZE2 A;  1BPO A;  1PBY B;  3I7H A;  3I7K A;  4G1E A;  4E54 A;  4PBZ A;  4BCB A;  1JMZ B;  4K3I D;  3AL9 A;  2GNQ A;  3EQ9 A;  4QRJ A;  4BUJ C;  5C2W B;  2AGZ A;  4E5Z A;  1VYH C;  4XEI C;  3SN6 B;  2BKL A;  4J0W A;  4RE5 A;  3V7D B;  3ZDY A;  3JRP A;  5K19 A;  2VDK A;  3ZE1 A; 
#chains in the Genus database with same CATH homology
 3IJ0 A;  3MKQ A;  3OTT A;  3I89 A;  2OK6 A;  4ERZ A;  3DWL C;  2OK4 A;  2IUV A;  5EAM A;  5FKS A;  5HQG A;  5A2Q g;  4FA1 D;  1NR0 A;  5CYK A;  3I8C A;  2IAA A;  3I7N A;  4L9O A;  2H6K A;  3SVW D;  4IMM A;  3MKS B;  1U4C A;  4J8G A;  1JOF A;  3K27 A;  4QT8 A;  1XKS A;  3UVM A;  1OLZ A;  2I0S A;  2P9P C;  3E0C A;  2I3S A;  3K26 A;  4A09 A;  3PVU B;  4JXM A;  5IGO A;  3BG1 A;  1GP2 B;  3PE7 A;  3UVL A;  2BBK H;  5EM2 B;  4JSN C;  4PNK B;  2YBA A;  4L3G D;  3SFZ A;  2HES X;  3OW8 A;  3SBR A;  5C9Z B;  5IJ8 E;  3RMZ D;  2HKR A;  3EI3 B;  3VH0 A;  3DXM C;  3J80 g;  2AH1 A;  4JSV C;  2B4E A;  3EWE A;  3RSE C;  4FB1 D;  3J81 g;  2J56 H;  5TDH B;  3SBP A;  2Z2N A;  4CY5 A;  3NVQ A;  5AFU 3;  5C2V B;  4AOW A;  3UKU C;  1NEX B;  2QXV A;  2B5N A;  4A2L A;  3ORV D;  4FWW A;  1GXR A;  4A08 B;  3C99 A;  4KFM B;  2PM7 B;  1MG2 A;  5FA5 B;  3DSM A;  3W15 A;  2H9N A;  3UKR C;  4CI3 A;  3NVN A;  4ES0 A;  3RLM D;  4CY2 A;  4J77 A;  3JZG A;  5HE1 B;  2H47 A;  1RI6 A;  2HJB A;  2OIZ A;  3OKW A;  4QL1 A;  5IJ7 E;  4GM8 A;  5CXC A;  2I0T A;  4R7A B;  2IUP A;  5IGQ A;  4U1E I;  3OL2 B;  5AJA A;  4K3J B;  1L0Q A;  2P9U C;  4O9D A;  2I0R A;  4LG8 A;  3SBQ A;  2J55 H;  3PXT D;  4CI8 A;  2OVQ B;  4A0B A;  4A2M A;  4OZU A;  4CZX A;  4UI9 R;  4N14 A;  3JZN A;  4JT6 C;  2AGW A;  3MMY A;  4PBY A;  2PM9 B;  4GM3 A;  3EI2 B;  4JT5 C;  3NVX A;  2I3T A;  3I8E A;  4H5I A;  5CYK B;  4GGC A;  4H5J A;  3F3F A;  4O45 A;  2PBI B;  5B4W A;  4U7A A;  3AFC A;  4LGN A;  5FKT A;  3OL2 A;  2W18 A;  3PXW D;  3GRE A;  4PXW A;  5H1M A;  4ZOX A;  1SQ9 A;  1GG2 B;  2P9S C;  2H6Q A;  2YB8 B;  2CE9 A;  2P9L C;  4ZN4 A;  2GC7 A;  4HDJ A;  2PM9 A;  1A0R B;  3IIY A;  4FAN D;  3MXX A;  2Z2O A;  4L3H D;  1QNI A;  2P9K C;  5TEE A;  4CY1 A;  2BCJ B;  1XHM A;  4MK0 B;  3SCY A;  4A11 B;  4AEZ A;  2CO0 C;  2AQ5 A;  5HYN B;  3OKY A;  2AH0 A;  2CNX A;  4GQB B;  2HXC A;  4I79 A;  3VGZ A;  3CFS B;  5CXC B;  3C75 H;  3RRM C;  2H13 A;  5EAL A;  2XL3 A;  2XYI A;  2H6N A;  3C5M A;  5K1C C;  5GXH A;  3F3P A;  3DM0 A;  1FWX A;  3RN0 D;  2CE8 A;  4PSW B;  1N6D A;  4ZOV A;  3C9C A;  3EMH A;  4J84 A;  4Z8L A;  4A0B B;  2EBS A;  4GQ1 A;  3PVW B;  5H17 A;  3EI3 A;  3JAM g;  4A08 A;  4GZ8 A;  3FM0 A;  4A7J A;  2IWK A;  4Y7R A;  4O3U B;  3EG6 A;  3I2N A;  3V9F A;  3SMR A;  2QC5 A;  5FKR A;  2XL2 A;  4JSX C;  4TZ4 A;  3RFG A;  3EI4 A;  5TF2 A;  3P4F A;  5EAR A;  5HE2 B;  4A0A A;  4J8B A;  2CN2 A;  3L4M D;  3I7L A;  4D6V A;  5SXM A;  3IJC A;  5EML B;  4GMB A;  1TBG A;  4YVD A;  2B5M A;  5EAP A;  4ZOY A;  1K32 A;  1MG3 A;  3BG0 A;  1U2V C;  4J79 A;  1SHY B;  4GQ2 P;  5EMM B;  4IA9 A;  2MTA H;  3MZL A;  1S4U X;  3B7F A;  5EM2 A;  5H14 A;  3SLE D;  4ZOZ A;  4JD2 C;  4G56 B;  4E5Z B;  3SXT D;  4X61 B;  4XYH A;  1P22 A;  1PEV A;  1JMX B;  3PSL A;  5FKQ A;  4X63 B;  3V5W B;  2AGX A;  3I7P A;  3FGB A;  5IC7 A;  4QQE A;  3I7O A;  2H9P A;  2XU7 A;  1ERJ A;  4A11 A;  1PGU A;  3UVN A;  1R5M A;  1PI6 A;  3CIK B;  4BH6 A;  4J86 A;  4PSX B;  2B5L A;  4FA4 D;  4FHL A;  4Y5R D;  3JPX A;  3AL8 A;  4A0A B;  4J82 A;  5HE0 B;  2H14 A;  3JB9 L;  4CY3 A;  4CZY A;  5GSA A;  2J57 G;  5KDO B;  3IIW A;  3SWS D;  4X60 B;  5I5M A;  2H9L A;  5CXB B;  4FA5 D;  3UVK A;  3F3G A;  4D0K A;  2TRC B;  3DXK C;  4OWR A;  2AGY A;  3KRX B;  4ERY A;  2UZY B;  2G9A A;  2Q7Q A;  1Q47 A;  3IKO A;  2HYE A;  2YNO A;  2HJ4 A;  4X3E A;  3CFV A;  2YNP A;  5I5I A;  5FXY A;  2H3X A;  4A09 B;  4NSX A;  3ULE C;  5FQD A;  3KRW B;  4ESG A;  3IJ1 A;  5JWZ A;  1GOT B;  3EI1 A;  2GC4 A;  2YNN A;  4GGD A;  4CC9 A;  5EMJ B;  5FLX g;  2OVP B;  2IUQ A;  3OKY B;  4J81 A;  3SHF A;  3JZH A;  3MZK A;  5HE3 B;  2Z2P A;  3A0F A;  4CI2 A;  4FA9 D;  5IT9 g;  2P9N C;  4J78 A;  1MDA H;  3RN1 D;  2IUR A;  2CN3 A;  2UZX B;  1N6F A;  5I5J A;  1XIP A;  3AH8 B;  4E54 B;  4PC0 A;  4CI1 A;  2H68 A;  4BL0 A;  3HFQ A;  4L1Q D;  2G99 A;  2PM6 B;  3EI4 B;  2H9M A;  5GMK n;  4J87 A;  4CZV A;  3JRO A;  1B9Y A;  3U4Y A;  1JJU B;  3BWS A;  2YMU A;  3N0E A;  4GM9 A;  4JSP C;  3FRX A;  4J0X A;  3VA6 A;  5THA A;  1K8K C;  5AMS A;  4FAV D;  2CO0 A;  3ZWL B;  5TEF A;  3EI2 A;  3N0D A;  4ERQ A;  1B9X A;  4XYI A;  3EI1 B;  3PXS D;  4LG9 A;  4EWR A;  4O3T B;  3ODT A;  1TYQ C;  5GXI A;  3AL8 B;  2O9K A;  3UVO A;  1N6E A;  2P9I C;  4J73 A;  2OVR B;  3RFH A;  3SJL D;  2AGL A;  4O1Q D;  3L4O D;  2HKM A;  3OKT A;  1OMW B;  3GFC A;  2IWF A;  4GGA A;  5CXB A;  1YFQ A;  3EU7 A;  5EMK B;  3PSC B;  1SQJ A;  2OJY A;  3UR4 A;  1PBY B;  3I7H A;  3I7K A;  4E54 A;  4PBZ A;  1JMZ B;  4K3I D;  3AL9 A;  2GNQ A;  4QRJ A;  4BUJ C;  5C2W B;  2AGZ A;  4E5Z A;  1VYH C;  4XEI C;  3SN6 B;  4J0W A;  3V7D B;  3JRP A;  5K19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...