3SXTD

Crystal structure of the quinol form of methylamine dehydrogenase in complex with the diferrous form of maug
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
375
structure length
375
Chain Sequence
b'ETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG
rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 99
structure length 375
sequence length 375
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sxtD00
5I5IA 2CE8A 3SN6B 3DXKC 3IKOA 1XKSA 4D6VA 3UKRC 5A2Qg 4LGNA 3EI4B 3I8EA 4FWWA 3L4MD 5TF2A 1PI6A 4CI3A 3GFCA 5EAMA 3PSCB 1SQ9A 3SHFA 2HESX 5K1CC 4A2LA 4J79A 3KRWB 3V5WB 3SXTD 5GMKn 1MG2A 3SJLD 3EWEA 4MK0B 5FKSA 4N14A 3SFZA 2Q7QA 3V9FA 2W18A 2P9KC 2J55H 3CFVA 3UVKA 4CY5A 5AMSA 4A0BB 5C9ZB 1PBYB 4A2MA 4PC0A 5HE3B 5B4WA 1YFQA 1TYQC 1R5MA 2H9NA 4ESGA 2P9UC 4FAND 4GQ1A 4BL0A 2CN2A 4FB1D 3SVWD 3RMZD 2IUPA 5I5MA 2XU7A 5HE2B 4GM3A 5FQDA 4BH6A 3K27A 4JT6C 5EMLB 1NR0A 2XL3A 5AFU3 5JWZA 2GC4A 2CO0C 1GOTB 3EI1B 3OL2B 5TEFA 5EM2B 5THAA 4J73A 2HYEA 4ZN4A 2IUQA 5IGQA 4A08B 2HKMA 4CY3A 4PBYA 4CI2A 2HJBA 3DM0A 4ZOXA 4FA9D 3OKTA 2AH1A 4CI1A 3UVNA 4J81A 3C9CA 4PSXB 4GM9A 2I3TA 2OVPB 2YNOA 3FRXA 3PSLA 2I0TA 4NSXA 5EAPA 1RI6A 4A0BA 3IIWA 3SMRA 1A0RB 4O3UB 4O9DA 3SLED 2AGLA 3OTTA 2H13A 4EWRA 4A09B 3VH0A 2P9IC 2HKRA 5EALA 3P4FA 3F3PA 3DXMC 1PGUA 3JRPA 5IJ7E 3PVUB 1QNIA 2TRCB 4A11B 3GREA 3AL8B 1NEXB 4J86A 2AGYA 2H6KA 2H14A 1MDAH 3ODTA 1PEVA 3PXWD 4FAVD 3MXXA 3EI1A 3OL2A 4QL1A 2BBKH 3VA6A 2G9AA 5EM2A 4ZOZA 2I0RA 4A08A 5HE1B 4JXMA 3V7DB 4XYIA 4CZVA 2AGZA 2P9NC 2G99A 3KRXB 3AL9A 3I7LA 3N0EA 4X61B 5CYKB 4XYHA 2O9KA 5AJAA 2B5NA 4GM8A 2B5LA 3RFHA 5IJ8E 3EI2B 3I7PA 2H9MA 4QRJA 1VYHC 3PXSD 4QQEA 5FKTA 2XL2A 3F3FA 3IJ0A 3UR4A 2BCJB 4XEIC 2Z2NA 5H17A 5HQGA 1B9YA 4U1EI 3FM0A 1XIPA 2IWFA 3EU7A 5EMJB 2Z2OA 4A09A 3PXTD 3JZNA 4CY2A 4U7AA 2AGWA 2YNPA 4GQBB 2AQ5A 4A0AA 2YBAA 5C2VB 3RSEC 1U4CA 4OWRA 4A11A 3AL8A 1OMWB 3EMHA 3L4OD 3I7OA 2H9PA 4FA5D 4G56B 4J77A 3EI4A 3J81g 3N0DA 4H5JA 4JSNC 4KFMB 4E54B 4ERZA 3EI3B 2CNXA 3JB9L 5FKRA 2CN3A 5IC7A 3PE7A 1MG3A 5IGOA 3FGBA 4O45A 2H6NA 4Z8LA 4IMMA 3CIKB 3VGZA 3OKYB 5CXCB 5CXBB 2YNNA 1FWXA 5GXIA 5CYKA 3RN0D 4A7JA 3SWSD 4GZ8A 3NVQA 3DSMA 3C5MA 4CC9A 3EI2A 4ERYA 5FXYA 1GP2B 3RRMC 3I7NA 4PBZA 1K8KC 3J80g 3UVLA 3JROA 4O3TB 1P22A 4ERQA 4GGCA 5FKQA 5HYNB 3C99A 2UZXB 3RFGA 2CO0A 1JMZB 3UVMA 4ZOVA 3SBQA 1U2VC 2IURA 3ORVD 4Y5RD 4PNKB 4J87A 4J84A 4AEZA 4YVDA 3SBPA 5IT9g 2J57G 1N6EA 4BUJC 4GGDA 3I8CA 2H3XA 5GXHA 3JZHA 4PSWB 2HXCA 1OLZA 2I0SA 2QC5A 3ZWLB 4L9OA 4E54A 3EI3A 4AOWA 3E0CA 3BWSA 3BG0A 5KDOB 3DWLC 3EG6A 3OW8A 2UZYB 4X63B 2I3SA 2Z2PA 3I7HA 3OKYA 4I79A 5CXCA 5CXBA 5EARA 2H68A 3SCYA 1N6DA 3UKUC 3IJ1A 3RLMD 5K19A 4CZXA 4PXWA 3A0FA 1TBGA 3B7FA 4UI9R 1SHYB 4J8BA 2B4EA 4Y7RA 3I7KA 4E5ZB 4J0XA 1Q47A 4QT8A 4ES0A 2QXVA 3I2NA 3HFQA 3IIYA 3MKSB 4FA1D 2B5MA 5SXMA 2OK6A 1GG2B 4HDJA 3AH8B 2OK4A 1ERJA 4J78A 2IAAA 1SQJA 2PM9B 2OVRB 3C75H 3MZKA 3RN1D 3NVNA 1S4UX 2IWKA 4LG8A 1XHMA 3MMYA 3K26A 4LG9A 2P9SC 4GGAA 1JMXB 4J82A 4D0KA 1JJUB 4FHLA 2GC7A 3NVXA 3ULEC 3UVOA 2J56H 4GQ2P 2P9LC 4CY1A 2AGXA 5H1MA 4L3GD 3CFSB 5GSAA 1N6FA 3W15A 4JD2C 4J0WA 3JAMg 2PBIB 4FA4D 4TZ4A 5TDHB 2EBSA 2OJYA 5H14A 3MZLA 4ZOYA 2XYIA 3I89A 4L1QD 4GMBA 4R7AB 2H47A 2PM6B 4E5ZA 3JPXA 3BG1A 4X60B 5FA5B 2MTAH 4H5IA 2AH0A 3MKQA 3F3GA 5FLXg 3JZGA 4JT5C 4K3ID 5TEEA 5EMMB 3SBRA 5C2WB 4JSPC 2YB8B 3OKWA 4JSVC 2HJ4A 4L3HD 4OZUA 4X3EA 4O1QD 4JSXC 1JOFA 2PM9A 2OIZA 4IA9A 2P9PC 4K3JB 2H6QA 4CI8A 3U4YA 2GNQA 3AFCA 5EMKB 4J8GA 2PM7B 2H9LA 5I5JA 1K32A 3IJCA 2OVQB 5HE0B 1B9XA 4CZYA 3PVWB 1GXRA 2CE9A 1L0QA 4A0AB 2IUVA 2YMUA
chains in the Genus database with same CATH superfamily
5I5IA 4Z7QA 2CE8A 3SN6B 3DXKC 5C86A 3V4PA 4DNWA 4UM8A 3IKOA 1XKSA 4D6VA 3UKRC 5A2Qg 4LGNA 2QR5A 3EI4B 3I8EA 4FWWA 4BCBA 3L4MD 5TF2A 1PI6A 3K6SA 4CI3A 3GFCA 5EAMA 3PSCB 1SQ9A 3SHFA 2HESX 5K1CC 4MMZA 4A2LA 3NIDA 4J79A 3GD1I 3KRWB 3V5WB 3SXTD 5GMKn 1MG2A 3SJLD 4G1EA 1UOQA 3EWEA 2EIBA 1E8NA 4MK0B 5FKSA 4N14A 3SFZA 2Q7QA 3V9FA 2W18A 2VDPA 2P9KC 2J55H 3CFVA 3UVKA 3MVDK 4CY5A 5AMSA 4A0BB 5E6RA 5C9ZB 1PBYB 4A2MA 4PC0A 3FCSA 3O4JA 5HE3B 5B4WA 5FFGA 4Z7NA 1YFQA 1TYQC 2VDKA 1R5MA 3OF7A 4MMXA 2H9NA 2EICA 2P9UC 4WK0A 4GQ1A 4ESGA 4FAND 4BL0A 2CN2A 4FB1D 1VE7A 3RMZD 2IUPA 3SVWD 5I5MA 2XU7A 4MMYA 5HE2B 3FCUA 4GM3A 5FQDA 1L5GA 4BH6A 3K27A 2WQ8A 4JT6C 5EMLB 1NR0A 2XL3A 5AFU3 5JWZA 5E6SA 2GC4A 2CO0C 1GOTB 3EI1B 3OL2B 3VI4A 5TEFA 4Z7OA 5EM2B 5THAA 4J73A 4JHPC 2HYEA 4ZN4A 2IUQA 5IGQA 3T3PA 2HKMA 4A08B 4CY3A 4PBYA 3K71A 4CI2A 4WJKA 4NC4A 2HJBA 3DM0A 4ZOXA 1O6GA 3OKTA 4FA9D 2AH1A 4AX4A 4CI1A 3UVNA 3C9CA 4J81A 4PSXB 4GM9A 4DNVA 2I3TA 2OVPB 2YNOA 3FRXA 1TYEA 3PSLA 2XZGA 2I0TA 4NSXA 1UOPA 3GC3B 2HU8A 5EAPA 1RI6A 4A0BA 3IIWA 3SMRA 4AMZA 1A0RB 3EQ8A 4O3UB 4O9DA 3SLED 2AGLA 2QZPA 3OTTA 2H13A 2VDRA 4O2WA 1T2XA 3IUJA 4EWRA 1K3IA 3VH0A 2P9IC 4A09B 2HKRA 5EALA 2XE4A 3P4FA 4BCCA 3F3PA 3VI3A 4NAAA 3DXMC 1PGUA 3JRPA 4G1MA 3MUOA 5IJ7E 3PVUB 1QNIA 2TRCB 3IURA 4A11B 3GREA 2VDQA 3AL8B 1NEXB 4J86A 2AGYA 2H6KA 2H14A 1MDAH 3ODTA 1PEVA 3PXWD 4FAVD 3MXXA 1VZ3A 3MUNA 3EI1A 3OL2A 4QL1A 2BBKH 3T3MA 3VA6A 2G9AA 5EM2A 4ZOZA 2I0RA 3EQ7A 4G55A 4A08A 5HE1B 4JXMA 3KCIA 3V7DB 4XYIA 4CZVA 2AGZA 2P9NC 2HU5A 2G99A 3KRXB 3AL9A 3I7LA 3N0EA 4X61B 5CYKB 1QFMA 4XYHA 2O9KA 5AJAA 2B5NA 4GM8A 2B5LA 3RFHA 5IJ8E 3EI2B 3I7PA 1E5TA 2H9MA 4QRJA 4WK4A 1VYHC 3PXSD 4QQEA 5FKTA 2XL2A 3F3FA 3IJ0A 3O4GA 3UR4A 2BCJB 4XEIC 2Z2NA 5H17A 5HQGA 1B9YA 4U1EI 3FM0A 1XIPA 2IWFA 3EU7A 5EMJB 2Z2OA 4A09A 3PXTD 3JZNA 4CY2A 4U7AA 3NIGA 1QFSA 2AGWA 2YNPA 4GQBB 2AQ5A 3K72A 4A0AA 2YBAA 2VC2A 5C2VB 3RSEC 1U4CA 2EIEA 4OWRA 4A11A 3AL8A 1OMWB 3EMHA 3L4OD 3I7OA 2H9PA 4FA5D 4G56B 1A12A 4J77A 5M5VA 3EI4A 3J81g 3N0DA 1O6FA 4H5JA 4JSNC 4KFMB 4E54B 4ERZA 3EI3B 1JV2A 2CNXA 3JB9L 2VZ1A 4AMYA 5FKRA 2CN3A 5M5UA 5IC7A 3PE7A 1MG3A 5IGOA 3FGBA 4O45A 2H6NA 1M1XA 4RE5A 4Z8LA 4IMMA 3CIKB 3VGZA 2XDWA 3OKYB 5CXCB 5CXBB 2YNNA 1U8CA 1FWXA 2EIDA 3O4IA 5GXIA 5CYKA 3RN0D 4A7JA 3SWSD 4GZ8A 1C9LA 3NVQA 3DSMA 3C5MA 3ZDXA 4CC9A 3EI2A 4ERYA 3NIFA 5FFOA 1JTDB 5FXYA 1GP2B 3RRMC 3I7NA 4PBZA 1K8KC 3J80g 5M5TA 3UVLA 3JROA 1YR2A 4O3TB 1P22A 4ERQA 4GGCA 3IUMA 3O4HA 5FKQA 5HYNB 3C99A 4L1MA 4NENA 2UZXB 3RFGA 2CO0A 1JMZB 3UVMA 4ZOVA 3SBQA 1U2VC 3ZE0A 3EQ9A 4D9SA 2IURA 3ORVD 2HU7A 4Y5RD 4PNKB 4J87A 4J84A 3ZE2A 5HDBA 4AEZA 4YVDA 1GOFA 3SBPA 5IT9g 2J57G 1N6EA 3IVMA 4BUJC 1H2WA 4GGDA 1I2MB 3I8CA 2H3XA 5GXHA 2VDOA 3JZHA 4PSWB 3ZDZA 1H2YA 2HXCA 1OLZA 2I0SA 2VDMA 2QC5A 3ZWLB 4L9OA 4E54A 3EI3A 4AOWA 3E0CA 4NBMA 3BWSA 1UOOA 3BG0A 4AN0A 5KDOB 3DWLC 3EG6A 3OW8A 2UZYB 4X63B 3ZDYA 2JKXA 5M5SA 2I3SA 2Z2PA 3I7HA 3OKYA 4I79A 5CXCA 5CXBA 5EARA 4DNUA 2H68A 3SCYA 1N6DA 3UKUC 3IJ1A 3RLMD 5K19A 4CZXA 4PXWA 3B7FA 1TBGA 1BPOA 3A0FA 4UI9R 1SHYB 4J8BA 2B4EA 4Y7RA 3I7KA 4E5ZB 4J0XA 3ZE1A 1E8MA 1Q47A 4QT8A 4ES0A 4WK2A 4O02A 2QXVA 3I2NA 3HFQA 3IIYA 3MKSB 4FA1D 2B5MA 1VE6A 5SXMA 2OK6A 1GG2B 4HDJA 3AH8B 2OK4A 1ERJA 4J78A 2IAAA 1SQJA 2PM9B 2OVRB 3C75H 3MZKA 3RN1D 3NVNA 1S4UX 3QI0A 2IWKA 4LG8A 3QHYB 1XHMA 4UM9A 3MMYA 3K26A 4LG9A 2P9SC 4GGAA 1JMXB 4J82A 4D0KA 3IUQA 1JJUB 4FHLA 2GC7A 3NVXA 1C9IA 4QAMA 2J56H 3ULEC 3UVOA 4GQ2P 2P9LC 4CY1A 1GOHA 2AGXA 5H1MA 4L3GD 3CFSB 5M5RA 2VDLA 5GSAA 1UTCA 3IUNA 1N6FA 4JHNA 4JD2C 3W15A 3IJEA 4J0WA 4BP9A 3JAMg 1H2ZA 2PBIB 4FA4D 4TZ4A 5TDHB 2EBSA 2OJYA 1GOGA 5H14A 5C92A 3MZLA 4IRZA 2XYIA 4ZOYA 3I89A 4L1QD 4GMBA 4R7AB 2H47A 4BP8A 2PM6B 4E5ZA 3JPXA 3BG1A 4X60B 5FA5B 2MTAH 4H5IA 2AH0A 3MKQA 3V4VA 3F3GA 5FLXg 3JZGA 4JT5C 4K3ID 5TEEA 5EMMB 3SBRA 4RE6A 5C2WB 3IULA 4JSPC 2YB8B 3OKWA 4JSVC 2HJ4A 4L3HD 2VZ3A 4OZUA 4X3EA 4O1QD 1VZ2A 4JSXC 1JOFA 2PM9A 2OIZA 4IA9A 2P9PC 4K3JB 2H6QA 5E6UA 4CI8A 4BCDA 3U4YA 2GNQA 3DDUA 3AFCA 5EMKB 4J8GA 2BKLA 2PM7B 2H9LA 5I5JA 1K32A 3IJCA 2OVQB 5HE0B 2VDNA 1B9XA 1H2XA 4CZYA 3PVWB 1GXRA 5M61A 4AN1A 2CE9A 1L0QA 4A0AB 2IUVA 2YMUA
chains in the Genus database with same CATH topology
5I5IA 2CE8A 3SN6B 3DXKC 3IKOA 1XKSA 4D6VA 3UKRC 5A2Qg 4LGNA 3EI4B 3I8EA 4FWWA 3L4MD 5TF2A 1PI6A 4CI3A 3GFCA 5EAMA 3PSCB 1SQ9A 3SHFA 2HESX 5K1CC 4A2LA 4J79A 3KRWB 3V5WB 3SXTD 5GMKn 1MG2A 3SJLD 3EWEA 4MK0B 5FKSA 4N14A 3SFZA 2Q7QA 3V9FA 2W18A 2P9KC 2J55H 3CFVA 3UVKA 4CY5A 5AMSA 4A0BB 5C9ZB 1PBYB 4A2MA 4PC0A 5HE3B 5B4WA 1YFQA 1TYQC 1R5MA 2H9NA 4ESGA 2P9UC 4FAND 4GQ1A 4BL0A 2CN2A 4FB1D 3SVWD 3RMZD 2IUPA 5I5MA 2XU7A 5HE2B 4GM3A 5FQDA 4BH6A 3K27A 4JT6C 5EMLB 1NR0A 2XL3A 5AFU3 5JWZA 2GC4A 2CO0C 1GOTB 3EI1B 3OL2B 5TEFA 5EM2B 5THAA 4J73A 2HYEA 4ZN4A 2IUQA 5IGQA 4A08B 2HKMA 4CY3A 4PBYA 4CI2A 2HJBA 3DM0A 4ZOXA 4FA9D 3OKTA 2AH1A 4CI1A 3UVNA 4J81A 3C9CA 4PSXB 4GM9A 2I3TA 2OVPB 2YNOA 3FRXA 3PSLA 2I0TA 4NSXA 5EAPA 1RI6A 4A0BA 3IIWA 3SMRA 1A0RB 4O3UB 4O9DA 3SLED 2AGLA 3OTTA 2H13A 4EWRA 4A09B 3VH0A 2P9IC 2HKRA 5EALA 3P4FA 3F3PA 3DXMC 1PGUA 3JRPA 5IJ7E 3PVUB 1QNIA 2TRCB 4A11B 3GREA 3AL8B 1NEXB 4J86A 2AGYA 2H6KA 2H14A 1MDAH 3ODTA 1PEVA 3PXWD 4FAVD 3MXXA 3EI1A 3OL2A 4QL1A 2BBKH 3VA6A 2G9AA 5EM2A 4ZOZA 2I0RA 4A08A 5HE1B 4JXMA 3V7DB 4XYIA 4CZVA 2AGZA 2P9NC 2G99A 3KRXB 3AL9A 3I7LA 3N0EA 4X61B 5CYKB 4XYHA 2O9KA 5AJAA 2B5NA 4GM8A 2B5LA 3RFHA 5IJ8E 3EI2B 3I7PA 2H9MA 4QRJA 1VYHC 3PXSD 4QQEA 5FKTA 2XL2A 3F3FA 3IJ0A 3UR4A 2BCJB 4XEIC 2Z2NA 5H17A 5HQGA 1B9YA 4U1EI 3FM0A 1XIPA 2IWFA 3EU7A 5EMJB 2Z2OA 4A09A 3PXTD 3JZNA 4CY2A 4U7AA 2AGWA 2YNPA 4GQBB 2AQ5A 4A0AA 2YBAA 5C2VB 3RSEC 1U4CA 4OWRA 4A11A 3AL8A 1OMWB 3EMHA 3L4OD 3I7OA 2H9PA 4FA5D 4G56B 4J77A 3EI4A 3J81g 3N0DA 4H5JA 4JSNC 4KFMB 4E54B 4ERZA 3EI3B 2CNXA 3JB9L 5FKRA 2CN3A 5IC7A 3PE7A 1MG3A 5IGOA 3FGBA 4O45A 2H6NA 4Z8LA 4IMMA 3CIKB 3VGZA 3OKYB 5CXCB 5CXBB 2YNNA 1FWXA 5GXIA 5CYKA 3RN0D 4A7JA 3SWSD 4GZ8A 3NVQA 3DSMA 3C5MA 4CC9A 3EI2A 4ERYA 5FXYA 1GP2B 3RRMC 3I7NA 4PBZA 1K8KC 3J80g 3UVLA 3JROA 4O3TB 1P22A 4ERQA 4GGCA 5FKQA 5HYNB 3C99A 2UZXB 3RFGA 2CO0A 1JMZB 3UVMA 4ZOVA 3SBQA 1U2VC 2IURA 3ORVD 4Y5RD 4PNKB 4J87A 4J84A 4AEZA 4YVDA 3SBPA 5IT9g 2J57G 1N6EA 4BUJC 4GGDA 3I8CA 2H3XA 5GXHA 3JZHA 4PSWB 2HXCA 1OLZA 2I0SA 2QC5A 3ZWLB 4L9OA 4E54A 3EI3A 4AOWA 3E0CA 3BWSA 3BG0A 5KDOB 3DWLC 3EG6A 3OW8A 2UZYB 4X63B 2I3SA 2Z2PA 3I7HA 3OKYA 4I79A 5CXCA 5CXBA 5EARA 2H68A 3SCYA 1N6DA 3UKUC 3IJ1A 3RLMD 5K19A 4CZXA 4PXWA 3A0FA 1TBGA 3B7FA 4UI9R 1SHYB 4J8BA 2B4EA 4Y7RA 3I7KA 4E5ZB 4J0XA 1Q47A 4QT8A 4ES0A 2QXVA 3I2NA 3HFQA 3IIYA 3MKSB 4FA1D 2B5MA 5SXMA 2OK6A 1GG2B 4HDJA 3AH8B 2OK4A 1ERJA 4J78A 2IAAA 1SQJA 2PM9B 2OVRB 3C75H 3MZKA 3RN1D 3NVNA 1S4UX 2IWKA 4LG8A 1XHMA 3MMYA 3K26A 4LG9A 2P9SC 4GGAA 1JMXB 4J82A 4D0KA 1JJUB 4FHLA 2GC7A 3NVXA 3ULEC 3UVOA 2J56H 4GQ2P 2P9LC 4CY1A 2AGXA 5H1MA 4L3GD 3CFSB 5GSAA 1N6FA 3W15A 4JD2C 4J0WA 3JAMg 2PBIB 4FA4D 4TZ4A 5TDHB 2EBSA 2OJYA 5H14A 3MZLA 4ZOYA 2XYIA 3I89A 4L1QD 4GMBA 4R7AB 2H47A 2PM6B 4E5ZA 3JPXA 3BG1A 4X60B 5FA5B 2MTAH 4H5IA 2AH0A 3MKQA 3F3GA 5FLXg 3JZGA 4JT5C 4K3ID 5TEEA 5EMMB 3SBRA 5C2WB 4JSPC 2YB8B 3OKWA 4JSVC 2HJ4A 4L3HD 4OZUA 4X3EA 4O1QD 4JSXC 1JOFA 2PM9A 2OIZA 4IA9A 2P9PC 4K3JB 2H6QA 4CI8A 3U4YA 2GNQA 3AFCA 5EMKB 4J8GA 2PM7B 2H9LA 5I5JA 1K32A 3IJCA 2OVQB 5HE0B 1B9XA 4CZYA 3PVWB 1GXRA 2CE9A 1L0QA 4A0AB 2IUVA 2YMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I5I A;  2CE8 A;  3SN6 B;  3DXK C;  3IKO A;  1XKS A;  4D6V A;  3UKR C;  5A2Q g;  4LGN A;  3EI4 B;  3I8E A;  4FWW A;  3L4M D;  5TF2 A;  1PI6 A;  4CI3 A;  3GFC A;  5EAM A;  3PSC B;  1SQ9 A;  3SHF A;  2HES X;  5K1C C;  4A2L A;  4J79 A;  3KRW B;  3V5W B;  3SXT D;  5GMK n;  1MG2 A;  3SJL D;  3EWE A;  4MK0 B;  5FKS A;  4N14 A;  3SFZ A;  2Q7Q A;  3V9F A;  2W18 A;  2P9K C;  2J55 H;  3CFV A;  3UVK A;  4CY5 A;  5AMS A;  4A0B B;  5C9Z B;  1PBY B;  4A2M A;  4PC0 A;  5HE3 B;  5B4W A;  1YFQ A;  1TYQ C;  1R5M A;  2H9N A;  4ESG A;  2P9U C;  4FAN D;  4GQ1 A;  4BL0 A;  2CN2 A;  4FB1 D;  3SVW D;  3RMZ D;  2IUP A;  5I5M A;  2XU7 A;  5HE2 B;  4GM3 A;  5FQD A;  4BH6 A;  3K27 A;  4JT6 C;  5EML B;  1NR0 A;  2XL3 A;  5AFU 3;  5JWZ A;  2GC4 A;  2CO0 C;  1GOT B;  3EI1 B;  3OL2 B;  5TEF A;  5EM2 B;  5THA A;  4J73 A;  2HYE A;  4ZN4 A;  2IUQ A;  5IGQ A;  4A08 B;  2HKM A;  4CY3 A;  4PBY A;  4CI2 A;  2HJB A;  3DM0 A;  4ZOX A;  4FA9 D;  3OKT A;  2AH1 A;  4CI1 A;  3UVN A;  4J81 A;  3C9C A;  4PSX B;  4GM9 A;  2I3T A;  2OVP B;  2YNO A;  3FRX A;  3PSL A;  2I0T A;  4NSX A;  5EAP A;  1RI6 A;  4A0B A;  3IIW A;  3SMR A;  1A0R B;  4O3U B;  4O9D A;  3SLE D;  2AGL A;  3OTT A;  2H13 A;  4EWR A;  4A09 B;  3VH0 A;  2P9I C;  2HKR A;  5EAL A;  3P4F A;  3F3P A;  3DXM C;  1PGU A;  3JRP A;  5IJ7 E;  3PVU B;  1QNI A;  2TRC B;  4A11 B;  3GRE A;  3AL8 B;  1NEX B;  4J86 A;  2AGY A;  2H6K A;  2H14 A;  1MDA H;  3ODT A;  1PEV A;  3PXW D;  4FAV D;  3MXX A;  3EI1 A;  3OL2 A;  4QL1 A;  2BBK H;  3VA6 A;  2G9A A;  5EM2 A;  4ZOZ A;  2I0R A;  4A08 A;  5HE1 B;  4JXM A;  3V7D B;  4XYI A;  4CZV A;  2AGZ A;  2P9N C;  2G99 A;  3KRX B;  3AL9 A;  3I7L A;  3N0E A;  4X61 B;  5CYK B;  4XYH A;  2O9K A;  5AJA A;  2B5N A;  4GM8 A;  2B5L A;  3RFH A;  5IJ8 E;  3EI2 B;  3I7P A;  2H9M A;  4QRJ A;  1VYH C;  3PXS D;  4QQE A;  5FKT A;  2XL2 A;  3F3F A;  3IJ0 A;  3UR4 A;  2BCJ B;  4XEI C;  2Z2N A;  5H17 A;  5HQG A;  1B9Y A;  4U1E I;  3FM0 A;  1XIP A;  2IWF A;  3EU7 A;  5EMJ B;  2Z2O A;  4A09 A;  3PXT D;  3JZN A;  4CY2 A;  4U7A A;  2AGW A;  2YNP A;  4GQB B;  2AQ5 A;  4A0A A;  2YBA A;  5C2V B;  3RSE C;  1U4C A;  4OWR A;  4A11 A;  3AL8 A;  1OMW B;  3EMH A;  3L4O D;  3I7O A;  2H9P A;  4FA5 D;  4G56 B;  4J77 A;  3EI4 A;  3J81 g;  3N0D A;  4H5J A;  4JSN C;  4KFM B;  4E54 B;  4ERZ A;  3EI3 B;  2CNX A;  3JB9 L;  5FKR A;  2CN3 A;  5IC7 A;  3PE7 A;  1MG3 A;  5IGO A;  3FGB A;  4O45 A;  2H6N A;  4Z8L A;  4IMM A;  3CIK B;  3VGZ A;  3OKY B;  5CXC B;  5CXB B;  2YNN A;  1FWX A;  5GXI A;  5CYK A;  3RN0 D;  4A7J A;  3SWS D;  4GZ8 A;  3NVQ A;  3DSM A;  3C5M A;  4CC9 A;  3EI2 A;  4ERY A;  5FXY A;  1GP2 B;  3RRM C;  3I7N A;  4PBZ A;  1K8K C;  3J80 g;  3UVL A;  3JRO A;  4O3T B;  1P22 A;  4ERQ A;  4GGC A;  5FKQ A;  5HYN B;  3C99 A;  2UZX B;  3RFG A;  2CO0 A;  1JMZ B;  3UVM A;  4ZOV A;  3SBQ A;  1U2V C;  2IUR A;  3ORV D;  4Y5R D;  4PNK B;  4J87 A;  4J84 A;  4AEZ A;  4YVD A;  3SBP A;  5IT9 g;  2J57 G;  1N6E A;  4BUJ C;  4GGD A;  3I8C A;  2H3X A;  5GXH A;  3JZH A;  4PSW B;  2HXC A;  1OLZ A;  2I0S A;  2QC5 A;  3ZWL B;  4L9O A;  4E54 A;  3EI3 A;  4AOW A;  3E0C A;  3BWS A;  3BG0 A;  5KDO B;  3DWL C;  3EG6 A;  3OW8 A;  2UZY B;  4X63 B;  2I3S A;  2Z2P A;  3I7H A;  3OKY A;  4I79 A;  5CXC A;  5CXB A;  5EAR A;  2H68 A;  3SCY A;  1N6D A;  3UKU C;  3IJ1 A;  3RLM D;  5K19 A;  4CZX A;  4PXW A;  3A0F A;  1TBG A;  3B7F A;  4UI9 R;  1SHY B;  4J8B A;  2B4E A;  4Y7R A;  3I7K A;  4E5Z B;  4J0X A;  1Q47 A;  4QT8 A;  4ES0 A;  2QXV A;  3I2N A;  3HFQ A;  3IIY A;  3MKS B;  4FA1 D;  2B5M A;  5SXM A;  2OK6 A;  1GG2 B;  4HDJ A;  3AH8 B;  2OK4 A;  1ERJ A;  4J78 A;  2IAA A;  1SQJ A;  2PM9 B;  2OVR B;  3C75 H;  3MZK A;  3RN1 D;  3NVN A;  1S4U X;  2IWK A;  4LG8 A;  1XHM A;  3MMY A;  3K26 A;  4LG9 A;  2P9S C;  4GGA A;  1JMX B;  4J82 A;  4D0K A;  1JJU B;  4FHL A;  2GC7 A;  3NVX A;  3ULE C;  3UVO A;  2J56 H;  4GQ2 P;  2P9L C;  4CY1 A;  2AGX A;  5H1M A;  4L3G D;  3CFS B;  5GSA A;  1N6F A;  3W15 A;  4JD2 C;  4J0W A;  3JAM g;  2PBI B;  4FA4 D;  4TZ4 A;  5TDH B;  2EBS A;  2OJY A;  5H14 A;  3MZL A;  4ZOY A;  2XYI A;  3I89 A;  4L1Q D;  4GMB A;  4R7A B;  2H47 A;  2PM6 B;  4E5Z A;  3JPX A;  3BG1 A;  4X60 B;  5FA5 B;  2MTA H;  4H5I A;  2AH0 A;  3MKQ A;  3F3G A;  5FLX g;  3JZG A;  4JT5 C;  4K3I D;  5TEE A;  5EMM B;  3SBR A;  5C2W B;  4JSP C;  2YB8 B;  3OKW A;  4JSV C;  2HJ4 A;  4L3H D;  4OZU A;  4X3E A;  4O1Q D;  4JSX C;  1JOF A;  2PM9 A;  2OIZ A;  4IA9 A;  2P9P C;  4K3J B;  2H6Q A;  4CI8 A;  3U4Y A;  2GNQ A;  3AFC A;  5EMK B;  4J8G A;  2PM7 B;  2H9L A;  5I5J A;  1K32 A;  3IJC A;  2OVQ B;  5HE0 B;  1B9X A;  4CZY A;  3PVW B;  1GXR A;  2CE9 A;  1L0Q A;  4A0A B;  2IUV A;  2YMU A; 
#chains in the Genus database with same CATH topology
 5I5I A;  4Z7Q A;  2CE8 A;  3SN6 B;  3DXK C;  5C86 A;  3V4P A;  4DNW A;  4UM8 A;  3IKO A;  1XKS A;  4D6V A;  3UKR C;  5A2Q g;  4LGN A;  2QR5 A;  3EI4 B;  3I8E A;  4FWW A;  4BCB A;  3L4M D;  5TF2 A;  1PI6 A;  3K6S A;  4CI3 A;  3GFC A;  5EAM A;  3PSC B;  1SQ9 A;  3SHF A;  2HES X;  5K1C C;  4MMZ A;  4A2L A;  3NID A;  4J79 A;  3GD1 I;  3KRW B;  3V5W B;  3SXT D;  5GMK n;  1MG2 A;  3SJL D;  4G1E A;  1UOQ A;  3EWE A;  2EIB A;  1E8N A;  4MK0 B;  5FKS A;  4N14 A;  3SFZ A;  2Q7Q A;  3V9F A;  2W18 A;  2VDP A;  2P9K C;  2J55 H;  3CFV A;  3UVK A;  3MVD K;  4CY5 A;  5AMS A;  4A0B B;  5E6R A;  5C9Z B;  1PBY B;  4A2M A;  4PC0 A;  3FCS A;  3O4J A;  5HE3 B;  5B4W A;  5FFG A;  4Z7N A;  1YFQ A;  1TYQ C;  2VDK A;  1R5M A;  3OF7 A;  4MMX A;  2H9N A;  2EIC A;  2P9U C;  4WK0 A;  4GQ1 A;  4ESG A;  4FAN D;  4BL0 A;  2CN2 A;  4FB1 D;  1VE7 A;  3RMZ D;  2IUP A;  3SVW D;  5I5M A;  2XU7 A;  4MMY A;  5HE2 B;  3FCU A;  4GM3 A;  5FQD A;  1L5G A;  4BH6 A;  3K27 A;  2WQ8 A;  4JT6 C;  5EML B;  1NR0 A;  2XL3 A;  5AFU 3;  5JWZ A;  5E6S A;  2GC4 A;  2CO0 C;  1GOT B;  3EI1 B;  3OL2 B;  3VI4 A;  5TEF A;  4Z7O A;  5EM2 B;  5THA A;  4J73 A;  4JHP C;  2HYE A;  4ZN4 A;  2IUQ A;  5IGQ A;  3T3P A;  2HKM A;  4A08 B;  4CY3 A;  4PBY A;  3K71 A;  4CI2 A;  4WJK A;  4NC4 A;  2HJB A;  3DM0 A;  4ZOX A;  1O6G A;  3OKT A;  4FA9 D;  2AH1 A;  4AX4 A;  4CI1 A;  3UVN A;  3C9C A;  4J81 A;  4PSX B;  4GM9 A;  4DNV A;  2I3T A;  2OVP B;  2YNO A;  3FRX A;  1TYE A;  3PSL A;  2XZG A;  2I0T A;  4NSX A;  1UOP A;  3GC3 B;  2HU8 A;  5EAP A;  1RI6 A;  4A0B A;  3IIW A;  3SMR A;  4AMZ A;  1A0R B;  3EQ8 A;  4O3U B;  4O9D A;  3SLE D;  2AGL A;  2QZP A;  3OTT A;  2H13 A;  2VDR A;  4O2W A;  1T2X A;  3IUJ A;  4EWR A;  1K3I A;  3VH0 A;  2P9I C;  4A09 B;  2HKR A;  5EAL A;  2XE4 A;  3P4F A;  4BCC A;  3F3P A;  3VI3 A;  4NAA A;  3DXM C;  1PGU A;  3JRP A;  4G1M A;  3MUO A;  5IJ7 E;  3PVU B;  1QNI A;  2TRC B;  3IUR A;  4A11 B;  3GRE A;  2VDQ A;  3AL8 B;  1NEX B;  4J86 A;  2AGY A;  2H6K A;  2H14 A;  1MDA H;  3ODT A;  1PEV A;  3PXW D;  4FAV D;  3MXX A;  1VZ3 A;  3MUN A;  3EI1 A;  3OL2 A;  4QL1 A;  2BBK H;  3T3M A;  3VA6 A;  2G9A A;  5EM2 A;  4ZOZ A;  2I0R A;  3EQ7 A;  4G55 A;  4A08 A;  5HE1 B;  4JXM A;  3KCI A;  3V7D B;  4XYI A;  4CZV A;  2AGZ A;  2P9N C;  2HU5 A;  2G99 A;  3KRX B;  3AL9 A;  3I7L A;  3N0E A;  4X61 B;  5CYK B;  1QFM A;  4XYH A;  2O9K A;  5AJA A;  2B5N A;  4GM8 A;  2B5L A;  3RFH A;  5IJ8 E;  3EI2 B;  3I7P A;  1E5T A;  2H9M A;  4QRJ A;  4WK4 A;  1VYH C;  3PXS D;  4QQE A;  5FKT A;  2XL2 A;  3F3F A;  3IJ0 A;  3O4G A;  3UR4 A;  2BCJ B;  4XEI C;  2Z2N A;  5H17 A;  5HQG A;  1B9Y A;  4U1E I;  3FM0 A;  1XIP A;  2IWF A;  3EU7 A;  5EMJ B;  2Z2O A;  4A09 A;  3PXT D;  3JZN A;  4CY2 A;  4U7A A;  3NIG A;  1QFS A;  2AGW A;  2YNP A;  4GQB B;  2AQ5 A;  3K72 A;  4A0A A;  2YBA A;  2VC2 A;  5C2V B;  3RSE C;  1U4C A;  2EIE A;  4OWR A;  4A11 A;  3AL8 A;  1OMW B;  3EMH A;  3L4O D;  3I7O A;  2H9P A;  4FA5 D;  4G56 B;  1A12 A;  4J77 A;  5M5V A;  3EI4 A;  3J81 g;  3N0D A;  1O6F A;  4H5J A;  4JSN C;  4KFM B;  4E54 B;  4ERZ A;  3EI3 B;  1JV2 A;  2CNX A;  3JB9 L;  2VZ1 A;  4AMY A;  5FKR A;  2CN3 A;  5M5U A;  5IC7 A;  3PE7 A;  1MG3 A;  5IGO A;  3FGB A;  4O45 A;  2H6N A;  1M1X A;  4RE5 A;  4Z8L A;  4IMM A;  3CIK B;  3VGZ A;  2XDW A;  3OKY B;  5CXC B;  5CXB B;  2YNN A;  1U8C A;  1FWX A;  2EID A;  3O4I A;  5GXI A;  5CYK A;  3RN0 D;  4A7J A;  3SWS D;  4GZ8 A;  1C9L A;  3NVQ A;  3DSM A;  3C5M A;  3ZDX A;  4CC9 A;  3EI2 A;  4ERY A;  3NIF A;  5FFO A;  1JTD B;  5FXY A;  1GP2 B;  3RRM C;  3I7N A;  4PBZ A;  1K8K C;  3J80 g;  5M5T A;  3UVL A;  3JRO A;  1YR2 A;  4O3T B;  1P22 A;  4ERQ A;  4GGC A;  3IUM A;  3O4H A;  5FKQ A;  5HYN B;  3C99 A;  4L1M A;  4NEN A;  2UZX B;  3RFG A;  2CO0 A;  1JMZ B;  3UVM A;  4ZOV A;  3SBQ A;  1U2V C;  3ZE0 A;  3EQ9 A;  4D9S A;  2IUR A;  3ORV D;  2HU7 A;  4Y5R D;  4PNK B;  4J87 A;  4J84 A;  3ZE2 A;  5HDB A;  4AEZ A;  4YVD A;  1GOF A;  3SBP A;  5IT9 g;  2J57 G;  1N6E A;  3IVM A;  4BUJ C;  1H2W A;  4GGD A;  1I2M B;  3I8C A;  2H3X A;  5GXH A;  2VDO A;  3JZH A;  4PSW B;  3ZDZ A;  1H2Y A;  2HXC A;  1OLZ A;  2I0S A;  2VDM A;  2QC5 A;  3ZWL B;  4L9O A;  4E54 A;  3EI3 A;  4AOW A;  3E0C A;  4NBM A;  3BWS A;  1UOO A;  3BG0 A;  4AN0 A;  5KDO B;  3DWL C;  3EG6 A;  3OW8 A;  2UZY B;  4X63 B;  3ZDY A;  2JKX A;  5M5S A;  2I3S A;  2Z2P A;  3I7H A;  3OKY A;  4I79 A;  5CXC A;  5CXB A;  5EAR A;  4DNU A;  2H68 A;  3SCY A;  1N6D A;  3UKU C;  3IJ1 A;  3RLM D;  5K19 A;  4CZX A;  4PXW A;  3B7F A;  1TBG A;  1BPO A;  3A0F A;  4UI9 R;  1SHY B;  4J8B A;  2B4E A;  4Y7R A;  3I7K A;  4E5Z B;  4J0X A;  3ZE1 A;  1E8M A;  1Q47 A;  4QT8 A;  4ES0 A;  4WK2 A;  4O02 A;  2QXV A;  3I2N A;  3HFQ A;  3IIY A;  3MKS B;  4FA1 D;  2B5M A;  1VE6 A;  5SXM A;  2OK6 A;  1GG2 B;  4HDJ A;  3AH8 B;  2OK4 A;  1ERJ A;  4J78 A;  2IAA A;  1SQJ A;  2PM9 B;  2OVR B;  3C75 H;  3MZK A;  3RN1 D;  3NVN A;  1S4U X;  3QI0 A;  2IWK A;  4LG8 A;  3QHY B;  1XHM A;  4UM9 A;  3MMY A;  3K26 A;  4LG9 A;  2P9S C;  4GGA A;  1JMX B;  4J82 A;  4D0K A;  3IUQ A;  1JJU B;  4FHL A;  2GC7 A;  3NVX A;  1C9I A;  4QAM A;  2J56 H;  3ULE C;  3UVO A;  4GQ2 P;  2P9L C;  4CY1 A;  1GOH A;  2AGX A;  5H1M A;  4L3G D;  3CFS B;  5M5R A;  2VDL A;  5GSA A;  1UTC A;  3IUN A;  1N6F A;  4JHN A;  4JD2 C;  3W15 A;  3IJE A;  4J0W A;  4BP9 A;  3JAM g;  1H2Z A;  2PBI B;  4FA4 D;  4TZ4 A;  5TDH B;  2EBS A;  2OJY A;  1GOG A;  5H14 A;  5C92 A;  3MZL A;  4IRZ A;  2XYI A;  4ZOY A;  3I89 A;  4L1Q D;  4GMB A;  4R7A B;  2H47 A;  4BP8 A;  2PM6 B;  4E5Z A;  3JPX A;  3BG1 A;  4X60 B;  5FA5 B;  2MTA H;  4H5I A;  2AH0 A;  3MKQ A;  3V4V A;  3F3G A;  5FLX g;  3JZG A;  4JT5 C;  4K3I D;  5TEE A;  5EMM B;  3SBR A;  4RE6 A;  5C2W B;  3IUL A;  4JSP C;  2YB8 B;  3OKW A;  4JSV C;  2HJ4 A;  4L3H D;  2VZ3 A;  4OZU A;  4X3E A;  4O1Q D;  1VZ2 A;  4JSX C;  1JOF A;  2PM9 A;  2OIZ A;  4IA9 A;  2P9P C;  4K3J B;  2H6Q A;  5E6U A;  4CI8 A;  4BCD A;  3U4Y A;  2GNQ A;  3DDU A;  3AFC A;  5EMK B;  4J8G A;  2BKL A;  2PM7 B;  2H9L A;  5I5J A;  1K32 A;  3IJC A;  2OVQ B;  5HE0 B;  2VDN A;  1B9X A;  1H2X A;  4CZY A;  3PVW B;  1GXR A;  5M61 A;  4AN1 A;  2CE9 A;  1L0Q A;  4A0A B;  2IUV A;  2YMU A; 
#chains in the Genus database with same CATH homology
 5I5I A;  2CE8 A;  3SN6 B;  3DXK C;  3IKO A;  1XKS A;  4D6V A;  3UKR C;  5A2Q g;  4LGN A;  3EI4 B;  3I8E A;  4FWW A;  3L4M D;  5TF2 A;  1PI6 A;  4CI3 A;  3GFC A;  5EAM A;  3PSC B;  1SQ9 A;  3SHF A;  2HES X;  5K1C C;  4A2L A;  4J79 A;  3KRW B;  3V5W B;  3SXT D;  5GMK n;  1MG2 A;  3SJL D;  3EWE A;  4MK0 B;  5FKS A;  4N14 A;  3SFZ A;  2Q7Q A;  3V9F A;  2W18 A;  2P9K C;  2J55 H;  3CFV A;  3UVK A;  4CY5 A;  5AMS A;  4A0B B;  5C9Z B;  1PBY B;  4A2M A;  4PC0 A;  5HE3 B;  5B4W A;  1YFQ A;  1TYQ C;  1R5M A;  2H9N A;  4ESG A;  2P9U C;  4FAN D;  4GQ1 A;  4BL0 A;  2CN2 A;  4FB1 D;  3SVW D;  3RMZ D;  2IUP A;  5I5M A;  2XU7 A;  5HE2 B;  4GM3 A;  5FQD A;  4BH6 A;  3K27 A;  4JT6 C;  5EML B;  1NR0 A;  2XL3 A;  5AFU 3;  5JWZ A;  2GC4 A;  2CO0 C;  1GOT B;  3EI1 B;  3OL2 B;  5TEF A;  5EM2 B;  5THA A;  4J73 A;  2HYE A;  4ZN4 A;  2IUQ A;  5IGQ A;  4A08 B;  2HKM A;  4CY3 A;  4PBY A;  4CI2 A;  2HJB A;  3DM0 A;  4ZOX A;  4FA9 D;  3OKT A;  2AH1 A;  4CI1 A;  3UVN A;  4J81 A;  3C9C A;  4PSX B;  4GM9 A;  2I3T A;  2OVP B;  2YNO A;  3FRX A;  3PSL A;  2I0T A;  4NSX A;  5EAP A;  1RI6 A;  4A0B A;  3IIW A;  3SMR A;  1A0R B;  4O3U B;  4O9D A;  3SLE D;  2AGL A;  3OTT A;  2H13 A;  4EWR A;  4A09 B;  3VH0 A;  2P9I C;  2HKR A;  5EAL A;  3P4F A;  3F3P A;  3DXM C;  1PGU A;  3JRP A;  5IJ7 E;  3PVU B;  1QNI A;  2TRC B;  4A11 B;  3GRE A;  3AL8 B;  1NEX B;  4J86 A;  2AGY A;  2H6K A;  2H14 A;  1MDA H;  3ODT A;  1PEV A;  3PXW D;  4FAV D;  3MXX A;  3EI1 A;  3OL2 A;  4QL1 A;  2BBK H;  3VA6 A;  2G9A A;  5EM2 A;  4ZOZ A;  2I0R A;  4A08 A;  5HE1 B;  4JXM A;  3V7D B;  4XYI A;  4CZV A;  2AGZ A;  2P9N C;  2G99 A;  3KRX B;  3AL9 A;  3I7L A;  3N0E A;  4X61 B;  5CYK B;  4XYH A;  2O9K A;  5AJA A;  2B5N A;  4GM8 A;  2B5L A;  3RFH A;  5IJ8 E;  3EI2 B;  3I7P A;  2H9M A;  4QRJ A;  1VYH C;  3PXS D;  4QQE A;  5FKT A;  2XL2 A;  3F3F A;  3IJ0 A;  3UR4 A;  2BCJ B;  4XEI C;  2Z2N A;  5H17 A;  5HQG A;  1B9Y A;  4U1E I;  3FM0 A;  1XIP A;  2IWF A;  3EU7 A;  5EMJ B;  2Z2O A;  4A09 A;  3PXT D;  3JZN A;  4CY2 A;  4U7A A;  2AGW A;  2YNP A;  4GQB B;  2AQ5 A;  4A0A A;  2YBA A;  5C2V B;  3RSE C;  1U4C A;  4OWR A;  4A11 A;  3AL8 A;  1OMW B;  3EMH A;  3L4O D;  3I7O A;  2H9P A;  4FA5 D;  4G56 B;  4J77 A;  3EI4 A;  3J81 g;  3N0D A;  4H5J A;  4JSN C;  4KFM B;  4E54 B;  4ERZ A;  3EI3 B;  2CNX A;  3JB9 L;  5FKR A;  2CN3 A;  5IC7 A;  3PE7 A;  1MG3 A;  5IGO A;  3FGB A;  4O45 A;  2H6N A;  4Z8L A;  4IMM A;  3CIK B;  3VGZ A;  3OKY B;  5CXC B;  5CXB B;  2YNN A;  1FWX A;  5GXI A;  5CYK A;  3RN0 D;  4A7J A;  3SWS D;  4GZ8 A;  3NVQ A;  3DSM A;  3C5M A;  4CC9 A;  3EI2 A;  4ERY A;  5FXY A;  1GP2 B;  3RRM C;  3I7N A;  4PBZ A;  1K8K C;  3J80 g;  3UVL A;  3JRO A;  4O3T B;  1P22 A;  4ERQ A;  4GGC A;  5FKQ A;  5HYN B;  3C99 A;  2UZX B;  3RFG A;  2CO0 A;  1JMZ B;  3UVM A;  4ZOV A;  3SBQ A;  1U2V C;  2IUR A;  3ORV D;  4Y5R D;  4PNK B;  4J87 A;  4J84 A;  4AEZ A;  4YVD A;  3SBP A;  5IT9 g;  2J57 G;  1N6E A;  4BUJ C;  4GGD A;  3I8C A;  2H3X A;  5GXH A;  3JZH A;  4PSW B;  2HXC A;  1OLZ A;  2I0S A;  2QC5 A;  3ZWL B;  4L9O A;  4E54 A;  3EI3 A;  4AOW A;  3E0C A;  3BWS A;  3BG0 A;  5KDO B;  3DWL C;  3EG6 A;  3OW8 A;  2UZY B;  4X63 B;  2I3S A;  2Z2P A;  3I7H A;  3OKY A;  4I79 A;  5CXC A;  5CXB A;  5EAR A;  2H68 A;  3SCY A;  1N6D A;  3UKU C;  3IJ1 A;  3RLM D;  5K19 A;  4CZX A;  4PXW A;  3A0F A;  1TBG A;  3B7F A;  4UI9 R;  1SHY B;  4J8B A;  2B4E A;  4Y7R A;  3I7K A;  4E5Z B;  4J0X A;  1Q47 A;  4QT8 A;  4ES0 A;  2QXV A;  3I2N A;  3HFQ A;  3IIY A;  3MKS B;  4FA1 D;  2B5M A;  5SXM A;  2OK6 A;  1GG2 B;  4HDJ A;  3AH8 B;  2OK4 A;  1ERJ A;  4J78 A;  2IAA A;  1SQJ A;  2PM9 B;  2OVR B;  3C75 H;  3MZK A;  3RN1 D;  3NVN A;  1S4U X;  2IWK A;  4LG8 A;  1XHM A;  3MMY A;  3K26 A;  4LG9 A;  2P9S C;  4GGA A;  1JMX B;  4J82 A;  4D0K A;  1JJU B;  4FHL A;  2GC7 A;  3NVX A;  3ULE C;  3UVO A;  2J56 H;  4GQ2 P;  2P9L C;  4CY1 A;  2AGX A;  5H1M A;  4L3G D;  3CFS B;  5GSA A;  1N6F A;  3W15 A;  4JD2 C;  4J0W A;  3JAM g;  2PBI B;  4FA4 D;  4TZ4 A;  5TDH B;  2EBS A;  2OJY A;  5H14 A;  3MZL A;  4ZOY A;  2XYI A;  3I89 A;  4L1Q D;  4GMB A;  4R7A B;  2H47 A;  2PM6 B;  4E5Z A;  3JPX A;  3BG1 A;  4X60 B;  5FA5 B;  2MTA H;  4H5I A;  2AH0 A;  3MKQ A;  3F3G A;  5FLX g;  3JZG A;  4JT5 C;  4K3I D;  5TEE A;  5EMM B;  3SBR A;  5C2W B;  4JSP C;  2YB8 B;  3OKW A;  4JSV C;  2HJ4 A;  4L3H D;  4OZU A;  4X3E A;  4O1Q D;  4JSX C;  1JOF A;  2PM9 A;  2OIZ A;  4IA9 A;  2P9P C;  4K3J B;  2H6Q A;  4CI8 A;  3U4Y A;  2GNQ A;  3AFC A;  5EMK B;  4J8G A;  2PM7 B;  2H9L A;  5I5J A;  1K32 A;  3IJC A;  2OVQ B;  5HE0 B;  1B9X A;  4CZY A;  3PVW B;  1GXR A;  2CE9 A;  1L0Q A;  4A0A B;  2IUV A;  2YMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...