3SXTD

Crystal structure of the quinol form of methylamine dehydrogenase in complex with the diferrous form of maug
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
375
structure length
375
Chain Sequence
b'ETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
molecule tags Oxidoreductase/electron transport
source organism Paracoccus denitrificans
publication title Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG
rcsb
total genus 99
structure length 375
sequence length 375
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sxtD00
2H3XA 2CE8A 2H9NA 4Y5RD 1GOTB 5FKTA 3VGZA 4JT5C 2P9LC 3SBPA 4QL1A 5H1MA 2IWKA 3SN6B 4A08A 1MG2A 4PBYA 3CFSB 2P9NC 2AGLA 4J82A 3SMRA 1ERJA 2BCJB 4K3JB 3UR4A 4J0WA 3I89A 5I5IA 4E54A 2Z2PA 3DWLC 3C5MA 3OKWA 2HKMA 3VH0A 1K8KC 3B7FA 2CN2A 3PVWB 5THAA 4AOWA 1RI6A 5HQGA 3RRMC 1PI6A 4O45A 4O1QD 3GFCA 3BG0A 3CFVA 3U4YA 5HE3B 3AL8A 1NEXB 4E5ZB 4GQ1A 1SQJA 3PVUB 4FHLA 4IA9A 5CYKA 5B4WA 2QC5A 2OVPB 4JSVC 5KDOB 4IMMA 3RFGA 4ZOXA 3NVQA 2OIZA 2H9LA 2QXVA 3OW8A 2B5LA 4A0BB 3BWSA 4EWRA 3PXWD 5TDHB 4G56B 3K26A 4A11B 2HXCA 2I0RA 2I3TA 3JB9L 1Q47A 5HE2B 4Y7RA 4J0XA 4GMBA 5I5MA 2O9KA 2Q7QA 1PEVA 2AGXA 4ERYA 3AL9A 3SBQA 4CC9A 2GC4A 2I3SA 3I8CA 5IJ8E 4PC0A 2GC7A 3ULEC 1GXRA 2B4EA 4J8GA 1U2VC 3L4MD 5K19A 2YB8B 3UKUC 1NR0A 1N6EA 2IUVA 5FA5B 4GM8A 5GXIA 3NVNA 3UVOA 5HYNB 2OK6A 3SXTD 2IURA 1MDAH 1XKSA 3SBRA 5TEFA 1A0RB 4A7JA 1FWXA 2P9UC 4X61B 2Z2NA 3NVXA 4AEZA 1TYQC 3JZNA 4JT6C 5IGQA 3IJCA 4A2LA 5GXHA 4FAVD 3AL8B 2H6NA 3EMHA 4FAND 5HE1B 5EALA 4J79A 4LGNA 4K3ID 5FQDA 5SXMA 2YNPA 4J78A 4QQEA 3DM0A 5CXCB 3MZKA 3OKYB 4JXMA 3PSCB 2HJ4A 2H68A 3OL2A 4JSNC 2YBAA 2IUQA 4XEIC 1YFQA 2PBIB 5CXCA 4FA9D 4A08B 5CXBB 4PSWB 3OKYA 5IGOA 5EM2A 3EI2B 4A11A 1GG2B 4MK0B 2MTAH 5A2Qg 4OZUA 2CE9A 5GMKn 5FKSA 3VA6A 4O3TB 4FA4D 2XL3A 4D0KA 3SFZA 4QT8A 2PM9B 4ES0A 3MKSB 4CI3A 5IJ7E 4GGDA 4A2MA 2J55H 3SVWD 4BL0A 3EI3B 5FLXg 1SHYB 4L9OA 3RN1D 1B9YA 2OVRB 4GQBB 4LG9A 5C9ZB 5CYKB 3I8EA 1MG3A 3DXKC 3E0CA 3PXTD 3FGBA 2H6KA 4BUJC 2P9KC 2I0SA 2OJYA 3SJLD 3GREA 4H5JA 3IJ0A 4GM9A 5AMSA 3EWEA 3OTTA 3HFQA 3RFHA 3CIKB 1OMWB 4ERZA 4ZOVA 3I7PA 3C75H 3PXSD 4YVDA 4CI2A 2B5NA 5JWZA 5I5JA 4FWWA 5AFU3 1JMXB 1R5MA 2PM6B 2AH0A 4J77A 2AGWA 5FKRA 5FKQA 4ZOZA 4JD2C 2YNNA 4CY2A 2H6QA 4L3GD 3JPXA 3JZHA 3ZWLB 5GSAA 5EM2B 4A0AB 2OK4A 4KFMB 4N14A 2XL2A 3MMYA 2B5MA 4CZYA 4X63B 3RLMD 3J80g 3N0DA 4BH6A 5AJAA 3KRXB 2PM7B 3J81g 2H14A 2XYIA 4A0BA 4O9DA 3I7KA 5EMKB 2H9PA 3SLED 2YMUA 4UI9R 3A0FA 2CN3A 2GNQA 4J86A 4JSXC 4LG8A 1XHMA 3V9FA 3UKRC 4ESGA 4ZN4A 2IWFA 4E54B 4L3HD 3FRXA 1U4CA 5H14A 3UVNA 3C9CA 5EAMA 5TF2A 5K1CC 4A09A 3FM0A 2YNOA 3IJ1A 4U7AA 5FXYA 1JOFA 3UVLA 3OKTA 4J8BA 3I7LA 2HYEA 4PSXB 5IC7A 1XIPA 1QNIA 3IKOA 1VYHC 1PBYB 3L4OD 4QRJA 4CI1A 2PM9A 3I2NA 4D6VA 2CO0C 4Z8LA 3SHFA 3JZGA 4U1EI 3IIWA 4PNKB 5EMMB 5EMJB 2IAAA 5TEEA 3MZLA 1B9XA 2W18A 3ODTA 2OVQB 1PGUA 4HDJA 4NSXA 2BBKH 3EU7A 2P9SC 4FB1D 2UZYB 2P9PC 4XYHA 4JSPC 3K27A 3EI3A 3I7NA 4TZ4A 5EMLB 4ERQA 2Z2OA 3EG6A 4GM3A 4XYIA 4E5ZA 2AGZA 3C99A 3W15A 1GP2B 3ORVD 4H5IA 5HE0B 3RSEC 3SCYA 2XU7A 4CY1A 2CO0A 3EI2A 5EAPA 1OLZA 3EI1A 3PSLA 4J87A 3MKQA 4J73A 4X3EA 2AH1A 3DXMC 2EBSA 4GGAA 1SQ9A 3JRPA 2AGYA 4I79A 4A0AA 4R7AB 2G9AA 5C2WB 4A09B 2P9IC 2H13A 3DSMA 2H47A 1S4UX 3P4FA 2J57G 3JROA 3MXXA 3OL2B 3F3PA 3EI4A 4GQ2P 2J56H 3AH8B 4ZOYA 3V5WB 5IT9g 5EARA 3N0EA 2CNXA 3RN0D 3I7HA 2H9MA 3IIYA 3UVMA 4FA1D 4PXWA 3KRWB 1JJUB 5C2VB 2TRCB 1N6DA 1JMZB 3EI4B 4L1QD 4J81A 4OWRA 4X60B 3V7DB 2HKRA 3PE7A 4J84A 1K32A 2UZXB 4O3UB 3SWSD 3AFCA 3UVKA 1L0QA 1N6FA 5CXBA 4CZXA 2AQ5A 2I0TA 2IUPA 1P22A 1TBGA 4CY3A 4GZ8A 4PBZA 4GGCA 3RMZD 2G99A 4FA5D 4CY5A 5H17A 2HESX 3JAMg 3F3FA 4CI8A 3BG1A 4CZVA 3EI1B 3I7OA 2HJBA 3F3GA
chains in the Genus database with same CATH superfamily
2H3XA 2CE8A 2H9NA 4Y5RD 1GOTB 5FKTA 3VGZA 4JT5C 2P9LC 3SBPA 4QL1A 5H1MA 2IWKA 3SN6B 4A08A 1MG2A 4PBYA 3CFSB 2P9NC 2AGLA 4J82A 3SMRA 1ERJA 2BCJB 1C9IA 4K3JB 4J0WA 3UR4A 3I89A 5I5IA 4E54A 2Z2PA 1VZ3A 1JTDB 1T2XA 3DWLC 3C5MA 3OKWA 2HKMA 2VZ1A 3VH0A 1K8KC 3B7FA 2CN2A 3PVWB 4MMZA 5THAA 4AOWA 1RI6A 1QFSA 5HQGA 3RRMC 1U8CA 1PI6A 4O45A 4O1QD 3GFCA 1VE7A 1BPOA 3BG0A 2VC2A 3CFVA 3U4YA 4L1MA 5HE3B 4Z7OA 3AL8A 1NEXB 2WQ8A 4E5ZB 4GQ1A 2BKLA 1SQJA 3PVUB 4FHLA 4IA9A 5CYKA 5B4WA 2QC5A 3GD1I 2OVPB 4JSVC 3IUJA 5KDOB 4IMMA 3RFGA 4ZOXA 3NVQA 2OIZA 2H9LA 2QXVA 3OW8A 2B5LA 4A0BB 3BWSA 3FCUA 4EWRA 5C86A 3PXWD 5TDHB 4G56B 3K26A 2VDMA 4A11B 2HXCA 2I0RA 2I3TA 3JB9L 3ZDYA 1Q47A 2VDOA 5HE2B 4Y7RA 4J0XA 4GMBA 5I5MA 2O9KA 2Q7QA 1PEVA 2AGXA 4ERYA 2JKXA 2EIDA 3AL9A 3SBQA 4CC9A 2GC4A 2I3SA 3I8CA 5IJ8E 4PC0A 2GC7A 3ULEC 1GXRA 2B4EA 4J8GA 5M5VA 1U2VC 3L4MD 5K19A 2YB8B 4WK0A 1NR0A 1N6EA 2IUVA 3UKUC 1GOGA 4NC4A 5FA5B 1H2WA 4GM8A 5GXIA 3NVNA 5E6RA 3UVOA 5HYNB 2OK6A 3SXTD 2IURA 1MDAH 1XKSA 3EQ9A 5TEFA 1A0RB 3SBRA 4A7JA 5FFOA 1FWXA 2P9UC 4X61B 2Z2NA 3NVXA 4AEZA 1TYQC 3JZNA 4JT6C 5IGQA 3IJCA 4A2LA 3FCSA 5GXHA 4G1EA 4FAVD 3AL8B 2H6NA 3EMHA 4FAND 5HE1B 5EALA 3QI0A 4J79A 1UTCA 4LGNA 4K3ID 5FQDA 5SXMA 4BCDA 2YNPA 3NIDA 2QR5A 4J78A 4QQEA 3DM0A 2VDQA 3O4JA 5CXCB 1H2ZA 3MZKA 3OKYB 4JXMA 4AMYA 3PSCB 2HJ4A 2H68A 3OL2A 5M5SA 4JSNC 2YBAA 2VDLA 2IUQA 4XEIC 3VI3A 4AN0A 1YFQA 4WJKA 2PBIB 2VDKA 5CXCA 4FA9D 4A08B 1O6FA 5CXBB 4PSWB 1A12A 3OKYA 3IULA 5IGOA 2QZPA 1H2XA 3ZE1A 5EM2A 3EI2B 3MUNA 4A11A 1GG2B 4DNWA 4MK0B 2MTAH 5A2Qg 4OZUA 2CE9A 5GMKn 5FKSA 3VI4A 3VA6A 2VZ3A 4O3TB 4FA4D 1M1XA 3KCIA 5M61A 2XL3A 4D0KA 3SFZA 2EIBA 4QT8A 2PM9B 4ES0A 3MKSB 4CI3A 5IJ7E 4GGDA 5M5RA 4JHPC 5HDBA 4A2MA 1UOPA 3ZDZA 2J55H 3SVWD 3IVMA 4BL0A 1YR2A 3EI3B 5FLXg 1GOFA 1SHYB 4L9OA 3RN1D 1B9YA 2OVRB 4GQBB 4LG9A 5C9ZB 5CYKB 4DNVA 3I8EA 1MG3A 3DXKC 3E0CA 3PXTD 3FGBA 5M5UA 2H6KA 4BUJC 2P9KC 2I0SA 2OJYA 3SJLD 3GREA 4H5JA 3IJ0A 4GM9A 5AMSA 3EWEA 3OTTA 3HFQA 3RFHA 3CIKB 1OMWB 4ERZA 4ZOVA 4G55A 3I7PA 3C75H 3PXSD 4YVDA 3GC3B 2B5NA 4CI2A 5JWZA 5I5JA 4FWWA 5AFU3 1JMXB 1R5MA 2PM6B 2AH0A 4J77A 2AGWA 5FKRA 5FKQA 2XDWA 4Z7QA 4ZOZA 4JD2C 2YNNA 3O4GA 4WK4A 3IUNA 4CY2A 2H6QA 4L3GD 3JPXA 3O4HA 3JZHA 3ZWLB 5GSAA 5EM2B 4NBMA 3T3MA 4A0AB 2OK4A 4KFMB 4N14A 2XL2A 4IRZA 3MMYA 2B5MA 4CZYA 4X63B 4BP8A 3NIGA 3RLMD 3J80g 3N0DA 1K3IA 4BH6A 5AJAA 3KRXB 2PM7B 3J81g 2H14A 2XYIA 4A0BA 2EICA 4O9DA 3I7KA 5EMKB 2H9PA 3SLED 4RE6A 1JV2A 2YMUA 1E8MA 4UI9R 3A0FA 2VDPA 3EQ7A 2CN3A 2GNQA 4J86A 4JSXC 1E8NA 4LG8A 1XHMA 3V9FA 3UKRC 4ESGA 4UM9A 4ZN4A 4D9SA 2IWFA 4E54B 4L3HD 4MMYA 3FRXA 1U4CA 5H14A 1O6GA 3UVNA 2XZGA 3C9CA 5EAMA 3ZDXA 5TF2A 1I2MB 2EIEA 5K1CC 4DNUA 1VZ2A 5E6UA 3FM0A 4A09A 2YNOA 3IJ1A 4U7AA 5FXYA 1JOFA 3UVLA 3OKTA 4J8BA 4RE5A 4G1MA 3I7LA 2HYEA 4PSXB 5IC7A 2HU7A 1XIPA 1QNIA 3IKOA 1VYHC 2HU5A 1PBYB 3IJEA 3L4OD 4QRJA 4CI1A 1UOOA 2PM9A 3I2NA 3K72A 2CO0C 4Z8LA 4D6VA 3SHFA 3JZGA 3IUMA 4U1EI 4O02A 3IIWA 4PNKB 1QFMA 5EMMB 5EMJB 2IAAA 5TEEA 3T3PA 3MZLA 1B9XA 2W18A 3ODTA 2OVQB 1PGUA 4HDJA 5C92A 4NSXA 2BBKH 3EQ8A 3EU7A 4UM8A 2P9SC 4FB1D 2UZYB 2P9PC 4XYHA 4NENA 1TYEA 4JSPC 3K27A 3EI3A 3I7NA 4TZ4A 5E6SA 5EMLB 4ERQA 2Z2OA 2VDNA 3EG6A 4GM3A 1VE6A 4XYIA 4E5ZA 2AGZA 4AX4A 4BCBA 3C99A 3W15A 1GP2B 3ORVD 1E5TA 4H5IA 5HE0B 3RSEC 3SCYA 2XU7A 4CY1A 2CO0A 3EI2A 5EAPA 1OLZA 3EI1A 3PSLA 4MMXA 4J87A 3MKQA 3DDUA 4J73A 2VDRA 4AN1A 4X3EA 4AMZA 2AH1A 4BCCA 3DXMC 2EBSA 4GGAA 4JHNA 1SQ9A 3JRPA 2AGYA 4I79A 4A0AA 4R7AB 2G9AA 3V4PA 5C2WB 2P9IC 4A09B 2H13A 3DSMA 1L5GA 2H47A 1S4UX 3P4FA 2J57G 3JROA 3MXXA 3QHYB 3OL2B 3F3PA 2HU8A 1H2YA 3EI4A 4GQ2P 2J56H 3AH8B 4ZOYA 3V5WB 5IT9g 4WK2A 5EARA 3N0EA 2CNXA 3RN0D 1UOQA 3I7HA 2H9MA 3IIYA 3UVMA 4FA1D 4PXWA 3KRWB 1JJUB 3ZE0A 5C2VB 2TRCB 1N6DA 1JMZB 3EI4B 1C9LA 1GOHA 3IURA 4L1QD 4J81A 4OWRA 4X60B 3V7DB 2HKRA 4QAMA 3PE7A 3NIFA 3ZE2A 4J84A 1K32A 2UZXB 3IUQA 4O3UB 3SWSD 3AFCA 3UVKA 1L0QA 1N6FA 5CXBA 4Z7NA 4CZXA 2AQ5A 2I0TA 2IUPA 4O2WA 1P22A 1TBGA 3K6SA 4CY3A 4GZ8A 4PBZA 4GGCA 3RMZD 2G99A 3K71A 4FA5D 4CY5A 5H17A 3V4VA 2HESX 4BP9A 3O4IA 3JAMg 3F3FA 4CI8A 3BG1A 3MVDK 3MUOA 4CZVA 4NAAA 3EI1B 3OF7A 3I7OA 5M5TA 2HJBA 3F3GA 2XE4A 5FFGA
chains in the Genus database with same CATH topology
2H3XA 2CE8A 2H9NA 4Y5RD 1GOTB 5FKTA 3VGZA 4JT5C 2P9LC 3SBPA 4QL1A 5H1MA 2IWKA 3SN6B 4A08A 1MG2A 4PBYA 3CFSB 2P9NC 2AGLA 4J82A 3SMRA 1ERJA 2BCJB 4K3JB 3UR4A 4J0WA 3I89A 5I5IA 4E54A 2Z2PA 3DWLC 3C5MA 3OKWA 2HKMA 3VH0A 1K8KC 3B7FA 2CN2A 3PVWB 5THAA 4AOWA 1RI6A 5HQGA 3RRMC 1PI6A 4O45A 4O1QD 3GFCA 3BG0A 3CFVA 3U4YA 5HE3B 3AL8A 1NEXB 4E5ZB 4GQ1A 1SQJA 3PVUB 4FHLA 4IA9A 5CYKA 5B4WA 2QC5A 2OVPB 4JSVC 5KDOB 4IMMA 3RFGA 4ZOXA 3NVQA 2OIZA 2H9LA 2QXVA 3OW8A 2B5LA 4A0BB 3BWSA 4EWRA 3PXWD 5TDHB 4G56B 3K26A 4A11B 2HXCA 2I0RA 2I3TA 3JB9L 1Q47A 5HE2B 4Y7RA 4J0XA 4GMBA 5I5MA 2O9KA 2Q7QA 1PEVA 2AGXA 4ERYA 3AL9A 3SBQA 4CC9A 2GC4A 2I3SA 3I8CA 5IJ8E 4PC0A 2GC7A 3ULEC 1GXRA 2B4EA 4J8GA 1U2VC 3L4MD 5K19A 2YB8B 3UKUC 1NR0A 1N6EA 2IUVA 5FA5B 4GM8A 5GXIA 3NVNA 3UVOA 5HYNB 2OK6A 3SXTD 2IURA 1MDAH 1XKSA 3SBRA 5TEFA 1A0RB 4A7JA 1FWXA 2P9UC 4X61B 2Z2NA 3NVXA 4AEZA 1TYQC 3JZNA 4JT6C 5IGQA 3IJCA 4A2LA 5GXHA 4FAVD 3AL8B 2H6NA 3EMHA 4FAND 5HE1B 5EALA 4J79A 4LGNA 4K3ID 5FQDA 5SXMA 2YNPA 4J78A 4QQEA 3DM0A 5CXCB 3MZKA 3OKYB 4JXMA 3PSCB 2HJ4A 2H68A 3OL2A 4JSNC 2YBAA 2IUQA 4XEIC 1YFQA 2PBIB 5CXCA 4FA9D 4A08B 5CXBB 4PSWB 3OKYA 5IGOA 5EM2A 3EI2B 4A11A 1GG2B 4MK0B 2MTAH 5A2Qg 4OZUA 2CE9A 5GMKn 5FKSA 3VA6A 4O3TB 4FA4D 2XL3A 4D0KA 3SFZA 4QT8A 2PM9B 4ES0A 3MKSB 4CI3A 5IJ7E 4GGDA 4A2MA 2J55H 3SVWD 4BL0A 3EI3B 5FLXg 1SHYB 4L9OA 3RN1D 1B9YA 2OVRB 4GQBB 4LG9A 5C9ZB 5CYKB 3I8EA 1MG3A 3DXKC 3E0CA 3PXTD 3FGBA 2H6KA 4BUJC 2P9KC 2I0SA 2OJYA 3SJLD 3GREA 4H5JA 3IJ0A 4GM9A 5AMSA 3EWEA 3OTTA 3HFQA 3RFHA 3CIKB 1OMWB 4ERZA 4ZOVA 3I7PA 3C75H 3PXSD 4YVDA 4CI2A 2B5NA 5JWZA 5I5JA 4FWWA 5AFU3 1JMXB 1R5MA 2PM6B 2AH0A 4J77A 2AGWA 5FKRA 5FKQA 4ZOZA 4JD2C 2YNNA 4CY2A 2H6QA 4L3GD 3JPXA 3JZHA 3ZWLB 5GSAA 5EM2B 4A0AB 2OK4A 4KFMB 4N14A 2XL2A 3MMYA 2B5MA 4CZYA 4X63B 3RLMD 3J80g 3N0DA 4BH6A 5AJAA 3KRXB 2PM7B 3J81g 2H14A 2XYIA 4A0BA 4O9DA 3I7KA 5EMKB 2H9PA 3SLED 2YMUA 4UI9R 3A0FA 2CN3A 2GNQA 4J86A 4JSXC 4LG8A 1XHMA 3V9FA 3UKRC 4ESGA 4ZN4A 2IWFA 4E54B 4L3HD 3FRXA 1U4CA 5H14A 3UVNA 3C9CA 5EAMA 5TF2A 5K1CC 4A09A 3FM0A 2YNOA 3IJ1A 4U7AA 5FXYA 1JOFA 3UVLA 3OKTA 4J8BA 3I7LA 2HYEA 4PSXB 5IC7A 1XIPA 1QNIA 3IKOA 1VYHC 1PBYB 3L4OD 4QRJA 4CI1A 2PM9A 3I2NA 4D6VA 2CO0C 4Z8LA 3SHFA 3JZGA 4U1EI 3IIWA 4PNKB 5EMMB 5EMJB 2IAAA 5TEEA 3MZLA 1B9XA 2W18A 3ODTA 2OVQB 1PGUA 4HDJA 4NSXA 2BBKH 3EU7A 2P9SC 4FB1D 2UZYB 2P9PC 4XYHA 4JSPC 3K27A 3EI3A 3I7NA 4TZ4A 5EMLB 4ERQA 2Z2OA 3EG6A 4GM3A 4XYIA 4E5ZA 2AGZA 3C99A 3W15A 1GP2B 3ORVD 4H5IA 5HE0B 3RSEC 3SCYA 2XU7A 4CY1A 2CO0A 3EI2A 5EAPA 1OLZA 3EI1A 3PSLA 4J87A 3MKQA 4J73A 4X3EA 2AH1A 3DXMC 2EBSA 4GGAA 1SQ9A 3JRPA 2AGYA 4I79A 4A0AA 4R7AB 2G9AA 5C2WB 4A09B 2P9IC 2H13A 3DSMA 2H47A 1S4UX 3P4FA 2J57G 3JROA 3MXXA 3OL2B 3F3PA 3EI4A 4GQ2P 2J56H 3AH8B 4ZOYA 3V5WB 5IT9g 5EARA 3N0EA 2CNXA 3RN0D 3I7HA 2H9MA 3IIYA 3UVMA 4FA1D 4PXWA 3KRWB 1JJUB 5C2VB 2TRCB 1N6DA 1JMZB 3EI4B 4L1QD 4J81A 4OWRA 4X60B 3V7DB 2HKRA 3PE7A 4J84A 1K32A 2UZXB 4O3UB 3SWSD 3AFCA 3UVKA 1L0QA 1N6FA 5CXBA 4CZXA 2AQ5A 2I0TA 2IUPA 1P22A 1TBGA 4CY3A 4GZ8A 4PBZA 4GGCA 3RMZD 2G99A 4FA5D 4CY5A 5H17A 2HESX 3JAMg 3F3FA 4CI8A 3BG1A 4CZVA 3EI1B 3I7OA 2HJBA 3F3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3X A;  2CE8 A;  2H9N A;  4Y5R D;  1GOT B;  5FKT A;  3VGZ A;  4JT5 C;  2P9L C;  3SBP A;  4QL1 A;  5H1M A;  2IWK A;  3SN6 B;  4A08 A;  1MG2 A;  4PBY A;  3CFS B;  2P9N C;  2AGL A;  4J82 A;  3SMR A;  1ERJ A;  2BCJ B;  4K3J B;  3UR4 A;  4J0W A;  3I89 A;  5I5I A;  4E54 A;  2Z2P A;  3DWL C;  3C5M A;  3OKW A;  2HKM A;  3VH0 A;  1K8K C;  3B7F A;  2CN2 A;  3PVW B;  5THA A;  4AOW A;  1RI6 A;  5HQG A;  3RRM C;  1PI6 A;  4O45 A;  4O1Q D;  3GFC A;  3BG0 A;  3CFV A;  3U4Y A;  5HE3 B;  3AL8 A;  1NEX B;  4E5Z B;  4GQ1 A;  1SQJ A;  3PVU B;  4FHL A;  4IA9 A;  5CYK A;  5B4W A;  2QC5 A;  2OVP B;  4JSV C;  5KDO B;  4IMM A;  3RFG A;  4ZOX A;  3NVQ A;  2OIZ A;  2H9L A;  2QXV A;  3OW8 A;  2B5L A;  4A0B B;  3BWS A;  4EWR A;  3PXW D;  5TDH B;  4G56 B;  3K26 A;  4A11 B;  2HXC A;  2I0R A;  2I3T A;  3JB9 L;  1Q47 A;  5HE2 B;  4Y7R A;  4J0X A;  4GMB A;  5I5M A;  2O9K A;  2Q7Q A;  1PEV A;  2AGX A;  4ERY A;  3AL9 A;  3SBQ A;  4CC9 A;  2GC4 A;  2I3S A;  3I8C A;  5IJ8 E;  4PC0 A;  2GC7 A;  3ULE C;  1GXR A;  2B4E A;  4J8G A;  1U2V C;  3L4M D;  5K19 A;  2YB8 B;  3UKU C;  1NR0 A;  1N6E A;  2IUV A;  5FA5 B;  4GM8 A;  5GXI A;  3NVN A;  3UVO A;  5HYN B;  2OK6 A;  3SXT D;  2IUR A;  1MDA H;  1XKS A;  3SBR A;  5TEF A;  1A0R B;  4A7J A;  1FWX A;  2P9U C;  4X61 B;  2Z2N A;  3NVX A;  4AEZ A;  1TYQ C;  3JZN A;  4JT6 C;  5IGQ A;  3IJC A;  4A2L A;  5GXH A;  4FAV D;  3AL8 B;  2H6N A;  3EMH A;  4FAN D;  5HE1 B;  5EAL A;  4J79 A;  4LGN A;  4K3I D;  5FQD A;  5SXM A;  2YNP A;  4J78 A;  4QQE A;  3DM0 A;  5CXC B;  3MZK A;  3OKY B;  4JXM A;  3PSC B;  2HJ4 A;  2H68 A;  3OL2 A;  4JSN C;  2YBA A;  2IUQ A;  4XEI C;  1YFQ A;  2PBI B;  5CXC A;  4FA9 D;  4A08 B;  5CXB B;  4PSW B;  3OKY A;  5IGO A;  5EM2 A;  3EI2 B;  4A11 A;  1GG2 B;  4MK0 B;  2MTA H;  5A2Q g;  4OZU A;  2CE9 A;  5GMK n;  5FKS A;  3VA6 A;  4O3T B;  4FA4 D;  2XL3 A;  4D0K A;  3SFZ A;  4QT8 A;  2PM9 B;  4ES0 A;  3MKS B;  4CI3 A;  5IJ7 E;  4GGD A;  4A2M A;  2J55 H;  3SVW D;  4BL0 A;  3EI3 B;  5FLX g;  1SHY B;  4L9O A;  3RN1 D;  1B9Y A;  2OVR B;  4GQB B;  4LG9 A;  5C9Z B;  5CYK B;  3I8E A;  1MG3 A;  3DXK C;  3E0C A;  3PXT D;  3FGB A;  2H6K A;  4BUJ C;  2P9K C;  2I0S A;  2OJY A;  3SJL D;  3GRE A;  4H5J A;  3IJ0 A;  4GM9 A;  5AMS A;  3EWE A;  3OTT A;  3HFQ A;  3RFH A;  3CIK B;  1OMW B;  4ERZ A;  4ZOV A;  3I7P A;  3C75 H;  3PXS D;  4YVD A;  4CI2 A;  2B5N A;  5JWZ A;  5I5J A;  4FWW A;  5AFU 3;  1JMX B;  1R5M A;  2PM6 B;  2AH0 A;  4J77 A;  2AGW A;  5FKR A;  5FKQ A;  4ZOZ A;  4JD2 C;  2YNN A;  4CY2 A;  2H6Q A;  4L3G D;  3JPX A;  3JZH A;  3ZWL B;  5GSA A;  5EM2 B;  4A0A B;  2OK4 A;  4KFM B;  4N14 A;  2XL2 A;  3MMY A;  2B5M A;  4CZY A;  4X63 B;  3RLM D;  3J80 g;  3N0D A;  4BH6 A;  5AJA A;  3KRX B;  2PM7 B;  3J81 g;  2H14 A;  2XYI A;  4A0B A;  4O9D A;  3I7K A;  5EMK B;  2H9P A;  3SLE D;  2YMU A;  4UI9 R;  3A0F A;  2CN3 A;  2GNQ A;  4J86 A;  4JSX C;  4LG8 A;  1XHM A;  3V9F A;  3UKR C;  4ESG A;  4ZN4 A;  2IWF A;  4E54 B;  4L3H D;  3FRX A;  1U4C A;  5H14 A;  3UVN A;  3C9C A;  5EAM A;  5TF2 A;  5K1C C;  4A09 A;  3FM0 A;  2YNO A;  3IJ1 A;  4U7A A;  5FXY A;  1JOF A;  3UVL A;  3OKT A;  4J8B A;  3I7L A;  2HYE A;  4PSX B;  5IC7 A;  1XIP A;  1QNI A;  3IKO A;  1VYH C;  1PBY B;  3L4O D;  4QRJ A;  4CI1 A;  2PM9 A;  3I2N A;  4D6V A;  2CO0 C;  4Z8L A;  3SHF A;  3JZG A;  4U1E I;  3IIW A;  4PNK B;  5EMM B;  5EMJ B;  2IAA A;  5TEE A;  3MZL A;  1B9X A;  2W18 A;  3ODT A;  2OVQ B;  1PGU A;  4HDJ A;  4NSX A;  2BBK H;  3EU7 A;  2P9S C;  4FB1 D;  2UZY B;  2P9P C;  4XYH A;  4JSP C;  3K27 A;  3EI3 A;  3I7N A;  4TZ4 A;  5EML B;  4ERQ A;  2Z2O A;  3EG6 A;  4GM3 A;  4XYI A;  4E5Z A;  2AGZ A;  3C99 A;  3W15 A;  1GP2 B;  3ORV D;  4H5I A;  5HE0 B;  3RSE C;  3SCY A;  2XU7 A;  4CY1 A;  2CO0 A;  3EI2 A;  5EAP A;  1OLZ A;  3EI1 A;  3PSL A;  4J87 A;  3MKQ A;  4J73 A;  4X3E A;  2AH1 A;  3DXM C;  2EBS A;  4GGA A;  1SQ9 A;  3JRP A;  2AGY A;  4I79 A;  4A0A A;  4R7A B;  2G9A A;  5C2W B;  4A09 B;  2P9I C;  2H13 A;  3DSM A;  2H47 A;  1S4U X;  3P4F A;  2J57 G;  3JRO A;  3MXX A;  3OL2 B;  3F3P A;  3EI4 A;  4GQ2 P;  2J56 H;  3AH8 B;  4ZOY A;  3V5W B;  5IT9 g;  5EAR A;  3N0E A;  2CNX A;  3RN0 D;  3I7H A;  2H9M A;  3IIY A;  3UVM A;  4FA1 D;  4PXW A;  3KRW B;  1JJU B;  5C2V B;  2TRC B;  1N6D A;  1JMZ B;  3EI4 B;  4L1Q D;  4J81 A;  4OWR A;  4X60 B;  3V7D B;  2HKR A;  3PE7 A;  4J84 A;  1K32 A;  2UZX B;  4O3U B;  3SWS D;  3AFC A;  3UVK A;  1L0Q A;  1N6F A;  5CXB A;  4CZX A;  2AQ5 A;  2I0T A;  2IUP A;  1P22 A;  1TBG A;  4CY3 A;  4GZ8 A;  4PBZ A;  4GGC A;  3RMZ D;  2G99 A;  4FA5 D;  4CY5 A;  5H17 A;  2HES X;  3JAM g;  3F3F A;  4CI8 A;  3BG1 A;  4CZV A;  3EI1 B;  3I7O A;  2HJB A;  3F3G A; 
#chains in the Genus database with same CATH topology
 2H3X A;  2CE8 A;  2H9N A;  4Y5R D;  1GOT B;  5FKT A;  3VGZ A;  4JT5 C;  2P9L C;  3SBP A;  4QL1 A;  5H1M A;  2IWK A;  3SN6 B;  4A08 A;  1MG2 A;  4PBY A;  3CFS B;  2P9N C;  2AGL A;  4J82 A;  3SMR A;  1ERJ A;  2BCJ B;  1C9I A;  4K3J B;  4J0W A;  3UR4 A;  3I89 A;  5I5I A;  4E54 A;  2Z2P A;  1VZ3 A;  1JTD B;  1T2X A;  3DWL C;  3C5M A;  3OKW A;  2HKM A;  2VZ1 A;  3VH0 A;  1K8K C;  3B7F A;  2CN2 A;  3PVW B;  4MMZ A;  5THA A;  4AOW A;  1RI6 A;  1QFS A;  5HQG A;  3RRM C;  1U8C A;  1PI6 A;  4O45 A;  4O1Q D;  3GFC A;  1VE7 A;  1BPO A;  3BG0 A;  2VC2 A;  3CFV A;  3U4Y A;  4L1M A;  5HE3 B;  4Z7O A;  3AL8 A;  1NEX B;  2WQ8 A;  4E5Z B;  4GQ1 A;  2BKL A;  1SQJ A;  3PVU B;  4FHL A;  4IA9 A;  5CYK A;  5B4W A;  2QC5 A;  3GD1 I;  2OVP B;  4JSV C;  3IUJ A;  5KDO B;  4IMM A;  3RFG A;  4ZOX A;  3NVQ A;  2OIZ A;  2H9L A;  2QXV A;  3OW8 A;  2B5L A;  4A0B B;  3BWS A;  3FCU A;  4EWR A;  5C86 A;  3PXW D;  5TDH B;  4G56 B;  3K26 A;  2VDM A;  4A11 B;  2HXC A;  2I0R A;  2I3T A;  3JB9 L;  3ZDY A;  1Q47 A;  2VDO A;  5HE2 B;  4Y7R A;  4J0X A;  4GMB A;  5I5M A;  2O9K A;  2Q7Q A;  1PEV A;  2AGX A;  4ERY A;  2JKX A;  2EID A;  3AL9 A;  3SBQ A;  4CC9 A;  2GC4 A;  2I3S A;  3I8C A;  5IJ8 E;  4PC0 A;  2GC7 A;  3ULE C;  1GXR A;  2B4E A;  4J8G A;  5M5V A;  1U2V C;  3L4M D;  5K19 A;  2YB8 B;  4WK0 A;  1NR0 A;  1N6E A;  2IUV A;  3UKU C;  1GOG A;  4NC4 A;  5FA5 B;  1H2W A;  4GM8 A;  5GXI A;  3NVN A;  5E6R A;  3UVO A;  5HYN B;  2OK6 A;  3SXT D;  2IUR A;  1MDA H;  1XKS A;  3EQ9 A;  5TEF A;  1A0R B;  3SBR A;  4A7J A;  5FFO A;  1FWX A;  2P9U C;  4X61 B;  2Z2N A;  3NVX A;  4AEZ A;  1TYQ C;  3JZN A;  4JT6 C;  5IGQ A;  3IJC A;  4A2L A;  3FCS A;  5GXH A;  4G1E A;  4FAV D;  3AL8 B;  2H6N A;  3EMH A;  4FAN D;  5HE1 B;  5EAL A;  3QI0 A;  4J79 A;  1UTC A;  4LGN A;  4K3I D;  5FQD A;  5SXM A;  4BCD A;  2YNP A;  3NID A;  2QR5 A;  4J78 A;  4QQE A;  3DM0 A;  2VDQ A;  3O4J A;  5CXC B;  1H2Z A;  3MZK A;  3OKY B;  4JXM A;  4AMY A;  3PSC B;  2HJ4 A;  2H68 A;  3OL2 A;  5M5S A;  4JSN C;  2YBA A;  2VDL A;  2IUQ A;  4XEI C;  3VI3 A;  4AN0 A;  1YFQ A;  4WJK A;  2PBI B;  2VDK A;  5CXC A;  4FA9 D;  4A08 B;  1O6F A;  5CXB B;  4PSW B;  1A12 A;  3OKY A;  3IUL A;  5IGO A;  2QZP A;  1H2X A;  3ZE1 A;  5EM2 A;  3EI2 B;  3MUN A;  4A11 A;  1GG2 B;  4DNW A;  4MK0 B;  2MTA H;  5A2Q g;  4OZU A;  2CE9 A;  5GMK n;  5FKS A;  3VI4 A;  3VA6 A;  2VZ3 A;  4O3T B;  4FA4 D;  1M1X A;  3KCI A;  5M61 A;  2XL3 A;  4D0K A;  3SFZ A;  2EIB A;  4QT8 A;  2PM9 B;  4ES0 A;  3MKS B;  4CI3 A;  5IJ7 E;  4GGD A;  5M5R A;  4JHP C;  5HDB A;  4A2M A;  1UOP A;  3ZDZ A;  2J55 H;  3SVW D;  3IVM A;  4BL0 A;  1YR2 A;  3EI3 B;  5FLX g;  1GOF A;  1SHY B;  4L9O A;  3RN1 D;  1B9Y A;  2OVR B;  4GQB B;  4LG9 A;  5C9Z B;  5CYK B;  4DNV A;  3I8E A;  1MG3 A;  3DXK C;  3E0C A;  3PXT D;  3FGB A;  5M5U A;  2H6K A;  4BUJ C;  2P9K C;  2I0S A;  2OJY A;  3SJL D;  3GRE A;  4H5J A;  3IJ0 A;  4GM9 A;  5AMS A;  3EWE A;  3OTT A;  3HFQ A;  3RFH A;  3CIK B;  1OMW B;  4ERZ A;  4ZOV A;  4G55 A;  3I7P A;  3C75 H;  3PXS D;  4YVD A;  3GC3 B;  2B5N A;  4CI2 A;  5JWZ A;  5I5J A;  4FWW A;  5AFU 3;  1JMX B;  1R5M A;  2PM6 B;  2AH0 A;  4J77 A;  2AGW A;  5FKR A;  5FKQ A;  2XDW A;  4Z7Q A;  4ZOZ A;  4JD2 C;  2YNN A;  3O4G A;  4WK4 A;  3IUN A;  4CY2 A;  2H6Q A;  4L3G D;  3JPX A;  3O4H A;  3JZH A;  3ZWL B;  5GSA A;  5EM2 B;  4NBM A;  3T3M A;  4A0A B;  2OK4 A;  4KFM B;  4N14 A;  2XL2 A;  4IRZ A;  3MMY A;  2B5M A;  4CZY A;  4X63 B;  4BP8 A;  3NIG A;  3RLM D;  3J80 g;  3N0D A;  1K3I A;  4BH6 A;  5AJA A;  3KRX B;  2PM7 B;  3J81 g;  2H14 A;  2XYI A;  4A0B A;  2EIC A;  4O9D A;  3I7K A;  5EMK B;  2H9P A;  3SLE D;  4RE6 A;  1JV2 A;  2YMU A;  1E8M A;  4UI9 R;  3A0F A;  2VDP A;  3EQ7 A;  2CN3 A;  2GNQ A;  4J86 A;  4JSX C;  1E8N A;  4LG8 A;  1XHM A;  3V9F A;  3UKR C;  4ESG A;  4UM9 A;  4ZN4 A;  4D9S A;  2IWF A;  4E54 B;  4L3H D;  4MMY A;  3FRX A;  1U4C A;  5H14 A;  1O6G A;  3UVN A;  2XZG A;  3C9C A;  5EAM A;  3ZDX A;  5TF2 A;  1I2M B;  2EIE A;  5K1C C;  4DNU A;  1VZ2 A;  5E6U A;  3FM0 A;  4A09 A;  2YNO A;  3IJ1 A;  4U7A A;  5FXY A;  1JOF A;  3UVL A;  3OKT A;  4J8B A;  4RE5 A;  4G1M A;  3I7L A;  2HYE A;  4PSX B;  5IC7 A;  2HU7 A;  1XIP A;  1QNI A;  3IKO A;  1VYH C;  2HU5 A;  1PBY B;  3IJE A;  3L4O D;  4QRJ A;  4CI1 A;  1UOO A;  2PM9 A;  3I2N A;  3K72 A;  2CO0 C;  4Z8L A;  4D6V A;  3SHF A;  3JZG A;  3IUM A;  4U1E I;  4O02 A;  3IIW A;  4PNK B;  1QFM A;  5EMM B;  5EMJ B;  2IAA A;  5TEE A;  3T3P A;  3MZL A;  1B9X A;  2W18 A;  3ODT A;  2OVQ B;  1PGU A;  4HDJ A;  5C92 A;  4NSX A;  2BBK H;  3EQ8 A;  3EU7 A;  4UM8 A;  2P9S C;  4FB1 D;  2UZY B;  2P9P C;  4XYH A;  4NEN A;  1TYE A;  4JSP C;  3K27 A;  3EI3 A;  3I7N A;  4TZ4 A;  5E6S A;  5EML B;  4ERQ A;  2Z2O A;  2VDN A;  3EG6 A;  4GM3 A;  1VE6 A;  4XYI A;  4E5Z A;  2AGZ A;  4AX4 A;  4BCB A;  3C99 A;  3W15 A;  1GP2 B;  3ORV D;  1E5T A;  4H5I A;  5HE0 B;  3RSE C;  3SCY A;  2XU7 A;  4CY1 A;  2CO0 A;  3EI2 A;  5EAP A;  1OLZ A;  3EI1 A;  3PSL A;  4MMX A;  4J87 A;  3MKQ A;  3DDU A;  4J73 A;  2VDR A;  4AN1 A;  4X3E A;  4AMZ A;  2AH1 A;  4BCC A;  3DXM C;  2EBS A;  4GGA A;  4JHN A;  1SQ9 A;  3JRP A;  2AGY A;  4I79 A;  4A0A A;  4R7A B;  2G9A A;  3V4P A;  5C2W B;  2P9I C;  4A09 B;  2H13 A;  3DSM A;  1L5G A;  2H47 A;  1S4U X;  3P4F A;  2J57 G;  3JRO A;  3MXX A;  3QHY B;  3OL2 B;  3F3P A;  2HU8 A;  1H2Y A;  3EI4 A;  4GQ2 P;  2J56 H;  3AH8 B;  4ZOY A;  3V5W B;  5IT9 g;  4WK2 A;  5EAR A;  3N0E A;  2CNX A;  3RN0 D;  1UOQ A;  3I7H A;  2H9M A;  3IIY A;  3UVM A;  4FA1 D;  4PXW A;  3KRW B;  1JJU B;  3ZE0 A;  5C2V B;  2TRC B;  1N6D A;  1JMZ B;  3EI4 B;  1C9L A;  1GOH A;  3IUR A;  4L1Q D;  4J81 A;  4OWR A;  4X60 B;  3V7D B;  2HKR A;  4QAM A;  3PE7 A;  3NIF A;  3ZE2 A;  4J84 A;  1K32 A;  2UZX B;  3IUQ A;  4O3U B;  3SWS D;  3AFC A;  3UVK A;  1L0Q A;  1N6F A;  5CXB A;  4Z7N A;  4CZX A;  2AQ5 A;  2I0T A;  2IUP A;  4O2W A;  1P22 A;  1TBG A;  3K6S A;  4CY3 A;  4GZ8 A;  4PBZ A;  4GGC A;  3RMZ D;  2G99 A;  3K71 A;  4FA5 D;  4CY5 A;  5H17 A;  3V4V A;  2HES X;  4BP9 A;  3O4I A;  3JAM g;  3F3F A;  4CI8 A;  3BG1 A;  3MVD K;  3MUO A;  4CZV A;  4NAA A;  3EI1 B;  3OF7 A;  3I7O A;  5M5T A;  2HJB A;  3F3G A;  2XE4 A;  5FFG A; 
#chains in the Genus database with same CATH homology
 2H3X A;  2CE8 A;  2H9N A;  4Y5R D;  1GOT B;  5FKT A;  3VGZ A;  4JT5 C;  2P9L C;  3SBP A;  4QL1 A;  5H1M A;  2IWK A;  3SN6 B;  4A08 A;  1MG2 A;  4PBY A;  3CFS B;  2P9N C;  2AGL A;  4J82 A;  3SMR A;  1ERJ A;  2BCJ B;  4K3J B;  3UR4 A;  4J0W A;  3I89 A;  5I5I A;  4E54 A;  2Z2P A;  3DWL C;  3C5M A;  3OKW A;  2HKM A;  3VH0 A;  1K8K C;  3B7F A;  2CN2 A;  3PVW B;  5THA A;  4AOW A;  1RI6 A;  5HQG A;  3RRM C;  1PI6 A;  4O45 A;  4O1Q D;  3GFC A;  3BG0 A;  3CFV A;  3U4Y A;  5HE3 B;  3AL8 A;  1NEX B;  4E5Z B;  4GQ1 A;  1SQJ A;  3PVU B;  4FHL A;  4IA9 A;  5CYK A;  5B4W A;  2QC5 A;  2OVP B;  4JSV C;  5KDO B;  4IMM A;  3RFG A;  4ZOX A;  3NVQ A;  2OIZ A;  2H9L A;  2QXV A;  3OW8 A;  2B5L A;  4A0B B;  3BWS A;  4EWR A;  3PXW D;  5TDH B;  4G56 B;  3K26 A;  4A11 B;  2HXC A;  2I0R A;  2I3T A;  3JB9 L;  1Q47 A;  5HE2 B;  4Y7R A;  4J0X A;  4GMB A;  5I5M A;  2O9K A;  2Q7Q A;  1PEV A;  2AGX A;  4ERY A;  3AL9 A;  3SBQ A;  4CC9 A;  2GC4 A;  2I3S A;  3I8C A;  5IJ8 E;  4PC0 A;  2GC7 A;  3ULE C;  1GXR A;  2B4E A;  4J8G A;  1U2V C;  3L4M D;  5K19 A;  2YB8 B;  3UKU C;  1NR0 A;  1N6E A;  2IUV A;  5FA5 B;  4GM8 A;  5GXI A;  3NVN A;  3UVO A;  5HYN B;  2OK6 A;  3SXT D;  2IUR A;  1MDA H;  1XKS A;  3SBR A;  5TEF A;  1A0R B;  4A7J A;  1FWX A;  2P9U C;  4X61 B;  2Z2N A;  3NVX A;  4AEZ A;  1TYQ C;  3JZN A;  4JT6 C;  5IGQ A;  3IJC A;  4A2L A;  5GXH A;  4FAV D;  3AL8 B;  2H6N A;  3EMH A;  4FAN D;  5HE1 B;  5EAL A;  4J79 A;  4LGN A;  4K3I D;  5FQD A;  5SXM A;  2YNP A;  4J78 A;  4QQE A;  3DM0 A;  5CXC B;  3MZK A;  3OKY B;  4JXM A;  3PSC B;  2HJ4 A;  2H68 A;  3OL2 A;  4JSN C;  2YBA A;  2IUQ A;  4XEI C;  1YFQ A;  2PBI B;  5CXC A;  4FA9 D;  4A08 B;  5CXB B;  4PSW B;  3OKY A;  5IGO A;  5EM2 A;  3EI2 B;  4A11 A;  1GG2 B;  4MK0 B;  2MTA H;  5A2Q g;  4OZU A;  2CE9 A;  5GMK n;  5FKS A;  3VA6 A;  4O3T B;  4FA4 D;  2XL3 A;  4D0K A;  3SFZ A;  4QT8 A;  2PM9 B;  4ES0 A;  3MKS B;  4CI3 A;  5IJ7 E;  4GGD A;  4A2M A;  2J55 H;  3SVW D;  4BL0 A;  3EI3 B;  5FLX g;  1SHY B;  4L9O A;  3RN1 D;  1B9Y A;  2OVR B;  4GQB B;  4LG9 A;  5C9Z B;  5CYK B;  3I8E A;  1MG3 A;  3DXK C;  3E0C A;  3PXT D;  3FGB A;  2H6K A;  4BUJ C;  2P9K C;  2I0S A;  2OJY A;  3SJL D;  3GRE A;  4H5J A;  3IJ0 A;  4GM9 A;  5AMS A;  3EWE A;  3OTT A;  3HFQ A;  3RFH A;  3CIK B;  1OMW B;  4ERZ A;  4ZOV A;  3I7P A;  3C75 H;  3PXS D;  4YVD A;  4CI2 A;  2B5N A;  5JWZ A;  5I5J A;  4FWW A;  5AFU 3;  1JMX B;  1R5M A;  2PM6 B;  2AH0 A;  4J77 A;  2AGW A;  5FKR A;  5FKQ A;  4ZOZ A;  4JD2 C;  2YNN A;  4CY2 A;  2H6Q A;  4L3G D;  3JPX A;  3JZH A;  3ZWL B;  5GSA A;  5EM2 B;  4A0A B;  2OK4 A;  4KFM B;  4N14 A;  2XL2 A;  3MMY A;  2B5M A;  4CZY A;  4X63 B;  3RLM D;  3J80 g;  3N0D A;  4BH6 A;  5AJA A;  3KRX B;  2PM7 B;  3J81 g;  2H14 A;  2XYI A;  4A0B A;  4O9D A;  3I7K A;  5EMK B;  2H9P A;  3SLE D;  2YMU A;  4UI9 R;  3A0F A;  2CN3 A;  2GNQ A;  4J86 A;  4JSX C;  4LG8 A;  1XHM A;  3V9F A;  3UKR C;  4ESG A;  4ZN4 A;  2IWF A;  4E54 B;  4L3H D;  3FRX A;  1U4C A;  5H14 A;  3UVN A;  3C9C A;  5EAM A;  5TF2 A;  5K1C C;  4A09 A;  3FM0 A;  2YNO A;  3IJ1 A;  4U7A A;  5FXY A;  1JOF A;  3UVL A;  3OKT A;  4J8B A;  3I7L A;  2HYE A;  4PSX B;  5IC7 A;  1XIP A;  1QNI A;  3IKO A;  1VYH C;  1PBY B;  3L4O D;  4QRJ A;  4CI1 A;  2PM9 A;  3I2N A;  4D6V A;  2CO0 C;  4Z8L A;  3SHF A;  3JZG A;  4U1E I;  3IIW A;  4PNK B;  5EMM B;  5EMJ B;  2IAA A;  5TEE A;  3MZL A;  1B9X A;  2W18 A;  3ODT A;  2OVQ B;  1PGU A;  4HDJ A;  4NSX A;  2BBK H;  3EU7 A;  2P9S C;  4FB1 D;  2UZY B;  2P9P C;  4XYH A;  4JSP C;  3K27 A;  3EI3 A;  3I7N A;  4TZ4 A;  5EML B;  4ERQ A;  2Z2O A;  3EG6 A;  4GM3 A;  4XYI A;  4E5Z A;  2AGZ A;  3C99 A;  3W15 A;  1GP2 B;  3ORV D;  4H5I A;  5HE0 B;  3RSE C;  3SCY A;  2XU7 A;  4CY1 A;  2CO0 A;  3EI2 A;  5EAP A;  1OLZ A;  3EI1 A;  3PSL A;  4J87 A;  3MKQ A;  4J73 A;  4X3E A;  2AH1 A;  3DXM C;  2EBS A;  4GGA A;  1SQ9 A;  3JRP A;  2AGY A;  4I79 A;  4A0A A;  4R7A B;  2G9A A;  5C2W B;  4A09 B;  2P9I C;  2H13 A;  3DSM A;  2H47 A;  1S4U X;  3P4F A;  2J57 G;  3JRO A;  3MXX A;  3OL2 B;  3F3P A;  3EI4 A;  4GQ2 P;  2J56 H;  3AH8 B;  4ZOY A;  3V5W B;  5IT9 g;  5EAR A;  3N0E A;  2CNX A;  3RN0 D;  3I7H A;  2H9M A;  3IIY A;  3UVM A;  4FA1 D;  4PXW A;  3KRW B;  1JJU B;  5C2V B;  2TRC B;  1N6D A;  1JMZ B;  3EI4 B;  4L1Q D;  4J81 A;  4OWR A;  4X60 B;  3V7D B;  2HKR A;  3PE7 A;  4J84 A;  1K32 A;  2UZX B;  4O3U B;  3SWS D;  3AFC A;  3UVK A;  1L0Q A;  1N6F A;  5CXB A;  4CZX A;  2AQ5 A;  2I0T A;  2IUP A;  1P22 A;  1TBG A;  4CY3 A;  4GZ8 A;  4PBZ A;  4GGC A;  3RMZ D;  2G99 A;  4FA5 D;  4CY5 A;  5H17 A;  2HES X;  3JAM g;  3F3F A;  4CI8 A;  3BG1 A;  4CZV A;  3EI1 B;  3I7O A;  2HJB A;  3F3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...