3SXTD

Crystal structure of the quinol form of methylamine dehydrogenase in complex with the diferrous form of maug
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
375
structure length
375
Chain Sequence
b'ETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG
rcsb
molecule keywords Methylamine utilization protein MauG
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 99
structure length 375
sequence length 375
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sxtD00
3I7OA 4A08A 3MKQA 1XKSA 3UVMA 5FXYA 4KFMB 2GC7A 4MK0B 2P9UC 2PM9B 3I2NA 5K1CC 4FA5D 1B9XA 2I0SA 1PI6A 2OVRB 1SQJA 4CZYA 5HYNB 3SWSD 4JSNC 5GMKn 1N6FA 3SHFA 1U2VC 1GG2B 3SLED 5IGQA 3L4MD 3RFHA 2P9LC 4J79A 3EU7A 2HYEA 3VGZA 3EI3A 3JZHA 4J81A 2Z2PA 4AOWA 3AH8B 4LG9A 1Q47A 3JPXA 1PBYB 4FWWA 4IA9A 3MMYA 3BG0A 2OK4A 4LGNA 4H5IA 2YNOA 4JSVC 3IJ0A 3SBRA 3FGBA 2B5MA 5HE2B 1QNIA 3SFZA 4FHLA 3HFQA 3IIWA 4A09A 2H47A 2AGZA 2B5NA 3CIKB 3BWSA 5AFU3 5AMSA 4AEZA 5IJ7E 5CYKA 5FKQA 2AH0A 4X63B 4CY5A 5GXIA 4LG8A 4BUJC 1GXRA 2P9PC 3PE7A 3N0EA 1SHYB 3CFVA 3NVXA 4GM9A 4EWRA 2IUPA 3C75H 2GC4A 5B4WA 5C2VB 5EARA 4A0AA 3CFSB 3A0FA 2IURA 2XL3A 5EMKB 2AGXA 5GSAA 4NSXA 3RSEC 3E0CA 3PSLA 3JRPA 2AQ5A 1PEVA 2G99A 4PXWA 3OKYA 4XYHA 3UVOA 5EMMB 4G56B 1GOTB 3IJCA 3V9FA 5EM2A 3JROA 3SJLD 4FAND 5TEFA 3I8CA 5SXMA 3RN1D 5C9ZB 4ZOXA 4Z8LA 4CI2A 1ERJA 2H3XA 3JZGA 2CE8A 1A0RB 1NR0A 3EI2A 4CI1A 4GZ8A 4QRJA 5EALA 3RMZD 4CY3A 1MG3A 4HDJA 4R7AB 5FLXg 4U1EI 3FRXA 3ORVD 3EI3B 4PSXB 2BBKH 5AJAA 3EWEA 4PBYA 4D0KA 3EI4A 4CI8A 3J81g 2HKMA 4A11A 4A2LA 3DWLC 4XEIC 3NVNA 3K27A 2YB8B 4FA4D 2Z2OA 2AGLA 2I3TA 5IJ8E 1OLZA 3N0DA 4J77A 3SBPA 1RI6A 4A09B 1PGUA 1B9YA 5IGOA 5CYKB 4N14A 3GFCA 4BL0A 2YMUA 3K26A 4XYIA 3V7DB 2P9SC 2PBIB 2TRCB 1JOFA 3ODTA 4ZOVA 3AL8A 3OL2A 3SMRA 2Q7QA 2H68A 5HQGA 2HKRA 4A0AB 3OTTA 2OVPB 1N6DA 4CZVA 3AFCA 3PXWD 3I7PA 5I5MA 3RLMD 2PM7B 4PC0A 2P9KC 2QXVA 3OKYB 4JD2C 2W18A 4QT8A 4JSPC 5EMLB 4PBZA 5I5IA 5EM2B 2GNQA 3PSCB 5CXBA 3KRWB 4L3GD 2I0RA 2OK6A 2EBSA 3JAMg 3VH0A 1GP2B 2AGYA 2Z2NA 4L3HD 3AL9A 1S4UX 2CN2A 3U4YA 2YNPA 3EI2B 3C9CA 5KDOB 3PVWB 3W15A 4X3EA 2H6NA 3PVUB 3J80g 4ZN4A 4GGDA 4J84A 4ZOZA 4ES0A 5FA5B 1N6EA 4J87A 3EI4B 1FWXA 3OKWA 4JT6C 4A11B 4JXMA 4D6VA 2UZXB 4FA1D 4YVDA 1OMWB 4U7AA 4X60B 4Y5RD 1VYHC 4O45A 4CZXA 2H6KA 3DXKC 5IT9g 4K3JB 4FB1D 3RFGA 4E54A 4J0XA 2QC5A 4A0BA 1XHMA 4GMBA 1JMZB 2J55H 3IIYA 4CY2A 2XYIA 3B7FA 3F3GA 1MDAH 2H9LA 2MTAH 5THAA 2UZYB 4Y7RA 2H6QA 3I7HA 4UI9R 2OJYA 2AGWA 3AL8B 3OL2B 2I3SA 3I7KA 4PSWB 2I0TA 3EG6A 3L4OD 2HESX 5IC7A 1SQ9A 5CXCA 4QL1A 4X61B 2XL2A 2CNXA 4GGCA 4BH6A 3SBQA 4L9OA 3P4FA 3UVKA 3C5MA 3DSMA 5FKRA 3RN0D 5FKTA 4J82A 3FM0A 3OW8A 2P9IC 5CXBB 5K19A 5H17A 4J0WA 2J56H 4OZUA 4CY1A 4K3ID 3IKOA 1JMXB 4A2MA 1JJUB 4GM8A 3MZLA 4JSXC 3SVWD 5HE1B 2O9KA 4FAVD 3IJ1A 1YFQA 2H9MA 5C2WB 1R5MA 3EMHA 4ESGA 4FA9D 1NEXB 2IUVA 2IWFA 1U4CA 4A7JA 2HJBA 2YBAA 4GM3A 3EI1A 3JZNA 3I7NA 4QQEA 5EAPA 2CN3A 2HJ4A 3KRXB 1TYQC 3ZWLB 2PM9A 3UVNA 3SCYA 4J78A 1TBGA 2H9PA 4GGAA 4J86A 2XU7A 4CC9A 5HE0B 1MG2A 1K8KC 5TF2A 3GREA 2H13A 5GXHA 3UKUC 4E54B 2P9NC 2AH1A 4A0BB 4J73A 2B5LA 3UR4A 1XIPA 1P22A 3I89A 3OKTA 5FKSA 3SN6B 2B4EA 4ZOYA 4E5ZB 4CI3A 4JT5C 4O9DA 2OVQB 3RRMC 3UKRC 5FQDA 3ULEC 4O1QD 5EAMA 2H14A 3F3PA 2YNNA 2OIZA 1K32A 3UVLA 3MZKA 5CXCB 4ERYA 3BG1A 5EMJB 2CE9A 3DM0A 3MXXA 5TEEA 5I5JA 2G9AA 3PXTD 3VA6A 4ERZA 3SXTD 3C99A 3PXSD 2CO0A 5TDHB 4A08B 3F3FA 2H9NA 2J57G 4J8BA 4J8GA 2HXCA 5H14A 4O3TB 4E5ZA 3DXMC 4L1QD 4ERQA 4GQBB 1L0QA 2IWKA 3NVQA 3I7LA 2CO0C 4TZ4A 2PM6B 4PNKB 5H1MA 4GQ1A 4GQ2P 3JB9L 4O3UB 4I79A 4IMMA 3V5WB 5JWZA 4H5JA 2BCJB 3MKSB 4OWRA 3EI1B 3I8EA 2IUQA 2IAAA 5HE3B 5A2Qg
chains in the Genus database with same CATH superfamily
3I7OA 4A08A 3MKQA 1XKSA 3UVMA 5FXYA 4KFMB 2GC7A 4MK0B 2P9UC 2PM9B 3I2NA 4DNVA 5K1CC 2VZ3A 4FA5D 1B9XA 2I0SA 3IUNA 1PI6A 2OVRB 1SQJA 2XZGA 5E6UA 4CZYA 5HYNB 3SWSD 4JSNC 5GMKn 1N6FA 3SHFA 1U2VC 1GG2B 3SLED 5IGQA 3L4MD 3RFHA 2P9LC 4QAMA 4J79A 3EU7A 2HYEA 3VGZA 3EI3A 3JZHA 4J81A 1JV2A 2Z2PA 4AOWA 3AH8B 4NENA 3O4JA 1Q47A 4LG9A 3JPXA 1PBYB 4FWWA 4IA9A 3MMYA 3BG0A 2OK4A 1GOGA 4LGNA 4H5IA 2YNOA 4JSVC 3IJ0A 3SBRA 3FGBA 2B5MA 5HE2B 1QNIA 3SFZA 4FHLA 3HFQA 3IIWA 4A09A 2H47A 2AGZA 2B5NA 3CIKB 3BWSA 5AFU3 2VZ1A 5AMSA 4AEZA 1UOQA 2VDPA 5CYKA 5IJ7E 5FKQA 2AH0A 1C9IA 4X63B 4CY5A 5GXIA 1H2ZA 4LG8A 4BUJC 1GXRA 2P9PC 3PE7A 3N0EA 1SHYB 3CFVA 3NVXA 3OF7A 4GM9A 4EWRA 2IUPA 2EICA 3C75H 3T3PA 2GC4A 5B4WA 5C2VB 5EARA 5M5UA 3GC3B 3IUJA 4A0AA 3CFSB 3A0FA 3FCSA 5C92A 2IURA 5FFGA 2XL3A 5EMKB 2AGXA 2HU8A 5M5SA 5GSAA 4NSXA 3RSEC 3E0CA 4BCBA 2XDWA 3PSLA 3JRPA 2AQ5A 2QR5A 1PEVA 4WK4A 2G99A 3IUQA 4PXWA 3OKYA 4XYHA 3UVOA 5EMMB 4G56B 1GOTB 3IJCA 3K72A 3ZE0A 3V9FA 5EM2A 3JROA 3SJLD 4FAND 1E5TA 5TEFA 1UOOA 3I8CA 5SXMA 3RN1D 5C9ZB 4ZOXA 4Z8LA 4CI2A 1ERJA 1H2WA 2H3XA 3JZGA 4NC4A 2CE8A 1A0RB 1NR0A 3EI2A 4CI1A 4GZ8A 4QRJA 5EALA 2VDLA 3RMZD 4CY3A 3FCUA 1MG3A 4HDJA 4R7AB 5FLXg 3ZE2A 4U1EI 3FRXA 3ORVD 4WJKA 3EI3B 4PSXB 4BCCA 1GOFA 2VDMA 2BBKH 5AJAA 2BKLA 4JHNA 3EWEA 4PBYA 4D0KA 4MMZA 3EI4A 5HDBA 4AN0A 4MMXA 3IURA 4CI8A 3J81g 2HKMA 4A11A 4A2LA 1O6GA 3DWLC 4XEIC 3NVNA 3K27A 2YB8B 1U8CA 2Z2OA 4FA4D 2AGLA 3IULA 2I3TA 5IJ8E 3VI3A 3O4GA 3MUOA 1T2XA 1OLZA 3N0DA 4J77A 4BCDA 3SBPA 1RI6A 4A09B 3O4HA 1PGUA 4Z7OA 1B9YA 5IGOA 5M5RA 5CYKB 4N14A 3GFCA 4BL0A 2YMUA 1VZ3A 3K26A 4XYIA 3V7DB 2P9SC 1VE6A 2PBIB 2TRCB 1JOFA 1M1XA 3ODTA 4G1MA 4ZOVA 3AL8A 1K3IA 3OL2A 4WK2A 3SMRA 2Q7QA 2H68A 5HQGA 2HKRA 4A0AB 1C9LA 4AMYA 2WQ8A 3OTTA 2OVPB 1H2YA 1N6DA 4CZVA 3AFCA 3PXWD 3O4IA 1VE7A 3I7PA 5I5MA 3RLMD 2HU5A 2PM7B 4PC0A 4UM9A 2P9KC 2QXVA 2VDOA 1E8MA 3OKYB 4JD2C 1UOPA 3ZDYA 2W18A 5C86A 4QT8A 4JSPC 5EMLB 4PBZA 3V4PA 5I5IA 5EM2B 2GNQA 3PSCB 5CXBA 3KRWB 2JKXA 1H2XA 2I0RA 4L3GD 2OK6A 2EBSA 3JAMg 3VH0A 1GP2B 2AGYA 2Z2NA 5E6SA 4L3HD 3AL9A 1S4UX 2CN2A 3U4YA 2YNPA 3EI2B 3C9CA 5KDOB 4MMYA 3PVWB 3W15A 4X3EA 2H6NA 3PVUB 3J80g 2VDKA 4ZN4A 4GGDA 4J84A 4ZOZA 1E8NA 4ES0A 5FA5B 1N6EA 4J87A 3K6SA 3EI4B 3K71A 1FWXA 1L5GA 3OKWA 4JT6C 4A11B 3KCIA 4JXMA 4D6VA 2UZXB 4FA1D 4YVDA 1OMWB 1JTDB 4RE6A 4U7AA 4X60B 4Y5RD 1VYHC 4O45A 4CZXA 3V4VA 2H6KA 3DXKC 4NAAA 5IT9g 4K3JB 2VDNA 3IJEA 4FB1D 3RFGA 3NIGA 4E54A 4J0XA 2QC5A 5FFOA 4A0BA 1QFMA 1XHMA 4GMBA 1JMZB 2J55H 3IIYA 4CY2A 2XYIA 3B7FA 3F3GA 1MDAH 2H9LA 2MTAH 5THAA 2UZYB 4Y7RA 2H6QA 3I7HA 4UI9R 2OJYA 5M5VA 2AGWA 3AL8B 3OL2B 2I3SA 3I7KA 4PSWB 2I0TA 3EG6A 3L4OD 1UTCA 2HESX 5IC7A 1SQ9A 3EQ8A 5CXCA 4QL1A 4X61B 2XL2A 3MUNA 2CNXA 1TYEA 4GGCA 4BH6A 3SBQA 4L9OA 1I2MB 1QFSA 3P4FA 3UVKA 3C5MA 3DSMA 4BP8A 5FKRA 3RN0D 5FKTA 4AMZA 4DNWA 3QHYB 4J82A 3FM0A 3OW8A 2P9IC 5CXBB 2QZPA 5K19A 5H17A 4J0WA 2J56H 4OZUA 4CY1A 3NIDA 4K3ID 3IKOA 1JMXB 4A2MA 1JJUB 4GM8A 3MZLA 3NIFA 3ZDZA 4AN1A 4JSXC 2XE4A 3SVWD 5HE1B 2O9KA 4FAVD 3IJ1A 1A12A 1YFQA 2H9MA 4NBMA 5C2WB 1R5MA 3EMHA 4ESGA 4G1EA 4FA9D 1NEXB 2VDRA 2IUVA 3T3MA 2IWFA 1U4CA 4A7JA 2HJBA 2YBAA 4GM3A 3EI1A 4O02A 5E6RA 3JZNA 3I7NA 4QQEA 5EAPA 2EIEA 2CN3A 2HJ4A 3KRXB 4WK0A 1TYQC 3ZWLB 2PM9A 3QI0A 3UVNA 5M5TA 3SCYA 4J78A 1O6FA 1TBGA 4G55A 2H9PA 4GGAA 4RE5A 4J86A 2XU7A 4CC9A 5HE0B 1MG2A 1K8KC 5TF2A 3GREA 2H13A 5GXHA 2EIDA 3UKUC 5M61A 1GOHA 2HU7A 4E54B 2EIBA 2P9NC 2AH1A 4A0BB 4AX4A 4J73A 2B5LA 3UR4A 1XIPA 3IVMA 2VDQA 3ZDXA 1P22A 3I89A 3OKTA 5FKSA 3SN6B 2B4EA 4L1MA 3EQ9A 4ZOYA 4E5ZB 4CI3A 4JT5C 4O9DA 2OVQB 3RRMC 4DNUA 3UKRC 5FQDA 3ULEC 4O1QD 5EAMA 2H14A 3F3PA 2YNNA 2OIZA 1K32A 3UVLA 3EQ7A 3MZKA 5CXCB 4UM8A 1BPOA 4ERYA 3BG1A 4O2WA 1YR2A 2CE9A 3DM0A 5EMJB 3MVDK 3MXXA 4Z7QA 5TEEA 5I5JA 2G9AA 3PXTD 3VA6A 4ERZA 3SXTD 3C99A 3PXSD 2CO0A 5TDHB 4A08B 3F3FA 2H9NA 2J57G 4J8BA 4J8GA 2HXCA 3GD1I 4JHPC 5H14A 4O3TB 4E5ZA 3DXMC 4IRZA 4L1QD 4ERQA 4GQBB 1L0QA 3ZE1A 2IWKA 4D9SA 3NVQA 4BP9A 3I7LA 2CO0C 4TZ4A 2PM6B 4PNKB 5H1MA 4GQ1A 4GQ2P 1VZ2A 3JB9L 4O3UB 3IUMA 4I79A 4IMMA 2VC2A 3V5WB 5JWZA 4H5JA 2BCJB 4Z7NA 3MKSB 4OWRA 3DDUA 3EI1B 3I8EA 2IUQA 2IAAA 5HE3B 3VI4A 5A2Qg
chains in the Genus database with same CATH topology
3I7OA 4A08A 3MKQA 1XKSA 3UVMA 5FXYA 4KFMB 2GC7A 4MK0B 2P9UC 2PM9B 3I2NA 5K1CC 4FA5D 1B9XA 2I0SA 1PI6A 2OVRB 1SQJA 4CZYA 5HYNB 3SWSD 4JSNC 5GMKn 1N6FA 3SHFA 1U2VC 1GG2B 3SLED 5IGQA 3L4MD 3RFHA 2P9LC 4J79A 3EU7A 2HYEA 3VGZA 3EI3A 3JZHA 4J81A 2Z2PA 4AOWA 3AH8B 4LG9A 1Q47A 3JPXA 1PBYB 4FWWA 4IA9A 3MMYA 3BG0A 2OK4A 4LGNA 4H5IA 2YNOA 4JSVC 3IJ0A 3SBRA 3FGBA 2B5MA 5HE2B 1QNIA 3SFZA 4FHLA 3HFQA 3IIWA 4A09A 2H47A 2AGZA 2B5NA 3CIKB 3BWSA 5AFU3 5AMSA 4AEZA 5IJ7E 5CYKA 5FKQA 2AH0A 4X63B 4CY5A 5GXIA 4LG8A 4BUJC 1GXRA 2P9PC 3PE7A 3N0EA 1SHYB 3CFVA 3NVXA 4GM9A 4EWRA 2IUPA 3C75H 2GC4A 5B4WA 5C2VB 5EARA 4A0AA 3CFSB 3A0FA 2IURA 2XL3A 5EMKB 2AGXA 5GSAA 4NSXA 3RSEC 3E0CA 3PSLA 3JRPA 2AQ5A 1PEVA 2G99A 4PXWA 3OKYA 4XYHA 3UVOA 5EMMB 4G56B 1GOTB 3IJCA 3V9FA 5EM2A 3JROA 3SJLD 4FAND 5TEFA 3I8CA 5SXMA 3RN1D 5C9ZB 4ZOXA 4Z8LA 4CI2A 1ERJA 2H3XA 3JZGA 2CE8A 1A0RB 1NR0A 3EI2A 4CI1A 4GZ8A 4QRJA 5EALA 3RMZD 4CY3A 1MG3A 4HDJA 4R7AB 5FLXg 4U1EI 3FRXA 3ORVD 3EI3B 4PSXB 2BBKH 5AJAA 3EWEA 4PBYA 4D0KA 3EI4A 4CI8A 3J81g 2HKMA 4A11A 4A2LA 3DWLC 4XEIC 3NVNA 3K27A 2YB8B 4FA4D 2Z2OA 2AGLA 2I3TA 5IJ8E 1OLZA 3N0DA 4J77A 3SBPA 1RI6A 4A09B 1PGUA 1B9YA 5IGOA 5CYKB 4N14A 3GFCA 4BL0A 2YMUA 3K26A 4XYIA 3V7DB 2P9SC 2PBIB 2TRCB 1JOFA 3ODTA 4ZOVA 3AL8A 3OL2A 3SMRA 2Q7QA 2H68A 5HQGA 2HKRA 4A0AB 3OTTA 2OVPB 1N6DA 4CZVA 3AFCA 3PXWD 3I7PA 5I5MA 3RLMD 2PM7B 4PC0A 2P9KC 2QXVA 3OKYB 4JD2C 2W18A 4QT8A 4JSPC 5EMLB 4PBZA 5I5IA 5EM2B 2GNQA 3PSCB 5CXBA 3KRWB 4L3GD 2I0RA 2OK6A 2EBSA 3JAMg 3VH0A 1GP2B 2AGYA 2Z2NA 4L3HD 3AL9A 1S4UX 2CN2A 3U4YA 2YNPA 3EI2B 3C9CA 5KDOB 3PVWB 3W15A 4X3EA 2H6NA 3PVUB 3J80g 4ZN4A 4GGDA 4J84A 4ZOZA 4ES0A 5FA5B 1N6EA 4J87A 3EI4B 1FWXA 3OKWA 4JT6C 4A11B 4JXMA 4D6VA 2UZXB 4FA1D 4YVDA 1OMWB 4U7AA 4X60B 4Y5RD 1VYHC 4O45A 4CZXA 2H6KA 3DXKC 5IT9g 4K3JB 4FB1D 3RFGA 4E54A 4J0XA 2QC5A 4A0BA 1XHMA 4GMBA 1JMZB 2J55H 3IIYA 4CY2A 2XYIA 3B7FA 3F3GA 1MDAH 2H9LA 2MTAH 5THAA 2UZYB 4Y7RA 2H6QA 3I7HA 4UI9R 2OJYA 2AGWA 3AL8B 3OL2B 2I3SA 3I7KA 4PSWB 2I0TA 3EG6A 3L4OD 2HESX 5IC7A 1SQ9A 5CXCA 4QL1A 4X61B 2XL2A 2CNXA 4GGCA 4BH6A 3SBQA 4L9OA 3P4FA 3UVKA 3C5MA 3DSMA 5FKRA 3RN0D 5FKTA 4J82A 3FM0A 3OW8A 2P9IC 5CXBB 5K19A 5H17A 4J0WA 2J56H 4OZUA 4CY1A 4K3ID 3IKOA 1JMXB 4A2MA 1JJUB 4GM8A 3MZLA 4JSXC 3SVWD 5HE1B 2O9KA 4FAVD 3IJ1A 1YFQA 2H9MA 5C2WB 1R5MA 3EMHA 4ESGA 4FA9D 1NEXB 2IUVA 2IWFA 1U4CA 4A7JA 2HJBA 2YBAA 4GM3A 3EI1A 3JZNA 3I7NA 4QQEA 5EAPA 2CN3A 2HJ4A 3KRXB 1TYQC 3ZWLB 2PM9A 3UVNA 3SCYA 4J78A 1TBGA 2H9PA 4GGAA 4J86A 2XU7A 4CC9A 5HE0B 1MG2A 1K8KC 5TF2A 3GREA 2H13A 5GXHA 3UKUC 4E54B 2P9NC 2AH1A 4A0BB 4J73A 2B5LA 3UR4A 1XIPA 1P22A 3I89A 3OKTA 5FKSA 3SN6B 2B4EA 4ZOYA 4E5ZB 4CI3A 4JT5C 4O9DA 2OVQB 3RRMC 3UKRC 5FQDA 3ULEC 4O1QD 5EAMA 2H14A 3F3PA 2YNNA 2OIZA 1K32A 3UVLA 3MZKA 5CXCB 4ERYA 3BG1A 5EMJB 2CE9A 3DM0A 3MXXA 5TEEA 5I5JA 2G9AA 3PXTD 3VA6A 4ERZA 3SXTD 3C99A 3PXSD 2CO0A 5TDHB 4A08B 3F3FA 2H9NA 2J57G 4J8BA 4J8GA 2HXCA 5H14A 4O3TB 4E5ZA 3DXMC 4L1QD 4ERQA 4GQBB 1L0QA 2IWKA 3NVQA 3I7LA 2CO0C 4TZ4A 2PM6B 4PNKB 5H1MA 4GQ1A 4GQ2P 3JB9L 4O3UB 4I79A 4IMMA 3V5WB 5JWZA 4H5JA 2BCJB 3MKSB 4OWRA 3EI1B 3I8EA 2IUQA 2IAAA 5HE3B 5A2Qg
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7O A;  4A08 A;  3MKQ A;  1XKS A;  3UVM A;  5FXY A;  4KFM B;  2GC7 A;  4MK0 B;  2P9U C;  2PM9 B;  3I2N A;  5K1C C;  4FA5 D;  1B9X A;  2I0S A;  1PI6 A;  2OVR B;  1SQJ A;  4CZY A;  5HYN B;  3SWS D;  4JSN C;  5GMK n;  1N6F A;  3SHF A;  1U2V C;  1GG2 B;  3SLE D;  5IGQ A;  3L4M D;  3RFH A;  2P9L C;  4J79 A;  3EU7 A;  2HYE A;  3VGZ A;  3EI3 A;  3JZH A;  4J81 A;  2Z2P A;  4AOW A;  3AH8 B;  4LG9 A;  1Q47 A;  3JPX A;  1PBY B;  4FWW A;  4IA9 A;  3MMY A;  3BG0 A;  2OK4 A;  4LGN A;  4H5I A;  2YNO A;  4JSV C;  3IJ0 A;  3SBR A;  3FGB A;  2B5M A;  5HE2 B;  1QNI A;  3SFZ A;  4FHL A;  3HFQ A;  3IIW A;  4A09 A;  2H47 A;  2AGZ A;  2B5N A;  3CIK B;  3BWS A;  5AFU 3;  5AMS A;  4AEZ A;  5IJ7 E;  5CYK A;  5FKQ A;  2AH0 A;  4X63 B;  4CY5 A;  5GXI A;  4LG8 A;  4BUJ C;  1GXR A;  2P9P C;  3PE7 A;  3N0E A;  1SHY B;  3CFV A;  3NVX A;  4GM9 A;  4EWR A;  2IUP A;  3C75 H;  2GC4 A;  5B4W A;  5C2V B;  5EAR A;  4A0A A;  3CFS B;  3A0F A;  2IUR A;  2XL3 A;  5EMK B;  2AGX A;  5GSA A;  4NSX A;  3RSE C;  3E0C A;  3PSL A;  3JRP A;  2AQ5 A;  1PEV A;  2G99 A;  4PXW A;  3OKY A;  4XYH A;  3UVO A;  5EMM B;  4G56 B;  1GOT B;  3IJC A;  3V9F A;  5EM2 A;  3JRO A;  3SJL D;  4FAN D;  5TEF A;  3I8C A;  5SXM A;  3RN1 D;  5C9Z B;  4ZOX A;  4Z8L A;  4CI2 A;  1ERJ A;  2H3X A;  3JZG A;  2CE8 A;  1A0R B;  1NR0 A;  3EI2 A;  4CI1 A;  4GZ8 A;  4QRJ A;  5EAL A;  3RMZ D;  4CY3 A;  1MG3 A;  4HDJ A;  4R7A B;  5FLX g;  4U1E I;  3FRX A;  3ORV D;  3EI3 B;  4PSX B;  2BBK H;  5AJA A;  3EWE A;  4PBY A;  4D0K A;  3EI4 A;  4CI8 A;  3J81 g;  2HKM A;  4A11 A;  4A2L A;  3DWL C;  4XEI C;  3NVN A;  3K27 A;  2YB8 B;  4FA4 D;  2Z2O A;  2AGL A;  2I3T A;  5IJ8 E;  1OLZ A;  3N0D A;  4J77 A;  3SBP A;  1RI6 A;  4A09 B;  1PGU A;  1B9Y A;  5IGO A;  5CYK B;  4N14 A;  3GFC A;  4BL0 A;  2YMU A;  3K26 A;  4XYI A;  3V7D B;  2P9S C;  2PBI B;  2TRC B;  1JOF A;  3ODT A;  4ZOV A;  3AL8 A;  3OL2 A;  3SMR A;  2Q7Q A;  2H68 A;  5HQG A;  2HKR A;  4A0A B;  3OTT A;  2OVP B;  1N6D A;  4CZV A;  3AFC A;  3PXW D;  3I7P A;  5I5M A;  3RLM D;  2PM7 B;  4PC0 A;  2P9K C;  2QXV A;  3OKY B;  4JD2 C;  2W18 A;  4QT8 A;  4JSP C;  5EML B;  4PBZ A;  5I5I A;  5EM2 B;  2GNQ A;  3PSC B;  5CXB A;  3KRW B;  4L3G D;  2I0R A;  2OK6 A;  2EBS A;  3JAM g;  3VH0 A;  1GP2 B;  2AGY A;  2Z2N A;  4L3H D;  3AL9 A;  1S4U X;  2CN2 A;  3U4Y A;  2YNP A;  3EI2 B;  3C9C A;  5KDO B;  3PVW B;  3W15 A;  4X3E A;  2H6N A;  3PVU B;  3J80 g;  4ZN4 A;  4GGD A;  4J84 A;  4ZOZ A;  4ES0 A;  5FA5 B;  1N6E A;  4J87 A;  3EI4 B;  1FWX A;  3OKW A;  4JT6 C;  4A11 B;  4JXM A;  4D6V A;  2UZX B;  4FA1 D;  4YVD A;  1OMW B;  4U7A A;  4X60 B;  4Y5R D;  1VYH C;  4O45 A;  4CZX A;  2H6K A;  3DXK C;  5IT9 g;  4K3J B;  4FB1 D;  3RFG A;  4E54 A;  4J0X A;  2QC5 A;  4A0B A;  1XHM A;  4GMB A;  1JMZ B;  2J55 H;  3IIY A;  4CY2 A;  2XYI A;  3B7F A;  3F3G A;  1MDA H;  2H9L A;  2MTA H;  5THA A;  2UZY B;  4Y7R A;  2H6Q A;  3I7H A;  4UI9 R;  2OJY A;  2AGW A;  3AL8 B;  3OL2 B;  2I3S A;  3I7K A;  4PSW B;  2I0T A;  3EG6 A;  3L4O D;  2HES X;  5IC7 A;  1SQ9 A;  5CXC A;  4QL1 A;  4X61 B;  2XL2 A;  2CNX A;  4GGC A;  4BH6 A;  3SBQ A;  4L9O A;  3P4F A;  3UVK A;  3C5M A;  3DSM A;  5FKR A;  3RN0 D;  5FKT A;  4J82 A;  3FM0 A;  3OW8 A;  2P9I C;  5CXB B;  5K19 A;  5H17 A;  4J0W A;  2J56 H;  4OZU A;  4CY1 A;  4K3I D;  3IKO A;  1JMX B;  4A2M A;  1JJU B;  4GM8 A;  3MZL A;  4JSX C;  3SVW D;  5HE1 B;  2O9K A;  4FAV D;  3IJ1 A;  1YFQ A;  2H9M A;  5C2W B;  1R5M A;  3EMH A;  4ESG A;  4FA9 D;  1NEX B;  2IUV A;  2IWF A;  1U4C A;  4A7J A;  2HJB A;  2YBA A;  4GM3 A;  3EI1 A;  3JZN A;  3I7N A;  4QQE A;  5EAP A;  2CN3 A;  2HJ4 A;  3KRX B;  1TYQ C;  3ZWL B;  2PM9 A;  3UVN A;  3SCY A;  4J78 A;  1TBG A;  2H9P A;  4GGA A;  4J86 A;  2XU7 A;  4CC9 A;  5HE0 B;  1MG2 A;  1K8K C;  5TF2 A;  3GRE A;  2H13 A;  5GXH A;  3UKU C;  4E54 B;  2P9N C;  2AH1 A;  4A0B B;  4J73 A;  2B5L A;  3UR4 A;  1XIP A;  1P22 A;  3I89 A;  3OKT A;  5FKS A;  3SN6 B;  2B4E A;  4ZOY A;  4E5Z B;  4CI3 A;  4JT5 C;  4O9D A;  2OVQ B;  3RRM C;  3UKR C;  5FQD A;  3ULE C;  4O1Q D;  5EAM A;  2H14 A;  3F3P A;  2YNN A;  2OIZ A;  1K32 A;  3UVL A;  3MZK A;  5CXC B;  4ERY A;  3BG1 A;  5EMJ B;  2CE9 A;  3DM0 A;  3MXX A;  5TEE A;  5I5J A;  2G9A A;  3PXT D;  3VA6 A;  4ERZ A;  3SXT D;  3C99 A;  3PXS D;  2CO0 A;  5TDH B;  4A08 B;  3F3F A;  2H9N A;  2J57 G;  4J8B A;  4J8G A;  2HXC A;  5H14 A;  4O3T B;  4E5Z A;  3DXM C;  4L1Q D;  4ERQ A;  4GQB B;  1L0Q A;  2IWK A;  3NVQ A;  3I7L A;  2CO0 C;  4TZ4 A;  2PM6 B;  4PNK B;  5H1M A;  4GQ1 A;  4GQ2 P;  3JB9 L;  4O3U B;  4I79 A;  4IMM A;  3V5W B;  5JWZ A;  4H5J A;  2BCJ B;  3MKS B;  4OWR A;  3EI1 B;  3I8E A;  2IUQ A;  2IAA A;  5HE3 B;  5A2Q g; 
#chains in the Genus database with same CATH topology
 3I7O A;  4A08 A;  3MKQ A;  1XKS A;  3UVM A;  5FXY A;  4KFM B;  2GC7 A;  4MK0 B;  2P9U C;  2PM9 B;  3I2N A;  4DNV A;  5K1C C;  2VZ3 A;  4FA5 D;  1B9X A;  2I0S A;  3IUN A;  1PI6 A;  2OVR B;  1SQJ A;  2XZG A;  5E6U A;  4CZY A;  5HYN B;  3SWS D;  4JSN C;  5GMK n;  1N6F A;  3SHF A;  1U2V C;  1GG2 B;  3SLE D;  5IGQ A;  3L4M D;  3RFH A;  2P9L C;  4QAM A;  4J79 A;  3EU7 A;  2HYE A;  3VGZ A;  3EI3 A;  3JZH A;  4J81 A;  1JV2 A;  2Z2P A;  4AOW A;  3AH8 B;  4NEN A;  3O4J A;  1Q47 A;  4LG9 A;  3JPX A;  1PBY B;  4FWW A;  4IA9 A;  3MMY A;  3BG0 A;  2OK4 A;  1GOG A;  4LGN A;  4H5I A;  2YNO A;  4JSV C;  3IJ0 A;  3SBR A;  3FGB A;  2B5M A;  5HE2 B;  1QNI A;  3SFZ A;  4FHL A;  3HFQ A;  3IIW A;  4A09 A;  2H47 A;  2AGZ A;  2B5N A;  3CIK B;  3BWS A;  5AFU 3;  2VZ1 A;  5AMS A;  4AEZ A;  1UOQ A;  2VDP A;  5CYK A;  5IJ7 E;  5FKQ A;  2AH0 A;  1C9I A;  4X63 B;  4CY5 A;  5GXI A;  1H2Z A;  4LG8 A;  4BUJ C;  1GXR A;  2P9P C;  3PE7 A;  3N0E A;  1SHY B;  3CFV A;  3NVX A;  3OF7 A;  4GM9 A;  4EWR A;  2IUP A;  2EIC A;  3C75 H;  3T3P A;  2GC4 A;  5B4W A;  5C2V B;  5EAR A;  5M5U A;  3GC3 B;  3IUJ A;  4A0A A;  3CFS B;  3A0F A;  3FCS A;  5C92 A;  2IUR A;  5FFG A;  2XL3 A;  5EMK B;  2AGX A;  2HU8 A;  5M5S A;  5GSA A;  4NSX A;  3RSE C;  3E0C A;  4BCB A;  2XDW A;  3PSL A;  3JRP A;  2AQ5 A;  2QR5 A;  1PEV A;  4WK4 A;  2G99 A;  3IUQ A;  4PXW A;  3OKY A;  4XYH A;  3UVO A;  5EMM B;  4G56 B;  1GOT B;  3IJC A;  3K72 A;  3ZE0 A;  3V9F A;  5EM2 A;  3JRO A;  3SJL D;  4FAN D;  1E5T A;  5TEF A;  1UOO A;  3I8C A;  5SXM A;  3RN1 D;  5C9Z B;  4ZOX A;  4Z8L A;  4CI2 A;  1ERJ A;  1H2W A;  2H3X A;  3JZG A;  4NC4 A;  2CE8 A;  1A0R B;  1NR0 A;  3EI2 A;  4CI1 A;  4GZ8 A;  4QRJ A;  5EAL A;  2VDL A;  3RMZ D;  4CY3 A;  3FCU A;  1MG3 A;  4HDJ A;  4R7A B;  5FLX g;  3ZE2 A;  4U1E I;  3FRX A;  3ORV D;  4WJK A;  3EI3 B;  4PSX B;  4BCC A;  1GOF A;  2VDM A;  2BBK H;  5AJA A;  2BKL A;  4JHN A;  3EWE A;  4PBY A;  4D0K A;  4MMZ A;  3EI4 A;  5HDB A;  4AN0 A;  4MMX A;  3IUR A;  4CI8 A;  3J81 g;  2HKM A;  4A11 A;  4A2L A;  1O6G A;  3DWL C;  4XEI C;  3NVN A;  3K27 A;  2YB8 B;  1U8C A;  2Z2O A;  4FA4 D;  2AGL A;  3IUL A;  2I3T A;  5IJ8 E;  3VI3 A;  3O4G A;  3MUO A;  1T2X A;  1OLZ A;  3N0D A;  4J77 A;  4BCD A;  3SBP A;  1RI6 A;  4A09 B;  3O4H A;  1PGU A;  4Z7O A;  1B9Y A;  5IGO A;  5M5R A;  5CYK B;  4N14 A;  3GFC A;  4BL0 A;  2YMU A;  1VZ3 A;  3K26 A;  4XYI A;  3V7D B;  2P9S C;  1VE6 A;  2PBI B;  2TRC B;  1JOF A;  1M1X A;  3ODT A;  4G1M A;  4ZOV A;  3AL8 A;  1K3I A;  3OL2 A;  4WK2 A;  3SMR A;  2Q7Q A;  2H68 A;  5HQG A;  2HKR A;  4A0A B;  1C9L A;  4AMY A;  2WQ8 A;  3OTT A;  2OVP B;  1H2Y A;  1N6D A;  4CZV A;  3AFC A;  3PXW D;  3O4I A;  1VE7 A;  3I7P A;  5I5M A;  3RLM D;  2HU5 A;  2PM7 B;  4PC0 A;  4UM9 A;  2P9K C;  2QXV A;  2VDO A;  1E8M A;  3OKY B;  4JD2 C;  1UOP A;  3ZDY A;  2W18 A;  5C86 A;  4QT8 A;  4JSP C;  5EML B;  4PBZ A;  3V4P A;  5I5I A;  5EM2 B;  2GNQ A;  3PSC B;  5CXB A;  3KRW B;  2JKX A;  1H2X A;  2I0R A;  4L3G D;  2OK6 A;  2EBS A;  3JAM g;  3VH0 A;  1GP2 B;  2AGY A;  2Z2N A;  5E6S A;  4L3H D;  3AL9 A;  1S4U X;  2CN2 A;  3U4Y A;  2YNP A;  3EI2 B;  3C9C A;  5KDO B;  4MMY A;  3PVW B;  3W15 A;  4X3E A;  2H6N A;  3PVU B;  3J80 g;  2VDK A;  4ZN4 A;  4GGD A;  4J84 A;  4ZOZ A;  1E8N A;  4ES0 A;  5FA5 B;  1N6E A;  4J87 A;  3K6S A;  3EI4 B;  3K71 A;  1FWX A;  1L5G A;  3OKW A;  4JT6 C;  4A11 B;  3KCI A;  4JXM A;  4D6V A;  2UZX B;  4FA1 D;  4YVD A;  1OMW B;  1JTD B;  4RE6 A;  4U7A A;  4X60 B;  4Y5R D;  1VYH C;  4O45 A;  4CZX A;  3V4V A;  2H6K A;  3DXK C;  4NAA A;  5IT9 g;  4K3J B;  2VDN A;  3IJE A;  4FB1 D;  3RFG A;  3NIG A;  4E54 A;  4J0X A;  2QC5 A;  5FFO A;  4A0B A;  1QFM A;  1XHM A;  4GMB A;  1JMZ B;  2J55 H;  3IIY A;  4CY2 A;  2XYI A;  3B7F A;  3F3G A;  1MDA H;  2H9L A;  2MTA H;  5THA A;  2UZY B;  4Y7R A;  2H6Q A;  3I7H A;  4UI9 R;  2OJY A;  5M5V A;  2AGW A;  3AL8 B;  3OL2 B;  2I3S A;  3I7K A;  4PSW B;  2I0T A;  3EG6 A;  3L4O D;  1UTC A;  2HES X;  5IC7 A;  1SQ9 A;  3EQ8 A;  5CXC A;  4QL1 A;  4X61 B;  2XL2 A;  3MUN A;  2CNX A;  1TYE A;  4GGC A;  4BH6 A;  3SBQ A;  4L9O A;  1I2M B;  1QFS A;  3P4F A;  3UVK A;  3C5M A;  3DSM A;  4BP8 A;  5FKR A;  3RN0 D;  5FKT A;  4AMZ A;  4DNW A;  3QHY B;  4J82 A;  3FM0 A;  3OW8 A;  2P9I C;  5CXB B;  2QZP A;  5K19 A;  5H17 A;  4J0W A;  2J56 H;  4OZU A;  4CY1 A;  3NID A;  4K3I D;  3IKO A;  1JMX B;  4A2M A;  1JJU B;  4GM8 A;  3MZL A;  3NIF A;  3ZDZ A;  4AN1 A;  4JSX C;  2XE4 A;  3SVW D;  5HE1 B;  2O9K A;  4FAV D;  3IJ1 A;  1A12 A;  1YFQ A;  2H9M A;  4NBM A;  5C2W B;  1R5M A;  3EMH A;  4ESG A;  4G1E A;  4FA9 D;  1NEX B;  2VDR A;  2IUV A;  3T3M A;  2IWF A;  1U4C A;  4A7J A;  2HJB A;  2YBA A;  4GM3 A;  3EI1 A;  4O02 A;  5E6R A;  3JZN A;  3I7N A;  4QQE A;  5EAP A;  2EIE A;  2CN3 A;  2HJ4 A;  3KRX B;  4WK0 A;  1TYQ C;  3ZWL B;  2PM9 A;  3QI0 A;  3UVN A;  5M5T A;  3SCY A;  4J78 A;  1O6F A;  1TBG A;  4G55 A;  2H9P A;  4GGA A;  4RE5 A;  4J86 A;  2XU7 A;  4CC9 A;  5HE0 B;  1MG2 A;  1K8K C;  5TF2 A;  3GRE A;  2H13 A;  5GXH A;  2EID A;  3UKU C;  5M61 A;  1GOH A;  2HU7 A;  4E54 B;  2EIB A;  2P9N C;  2AH1 A;  4A0B B;  4AX4 A;  4J73 A;  2B5L A;  3UR4 A;  1XIP A;  3IVM A;  2VDQ A;  3ZDX A;  1P22 A;  3I89 A;  3OKT A;  5FKS A;  3SN6 B;  2B4E A;  4L1M A;  3EQ9 A;  4ZOY A;  4E5Z B;  4CI3 A;  4JT5 C;  4O9D A;  2OVQ B;  3RRM C;  4DNU A;  3UKR C;  5FQD A;  3ULE C;  4O1Q D;  5EAM A;  2H14 A;  3F3P A;  2YNN A;  2OIZ A;  1K32 A;  3UVL A;  3EQ7 A;  3MZK A;  5CXC B;  4UM8 A;  1BPO A;  4ERY A;  3BG1 A;  4O2W A;  1YR2 A;  2CE9 A;  3DM0 A;  5EMJ B;  3MVD K;  3MXX A;  4Z7Q A;  5TEE A;  5I5J A;  2G9A A;  3PXT D;  3VA6 A;  4ERZ A;  3SXT D;  3C99 A;  3PXS D;  2CO0 A;  5TDH B;  4A08 B;  3F3F A;  2H9N A;  2J57 G;  4J8B A;  4J8G A;  2HXC A;  3GD1 I;  4JHP C;  5H14 A;  4O3T B;  4E5Z A;  3DXM C;  4IRZ A;  4L1Q D;  4ERQ A;  4GQB B;  1L0Q A;  3ZE1 A;  2IWK A;  4D9S A;  3NVQ A;  4BP9 A;  3I7L A;  2CO0 C;  4TZ4 A;  2PM6 B;  4PNK B;  5H1M A;  4GQ1 A;  4GQ2 P;  1VZ2 A;  3JB9 L;  4O3U B;  3IUM A;  4I79 A;  4IMM A;  2VC2 A;  3V5W B;  5JWZ A;  4H5J A;  2BCJ B;  4Z7N A;  3MKS B;  4OWR A;  3DDU A;  3EI1 B;  3I8E A;  2IUQ A;  2IAA A;  5HE3 B;  3VI4 A;  5A2Q g; 
#chains in the Genus database with same CATH homology
 3I7O A;  4A08 A;  3MKQ A;  1XKS A;  3UVM A;  5FXY A;  4KFM B;  2GC7 A;  4MK0 B;  2P9U C;  2PM9 B;  3I2N A;  5K1C C;  4FA5 D;  1B9X A;  2I0S A;  1PI6 A;  2OVR B;  1SQJ A;  4CZY A;  5HYN B;  3SWS D;  4JSN C;  5GMK n;  1N6F A;  3SHF A;  1U2V C;  1GG2 B;  3SLE D;  5IGQ A;  3L4M D;  3RFH A;  2P9L C;  4J79 A;  3EU7 A;  2HYE A;  3VGZ A;  3EI3 A;  3JZH A;  4J81 A;  2Z2P A;  4AOW A;  3AH8 B;  4LG9 A;  1Q47 A;  3JPX A;  1PBY B;  4FWW A;  4IA9 A;  3MMY A;  3BG0 A;  2OK4 A;  4LGN A;  4H5I A;  2YNO A;  4JSV C;  3IJ0 A;  3SBR A;  3FGB A;  2B5M A;  5HE2 B;  1QNI A;  3SFZ A;  4FHL A;  3HFQ A;  3IIW A;  4A09 A;  2H47 A;  2AGZ A;  2B5N A;  3CIK B;  3BWS A;  5AFU 3;  5AMS A;  4AEZ A;  5IJ7 E;  5CYK A;  5FKQ A;  2AH0 A;  4X63 B;  4CY5 A;  5GXI A;  4LG8 A;  4BUJ C;  1GXR A;  2P9P C;  3PE7 A;  3N0E A;  1SHY B;  3CFV A;  3NVX A;  4GM9 A;  4EWR A;  2IUP A;  3C75 H;  2GC4 A;  5B4W A;  5C2V B;  5EAR A;  4A0A A;  3CFS B;  3A0F A;  2IUR A;  2XL3 A;  5EMK B;  2AGX A;  5GSA A;  4NSX A;  3RSE C;  3E0C A;  3PSL A;  3JRP A;  2AQ5 A;  1PEV A;  2G99 A;  4PXW A;  3OKY A;  4XYH A;  3UVO A;  5EMM B;  4G56 B;  1GOT B;  3IJC A;  3V9F A;  5EM2 A;  3JRO A;  3SJL D;  4FAN D;  5TEF A;  3I8C A;  5SXM A;  3RN1 D;  5C9Z B;  4ZOX A;  4Z8L A;  4CI2 A;  1ERJ A;  2H3X A;  3JZG A;  2CE8 A;  1A0R B;  1NR0 A;  3EI2 A;  4CI1 A;  4GZ8 A;  4QRJ A;  5EAL A;  3RMZ D;  4CY3 A;  1MG3 A;  4HDJ A;  4R7A B;  5FLX g;  4U1E I;  3FRX A;  3ORV D;  3EI3 B;  4PSX B;  2BBK H;  5AJA A;  3EWE A;  4PBY A;  4D0K A;  3EI4 A;  4CI8 A;  3J81 g;  2HKM A;  4A11 A;  4A2L A;  3DWL C;  4XEI C;  3NVN A;  3K27 A;  2YB8 B;  4FA4 D;  2Z2O A;  2AGL A;  2I3T A;  5IJ8 E;  1OLZ A;  3N0D A;  4J77 A;  3SBP A;  1RI6 A;  4A09 B;  1PGU A;  1B9Y A;  5IGO A;  5CYK B;  4N14 A;  3GFC A;  4BL0 A;  2YMU A;  3K26 A;  4XYI A;  3V7D B;  2P9S C;  2PBI B;  2TRC B;  1JOF A;  3ODT A;  4ZOV A;  3AL8 A;  3OL2 A;  3SMR A;  2Q7Q A;  2H68 A;  5HQG A;  2HKR A;  4A0A B;  3OTT A;  2OVP B;  1N6D A;  4CZV A;  3AFC A;  3PXW D;  3I7P A;  5I5M A;  3RLM D;  2PM7 B;  4PC0 A;  2P9K C;  2QXV A;  3OKY B;  4JD2 C;  2W18 A;  4QT8 A;  4JSP C;  5EML B;  4PBZ A;  5I5I A;  5EM2 B;  2GNQ A;  3PSC B;  5CXB A;  3KRW B;  4L3G D;  2I0R A;  2OK6 A;  2EBS A;  3JAM g;  3VH0 A;  1GP2 B;  2AGY A;  2Z2N A;  4L3H D;  3AL9 A;  1S4U X;  2CN2 A;  3U4Y A;  2YNP A;  3EI2 B;  3C9C A;  5KDO B;  3PVW B;  3W15 A;  4X3E A;  2H6N A;  3PVU B;  3J80 g;  4ZN4 A;  4GGD A;  4J84 A;  4ZOZ A;  4ES0 A;  5FA5 B;  1N6E A;  4J87 A;  3EI4 B;  1FWX A;  3OKW A;  4JT6 C;  4A11 B;  4JXM A;  4D6V A;  2UZX B;  4FA1 D;  4YVD A;  1OMW B;  4U7A A;  4X60 B;  4Y5R D;  1VYH C;  4O45 A;  4CZX A;  2H6K A;  3DXK C;  5IT9 g;  4K3J B;  4FB1 D;  3RFG A;  4E54 A;  4J0X A;  2QC5 A;  4A0B A;  1XHM A;  4GMB A;  1JMZ B;  2J55 H;  3IIY A;  4CY2 A;  2XYI A;  3B7F A;  3F3G A;  1MDA H;  2H9L A;  2MTA H;  5THA A;  2UZY B;  4Y7R A;  2H6Q A;  3I7H A;  4UI9 R;  2OJY A;  2AGW A;  3AL8 B;  3OL2 B;  2I3S A;  3I7K A;  4PSW B;  2I0T A;  3EG6 A;  3L4O D;  2HES X;  5IC7 A;  1SQ9 A;  5CXC A;  4QL1 A;  4X61 B;  2XL2 A;  2CNX A;  4GGC A;  4BH6 A;  3SBQ A;  4L9O A;  3P4F A;  3UVK A;  3C5M A;  3DSM A;  5FKR A;  3RN0 D;  5FKT A;  4J82 A;  3FM0 A;  3OW8 A;  2P9I C;  5CXB B;  5K19 A;  5H17 A;  4J0W A;  2J56 H;  4OZU A;  4CY1 A;  4K3I D;  3IKO A;  1JMX B;  4A2M A;  1JJU B;  4GM8 A;  3MZL A;  4JSX C;  3SVW D;  5HE1 B;  2O9K A;  4FAV D;  3IJ1 A;  1YFQ A;  2H9M A;  5C2W B;  1R5M A;  3EMH A;  4ESG A;  4FA9 D;  1NEX B;  2IUV A;  2IWF A;  1U4C A;  4A7J A;  2HJB A;  2YBA A;  4GM3 A;  3EI1 A;  3JZN A;  3I7N A;  4QQE A;  5EAP A;  2CN3 A;  2HJ4 A;  3KRX B;  1TYQ C;  3ZWL B;  2PM9 A;  3UVN A;  3SCY A;  4J78 A;  1TBG A;  2H9P A;  4GGA A;  4J86 A;  2XU7 A;  4CC9 A;  5HE0 B;  1MG2 A;  1K8K C;  5TF2 A;  3GRE A;  2H13 A;  5GXH A;  3UKU C;  4E54 B;  2P9N C;  2AH1 A;  4A0B B;  4J73 A;  2B5L A;  3UR4 A;  1XIP A;  1P22 A;  3I89 A;  3OKT A;  5FKS A;  3SN6 B;  2B4E A;  4ZOY A;  4E5Z B;  4CI3 A;  4JT5 C;  4O9D A;  2OVQ B;  3RRM C;  3UKR C;  5FQD A;  3ULE C;  4O1Q D;  5EAM A;  2H14 A;  3F3P A;  2YNN A;  2OIZ A;  1K32 A;  3UVL A;  3MZK A;  5CXC B;  4ERY A;  3BG1 A;  5EMJ B;  2CE9 A;  3DM0 A;  3MXX A;  5TEE A;  5I5J A;  2G9A A;  3PXT D;  3VA6 A;  4ERZ A;  3SXT D;  3C99 A;  3PXS D;  2CO0 A;  5TDH B;  4A08 B;  3F3F A;  2H9N A;  2J57 G;  4J8B A;  4J8G A;  2HXC A;  5H14 A;  4O3T B;  4E5Z A;  3DXM C;  4L1Q D;  4ERQ A;  4GQB B;  1L0Q A;  2IWK A;  3NVQ A;  3I7L A;  2CO0 C;  4TZ4 A;  2PM6 B;  4PNK B;  5H1M A;  4GQ1 A;  4GQ2 P;  3JB9 L;  4O3U B;  4I79 A;  4IMM A;  3V5W B;  5JWZ A;  4H5J A;  2BCJ B;  3MKS B;  4OWR A;  3EI1 B;  3I8E A;  2IUQ A;  2IAA A;  5HE3 B;  5A2Q g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...