3SXUA

Structure of the e. coli ssb-dna polymerase iii interface
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
KNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLRTSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the SSB-DNA polymerase III interface and its role in DNA replication.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA polymerase III subunit chi
total genus 49
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04364 DNA_pol3_chi DNA polymerase III chi subunit, HolC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold DNA polymerase III subunit chi 3sxuA00
3SXUA 1EM8A
chains in the Genus database with same CATH superfamily
2QTVB 2RHWA 4QVIA 2FPGA 4C05A 4Z1MD 4B45A 1HEYA 4JLBA 2AF3C 3FMOB 4DANA 5C5IA 1A8QA 1D2EA 2EKQA 2ZTLA 3FF4A 2PKWA 1QLJA 1J2JA 5LU9A 3MNFA 3GLIB 1KQ3A 3KOUA 4UQOA 3PX7A 1NFQA 3HJUA 5LM3A 1JIKA 3AOGA 2R62A 4MRRA 4PR3A 5HILA 3O8RA 3ZHCA 1HR0B 4YAFA 1NNEA 2E4ZA 2HMUA 1PZFA 1BXRA 1PT6A 1Y9ZA 1C0KA 2J7PD 4P0TA 4OKIA 5DCWA 3U3DA 1H2EA 2RIRA 4JAVC 3IMKA 2BPOA 2DKFA 2HHAA 3KOOA 1SQGA 2I4LA 4DUGA 2VVTA 2BMJA 1RMQA 3LHIA 2XITA 3RYFA 1X86B 1KSFX 1V1RB 4WI1A 3AETB 1JHMA 3C6YA 3SGLA 5AW1A 1NF2A 5IAEA 5JPIA 4RMGA 1LPBB 4D79A 3BAZA 2VHYA 1R9NA 4J0DA 5DRTA 4DSUA 1I3OA 1BROA 5DGXA 2C99A 3K92A 3AUJB 4EYKA 4DQKA 3JVDA 4RU1A 1NKSA 1SCNE 2RIPA 4Q9NA 4KB5A 4UVGA 5EQDA 4OXQA 5B3JC 3W5AA 3MJCA 5BRJA 3MMNA 2QAGC 1Z06A 3M4ZA 4XUGB 3I9OA 1JLLB 3OU7A 4J9VA 4JUFA 5T5QA 3QE9Y 3DOFA 3FWPA 5JVDB 3UJHA 4M0PA 1GPAA 2BF7A 2VG8A 3OECA 3B1ZA 2TRSB 2A0FA 2QG6A 4YLEA 2I2BA 4WINA 3QU5A 2BR3A 1WTAA 3V1TC 2B78A 2C1EA 2NV0A 3FYTA 3P9RA 1CUSA 2ZRAA 3C6ZA 1BKDR 3AVYA 3NGLA 1AGPA 5U4XA 3DFKA 1LPOA 3VHQA 1X6VA 4NZMA 4UBJA 4ND6A 3OMLA 2G72A 2NOAA 1QYXA 2CFTA 1Q74A 4NU5A 4RVHA 3HM9A 3RYHA 1YBFA 4HDSB 1G8GA 2D3TA 4GRDA 4M7OA 1U3WA 3M1AA 5DSZA 3UV7A 4HS9A 1TAQA 4EW1A 2AFVA 2WFLB 3GI1A 2NXWA 4TMXA 4XSVA 2YWHA 5I45A 2E55A 2PA0A 3SQDA 3TX6A 3KQUA 4FYVA 3OQHA 4XR9A 2VSQA 4ZVRA 4BS9A 2G1KA 3B6MA 2QJTA 3N74A 1XVLA 3RIGA 4ZKDA 4AF6A 5LN1A 2JCYA 2QBYB 1QRRA 1WXEA 5KWVA 2QTTA 3EUWA 1OWMA 1T9HA 1B2RA 1THZA 1TVKA 1PSZA 1JR3E 5DEOA 2HDNB 4FYWA 3VZBA 4N8EA 4P4LA 3GN1A 3UAXA 4M1SA 3JAKB 2VCYA 1Z0SA 3PUVA 2EU8A 1E1KA 4H3VA 4FHCA 5A0FA 2C3PA 3NEYA 4JT9A 3UJDA 5KQSA 3OUUA 4MQLA 1OIVA 2BMDA 4OLJA 4Q3CA 1KQPA 2VO1A 3DMRA 3ER9A 1YVEI 3RU2A 3S2UA 5KMGB 4WXEA 4BNMA 2Q8QA 3DMTC 4MJXA 2JGLA 3L8HA 4I4CA 3KJXA 1L4YA 4QO7A 5LU8A 3IVXA 5L53A 1R27A 3EWAA 3WJ1A 1RADA 5BSHA 3JQDA 2WJJA 4X95A 3T38A 2LIVA 3CRW1 2P0EA 2PPLA 2XGMA 5K4GA 2ZM5A 4MLZA 2AXQA 2ENWA 3E22B 4O59O 3SDBA 1DTWA 1LRJA 3Q7PA 3GDHA 1HPLA 4I6JA 4R1LA 1PNVA 2YVAA 3TZEA 1WDTA 5FNVA 1BEEA 2QUZA 3G59A 1XZLA 4HHEA 2V7GA 1JQAA 1KKMA 2Z5VA 3GFVA 2APJA 5DNAA 3E0QA 1QIMA 3W3AA 2ODQA 3HLYA 3HZZA 1AKTA 1R8JA 2DE0X 2BRUA 2JIMA 4MR9A 3E1GA 3GCZA 3FNIA 1SUSA 3V48A 5LNK1 3TAXA 4A1OA 1P77A 3A1WA 3UFXB 3IILA 5KQPA 1R0XA 4CKXA 1KZ4A 3FCEA 1NBMD 2B35A 1PR5A 5C5DA 2XNDD 1YKGA 1YL7A 2KI5A 3NG1A 5IH3A 1I4EB 2ZSDA 4REOA 1XU7A 3BT7A 3FYDA 2F64A 3N6VA 4CL3A 3QMPA 1E0AA 1GQRA 1R6UA 1NW3A 1VJ1A 2PVSA 1SBIA 3QA9A 1AC5A 3O4RA 1ZD2P 2OORA 5KQMA 4I2NA 1GTRA 1DG9A 1YF3A 5DCUA 1TM1E 1UC5B 3QPVA 2PPVA 5HOQA 4LJSA 1RWOA 5LQKA 1VI2A 1K27A 1CNMA 2N42A 1B4DA 3ZDBA 5AOBA 1Y3BE 2BFEA 3OH8A 3EPRA 1RTTA 2ON6A 2VYNA 5CLLA 4DLWA 3C2QA 3PI7A 3CSSA 1H6CA 1EFKA 2H52A 3V1YA 4RTJA 4EWLA 3GPLA 1GZVA 2O2ZA 2DJIA 3AILA 4HWGA 2X2PA 4UM8B 4PLZA 3EXIB 4W82A 3WWEA 2X0NA 3AHCA 3ZHBA 1PV4A 1V8OA 1XGKA 4Q3BA 3KQNA 4PX3A 3A1DA 4FEYA 3H1TA 1II8A 3L7IA 2R1VA 4H77A 2IUSA 3UWSA 3OE1A 1ZKMA 3LCMA 4O4IA 4EYEA 2AG5A 1BGWA 3QEAZ 2DP4E 3DFZA 4CI9A 2R47A 3FCAA 4D99A 1P80A 5EWLB 5A4MS 5ESDA 1OGYA 1QH8B 2P35A 3WGOA 1X77A 1JZQA 3MOGA 5DBFA 3TM5A 3WDKA 4MKGA 2O1SA 2QRGA 4BB6A 4D8XA 5JZVA 2H4JA 3G1TA 3CR7A 1S4QA 2BW0A 3FFWA 1QVWA 2J0SA 3A1EA 4FI3C 4OM8A 1SULA 3LC1O 1E99A 4M22A 5T8KC 5JSFA 1EVQA 5E1MA 2PUGA 2Z9DA 2JD2A 4WXRA 3RVJA 3T3MB 2IKSA 4BWVA 1ISJA 3AHHA 4LHYA 4LJ8A 5TS2A 4O02B 4MCIA 2VCEA 1DXOA 2M6KA 3SJCA 1H2FA 3LOQA 1U7TA 3IR7A 4HNHA 5AI0A 3IQXA 4Y6QA 3MFYA 1OYOA 2PBFA 2OHXA 1O94D 1P2VA 4YGYA 4PSDA 4EO4A 1KJNA 5ARBA 5D86A 1XA3A 5CB4F 1I4WA 1BX1A 4LC9A 5KIAA 1EUYA 2WIGA 5DXAA 4OGKA 1G5QA 1U28A 2P9YA 3I34X 3IHKA 3E5MA 1U8AA 1LBHA 4MKZA 4Y7DA 4EUKA 1MPXA 4OYLA 4RW0A 1C81A 1X13A 2MCFA 4TPKA 3ZXYA 1IE3A 3ITKA 3VYTB 1ZD1A 1Y5NA 2BFCB 1OILA 1W8DA 4PZLA 4EABA 1UK6A 3TLYA 3LGSA 2PWPA 4ZT5A 5JXIA 2YUTA 1QE5A 1RMYA 5FPHA 1T9ZA 4IMPA 5AKZA 2BSXA 1FQWA 1E98A 1I9CA 1XO1A 2QXUA 5DYGA 1I30A 2PUHA 1CUUA 1XTPA 3AEKB 3NW9A 3OQIB 4GXNA 4S1WA 5IC6A 4WCDA 2OZKA 3BD9A 1XXHE 4GP6A 4E08A 5IULC 3PD1A 3D8HA 3GJZA 5IMBA 3IPCA 5LMUB 1ORWA 4Y9SA 2C5FA 3TINA 4CG3A 5JZ9A 1ZMRA 4IWNA 2AZTA 1YMVA 3AXTA 3AJAA 3LUAA 3LQ2A 5H9VA 2JPDA 5SY6A 2IV7A 3NM5A 5KSYA 2UVDA 3A1NA 4CDNA 1YRLA 1MA3A 1C7FA 1MB9A 1ZU4A 2XE7A 1ZHHA 3AKEA 3QTLA 4FGJA 1EP2B 3DC2A 3UJ7A 4QULA 4RENA 3LBYA 2GAFA 3K31A 4RVSA 3F73A 3G8BA 1WWKA 3PHLA 2JHCA 1TAHA 4Y3UA 4JT2A 2FEMA 4M0FA 2PX2A 4MYCA 3T6KA 3S3TA 2A7XA 3NETA 4NC9A 1UZUA 2DR3A 4O1MA 4OXNA 2CKDA 4AY3A 4WE3A 3FLAA 4M54A 3GEPA 1QHFA 2V74B 4UBLA 4AF8A 4KXXA 2DU8A 5A5VA 2GTHA 2X9VA 4QNRA 5BMVB 4XJSA 5KSOA 2G08A 1U3CA 1XDWA 3WL8A 4JYBA 1X80B 2OOKA 4I99A 1DGQA 1FDRA 1LSJA 2HU8A 1L3IA 3LPMA 3SLRA 4HUJA 3U3KA 2IHNA 4FT4A 4B3GA 2OCLA 4M8IA 2CV0A 4E51A 1PHRA 1XIVA 2C5BA 3LAWA 4O2LA 2QRVA 2R7LA 1J33A 2EX1A 3KFVA 4MB0A 4O2RA 2OBNA 3EAQA 2HWXA 2HSEA 1MAUA 2ATXA 3TX2A 1H05A 2D06A 1VL0A 3EEQA 4BMOB 2P5UA 3GLGA 1ISMA 1ZOIA 4OHWA 3QSYA 1AMUA 3GFSA 2AMLA 2DG2A 2XMDA 1H0KA 4CMKA 1W48A 2XT9A 4CKEA 4GI3A 5BWBA 1N57A 2ZIZA 4G1BA 4YDQA 3FSGD 3ITNA 4IGKA 4BJHB 1DZ3A 4BP9A 2DBYA 2P41A 1LTQA 1JJVA 3C3JA 3JYLA 3M9LA 4OGWA 4P83A 4WN3A 4A8TA 4CCSA 4AJKA 5ITVA 3AXSA 2XTAA 2ZANA 3E6AA 3PFHA 5HR5A 1B00A 1CZNA 4EYQA 4D8TA 2WVGA 3N7TA 1KK1A 2JH8A 3AHFA 3CPJB 3R9XA 4F6RA 3EMVA 4HZUB 1QM5A 2WUEA 4B9AA 2JLAA 1LLDA 3K0BA 3ROFA 1JR4A 1DAPA 2HADA 5REQA 2AR0A 3F8WA 1VHJA 1VHQA 3RYCA 5D87A 4R9VA 4WXYB 2E0IA 2F8MA 2HJGA 4G0YA 4DQDA 1BJRE 4H35A 1G41A 1R4NA 3BD6A 3DBLA 1CEXA 3KEMA 2OFWA 3LBIA 5DMXA 3U9SA 5IEBA 4KOEC 2W8BA 2ZTSA 1EGQA 4KV7A 1XQ1A 5J2TA 2GZ3A 3UHOA 1O9BA 3TSAA 5CDFE 3K94A 2IYEA 2WE8A 2YV1A 3DHWC 4DBLE 3LY7A 4U2DA 1L5LA 3NHJA 3WC4A 3BILA 3K0AA 1A9ZA 3PZRA 4JOQA 4KFTA 4Z0PA 3I6YA 5F5LA 1AD2A 1NF8A 1DBVO 4Y30A 5EP3A 3ZJTA 1UZMA 3IPLA 2PK3A 2J67A 3ORSA 4EOGA 1NUUA 3OZIA 2OLJA 4YMVA 1D2MA 2OK8A 2OPBA 3P9KA 5IANA 1CY6A 1M1YB 1HYGA 3GXOA 3MUEA 4FYHA 3NDIA 4OP2A 1ORDA 1WKBA 4IJ6A 3T7EA 3REQA 4N8SA 5ILOA 3RS4A 3K8QA 1EGHA 3MN1A 1L6IA 1SIUA 1V4VA 4GX1A 3ZVRA 2SBTA 3ANNA 2A5YB 2G5PA 3C39A 4JJAA 2DUJA 3ZE9A 2LWIA 3H2HA 1E6EA 5GADl 3KETA 3C8HA 1XVUA 7REQB 4R0VA 5BUQA 1N3IA 2XI4A 4RNDB 1JFFA 1RJGA 4LOAA 3ZV6A 4OH1A 4DNOA 4X91A 4EFLA 4IEFB 4WCFA 1QF7A 5DHAA 2E5LB 1XZDA 2C8KA 3TN7A 4B4OA 3H84A 1VCIA 2ACVA 4IUYA 2R5NA 4HGPA 5E9AA 1XWIA 1XD2B 1E77A 5CXUA 4KFRA 1C1DA 3OZCA 1A5AB 2Z5FA 4U3JA 1IY9A 1DEAA 2CBZA 2GCGA 4IIJB 1FF9A 1L9XA 2G7ZA 2XTZA 3HWSA 4PG7A 4Y6RA 1SC1A 3WBKA 5KNBH 4LF9B 4NOMA 1NNSA 5B2FA 2IELA 2WSLA 1WLSA 3NWPA 5JWHA 1YZHA 3U40A 3VKFA 4FFSA 2AG1A 3B89A 4PAWA 4YAOA 1P72A 4A7PA 1NR1A 3QHQA 3JU3A 5MHTA 1FP4B 3K5PA 3C3PA 4MPTA 1P1KA 1QOPB 1O7JA 1PZGA 4YCSA 5IYZA 2ZYUX 3ELWA 4IIXA 4D0NA 4F56A 1UJCA 5HZKA 1QFZA 2FPRA 3ZHXA 4UBMA 5AVXA 2JDIA 2PUAA 2RHBA 1JHVA 2P9JA 1LEHA 1HYHA 2A0WA 1A97A 1XN4A 1ATIA 1VLMA 3NWBA 4TTTS 3IQHX 5JI2E 1IOWA 4FJ0A 4KPYA 2AC2A 2CYAA 1PRYA 2IUFA 2RGNA 1M72A 3E22A 1Q44A 1RQ7A 3GEIA 3NAZA 5FOTA 5KO2A 2PMBA 4O4JB 4ALJA 3FPEA 3CVXA 1RLMA 4Q4DA 4F38A 2CDAA 4FHZA 1WQ4A 1HT1E 1Z7WA 3G9QA 4MOWA 4UEOA 4WK6A 2OCXA 3RTEA 1OI3A 1PQYA 2FEPA 3ZHSA 1NVMB 1TT5A 3ADCA 3ZVNA 3R0QA 1U8CB 3OLQA 4G26A 4GMKA 3M6XA 2HO5A 3PQ3A 1A5BB 1JEQB 3LE8A 4RA6A 3PNVA 1JEYB 2XDQA 1DLIA 2AFIB 1U1GA 3KQOA 1GUFA 5KTPA 4DLRA 3H2BA 2EWVA 4IPTA 3RWOA 4G5SA 4JL6A 2XBLA 3AJ9A 1SM4A 2CV1A 3H8JA 3OPYA 2QPLA 2D7DA 2JI4A 4ZQBA 2GPWA 3ZWNA 4KGZA 5D7NA 1SG9A 3FVVA 1FX1A 2G3YA 1IVYA 2XE6A 3G0BA 3IE2A 1MABB 2XA9A 3TGLA 1OXTA 2GKSA 4BFZA 5LB2A 5KTOA 2K4MA 2ASEA 4HH1A 1QUFA 1XTJA 3SSNA 2Q2VA 1MXHA 1SKYE 3H2YA 3QYAA 4MNTA 3QNUA 4I2VA 3GLSA 1KQGA 2ZDHA 1Q11A 1HC7A 2GWHA 3C41J 3DFFA 4IM7A 4OYHA 1ZJYA 5GZ6A 4LMRA 1Y1KE 1IHPA 2IW3A 3QUSA 2UVPB 4J90A 2AF4C 2ZSBA 3NVDA 1PWHA 4K9KA 5CNKA 2X0DA 4CF6A 3VSBA 5H8WA 3JQAA 2J5BA 2IU6A 2CB9A 3H5OA 3K96A 4KPUB 3OIDA 2AZ4A 3TNFA 3VOTA 5IH7A 2PUFA 4IDGA 4PC6A 2W6ID 1HDRA 2YRXA 3GDOA 3I04A 4HYEA 3FGOA 3LDAA 1XJQA 2XNHA 3FB4A 3R41A 4JC5A 4P2GA 1MN6A 4PVCA 1S3SA 4M9RA 4YFYA 5JJ5A 4O25A 3BIWA 3ZKWB 3ZV4A 1V43A 3KPYA 4K81B 4TXNA 1B0AA 1XTVA 4RABA 1CVRA 2V9CA 3IBSA 3OLZA 1GZ6A 4G1UC 3T94A 1XJWA 3OTWA 2JAUA 1P0IA 1KEEA 1AUPA 2DTDA 3MLBA 4TXMA 4ZJZA 2AXNA 1JQLB 2MR6A 2QTCA 3NH9A 5A6SB 2ZW9A 2YCLA 1EP3B 3PDIA 4PCLA 1CEYA 2FVXA 5C46F 3EH2A 1XZPA 3KD2A 4BP3A 3EIXA 2BTOA 3EE6A 1US8B 3EZNA 1NUSA 2FWAA 3AVQA 1KMNA 1SVLA 1MU0A 2B7BA 1SOAA 3HYCA 3L93A 4FDUA 4KQ6A 5EGSA 3ZZ0A 2G1AA 5F76A 1N2JA 3C85A 3JD1A 5HDQA 3M5PA 4J4BA 2X0JA 4ECAA 1F60A 2IEZA 2PS0A 1SB9A 3IOEA 4ZANA 1L8AA 7ABPA 4PFSA 3LTNC 3RC3A 3TOVA 4ZTBA 1LX7A 4EO7A 4HX2A 3HXPA 2FRDA 4KN9S 3IMCA 2Q1TA 1P60A 3IVMA 1B3RA 5HE8A 5TB5A 4E15A 3Q8KA 3QJGA 2HMYB 1F2TA 3LSTA 3HFGA 4B4VA 3AG5A 4KYVA 2CMDA 1C0IA 5BSWA 4E5YA 4TYNA 3JQ9C 2BFCA 1FUKA 3CX4A 3E23A 3GVXA 3INYA 3N2ZB 3AFHA 1NVKA 2JVIA 3RYTC 4JWTA 2BSQA 5IT0A 3KSZO 2R7KA 4XR4A 4QL3A 4Z9XA 1J24A 1GUBA 2GAAA 3DCJA 1GHTA 1NYRA 3HYLA 3LSYA 3NHYA 4US0R 1GZHB 1KO4A 1SCQA 1NJ2A 2PGDA 3AIOA 3EDRA 4TL6A 5EJ2A 4E14A 1HEIA 1RKBA 3VA7A 2ADOA 3OQIA 4ZYTA 2FWJA 5F3RA 3CGWA 2J30A 3ISJA 2R4QA 5IBCA 3KJZA 5KX5B 1UT6A 5K0EA 3BJMA 1CW2B 4CI0B 1QV9A 4N0EA 2W6ZA 1YS1X 1GTL1 3PFFA 4H60A 5JDIC 1E7SA 5LDHA 4QHSA 4K26A 3KB2A 1B8PA 1L4GA 1DT5A 1LU9A 1ZUHA 3M6WA 4L5CA 4EELA 3HZOA 2BWJA 1QS0B 1W52X 3AQIA 3NBFA 4UCFA 3E4DA 3VZDA 2PUBA 2XXJA 2HD4A 4BO2A 1Y1SA 2ECKA 4F8YA 4TLEA 2BI8A 2GYVA 1AU9A 3SZ3A 3IEMA 4XXHA 2PWBA 4XVCA 4DMFA 3WWDA 1NQTA 3HMQA 4LBZA 4FFBB 1E9SA 1I2ZA 3GVIA 4R2KA 4F96A 1VBFA 5CT5A 1BX0A 1NBMA 2VBFA 3HA5A 5H5JA 1N8TA 5JMTA 3NNDA 1TTTA 1ZK0A 2ZCUA 5DIFA 4CTOA 4ZXFA 1IEQA 1D4OA 2UUAB 4EY5A 2CLLB 2A9JA 1H2ZA 3SXUA 1OXVA 2ZBPA 2IDKA 5FHRA 4AU1A 1X80A 5AYVA 4BNYA 2FF5A 2XZPA 3OFSA 4DN6A 1PDWA 3RVLA 4HATA 4N48A 2J9XB 3CVOA 3FI9A 4YRBA 1VRWA 3ABSB 3I9LA 2PFGA 1KYVA 3ANMA 1S2OA 3PFIA 4V0LA 4Y9DA 4BN4A 2ZE5A 3QBEA 4RZUA 5IZ4A 4BU1A 2K87A 2DT5A 1UFOA 1FXWA 1IZ7A 4FDMA 5COAA 4DSTA 3QIVA 4L7QA 1XROA 4JD5A 4NESA 4D9JA 4FMPA 2NXJA 3HM2A 4RLQA 5I4CA 3DE0X 1UKZA 2J4DA 2BP7A 2XUAA 1LY1A 2BJVA 2ZBQA 1ADJA 1RLJA 4IUCS 1MV8A 2YKGA 3JCZA 1CY4A 2BEVB 2OORC 1BU5A 1GU1A 4D2IA 4LF4B 1Y9EA 1DTSA 3NONA 1P0FA 1SELA 2H5EA 4NENA 4JFRA 3ORYA 3FTPA 2IPLA 4OD0A 2ECFA 4MSUA 5LPNA 3THOA 3R8CA 2XPCA 4LE1A 1UANA 3WGTA 2C4UA 3F67A 2JJYA 3I9V1 3U3JA 3JYQA 3S6JA 3I8OA 4J49A 4F3RA 4UNQA 2NO0A 3HVKA 3K05A 4NV3A 4DAOA 2KM1A 1JJBA 4P4TA 5EE0A 1JLSA 2JCSA 3N59A 3RG2A 2GZAA 2P2GA 5EMJA 2Q6OA 3E58A 2FPLA 4RS3A 2FSGA 4CKBA 1VFNA 2GZRA 3WYEA 5DWDA 1Q0QA 1P44A 2XH8A 2IHKA 4BLOA 1I3MA 3L7JA 1PG2A 1YJ5A 5K0CA 2QU8A 1H6DA 3HKDB 3K9HA 4MITA 4X60A 5F73A 4C0SA 1YB2A 4RSHA 4E88A 2ADFA 1JYSA 5I51A 1E58A 2VZLA 3ABOB 3PFBA 4ON9A 1Z4OA 2HA6A 4P92A 4BZWA 2IGTA 4QBFA 2IWHA 4DBLC 1P7PA 2RI0A 5EJMA 4QU5A 2EWMA 3A7EA 1OGJA 4PIPA 1XU9A 3T35A 4B2IA 1H2RS 5KYVA 4G0UA 3AOEC 4KXNA 2J6CA 4MYSA 1DARA 2O48X 3H3JA 3HN7A 3V80A 4PYJA 5GTDA 3GRUA 1NUPA 1GPKA 5DGTA 5SV2A 1VFPA 1OXBB 1M1YA 3FZNA 4TS1A 4Z4GA 4JZKA 1P31A 2GX6A 2I7VA 1S2IA 2HGZA 3GA0A 3HLKA 3M4NA 5DM70 2G67A 3U60B 5FPTA 3TCXB 5EP2A 5CLFA 1NLYA 3ECCA 5J2UB 2XB4A 5EJAA 3L7LA 1O96A 1XXLA 2EP5A 4JA2A 2BTQA 3WQHA 4BMCA 2XCIA 1N0UA 1MZVA 2AV6A 2VZEA 3I9MA 5AVOA 4R1UA 3UJPA 3H17A 3WRYC 3RNOA 4C0JA 2BEWB 3A31A 2BM1A 2ACEA 1EXWA 1T8RA 4P7BA 3TG8A 1JSLA 4YMIA 3EIQA 2NU9B 3SHOA 2P67A 5I9SA 1PL8A 1PR0A 4OPMA 2Q4RA 2V7QD 2A1IA 2UV8A 4NXMB 1H1LA 3T1HB 3RBAA 2HBZA 3MTEA 3A6ZA 1ENPA 3DBRA 3BERA 5KJEA 4QOSA 4N0DA 4QUJA 5ALMA 4FEEA 1LZLA 1SVWA 2OG1A 4JUBA 5KYGA 4NLLA 3DFMA 2FFAA 1BGVA 1D3AA 1ST3A 4UBKA 4UM9D 1SCBA 3T5TA 3ZYZA 3DLBA 1M1NA 1L7AA 3C70A 2PZ8A 1YCGA 1CY7A 1GR1A 4YRJA 2QP4A 4CQNA 4CEJA 2A4MA 2CLEB 3F90A 2L42A 3OT1B 2ZJ4A 4EHFA 4JP1A 3N8GA 3U61B 3RVBA 1L4BA 5IZCA 1AHNA 1LQUA 2EFDB 1PLJA 3GRFA 4W8OA 3SQLA 4QYIB 1VIYA 2CCGA 4OB7A 4RLHA 4PR0A 1JQ3A 2B6NA 3PD0A 3KYCB 1YR6A 4OXYA 3TW8B 1BTOA 2H2GA 4LVCA 3FNFA 2W43A 2Y8EA 5AESA 3MLAA 4L02A 4RVUA 4WUVA 1PR1A 4CL0A 6YASA 4ZVPA 1H9BA 1TFUA 2R79A 2B92A 1M83A 2VJBA 4DM4A 4X1YB 3ULKA 2Z04A 2CFCA 4L85A 3VNUA 1VPLA 4FCWA 3L6CA 1CR1A 2VBIA 1PL7A 3KFLA 3EF1A 3WS7A 5EWJB 4IBOA 4NH4A 4ZI7A 3WSVA 2VDOB 3MCTA 2PGLA 2PV0A 1MHTA 3E70C 4DJFC 3NCTA 4R6WA 4R9RA 4B3FX 3EOZA 3OCWA 3VR5A 2HJHA 5J2UF 4PBRA 5ITSA 4QJ5A 3ZNNA 2H4HA 1ZSYA 3GNQA 3QMWA 3QBJA 1ZOOA 4X1OA 3SS7X 3VDXA 1DO0A 3VTZA 1L5RA 2C7RA 4HAUA 1FUIA 3SX2A 4D0GA 5GWXA 1O9GA 2O1EA 4ZQFA 1JSXA 3OQVA 3D81A 4H3KB 4D8UA 2YFHA 4JQCA 5DLPA 5L51A 1T9KA 2BJWA 5T3UA 4CRWB 3E0XA 4TVSA 3SJUA 1DAOA 5CB0A 2YHUA 4LGVA 1GZDA 1EGAA 5E2IA 4F3TA 4C04A 4KH1A 2X4GA 2CMHA 3O82A 1CZRA 1W4AA 3Q72A 4S04A 3OE7A 4XFDA 3C8ZA 3UAOA 5KQRA 2VHEA 1N2HA 4G5QA 1XZIA 2ODEA 4OHYA 1K3TA 3ZN2A 1MABA 4LJ9A 4BOYA 1PGPA 1ESMA 1GCAA 1X70A 4BVAA 4EUEA 3N3AC 5ADHA 4PX9A 1SRQA 5FA5A 4EHBA 2FY8A 1GLGA 3DGFC 2PWYA 1IXZA 1T0PA 1UC9A 4NJMA 1P2DA 2PZLA 4P4UA 3D7RA 4OL0A 4OQZA 1P45A 2ZXEA 1K7CA 4TKVB 2AOUA 2HF8A 1J25A 3O8QB 2EP8A 3M5CA 3IEXA 1ISSA 3OUZA 4DLUA 4QG7A 4WESB 3SD7A 4B6FA 2BELA 2PNJA 3L4KA 3PEVA 2DR2A 2WJWA 5ESRA 2TMKA 5AXAA 5IAGA 3CWQA 3KSBC 4Z3OA 1GUDA 2JFZA 2G9RA 4OH7A 4JLNA 2BCGY 3RYFB 1FFSA 4BMZA 1IMOA 4M21A 4RDIA 1RZVA 1U4OA 5CTJA 1SIWA 2H9YA 5GY7A 2Q7DA 1WF6A 2D2EA 3UQYS 5A9SB 1E4OA 1XAHA 1D1PA 1UOQA 2L69A 3GLKA 5JU6A 3QFTA 4EO9A 1USKA 2IEBA 3OLCX 3N05A 4FBMA 3ZBTA 1RRFA 3W8RA 3ACBA 4U2CA 4GI1A 2VLBA 3TE7A 1MHPA 4OOFA 1XAGA 4G6ZA 4JWKA 3UMFA 3B8EA 4LZNA 4C0QC 3NX4A 3I5UA 5ES4B 1PZNA 1Q3HA 1J9ZA 4KTVE 2IOHA 4MV5A 4C2UA 3LQ1A 1WCV1 3O3CA 4G65A 3D7NA 4AMVA 4KZPA 4KIWA 1XN1A 3HXQA 1P1BA 5I9TA 3W2HA 3D1LA 2CNLA 2KS6A 5SZIA 1ZEJA 4BLPA 4F04A 2PZJA 1IN4A 1S2LA 4CUZA 4Q0MA 5IM4A 3G79A 4RORA 4YRAA 2HUPA 1S2MA 1QIJA 5BXYA 4U7PB 5FOVA 3TRHA 4ZMRA 5KOIA 4KPEC 2FPUA 3PNLA 1L4EA 4F4IA 5G1NA 4B34A 1GL7A 3RYHB 3KJNA 3I58A 4HDSA 2OHFA 2Q4DA 2EKPA 1T8SA 4UULA 3F7MA 1P61B 1VG8A 5E6RB 2ESRA 1ICIA 5CJPA 1J00A 4UPEA 2PS3A 1CRQA 1PT9A 3AUKA 4GLJA 3RAJA 5ALPA 1QGUB 5CX1A 4XB2A 1SKBA 5GAJA 1MGOA 2C0CA 4WKNA 1A9XA 1OXMA 3PA8A 2OXTA 1NASA 2GYWA 2QTRA 3MERA 3IAXA 2XMQA 4XZ3A 3RU9A 4PXSA 3GUCA 5A5DA 1R9JA 3ISTA 3K8OE 5B37A 2LCQA 4EG6A 2IYWA 5EUCA 2CYBA 1UKCA 2DQSA 2P8JA 2WY2D 1NURA 1PKXA 4AY2A 4QATA 3HCBA 4KK4A 4MRVA 4WFQA 1U0RA 3FJ1A 2ZPAA 3JAKA 3EY4A 2BGLA 1AOXA 1CKEA 4UD6A 2PE5A 1GN9A 1XALA 2ECOA 2PIAA 3PJFA 4XUEA 3WGHA 4EA6A 3UOWA 1CZKA 3N7UA 5I9IA 2OQVA 3NXKA 3SF8B 2D5AA 1MLDA 5KMGA 4RTKA 4D81A 2QD5A 2JH9A 2QN1A 5CP8A 2Y99A 4HUQB 5EYPA 4GOOD 1CE8A 3KYJB 4EFDA 3QWFA 3UIEA 5H3LA 2PMFA 2DWOA 1FNSA 4HB4A 1LJLA 3PA6A 4OXKA 1NVTA 3GX1A 3B7PA 4NG5A 5TJHA 3TTVA 4J94A 3FLMA 4BGUA 2QEQA 2QG4A 3HBLA 1XZCA 2Q3JA 3KL4A 4RY8A 1QR6A 5TEVA 3L0SA 1OCEA 2IV3A 4YT8A 1PEAA 4LF7B 2BIFA 4DQ0A 3A6JA 3KZOA 3UN1A 2IIQA 3IAS6 2ZWPA 1ENZA 4AXXA 3HADA 4PTYA 3HP4A 2FSPA 2P2DA 4FKZA 5ALZA 1YQWA 2QN8A 2HV8A 4X64B 2AKAB 4KVZA 3D6HA 2HIGA 4HYQA 1LRLA 2FVYA 2JIPA 5DGHA 1NDUA 2XKAA 3JWPA 5KINB 2GHQA 1XNHA 1PGOA 3LLMA 4US1R 1T5SA 1JPNA 3ME5A 2EW2A 1T36A 1FNMA 2GBLA 2W6NA 3OD5A 3U4GA 5K3CA 3QLUA 1R74A 2IUEA 3CVVA 3OCVA 3ZW8A 1X87A 5C7IO 3L5OA 3M1LA 2FZ5A 1NY6A 4BWYA 2WF8A 5BMVF 4M49A 2BEVA 2JFXA 1NU8A 4FBLA 4K1LA 4D9GA 4EKEA 1AB5A 4HGQA 1E1RD 2DPMA 3PR3A 1HG1A 1EB9A 3D4PA 3DOHA 3W04A 3ZCRA 2PUEA 4ZZIA 1ORRA 1DQPA 1CK4A 1TZJA 3CS3A 4I36A 4L27A 4M1YA 2G1PA 3FCSB 2R7MA 1MOSA 3DT8A 2D5LA 1TMOA 4IOKA 4JELA 3UXMA 2ZS7A 5I6DA 2VUHB 1NI3A 1PR4A 2AYXA 2YOHA 4N1AA 4FONA 2MTBA 5JPDA 3FCUB 4DLSA 3VZPA 4PSKA 2AJLI 1CC1S 1XTSA 1IULA 2HX1A 1II9A 2OG2A 3IR6A 1HFKA 1IXYA 4GE0A 5AI4A 4WY8A 4PZZA 4CDRA 1QKIA 2YX1A 4NECA 1NBEA 1QH8A 4P82A 4ALIA 2FEWB 4AP9A 5JT1A 4QDXA 4NOJA 4EFNA 1O0CA 4G85A 2WWRA 4DW8A 4B09A 4UKDA 1YQEA 4IS2A 1J23A 2Q1YA 1OAOC 4J1SA 3R3SA 1J2UA 4UZEA 5BURA 2R1UA 3VKVA 2D1FA 3ZY4A 1P7WA 2ZYRA 3CLSD 5FA6A 3TZLA 1Q6ZA 4JCCA 4MIEA 1HE4A 1Z0JA 3UW1A 4DLYA 4E5MA 5FUWA 4FOOA 4EW3A 4L6IA 3L6DA 2ZRJA 2YQ4A 3BK1A 1E32A 1XSEA 4ILKA 5BT9A 1D1SA 1SVIA 4BMYA 1DC3A 4PPFA 5JZOA 3NIDB 3G7UA 3VV2A 4LNAA 4K9NA 1TW2A 1C9NA 2UYOA 3DL2A 1VRVA 1FBNA 1Y98A 2YN2A 4ODIA 2CWWA 3MVEA 2BTQB 4UEKA 1KEKA 5FBLB 3BCUA 1RRMA 4WKPA 2Z8YM 2QMUA 5FWXA 2Z08A 4FSHA 3LC0A 3Q85A 2GN4A 4RWZA 1UWLA 4UBOA 4OSEA 1YRAA 3PXEA 1ZI6A 4KDEA 4UFNA 4PC2A 1W36D 1A9RA 5C7YA 2ZCVA 4RPJA 3DBRB 1R00A 2IYPA 1SKYB 4WX2B 3VX4A 1R5BA 1F1BA 1LI5A 3GEMA 2GVZC 2FHPA 4NBVA 5LQMA 3CLRD 4MQMA 4X3PA 4TMWA 1I4DD 3AEKA 4GPIB 3GJ0A 1B23P 3R5TA 4QX6A 2GESA 2JIQA 3TZKA 3CNLA 5AWFC 3AL0C 3FCYA 2XQFA 1LXCA 1KDOA 3IUEA 1ZA1A 3U0VA 4RYDA 4WKBA 5CGQB 1YSCA 3WP0A 3C5CA 2XRYA 3GHHA 3CRMA 1F1JA 2NVUA 1SOWA 5JATA 4WLOA 3RT7A 2QPAA 4KLAA 4PAQA 2RBEA 2IH4A 2R84A 3PYLA 2G8NA 2X5JO 4V1CI 4B2LA 3R5SA 1OJ7A 4OQNA 4N0MA 5DX8A 4BE9A 3RVMA 4I14A 1AMOA 3LBNA 5CBKA 3H05A 4H59A 2XB8A 1JT9A 3IDAA 1Z63A 4BYMA 1L5ZA 4C3VA 3EIHA 2A33A 2EL9A 2ZJ5A 3JQ6A 4I5DA 4I4IA 4P53A 4WKOA 4Y9TA 3RSLA 4LF8B 4IUBS 2FPIB 3WY9A 3ETJA 3GFQA 1NR7A 1JTFA 3NV9A 3NYRA 3F4LA 4QHYA 5EN4A 4D8VA 1Z6GA 1E2NA 2J3MA 3ESDA 4DIEA 5B3JA 3Q8WA 3WGUA 3MLEA 2IHTA 3L18A 3RSOA 3WK5A 2DFKB 1MQ9A 3JD4A 3LYUA 1XLTA 3E84A 3SX0A 4M87A 1GGHA 5IRCD 2BSAA 5GJBA 1W0JA 3D4NA 3LDGA 1DMSA 2B82A 3GPIA 3R5XA 1J0EA 2TYSB 4QNNA 1H6AA 2ZULA 1LDEA 3UJNA 2RGRA 3JQFC 2W2TA 1FLNA 2I6QA 1BHQ1 1VI6A 3R3UA 2QW1A 2V9PA 5CFNA 2H2DA 1GQOA 3HGTA 2JW5A 4EMTA 3HR4A 2Q2NA 3TOSA 3WKAA 1LVGA 3PHJA 3T1TA 2WTAA 2ZYHA 3PZBA 5KSPA 1O5IA 1YUBA 1X1QA 4EQ6B 3GLVA 1RRKA 3WOVA 2QA5A 2WD7A 5FL7D 1UXGA 2PV7A 1E92A 1T1SA 3FX2A 3OIYA 3UA3A 3W2EA 3D6MA 3H18A 4L0QA 3ZEAA 5KTNA 2DXIA 3DZHA 1G4AE 4RVGA 2H2AA 3A0UA 2MSNA 3AGPA 1D2NA 5EZQA 4BE7B 1TEHA 1NW9B 2CLKB 2Z2IA 1EEXB 2GZMA 2OZLA 1V1MB 4LGYA 5I9MA 3TBKA 4CLDA 5JE8A 3KQMA 3O4JA 2C5LA 1IHOA 3AY7A 1QIEA 3NU1A 3RYCB 3P1JA 3BGSA 4QAQA 1MH1A 3G8YA 1FSSA 3RTGA 3VSCA 2JBHA 2IU4A 4R3UC 4JLVA 2IPNA 2Y77A 4DT1A 3LPCA 3OEHD 3I32A 6NULA 4HRAA 4N49A 2DFVA 2VK2A 1IHDA 2EZUA 3PUYA 1AGXA 1I8TA 3SPXA 2I99A 3V00A 1EBBA 2ZIVB 3C3EA 2AUNA 3ASUA 4GPBA 4OEHA 2NVOA 2VZ8A 4ZT3A 5TARA 1N2CB 1PS9A 4D92A 2R2AA 1H1TA 1VLQA 3MIZA 1PT7A 3ZXXA 1AH2A 2R68A 4E1VA 1A95A 2NZYA 4ZCIA 2JJ2D 1LTKA 1LNZA 2QQFA 3U4AA 3ZIAD 3CGGA 1BXZA 2J9GA 1O6BA 1R8XA 2LZ0A 1TW3A 5T6BA 4HDNB 1Z0KA 5TMDA 5KOJA 3NAMA 3EG9B 4RFVA 2H5LA 4ECEA 5JDCA 2NPOA 5HVNA 1GCOA 2WQZA 1VE7A 3BICA 1E2IA 4R83A 3A3PA 2GJ4A 2C5GA 4FZ3A 3O0DA 5G4KA 2WTEA 4EX7A 3JAMA 1P75A 4TLAA 2UYCA 2E5WA 2QAJA 2R7AA 3PV0A 3OOJA 4FNOA 1KZHA 1QHNA 1X9HA 1N75A 1KNQA 1Y6ZA 1ONBA 3WAJA 2WHRA 5I8WA 2PQ2A 4R8MA 5JYDA 1JSRA 2F17A 5DN6A 2X40A 4UTOA 1LVUA 1XZNA 2FWIA 3KTFA 2Q1XA 4YYEA 5E0OA 4PLHA 4DSAA 3OI7A 3PRJA 4P32A 5A5FA 5THXA 2B8NA 2J59A 1H9CA 4HD8A 4IIJA 4A6DA 3PGMA 2WKWA 1FFHA 5EC8A 1WBJB 1QJCA 2FGJA 4K9RA 4XYEA 2GYUA 1NIPA 4C5AA 4K03A 2G71A 1Z5OA 4K86A 2QN6A 2VUIB 3F6SA 3NV7A 5FH9A 1UH5A 3FA2A 4ZOQI 1T9AA 3GNTA 1WPXA 1NULA 2HT6A 4XFJA 4YQZA 1G2QA 3UAZA 3OCJA 4IXDA 3WGKA 4BJ1A 5L8VA 1Z18A 5KNCA 3BB3A 1F4PA 2W0SA 2Y1KA 1DELA 3JQEA 2AR7A 1EZ4A 2ZIUB 3BM5A 4ZN6A 4U7GA 2OHIA 3HNOA 4O4LB 3CB2A 4DNXA 4YUXA 2IITA 1U2SA 2Q9CA 4EJSA 1KDTA 3T12A 4NAVA 3WLOA 3T7RA 1WETA 4AJHA 3MTGA 1GGKA 2C2GA 2FZCA 2YXNA 1PR6A 2ZJOA 4GZ6A 1UF9A 4NK4A 1VLJA 3MPUA 3EVBA 1CETA 1ESZA 2JBAB 5AD1A 3ZH9B 1C4OA 3MTIA 4CMEC 3OA2A 1UIRA 2VZ0A 3QVMA 4YDSA 1JVBA 1OHHD 1Z38A 5J4LA 1D07A 2IVZA 1SVNA 3KVOA 5CYOA 2XUDA 2C04A 2XDQB 5LIPA 2E1PA 1WHTB 3FNEA 1XBTA 4G5HA 4M8NE 3NXSA 5A3VA 5DTMA 1JWLA 4FZRA 4G4JA 1BVUA 2GRJA 2D2IA 1XNQB 3U6KA 1EWQA 1HT2E 1TU0A 3HVJA 4YTEA 3LQFA 2H54A 4UOEA 4K9PA 1ZSVA 2PX6A 3OPYB 5JALA 2XEXA 2EHJA 4ONEA 3HTXA 4AN4A 5F9FA 4JLUA 1HUQA 1X8KA 2QSZA 1N0HA 2M1ZA 4KSYA 5F4ZA 1EFUA 3TFQA 3W1VA 4EG5A 1UT5A 1YD7A 1ZS9A 1XFAA 4WNIA 1U1EA 3QU4A 4NYJQ 2XRFA 4POAA 4QXMA 3S2ZA 3HSSA 5F23A 4GHWA 2FN9A 3H9CA 3M34A 4WZAB 5I8PA 2M32A 4IMJB 4NY1A 2G7MC 2YUIA 5CVVA 2UVPA 3GA7A 1U5BB 1D2CA 3BMNB 4B85A 4KFSA 4AICA 3DBVO 4HXYA 1M2GA 1V8FA 5IG2A 3ZS9A 1JKFA 4KE7A 4KPUA 2F8SA 4ZZ0A 4WKGA 1QG4A 1YDEA 5CPFA 4CF5A 3K6KA 2NZJA 5KKCA 2UYGA 3HWX1 3IESA 5AM4A 2X2OA 3MJDA 4YRTA 4GF5A 5KQLA 1QZZA 4LZLA 4NBTA 1KAEA 3KPUA 5HP4A 4LVOA 5J5AA 3G2IA 1Y9AA 1ESEA 4EGAA 5BNZA 3A70A 4HDRA 4F93B 3N5KA 1KEEB 5E6UB 3EGXA 5BR8B 4DV3B 4JXXA 3LPNA 4LYGA 5C5CA 5H70A 1M2KA 1XHLA 1YIAA 5AVTA 3UXEA 2FN7A 3DC7A 2DM6A 1SBTA 4Z4EA 2PRIA 1US8A 1EQAA 4R1MA 1SU7A 1UK8A 3OZRA 3X2SA 3IX7A 1T1RA 2G5TA 1C4XA 1NMEA 1SG0A 1U31A 3QOWA 6LDHA 5JSHA 2PUJA 5CB6A 5ALGA 1MD9A 3GRAA 2X15A 1V5FA 3HDTA 4GX5A 2ZRFA 4I50A 4IKPA 4MUMA 4RH3A 1T1JA 1JLRA 4H6XA 5JO9A 2CJWA 4RFLA 3TEJA 5IAAA 4Z53A 3SEFA 4WFKA 4E3WA 1U2GC 5FWXB 5L7WA 2KW5A 5KJ6A 1T4GA 4ZZ2A 2BBTA 2XJ4A 1DBIA 2CD9A 3CUTA 2JEZA 4V0SA 2NO9A 2D1TA 1FLDA 3AP2A 1J8YF 2AD1A 1CZOA 4RV9A 1KVRA 2O0HA 5TF0A 3LKZA 3KTDA 1HLGA 5LXTB 1E2FA 3RROA 3SFVA 1CJSA 4BEWA 3PHCA 4RL4A 3DEIA 3B53X 1JQBA 2HEGA 4PYKA 3QVTA 5CB8A 3UPDA 3VOSA 2QUIA 4HAOA 4QXPA 5KNBA 2AMVA 3EVZA 2HDOA 2NUTA 1L4LA 4CLRA 2YV2A 4X24A 3PDUA 4C0AC 5ALTA 5LZ5A 5WRFA 4P7GA 5I48A 3MYYA 2EYUA 2X0RA 3LVRE 3C8UA 3RVDA 3SDSA 4ZHSA 1DPFA 3I28A 4PS1A 3PF8A 1T43A 4IMRA 1L5HA 4RHXA 3G2MA 3AY6A 3CUKA 3D2BA 4UAGA 4WTOA 5I4IA 3L4BC 2AJCA 3NDBB 3SIPA 3CB4A 3FSEA 1N3YA 1WUYA 2Q29A 2Q3LA 2W8ZA 3NWEA 3RU3A 2BTEA 3BE5A 1Y42X 2AFHE 4KBYA 4MVXA 1YZGA 5FTMA 2O6LA 2VF2A 3L9WA 3LYAA 4ZRDA 4G0NA 3ESAA 5C18A 3NKFA 1ZBQA 1DP4A 1KMMA 1QE0A 1UMBA 5ADUS 1YJBA 3PS9A 2FWPA 1VL1A 1B3BA 1F2UB 5LB4A 4EG1A 2NT4A 3LQRA 4D4GA 3GXBA 2DKOA 3E7FA 1XG5A 3WMRA 5CA0F 2QROA 2I2FA 3RDPA 5KOHB 1O4VA 3K4HA 3ZD8A 4DRYA 2XVMA 1S3GA 1XUOA 5DT2A 1RACA 1PJ3A 4E1AA 5EIXA 1IIBA 1U9IC 3LWNA 2FX2A 4BASA 2YJ3A 5LL6P 4KREA 4QNMA 1UPTA 3W4IA 4DPMA 4EI2A 3GGPA 5HQTA 2Y1GA 5FCDA 3MGAA 3ZTWA 4LY6A 1JHXA 4FMDF 4D98A 2NNLD 1FJHA 1FNNA 4P6VF 1NVVQ 2ODNA 3ZHOA 1ZEMA 4B7AA 1T4DA 1U6JA 1JKMA 1R9MA 4KITB 5AW7A 3SQWA 1BDMA 4KJZA 4EHKA 2ZRKA 3KVNA 1O03A 3EGEA 4EDHA 1E3TA 4OYYA 5LYJF 3FGPA 3ZU6A 1E4EA 1Y63A 5CVUA 3IMGA 2PUTA 3UAVA 3U62A 2GPYA 1R6TA 2QP9X 4NCJA 4TMKA 3DXZA 1MAAA 4DIUA 1GZ4A 3E82A 1U90A 4P1ZA 4X61A 5EQFA 2HCBA 1VHWA 4ZI5A 3P8ZA 3PL5A 5TSDA 2HUNA 1ADCA 5HCIA 2YVKA 3D4IA 1HKHA 2WYOA 5E1BA 2AS0A 1Z2OX 3V7NA 2FFBA 1ZCJA 4C6TA 3LL7A 3UB2A 1BS1A 2DBRA 2UKDA 1U02A 4RV5A 2JFPA 3W3ZB 1BYIA 1E1NA 4G0ZA 5BSTA 4KR3A 2ZYWX 4RTSA 1OAAA 3C24A 1TYCA 1V1JA 2C4KA 4AZ0A 3B1YA 1JEEA 3G02A 4YRIA 3S81A 3QXHA 2NU7A 1AHIA 3DAYA 1ORVA 4V2UA 5JZSA 3WLKX 3BL6A 2B2XA 1VB5A 3FPJA 1X7HA 4MO2A 1DFHA 6Q21A 1FNBA 3W2FA 1A4IA 2GZHA 4D6PA 1Z5WA 1U5AA 3D6NB 4ESOA 1X19A 1KE1A 3C7AA 4Q4LA 2B8EA 4TUYB 3FPHA 3RIEA 1E6WA 5EJ8A 1PG0A 4KXQA 1K08A 4PIVA 5B3AA 1ZY2A 3WRVA 1CZUA 1JJIA 1XCMA 4JMPA 3H4IA 2UUPA 3D7SA 3DOCA 2ZDQA 5AQEA 1VDMA 3IO3A 2VAVA 3WSTA 5IJ0B 2G5GX 4YAWA 4ANFA 4EP1A 1XRQA 3B1VA 4WZAE 5HQ3B 1M7BA 1GTSA 2H4WA 3URKA 2VI5A 3KKPA 2FR1A 5F2NA 3P2KA 4Z4FA 3PK0A 2D62A 2IX9A 2G9VA 2JGAA 2MINA 1CERA 3IPXA 4R4JA 1XCPA 4NFYA 4RANA 3ZG6A 3C6KA 5EJ4A 4EEXA 3I3OA 2IVFA 1UBMS 2ABWA 3M89A 3W5HA 3EG9A 5JTTA 3OJOA 4MW7A 4L5AA 3O03A 5U9CA 3RBXA 4HDMA 13PKA 5DTQA 1MJFA 4A15A 1O96B 4NDNE 4LDJA 3SS8A 2LP4Y 1EP9A 1T1IA 5AHWA 3MB5A 3VQTA 1WBBA 2A1TR 3G0CA 2P7HA 3I3SR 3KALA 1PO7A 3Q40A 4FFLA 4OXXA 2NU6B 2YNMA 3J81A 1DIGA 2A3NA 5DI9A 4GFDA 1ODLA 1UBHS 5LWHA 1TPZA 3TPFA 4LWOA 2V7VA 3U81A 2V55B 1XNRB 4OLBA 1TJNA 2HSWA 2NZ8A 3BXGA 3UT0A 4Q37A 5J5CA 2P3SA 4UU7A 4ER6A 3RFXA 2NAPA 2RHDA 2Q1WA 1U8XX 3L05A 5GZ3A 2QD4A 3WWYA 4EW2A 4PVDA 3W1WA 1Z6AA 2VRCA 3AR7A 4D82A 1Q0LA 1OZHA 1XZAA 1IN8A 2C95A 4FFRA 1GPBA 3R6DA 1NF9A 3HP7A 2C83A 5K01A 1QANA 1ZIXA 5B30A 1T9GS 4JBNA 2IS2A 3GPBA 2WF6A 4Z8YA 2I54A 4FYMA 1U1DA 3CX6A 3DMGA 3PPWA 3ROZA 5JC8A 1Z39A 4CLXA 1JLKA 2P5YA 2W58A 4PZAA 3VUEA 4HH3C 3TW8A 1W34A 3FUVA 2HREA 1I7SB 2VXYA 2WAXA 2H1LA 3QFHA 5IMSA 1HFJA 2IE0A 4ACBA 3ZKAA 3RS0A 4P4NA 1KYYA 2Y1EA 4EF6A 4B7UA 3D2LA 2VH2A 5C4MA 3I76A 4BCCA 2JIZA 3DDZX 8ABPA 2H5IA 5JANA 3WA7A 3R3XA 4WHMA 2IEIA 3KLOA 4QOFA 3AYXB 4R6XA 4U0JA 4RGBA 3F47A 1RQXA 1PFUA 4RYLA 2GK7A 5EESA 1JHDA 1R18A 2VDRB 2WWXA 2Z5GA 1NIJA 2QI9F 3JRXA 4J2HA 2I4OA 2XEDA 2G0AA 3TFOA 3K6SA 1XEFA 3JQQA 2QAGA 5D1HA 1JR6A 3NBUA 2ZRHA 2Y9PB 3A9VA 4LJRA 2ORED 4FMDB 1LK0A 3OIGA 4EPXA 1WW8A 1FUUA 2C5EA 2PSHA 4IGEA 3VUFA 1GZUA 2GM4A 5AI6A 1LI7A 4URWR 1AV6A 4FN4A 2UYHA 3EFOA 4RVFA 4Q00A 5FADA 4MDHA 1O3YA 4FGLA 4X20A 5KTTA 5KNDD 4QDJA 5IABA 3DDOA 4LZOA 3W79A 4ZA2A 4HDKB 4QXQA 4HLQB 3VTKA 5ELMA 1ECFA 1VLHA 5DI3B 1ORHA 1PJ2A 1Q1QA 3TLGA 4P7JA 2IS4A 2V65A 1QF6A 1M7GA 1GA4A 1ZR4A 2QE7D 1VCHA 1T2AA 3DW3X 1VA4A 5D5HA 1U2ZA 4OQDA 2WF7A 3TGPA 5IKEA 3FOBA 1GP2A 2HGSA 4GXRA 5C35A 1J1ZA 3LS2A 3KQVA 3T3EA 1KU6A 2QYTA 2HRCA 2IZ0A 1G8KA 3W3AH 1T2EA 3LHKA 4NMXB 3THXA 2ORYA 2JEOA 2PGIA 2WJGA 3BKWA 4O2BB 4D9KA 3ZLUA 4EY4A 1NQVA 4MAFA 4L08A 2HBYA 4MVYA 3OG9A 4ARVA 1R0ZA 3V3KA 2YS7A 5AHXA 2GEUA 1WNFA 2O6HA 1QH9A 3WLFA 2PT9A 4CT0A 3DB1A 1P2BA 1UQTA 4I4TF 4GLLA 1L5NA 1EG7A 1G7SA 1GRNA 1HRDA 4EI7A 1FYWA 1KXJA 1VM6A 3QE0A 1OJLA 4H4DA 1YBHA 2O07A 1M2WA 1NBOA 2YWEA 4NZ9A 5EE1A 4US2R 5F5XA 1LDGA 5H16A 1U8FO 1YVUA 3DYVA 3MTAA 2ALJA 1RKVA 2CK3A 2JS7A 4C01A 1NOIA 3EXFA 4J0EA 4HN9A 3KSDO 3I09A 4V0OA 3ZCTA 3V4LA 4KGVA 2H1FA 4OAOA 3QPDA 5E6UA 4DLKA 3K5IA 2G9QA 3C3AA 4OSPA 4MIYA 2C7PA 4XYMA 4WKCA 2VAXA 2VJQA 1Y1PA 1U3UA 2RH5A 2DUWA 3INRA 1Z8NA 3GNLA 1LBQA 2ZB4A 2OYSA 2QDXA 5HXAA 1CQPA 2JVJA 3D6AA 1B15A 1V8ZA 4RLSA 5K3SA 4FGKA 5DNCA 1ZVQA 5GIOE 2H5JA 2JLRA 1BDHA 1HTWA 3PX3A 3L6RA 3RYIA 2WWFA 2LKDA 5BN4B 5KJFA 3A36A 1OT5A 4P33A 2WAAA 5ALIA 3T3GA 5LLDA 3NUZA 1JEOA 1OA0A 1W4ZA 3GWGA 5B2EA 2OXIA 1D4AA 4RJTA 2OKGA 4OI4A 2GAJA 1UADA 3MILA 3JV7A 1I1HA 3IXMA 1QAMA 3I6ZA 1XFDA 2QR5A 3A2NA 2F4NA 1WY7A 3O4FA 3PL1A 1JYEA 1HI9A 2NYRA 2QGFA 1GFIA 3NUGA 1C3OA 2R11A 1QGUA 5CX1B 2V45A 1ZK2A 2BGWA 1Z7BA 3I1FA 3WQBA 3ZNOA 5LKRA 4XQ9A 4BNXA 1A9XB 4GW3A 4MW0A 4REQA 4LYJA 5AT1A 1FFBA 4K87A 3TNJA 1YMUA 1AKQA 3NHPA 3QZUA 3ICEA 4FZ5A 3TVTA 1SKMA 1W1UA 4WL0A 4DMMA 1Z29A 4IL5A 5K0NA 5L3QA 4X6XA 1TL7C 2C9ZA 2FEXA 3ENQA 3KAPA 3KVRA 3N2LA 4W1PA 1T6BY 4MVJM 1ZGBA 5ULLA 4R8KA 1G2OA 1HYEA 2ERXA 5FPYA 2HIMA 4RF5A 1K7XB 4D43A 2RBGA 1I1OA 1CP2A 4RD0A 1EFHA 3DCNA 2B34A 2CNKA 3L8YA 3QF4A 5DK4A 3RH0A 4M1WA 2ACKA 1WMAA 3U4IA 4HMQA 4LXUA 4TL9A 3V4FA 4LSZA 5A3RA 2AD5A 5AIBA 1CE8B 1VL8A 2A9OA 3IXQA 4OIMA 2XHEA 4ZOLB 2EF1A 3R7WB 4ZHQB 3DAOA 1EWTA 4N3NA 4QYXA 4RPLA 4EHHA 3L8EA 1N2CE 4ZRNA 4F5YA 1JIIA 4U9UA 2HHJA 5D00A 2C2MA 2P6NA 3V4VB 2X9QA 4CNQA 1T10A 5IFKA 1AZTA 4OJTA 5J2TF 5JAZA 3DVSX 2WK1A 3NC4A 2PKQP 4HB3A 4BNGA 3I6IA 3A1TA 3S44A 5ALYA 1YR9A 4HRVA 3NI2A 4B75A 4R31A 3HKBB 3JS5A 4AJIA 2HOQA 1UBKS 1OUMA 2FPKA 3ANYB 4JLWA 1C3XA 5FYDA 1KI8A 1HY3A 2GWRA 1GLNA 1BWPA 1H2YA 2HSZA 4M9UA 4RHCA 4UQLA 5IXSA 2JGMA 1I2CA 5BUCA 4ZV4A 2EQAA 3TYXA 4F11A 3Q5EA 3H9EO 3KB1A 3WKEA 4CKEB 1EFRD 5BWCA 4NCAA 4CT5A 4HX9A 1SURA 5HPYB 1OHHA 3WYCA 3OCXA 4ND2A 4KQ1A 2CLIB 4F9EA 4AUKA 2XZOA 2YZGA 2Q5EA 1AKUA 4F4JA 4U6QA 5JH7B 3PC8A 2AJTA 1GO2A 2C4TA 2XV1A 1QVRA 1SVUA 1C9DB 3SKYA 1H8EA 1K06A 2JRLA 1QFMA 2FZGA 3FR7A 2GLTA 4AZ0B 3R9XB 1PWEA 3DMHA 3DZGA 3VKUA 4E31A 1JKXA 2DVMA 3F6BX 2I1WA 3VJKA 5FI5A 1DDIA 1E79D 2QZJA 3AEUA 2C3UA 3I2JA 4TYMA 2J9FB 4HQFA 2GVNA 3BIXA 1RIFA 3HVIA 3ZK7A 5AHRA 5E1OA 1OH7A 1CIPA 2XMGA 3KB6A 4PZDA 5AVUA 3PP8A 2XUPA 3A2LA 1U11A 3G2QA 3GP3A 2NTVA 3EEYA 1W47A 1N2XA 1R4NB 2YFYA 4TUYA 1M2HA 2DJ5A 3RC8A 3MGBA 3W0LB 4BBZA 1FFDA 1XTUA 1ZA2A 3LCUA 4CODB 1QYRA 4EMSA 2YRFA 4E12A 4MA5A 4AAYA 4Q3LA 2I7DA 4JSTA 1QHHA 5GZ1A 2WWGA 1KL7A 3KQWA 4DSOA 5IJ0A 5LKAA 2IH2A 1P1HA 3TZBA 3K0AB 4XYLA 3LC7O 2A67A 4OM7A 3IB3A 3I64A 4UTRA 2L82A 4BMVA 2D4HA 4RADA 4V3BA 1LDBA 2QM3A 2JB9A 4AX8A 2GT1A 2XTNA 3K2QA 4IV0A 2IS6A 3EW7A 3QFRA 1NW7A 1QFXA 1SIOA 4H7FA 3REQB 3A3NA 5T67A 4OMUA 1W5TA 3EIEA 1Y8QA 4D9CA 5DF1A 1ZD4A 1CF9A 3DEHA 3UYLA 3G13A 1KU0A 1CRZA 4N47A 2YHAA 2PQ0A 3HB4X 1T0JB 4RKQA 3QWIA 1VIMA 4QT0A 2XMSA 2HV9A 4AG6A 4BNIA 1L0BA 3OM8A 2ZI4A 4RGYA 3ZVLA 2DBVO 2LKCA 1UBCA 2X8JA 1ZMBA 4ND4A 4RZ2A 5EEGA 1Y6JA 2B8JA 3D8BA 3LA8A 4X94A 1KI2A 2XD4A 3VDRA 2BYTA 5FEMA 1Z88A 4GEKA 4ZARA 2CJFA 4DUZB 3T1QA 1XD2A 4OFWA 2DHQA 1LV8A 4DTCA 4HVTA 5HIIA 4MYDA 1QC5A 1Y1TA 1M0TA 1QSGA 2CWDA 4PXYA 4U3JB 3EIUA 3BGVA 1ZD3A 3B9PA 3BOSA 4QOJA 1ISRA 4RVOA 4U9IS 3RFCA 3ZNQA 4DREA 2D0PB 4OLHA 1P19A 2XXBA 4K9QA 5L9AA 2G76A 1WXGA 3OX3A 1HDYA 3LP5A 4I08A 1ONPA 2KWIA 1ZAKA 3A9WA 1SKUA 3P0FA 1Z2PX 3E9QA 5G40A 4DIMA 1OB2A 4A8HA 4FDLA 5IP5A 1WCXA 2XBMA 4D6XA 5CH5A 5TEWA 3GT4A 4N5LA 1N9KA 4WOJA 5KX5F 4YT4A 1P9LA 1KO5A 4HSEA 5ECYA 2X0EA 1IK4A 3ASZA 4G9GA 2IHVA 4PIMA 5KNBD 3VR6H 2AI3A 1KC1A 3COZA 5K51A 2VDLB 3P2OA 3S2SA 3ZZMA 1ADYA 5LLTA 2E5FA 2EJVA 2GAIA 5B1DA 1GAEO 1Z4KA 3GO4A 4HXGA 1GFSA 1SRRA 5L7TA 1KAQA 1SGWA 1W0KD 5ILGA 3IAS1 3H2GA 4XDGA 2AEJA 3RRBA 1NTRA 4DZTA 2B1QA 3CPEA 4L9WA 4NS1A 2FPIA 1YDMA 3BG5A 2ZIAA 1ABEA 2ZIXB 3JQPA 4M86A 2ISCA 2Q46A 4B3JA 5B6JA 3TW6A 3UPTA 1VJ5A 2N1MA 3LUBA 3FKSD 2XKJE 1D2GA 5FD8A 2JLZA 4DG5A 4Q4JA 3VNAA 3AERA 4TKUA 3OX4A 4PN7A 3GLHB 3RRYA 2GF2A 2CSUA 2R6R1 3NT5A 4MEBA 2PMEA 4AXBA 2PHZA 3OZEA 5AW4A 3DP7A 4B83A 2TMYA 2PR7A 4UEJA 7AT1A 5IVKA 1Z16A 3FYUA 1JFVA 4DSNA 2IL1A 4RCYA 2IYLD 3KL2A 4N40A 5AK3A 4IXWA 4DRXB 4DGSA 5BVGB 2JH3A 2UUBB 1RDFA 1T3TA 5EXEA 3EFOB 3ZOKA 4KLZA 5SY9A 1PL0A 4TQ9A 2PKCA 3DUFA 3BXFA 4J07A 4X20B 1KJIA 5AUQA 2V98A 1JGTA 4HDKA 3U1VA 5F78A 1XRLA 4LE0A 4D56A 2OCDA 4YRKA 3F8TA 4EJ0A 2CMGA 1SD2A 3GRRA 2CJXA 3DPSA 5CB4B 2R8XA 2K7ZA 3C4JA 4DDWA 3NWJA 3I2FA 4B6GA 2I1LA 2WD7B 2WAOA 3GT7A 2VKQA 4BTVA 1HORA 1ULZA 5AM5A 4L9AA 1SUWA 3SZGA 3L92A 3O1JC 3AP1A 1MX5A 4RDCA 4O2BA 3IVGA 2R44A 4EX6A 3O4GA 4F86A 2A5LA 4PZCA 1RC8A 4D4JA 1XPJA 3KHTA 1Y4SA 1FRVA 3P2EA 4JBIA 4BTEA 4BNNA 2X76A 1MEOA 3GFOA 2OO7A 4JI7B 3ET4A 5JS6A 3G0HA 2FCAA 4PZEA 5LD2B 4JYAB 1HSZA 1F4VA 1J70A 1Y5IA 3ACDA 1LQ2A 1AKNA 2XQVA 3IT2A 2CFRA 2WICA 4G5XA 5CLQA 1ZQ1A 5LQCA 1ZHFA 1QUEA 4CTNA 1C9KA 4YV7A 1LBIA 2REQA 4MGYR 3N2IA 4DT1B 3IB6A 2ZLBA 3QVWA 5IKXA 2JLBA 3LA6A 4F3YA 5FF9A 3O8BA 4HV4A 4MZXA 4DUPA 4J1TA 2ATCA 3HCWA 1Z4PX 1L4NA 1TQ4A 1B74A 521PA 1W5AA 4Q1VA 1WZIA 1Q84A 1JE1A 2AOVA 2J08A 2EEPA 3MTQA 2NO1A 3U7EB 3W6PA 3TW4A 3KSAC 1G7TA 3G0IA 3KQPA 1E7QA 1UBEA 2WSYB 3WLNA 4WMLA 3STTA 2WAYA 4EEZA 1IAQA 1HDEA 5D51S 3TLAA 4PLVA 1H4SA 3KNZA 2ZSEA 3DZKA 4LDRA 5BPHA 4K6KA 4MV7A 1QHSA 2CF6A 3B78A 4PSUA 3M6MD 2B5OA 3SR3A 1B2LA 4IIFA 4DCGA 1A9YA 1TJ3A 3VYVA 5E6SB 1P39A 3ZQ4A 4DM3A 1FQOA 2YXLA 3W9YA 3NLLA 2PGOA 1ZVJA 1E5TA 1VJCA 2HMAA 4KKXB 1UBUS 1UXHA 2NYUA 3JY6A 1V3VA 4BNJA 3FHLA 3FIUA 3WRXC 4UTNA 1XPUA 2QRNA 4JYPA 1AM4D 2ATEA 1NNUA 2V58A 4Y0AA 2ZI6A 2NYAA 5AM2A 1XTZA 2C98A 1KY4A 3PLAE 1CB0A 1JG1A 1UC4B 4O4JF 2Y67A 1QPZA 1EM6A 2QHXA 3NOXA 4WK2B 2P62A 1C3OB 4B7XA 3M82A 1H5QA 3QIAA 4URYR 5FUXA 2QZ4A 3L0IB 2Q8PA 4AG5A 1DC8A 1PFKA 2GXSA 4MS3B 1V3TA 1UOEA 3MHTA 2QVXX 2HRQA 2JI9A 1TM4E 1Q6YA 1HBJA 5LQUA 4CIAA 1AS2A 1BMDA 2V7WA 2WMDA 1A8UA 4Q7JB 5BNIA 3ENZA 2D1SA 3P0RA 2RBKA 4NYIR 3UTCA 1PJRA 1PQWA 4B87A 4B33A 2CE2X 3WLTA 1QNLA 4IYJA 4B8ZA 5F4BA 2CT8A 4XVQA 1U80A 3D7MA 2NXNA 4V39A 4YRRA 5DW3A 1HNZB 1FXWF 1EFRA 4D9HA 2I71A 2AWOA 4HMPA 1MIOA 2FETA 3JVEA 3EZ7A 4KLRA 3KPVA 1ZICA 4LC0A 1V4BA 5DP1A 4X7MA 3HBAA 3VYSB 1K98A 2F9MA 3C5WP 4C07A 5HJ2A 2I03A 1QS0A 2HLHA 1E9CA 2JIOA 1DU4A 1NBAA 2ZG6A 1EXNA 3JQGB 3LQYA 1N33B 4BMPB 1IQPA 1R88A 3BZWA 3R7BA 1VJRA 3EOAI 3VJRA 2HNBA 4FFBA 4DEXA 2J3KA 3IJPA 1J0XO 3D43A 3DKPA 5F2EA 2WT4A 5COBA 4Q1FA 4A91A 1GT6A 4RULA 2XQJA 3D1JA 4ADSG 4I9NA 3QEKA 1VMKA 2I34A 4PWZA 1DAMA 4OYRA 4HWSA 1T0BA 3RSFA 2Q9AA 4MVJI 3VAAA 2C4HA 3GUYA 3M2PA 3QPAA 4TS9A 3C7TA 5DBIA 3G3EA 3IUYA 2N46A 3LIIA 4WZZA 4EB8A 5CXQA 1BWQA 3GYGA 1AX9A 1LF0A 2DWPA 2IXFA 3Q7TA 4YJ3A 4YB8A 4UEQA 4E3ZA 1NN1A 3E53A 2I8AA 2HLPA 1V16A 2EFEB 1FMTA 2WHPB 8ATCA 1HKUA 2JLWA 1DOHA 3NR2A 2VYQA 2XF2A 3CNQS 1QRAA 1EEHA 1TFRA 1YB1A 1ZX1A 1LKZA 2WV9A 3FHOA 1ZNXA 1KP3A 3LYHA 4HLUA 4UAVA 5C53B 1N1GA 2QX7A 5K0GA 4DCNA 1ZM3A 4PQEA 1YB4A 2AB0A 2XKKA 3ANLA 3FWYA 4HGRA 3SXJA 2GDZA 4BGDA 3DPUA 4OP1A 1DV1A 2BGNA 1S0UA 4CG1A 1WZUA 2BP7B 2OCKA 1HNXB 2Z95A 3ZBQA 3ZCVA 5CITA 3WAGA 2VQ6A 3TLJA 4BKQA 3W8NA 4PN3A 2EIXA 2V03A 3W7BA 3S29A 3TLKA 3LZDA 4ZPXA 3JQ9A 3O6VA 4YP5A 2B25A 5JSQA 3TZHA 1OI7A 4WBXC 4EF4A 1E6CA 4P4GA 4UUBA 1QG0A 1PUIA 3I0MA 3RUDA 5BPFA 3FDXA 1U5BA 4TT3A 3RD5A 3ST7A 2PS9A 3OE7D 2JGIA 1YDFA 1J21A 3SM9A 4FFVA 1ORTA 1U65A 3AR5A 2J9FA 1KE2A 2IQ5A 5ETJA 1W19A 4BXOB 4W8GA 2POQX 4E2WA 2H1IA 3FB1A 1EHIA 4X1KB 2O2XA 2UUOA 3ML1A 1IM5A 3LVFO 3P32A 2PU5A 3L8FA 3OOWA 3OTGA 2QMEA 4M4SA 4L22A 4QRIA 3DFIA 1UEXC 2BUCA 1D2RA 3DKIA 4DVGA 2YZ7A 3EDMA 1U0GA 5C81A 1JVSA 1Q57A 4C7MA 2ASVA 2SCUA 4JOCA 1QG6A 3L8CA 1ECBA 2V4ZA 2Z2KA 4FKMA 3D3JA 4LOHA 4Q3DA 1L7DA 3EGXB 1CQJB 3QWAA 1UXOA 4ZPJA 5E38A 4RWEA 2VEDA 1VMIA 1U7UA 3FDZA 4MLPA 3QKSA 4MWGA 4BNLA 3AVOA 1BS9A 3QXGA 4QDUA 1DAGA 3NB0A 1D7AA 1Q7TA 2FPPB 4W99A 4LY3A 4AJ2A 1Y4ZA 5B3LA 4G0PA 1ETHA 2B3DA 2MSEB 3ODGA 1ULTA 1OBVA 3ABRB 2C94A 1QKKA 2FX5A 4G1MB 4F3NA 2P9EA 5IWAB 3PHBE 2OQ2A 5E2BA 3CONA 3KQSA 2VQSA 4Z0NA 1A7KA 2E6KA 2IHYA 1W44A 4Z1OA 4D42A 5LIRA 1QQAA 1FQJA 2YMMA 4MQFA 4NMHA 4ND8A 3OJCA 5J2UA 3BXPA 3RUCA 3ZWXA 5HCUA 1ZCAA 2E6UX 5I7AA 4PCVA 4KAXA 1P4HA 1ZESA 1I3CA 3G5AA 4R0NA 1RNLA 2V97A 4A82A 2O06A 5TS3A 1USVA 4TS3A 4GR4A 2CZGA 2GXQA 2XUOA 3EUFA 2NU9A 3VAZA 4ARCA 1W93A 4H17A 5IAOA 2VPTA 3IAM6 4YAJA 1Y5MA 2Q2QA 4OHRA 1T34A 5FA8A 3JATA 4DIKA 1FP1D 1Z26A 5DM4A 5H81A 4XVUA 5KNDH 3FPKA 4QM6A 1XB2A 1C5KA 2FP4A 1FFXA 1RXEA 2VSFA 4BZQA 1UP4A 2O0MA 4M1TA 4DKXA 1FQKA 1NRXA 4IGAA 1T13A 2X58A 1XPRA 3CO0S 1FDUA 1M1NB 3I1IA 3PYXA 1KXZA 4W6ZA 4BUZA 2PGXA 1R3DA 2GBFA 4KAJA 5AXDA 4X41A 2B9VA 4EY3A 2ID7A 2H9IA 2J0EA 5HWSA 3GNSA 1BA2A 2ANCA 1GQFA 2I5PO 1RM0A 5GJCA 4AWBA 4CXMA 1IQ0A 1UXKA 1F0KA 1A71A 1PVOA 1ZJ5A 4QQKA 4JYCA 2HYDA 2MSDB 2Z8ZA 3B20A 1NV8A 1SUBA 5NULA 1J5PA 1TK2A 1Z6XA 2CMFA 3BS4A 3HKEB 1SWVA 3OF3A 3OPVA 4XYGA 1AG9A 3UH0A 4KIUA 4I5IA 3PDWA 5FJIA 3TCNA 2PEYA 2R6DA 4QTTB 2W71A 2CNWA 1CP3A 4S3MA 3JPWA 4JSRA 2F4VB 2FFHA 1CY0A 3HFSA 2Z4TA 3AF2A 3I1YA 5IDYA 5C8VA 5LP6B 2EGGA 1BFUA 1NQ5A 1ZUWA 2ZSKA 4P7FA 1DJOA 2FPWA 3RU7A 1JPJA 4J3JA 3PI6A 2EJTA 2VH5R 3II6X 1VPDA 2YJGA 4UHEA 3MBIA 5K3FA 3H2KA 4E5KA 1U0FA 1I7PA 3CO5A 3MAGA 4G89A 1WD5A 4DA0A 2JFHA 4R2MA 4MV9A 7ADHA 2RJOA 3NVMB 1TCBA 3QLTA 3FYUB 4ML3A 3VR4A 1P74A 3L4JA 3CTMA 3CLRC 1W75A 2FR8C 1KY3A 2QGNA 4DCSA 3PKZA 5IJ9A 2B98A 3OQ6A 3K6JA 4TRNA 3MD9A 5HTKA 3VC7A 2EATA 3QUCA 1RBYA 1Y7IA 3HXLA 3GV0A 3ZI0A 4JBGA 1EGMB 3VMFA 3DEKA 1U99A 1X8LA 4RDHA 1MAWA 3TSOA 5A02A 4DV6B 1I3KA 1J07A 1Z9BA 1QKJA 1QGZA 1JDVA 1N2GA 1OREA 2HO4A 3OEEA 3H9QA 5DO9A 2QTNA 1DJNA 1SUDA 3SP1A 3HH8A 4YAGA 2YYAA 3NEJA 2GPJA 1GPDG 1EFVB 3WMXA 1YE5A 4N3GA 2E49A 4C21A 2E4XA 1QDLB 3LG2A 3VMMA 4H18A 2XTJA 1JA9A 2DQKA 2OXEA 3LY9A 2NO6A 2GPTA 3VI4B 3A0RB 2ERCA 4N8DA 5DLQC 2Z58A 3QUBA 1JXMA 2H4XA 2W42A 1GAXA 5FL3A 4QJIA 5FWYB 3ZY5A 5ALNA 3NAGA 6REQB 5AVVA 1AHPA 4IX9A 1K5HA 3B8HA 3IKVA 4PYNA 4UTXA 2V7TA 3WRWA 4IDDA 2XDWA 3WDLA 4BIIA 4WERA 4C88A 3G5TA 4TWZA 3MGCA 3IXLA 3REGA 4J8PA 4D8WA 2N3ZA 2QL9A 2VHUA 1CS4C 2ZB7A 3BF7A 2REQB 421PA 3J81k 1Z4LA 2R8EA 1W5EA 4QU9A 4BQNA 2VQEB 3LUCA 1JDZA 2W70A 3OMXA 4GO1A 5DZSA 4C20A 5M7EA 2G9ZA 2R1TA 3OWHA 4GD3Q 1DKOA 3X1ZA 3JAWB 4QQ8A 4JGBA 4PAGA 4CHGA 5ALDA 1AKMA 3CZRA 3F2IA 2BEUA 4DMKA 4IQ0A 4ZCTA 4Y2YA 2OHJA 3PC7A 4JLAA 1KETA 4TV9B 4C7JA 3IE0A 2OE2A 4GGMX 5BYKA 1BMFA 2Q50A 2I78A 3W8EA 4YHBA 4UTVA 1QOQB 2WU4A 5F2KA 1SCIA 3KLMX 4HH0A 4ZICA 2JD1A 4BNDA 3ZR4B 2H4FA 1Z0AA 1KSJA 2BLLA 4F12A 3JSXA 3OZFA 3SIXA 2VL7A 1DAHA 3D3NA 2IEYA 2ZTMA 2V54A 1NATA 2HF7A 2CL5A 1V9SA 3IAFA 4IJQA 4MGHA 3T41A 2AE2A 3AKDA 4KQHA 3U26A 3WX0A 4TLMB 1QHYA 1U2QA 1Y4UA 3SYNA 1EFLA 3I9FA 4OBBA 3R74A 4WLVA 3N76A 2VRNA 4K0RA 2MSWA 5KWJA 4G2TA 3HCFA 4ZGBA 1DZIA 4EI9A 4YH1A 4P98A 5KWIA 2BKVA 3DLTA 2VJYA 3A1UA 3K20A 5IC5A 5A3SA 3UAYA 2O5RA 1VSQA 3MXTA 1AO0A 2O2SA 4L72A 2R8BA 4C7OB 2AOXA 4LGMA 3IHWA 4OCZA 3GGSA 3CEPB 2EGHA 4KHZA 3SLGA 1A77A 4QU8A 4X97A 5J1TB 3WJ7A 4YR9A 3WAKA 1A7JA 1JBEA 1D7OA 1FBTA 3FH0A 3MQ4A 3RRZA 2UZIR 1FEZA 2QM7A 5JAOA 2R48A 3MWGA 5HG0A 3MCZA 4D44A 3TKAA 3E3AA 4FM9A 1W6RA 2D0DA 2KHZA 1QGOA 3OQJA 3T9FA 3ROMA 3U3MA 2I3ZA 3HI4A 3J7TA 1AGRA 2OAQ1 4E46A 4F4HA 3RBZA 4N7MA 1T5DX 2VYVA 3ER8A 3SF8A 3HJTA 2BMEA 4DR7B 3D8SA 1XZFA 2OOSA 4MV8A 3KWLA 4X8HA 3HBFA 3AR8A 5DSXA 4CMGA 2JC3A 4MDFA 1NOKA 3L04A 3KYIB 4CF7A 3ZJYA 3PQ5A 4IRUB 5HFAA 2BGMA 5K09A 4OX9B 4QIHA 3OESA 2A0KA 4GR9A 2Z4RA 4ZQEA 3NHAA 1W49A 1NL3A 1W35A 2HHCA 3M49A 3OFND 5ALUA 721PA 2C58A 4ND5A 3EHEA 2BZ0A 1GR0A 3A10A 3UV6A 3E4CA 1WCWA 2PX3A 2Q9BA 1ICEA 5IEJA 4TQAA 2A59A 3Q6NA 5FUQA 3LI2A 3HEMA 1IY0A 1B16A 1FS6A 1R4ZA 4N9WA 3K6SB 4AI6A 3BN3A 3L7YA 3C6BA 1EK2A 4DLXA 4YMGA 2B8WA 4O8CA 3UOGA 1K5PA 1O08A 3GCDA 7GPBA 1QPGA 2NSLA 1Q1NA 3KT6A 5AO9A 2DZDA 1FXUA 1LLQA 3MWYW 2O4CA 2DPXA 4KMOA 3UWMA 3KT0A 3BRWD 2PH5A 2GD2A 1SBZA 2I76A 5I4KA 1J56A 1TJ4A 3IP8A 1A0OA 1YR1A 2GEVA 4Y2HA 3KR9A 5C32A 1T36B 2AK2A 3JZAA 3ER6A 3OZSA 3SIWA 3TI7A 4BVFA 2CUZA 1KF0A 2HK7A 4B8WA 2OPHA 4FD3A 3L1KA 3PC2A 2F43A 3UHPA 2WM8A 1C7EA 5KB3A 5K3DA 3RSGA 2H51A 3IA2A 5H7XA 3FIJA 3BCHA 1STOA 3HPQA 2CN1A 4JB0A 1I6LA 1P18A 2I87A 2EW1A 1P5RA 1T6XA 2ZITA 2D54A 3LFTA 2IFTA 2IYTA 3ND6A 1GLVA 2BF4A 4FJ1A 4L74A 1ZDMA 4Q02A 5EINA 4BO5A 2ZXUA 3ZDCA 3GCXA 4ZAXA 5SZKB 3CT6A 3JZDA 5KDLA 1PEDA 5J59A 4DR3B 2OM2A 1IUNA 4JUCA 4XWAA 1MF7A 5ERYA 2VQDA 1TLFA 3TH5A 3QKIA 3C3BA 4R9NA 5H68A 3VJLA 1TZMA 1XQXA 1FRZA 1ZH4A 4PYQA 5TPZA 5IDQA 1GRQA 1V3UA 3HB7A 1C8BA 3FZYA 4QYWA 1QCZA 2QTBA 4J7CA 2NWQA 3ORRA 3BWBA 4I0WB 4M7PA 4AZ3B 1PWXA 5DHFA 2DHCA 5CA0A 5TMPA 4FWIB 4RM2A 1ZSNA 3ZHUA 1J6UA 2IY9A 1J97A 1J2EA 1LPAB 2PZFA 3BTUA 5ECGC 3H13A 2H4ZA 3ROPA 1PK9A 4MRPA 2FXIA 2CNDA 1KKUA 2F3SA 2DFNA 3E3NA 3O2SB 3DJYA 1F8GA 2J0QA 1K9VF 4J7UA 2FYTA 2JLCA 3P9IA 4K2AA 4KSCA 3IO5A 1FS4A 4QPPA 2QM8A 4UPDA 3TIGA 1W87A 5HX7A 5B6PA 2EZ4A 4LECA 3RWMB 1Y6QA 2K2QB 4DCCA 2JHPA 4RA9B 4HNTA 3GLHE 5IVPA 3GH1A 3VU0A 5I7UA 4DY4A 2GBIA 3CKLA 1IWPB 1EAYA 1GL9B 4GZ5A 4EYGA 1Y7PA 2RI6A 4OREX 2OHOA 2ZPTX 2EL7A 3B1XA 4OU5A 4BEJA 4V3CA 4N82A 4D6YA 3IP9A 1SIBE 4QEZA 5BN4A 2PH3A 3MC1A 3N70A 1SXJA 1EU1A 4MQFB 4TVBA 4U2EA 1BE8A 1OBFO 4GVXA 3T3NA 5DCLA 2VZ9A 5K0ZA 1WE2A 2FRVA 5C31A 1SUIA 4ZCMA 1ID1A 2NXEA 5BSUA 2KQUA 3JVUA 4JNKA 3G1UA 5HRCA 4KAAA 3MIIA 1QO9A 4XJVA 3IAM1 1P81A 4WXMA 1DBQA 1O8CA 3MG9A 4DL9A 4ZYUA 1WLYA 1GPNA 1H0RA 2BN4A 2QMQA 3AFMA 3ZDFA 2XVAA 3USZA 2B21A 3PGJA 1MW9X 5KSZA 3NBZC 5FTLA 5BOSB 1T35A 4YVFA 3B52X 4BPBA 5BNFA 1IHUA 5LQNA 1GQQA 4DFDA 4WDRA 2X8WA 2IOYA 3R6GA 5HF8A 4WLUA 1ZGCA 3G7NA 1CB7A 2UVQA 3Q5GA 1T2VA 4KWEA 1E59A 1Z2DA 1UZLA 3C1AA 4OKNA 2R3SA 5JXGA 3U7GA 1XPOA 2DPHA 2EFGA 1BXGB 2HA0A 4TTIA 4CF4A 1AQNA 1XYVA 1P2UA 2BM8A 3ZWWA 5JS2A 4DHWA 5EVJA 4HG2A 1Z7YA 2VSYA 1NJ5A 3M2TA 2YWXA 3IV7A 4YT2A 3QF4B 3L4SO 3PEUA 1CWUA 5EKTA 3WYFA 1I0ZA 4EB0A 3OSUA 1JU3A 2Z6QA 4E09A 3SHFA 1ISHA 3HKEA 1M8PA 4C4ZA 4ZOLA 3R7WA 1BCRB 2H7VA 5P8WA 3NTXA 5J23A 2V1UA 2ODBA 2GYYA 1CIVA 1KOJA 1KYWA 1CJUC 4GZ3A 4WXPA 4ZQCB 4YUVA 1PIWA 3V8VA 4B3BA 2J85A 5CG1A 5JS7A 2RKOA 2SECE 3DAPA 4OI0A 5LJIA 1PHPA 1NI4A 2JAQA 5L3SA 3OM1A 4PC7A 4F06A 4JIGA 5FTWA 2VBGA 3ILXA 3OBIA 2DFLA 2JGRA 1LBEA 4FW8A 5JNVA 3X3HA 1QCCA 4C14A 4OQ4A 3AX6A 3O1LA 1PR9A 2YDXA 3O9ZA 4UBIA 4MPDA 5TE9A 4F60A 1KJQA 3UJ3X 3UK7A 1DHTA 3KD3A 3VPFA 3C45A 3DOJA 1DO8A 4CEIA 3GT3A 2EV9A 1A4XA 2QNRA 2GS9A 1Q7RA 1WF3A 3BHMA 2RONA 3Q7SA 3STVA 2YQZA 3OTHA 4MICA 3VPHA 2R6AA 3ZGLA 4EECA 3ND9A 3HXMA 4ZOLF 2FPGB 2ZZNA 1J90A 2V7PA 1TYEB 1XDSA 2NNWB 4KDRA 3SX4A 1A69A 4BQSA 4HSGA 4BO6A 1EFVA 2WEKA 4JIMA 3DEAA 3KG2A 3MT7A 4EQ6A 5JHGB 1AQUA 2IY8A 1E1MA 2QGZA 8GPBA 5GM1A 4ZOEA 1NHGA 4JI6B 1BJKA 5EQJB 1G5FA 4TSRA 3HN2A 4BRZA 5FWYA 1IBMB 4TWBA 4HGOA 2KBEA 4DEYA 3GAAA 4LDPA 2FAXA 1ODTC 1GDDA 4MRNA 4CIWA 5HE9A 5J1SB 2H08A 4ZEMA 3H6GA 1IK6A 3B48A 3CH5A 2RC5A 3GBPA 4YDHB 3S0JA 5FEUA 4DXHA 3QXCA 3ZDEA 4ZI3A 2CF5A 1V1RA 3WKDA 1Z6QA 3RKRA 4D3FA 1X3LA 2HSJA 4D4MA 3H1GA 5FKJA 4TYQA 1SC3A 4HJXA 1M34E 3OE5A 4U63A 8OHMA 1NVGA 2ZUEA 4QGGA 3NHFA 3L46A 2G09A 2C2BA 5KTSA 4MARA 2X6RA 4MLDA 3CZQA 5IKOA 5KYWB 1AUVA 2D1RA 1VL5A 2WVJA 2NPFA 3T9AA 3WFJA 1YTUA 1TD1A 3ZD7A 2V7UA 1N2CA 1DE0A 1AB6A 1P8JA 3OWOA 1YA4A 2PEZA 4JP2A 4Q4AA 4I8XA 3E18A 5FORA 4FGZA 3L7AA 4WOKA 4LQLA 3GY0A 1Y82A 4B2PA 1O58A 4TMYA 4W5RA 2VYVD 2G17A 4RQTA 4BNDB 3RLIA 1OAKA 1BOOA 1L8QA 2J7P