3SXYA

Metal-free full-length structure of tm0439, a metal-binding fcd family transcriptional regulator
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
201
structure length
201
Chain Sequence
RTKVYNLLKEMILNHELKLGEKLNVRELSEKLGISFTPVRDALLQLATEGLVKVVPRVGFFVTDVDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVEKSAKREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, GntR family
publication title Metal-free full-length structure of Tm0439, a metal-binding FCD family transcriptional regulator
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 83
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3sxyA01
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxyA02
1YS7A 1UFMA 1ONVA 3EYYA 4WX9A 4KNYA 3CUQB 1BIAA 3SHFA 4HF1A 1L0OC 2A69F 3B02A 2XRNA 2P8TA 4N9HA 1YS6A 3V4GA 4Q5SF 1MJAA 3KP3A 2FRHA 3J80K 1EH8A 4KIGA 4M74A 2RQPA 5J8CA 4RGUA 4UNOA 2IA0A 1RUNA 5LEJA 4I7HA 2GQQA 3IC7A 1XDUA 1O7FA 4N0BA 2EA4A 3COAC 2V9VA 3TGNA 3GYHX 2XUBA 1Z05A 3F8FA 3EYIA 2O03A 5ED4A 4PCQA 3DP7A 5AIPA 1USTA 2OU2A 4P9UA 1SFUA 1CGPA 1ZH5A 2VONA 5ICCA 4Y15A 1QZZA 3GFIA 2QQAA 4CGZA 3CUOA 4NQWA 1H0MA 3HSFA 3TDZC 1IXCA 3W6JB 3NRVA 3H3ZA 4YIFA 3F21A 2ZO4A 1U5TB 4S05A 4HZFA 3TO7A 2HQNA 4EM0B 4MEYF 1JHHA 1LDKB 3DFGA 4ZH4F 5FD6A 3O3KA 2IT0A 2DT5A 4PGGA 2AS5F 4WXCA 4A6EA 2DU9A 3L09A 4JBAA 5CVVA 4KMFA 2XASA 2Y0MA 4BHBA 4BYYA 2BBYA 3QOPA 2G7UA 1TNTA 3RPUA 4L0ZB 5DCFA 2PBIA 1S7OA 4ZYHA 1KYZA 4KIFA 5LLQA 3C7JA 2P5VA 3JSPA 5EEHA 2H09A 4Z2YA 4JQFA 4YIIA 2X0LA 2ETHA 2V1DA 2KRFA 2HZTA 4BHPA 5FFXA 3LSTA 4EVIA 3IRRA 2K4BA 4A0XA 4BQAA 4ZZDA 4FX4A 4G7OF 4TV7A 5D4RA 3Q9SA 1REPC 4GGGA 2ZNZA 1FZPB 3ZQ7A 2M87A 3CUQA 1HBXG 3BJOA 1KQ8A 3IWZA 1TLHB 1HSJA 4G9YA 5L3GA 4HX8A 2BYVE 1UHWA 1WRJA 2VOOA 3HRTA 4IRIA 3DV8A 3KP4A 5DEQA 5AONA 4EM1A 3IL2A 4ESFA 3CJNA 3WU0A 2O3FA 4R1HA 2PFBA 1YFHA 2V1UA 3ZMDA 3ROUA 4LMYA 1G4DA 4LB6B 4LGWA 2CYYA 5HDKA 2Y48A 2WC2A 3KEOA 5LRRA 2PQ8A 1O3TA 5LHIA 5LGUA 1O3RA 3I59B 2KJCA 1R1VA 3R61A 3E5XA 2YPRA 2V1XA 5K5OA 1IAWA 3WGIA 1S8NA 3R0JA 2ESNA 3QP6A 4KT5C 1MJ9A 4OIQF 5FD5A 1T38A 3F22A 2XHKA 4UV8A 2OQGA 1BI0A 2EV5A 3KE2A 4HX4A 1UCRA 1DDNA 3ISPA 3QAHA 4KDPA 5D4SA 2W84A 5L3DA 5HS9A 2JRTA 4G8XA 1OYIA 5LGNA 3EUHA 1JGSA 1U2WA 3F3XA 4UV9A 3L00A 2DFIA 2GZWA 1YQAA 3ZN0A 4UUVA 3SXMA 2IP2A 1VTNC 4PDKA 3KLNA 5CYVA 1WKMA 3I5UA 4Q48A 1J7KA 3JTHA 4WWCA 1TQPA 3V7CA 3GX4X 4WK8F 1XMKA 2STWA 1MKMA 1HXDA 4WF2A 4XRFA 3ZMZA 5H20A 1IRGA 4FT8A 4MQ9F 4CHUA 2HS5A 3MCZA 4IJAA 5CVIA 3ECOA 3HHHA 3FHZA 2A3SA 1MJBA 3LQRA 2DQLA 1YW9A 1QQIA 4OIRF 2LF7A 4HYEA 1BOAA 2VBZA 1R23A 3BPXA 2ZMEB 2QBYB 3E5QA 3J81Z 3DEUA 1ZGJA 4GYIA 5E18F 1B9NA 2D1HA 2PG4A 4L9NA 5DD4A 4XLPF 1EH7A 2MA3A 2Z33A 5LHGA 4P5OA 4WXDA 1P2FA 1R7JA 3IKVA 2XAFA 2GA2A 3VOEA 1K7AA 2GAUA 4A0YA 3R0AA 1IN7A 3I53A 2DK5A 3HYIA 2VOPA 4EM2A 1Z9CA 1FYMA 5LHHA 1XMAA 1R1UA 5LRSA 1G3WA 1UB9A 1BC8C 1QPMA 1J5YA 2VC1A 3MAJA 3K0LA 2RDPA 1PP8F 3ULQB 4YFKF 1S6LA 2P6SA 1LDJA 2JSCA 5L3CA 1ZYRF 2VBYA 3MEXA 1XSVA 2YR2A 4KA4A 1ON2A 1MD0A 3HRSA 3ZP5A 5DV5A 1B6AA 5DDGA 4MGRA 2IA2A 3E6CC 3T8RA 5HLGA 1SFEA 3BPVA 3QU6A 1FBSA 5HLIA 2ZXJA 2O0YA 5E8IA 1H9GA 2XKPA 2QVOA 2EFOA 3O2PE 4BHCA 1XCBA 2YX4A 3DF8A 2QQ9A 2RVCA 2PEXA 1W5SA 3L7WA 2STTA 1SMTA 5CJ9A 4AIJA 4I01A 3RTRA 1FX7A 1GHCA 3S2WA 1TQMA 2A6HF 2NNNA 3CDHA 2NNYA 2IJLA 2OQRA 1ZG5A 1P6RA 3GUDA 2VT2A 3K1PA 2QZ8A 5HDNA 2W24A 2PN6A 5IT3A 1WWXA 4GCVA 3G3ZA 3JSOA 1ZG3A 4ON0A 2D45A 3BROA 4HDUA 4UXNA 5D5WB 2RKHA 3EETA 3IHUA 4M71A 1IXRC 2ZMEA 1KA8A 3SQNA 1T6SA 2QBYA 1R5GA 5ERIA 1E17A 1BC7C 5HLHA 4YFNF 2FBKA 3E6MA 2LF8A 1YLFA 4KYWA 3ABTA 3WTSC 3KP2A 3JAMZ 3I0TA 2Z3YA 1D8KA 2ELHA 2MLGA 1LQ1A 3FXRA 4L9JA 2H6CA 1V4RA 1HKQA 2IVMA 4RB1A 1T0FA 4YG2F 1ZG1A 2W85A 3V7SA 4G6QA 1BIBA 3FZVA 5LBQA 4JK1X 2CO5A 2GXBA 3B73A 4G7HF 3CTAA 5JFRA 3F23A 3FMQA 1ZN2A 2YSRA 3BY6A 2VODA 5DUIA 4I09A 1KYWA 4M6YA 1J59A 2EV0A 4ETSA 2EFWA 3GWZA 5D6EA 2EA2A 3WTYC 3ERED 4L5JA 3FWEA 4CYDA 2FBIA 4LK0F 1DPRA 1RUOA 1HW1A 2OA4A 3J80Z 4KFCA 5CVUA 2HTJA 1U6GA 2FF4A 4RS8A 2RGVA 3D0SA 3GF2A 5FO5A 4HF0A 2E7WA 2Z99A 2BE5F 3R60A 3K1MA 1OMIA 2HKOA 1RNLA 1P4WA 5DCMA 2D1VA 2DTRA 3VODA 3C1DA 1P4AA 1RZ4A 4O5VA 4LD5A 4HA8A 2VT3A 1RI7A 3R4KA 3M7GA 3G73A 1F9NA 3C3WA 2VE9A 4WCGA 3TO9A 2FMYA 4ZYEA 1FBUA 2R7FA 2HKXA 3BOQA 1ODDA 4FHTA 2MH9A 1I27A 5D5UB 1GXQA 1SD5A 4Y17A 3E97A 1FY7A 3WGGA 3I58A 1IN5A 2PLYA 2FNPA 2GXGA 4L0YB 1O3QA 5H6QA 2P4WA 2Q8KA 2GA1A 4F7ZA 4AIKA 3REOA 3H3UA 2XAQA 4G94A 3BP8A 2F5FA 3RIRA 1MZBA 1D3YA 1P92A 1ZRDA 2NRAC 2CSOA 3HOTA 2EFPA 1KGSA 1KU7A 1SAXA 1UHMA 2EWNA 3N4MA 3U1DA 4XBFA 3RPQA 1F5TA 3J7AO 1LJ9A 5FGMA 2FEZA 2NS0A 1S7AA 2LDUA 3C18A 4LLLA 1HKSA 2RV8A 4OIOF 5F1RA 2A6EF 2DQRA 3I71A 2W25A 4KIBA 4MHGA 1QBJA 3DQVC 2L4MA 4NB5A 1HKTA 3Q9VA 1GVJA 3EDPA 1Z1DA 3RKWA 1TTYA 5E1XA 2R3SA 2E1NA 5A2QK 2EV6A 4HV6A 3HIFA 4ENKA 1FLIA 1ON1A 1RIOH 5DUKA 1K79A 2D2WA 5FLXK 1K78B 3F8MA 1R36A 2ZJ2A 2XGXA 3K1NA 4LLGF 4KMUX 2YX7A 1CF7B 3DXJF 5HS7A 2DPDA 1G3SA 2H6BA 4XSZF 1JXSA 1YO5C 1AOYA 5H6RA 4M9ZA 1ZRCA 2QLZA 3MFKA 4EGYA 4BXUA 1A04A 1Z6RA 3RI4A 2FMLA 3QPHA 3GFJA 2ZKZA 4P55A 5HVQC 3RDIA 1TBXA 2C6YA 1XGNA 2CGPA 2FSWA 2V79A 2QENA 2DW4A 3HUGA 3ML6A 3JW4A 1KU3A 1OYWA 5K1YA 2XROA 2XIGA 3GFLA 4LG0A 3LA3A 3WTZA 1W5TA 5BOXA 1AWCA 1C0WA 1USSA 2UZKA 1B9MA 1STZA 2RC4A 4A2UA 3IRQA 3T0YA 2Z9OA 5IT9K 3RKXA 4FX0A 1SD7A 1FBQA 4UVAA 3SXZA 1B4AA 1HSTA 2ISYA 5BPDA 3KEQA 3WODF 1FOKA 5D6FA 3BDDA 2J5PA 4B09A 4U0WA 4L18B 3FM3A 1T39A 1R58A 4RAZA 1OR7A 3GVAA 4KN7X 4MTEA 4CICA 3VEPA 3V8JA 5BS6A 4CXFA 4M6XA 3RKYA 2A07F 2HFHA 2KIUA 3P9KA 4A6DA 3MZHA 3HHGA 3LA2A 2AXLA 4IRGA 1SD4A 1BJAA 1KU9A 1XSXA 3M8EA 1V3FA 5DYMA 2P5LC 2PI0A 2P6TA 3DPLC 4H0EA 4I98B 1QZYA 2GIVA 4ZZLA 2CFXA 3T8TA 1H9TA 3DPTA 2HYFA 4IF4A 2LSOA 1ZHFA 3W6KB 4UVCA 1FT9A 1KQ9A 2O8XA 4HAMA 2TDXA 2Q2EA 4I02A 3Q5FA 1Z6TA 3I54A 4A5NA 3GW2A 1K78A 2HDCA 2A61A 1TW3A 1CF7A 3VFZA 1XSDA 4KN4X 3DKWA 4HW0A 3WG9A 1L3LA 2QWWA 3WE2A 1Z7UA 3LQQA 4I0BA 2IRFG 1FPQA 3KZZA 2JZYA 1SMYF 2UXNA 2K4JA 1W7PB 5HOOA 2DI3A 2EK5A 1IUYA 4A5MA 4HV5A 5FB2A 4HF2A 2E7XA 4Q4ZF 3LFKA 4XLNF 3F8BA 5FFZA 5DCMB 2RN7A 1Z91A 4ENMA 4OIPF 5J6XA 1LEAA 1XCVA 5F6FA 1ZLJA 2CWEA 3F6OA 2R7DA 2GWRA 1IZ1A 4LJZF 3M9AA 4P9FA 3LA7A 1P4XA 3P7NA 5D8LB 4ENJA 2HEOA 1OYYA 1BM9A 4AD9A 3FMSA 4CZZA 4KICA 4EJTA 2LKPA 3R6SA 2OZUA 1FSEA 2BGCA 3ZMSA 3PQJA 4D0PA 2L01A 3WTTC 4L5IA 4RB2C 1BI2A 1F4KA 3ZN1A 3K9TA 3K2ZA 1IF1A 3WTUC 2FBHA 4B8XA 2VXZA 1BI1A 3VB2A 1HW2A 2KJBA 5L3EA 1EV7A 4EV0A 4MTDA 4WXHA 2VBXA 3MWMA 2PMUA 1LB2A 1MDMB 4RAYA 2ESHA 1OPCA 1IW7F 5E17F 4OOIA 4MNUA 1BI3A 5JR3A 5LGTA 4HOBA 1HQCA 3FM5A 4HBLA 4U0VA 1LEBA 1G6NA 5L3FA 2MLKA 3KP6A 1XGMA 2MBFA 2K7LA 4LK1F 1F1ZA 1OKRA 2JTVA 3QRFF 4Y13A 2G7HA 3FMRA 3HTSB 4LFUA 4OMYA 4GYGA 2FU4A 3L9FA 2Q0OA 6PAXA 1D5VA 2XVCA 2PJPA 1QO0D 2KIMA 3QP5A 1FC3A 3PFIA 2EFQA 2EJRA 2OAZA 1ZREA 2L54A 3ZPLA 4HLYA 3M1EA 4ENNA 4P96A 3FXUA 4IVNA 4G7ZF 4CO8A 4NHJA 5HS8A 3JTGA 1PUEE 2E1CA 5D8KB 4UVBA 1T2KA 3CO7C 2VN2A 1W4MA 2V6CA 2QM3A 4EMSA 2FQ3A 3O6BB 1ZARA 5BMZA 1S29A 2H27A 5TJJA 1W7PA 1X3UA 3BJAA 2ACJA 2HQRA 4DNCA 1FWZA 3K69A 2FNAA 3RYRA 1FYKA 1KQ0A 4R8HA 1WI9A 1PDNC 1R22A 2P5KA 1G3TA 2M1BA 3U2RA 2CG4A 2ZCWA 1ZRFA 2W57A 4HX7A 4BNCA 2RNJA 4LG0B 4N9IA 4RB3C 3GEZA 2CQKA 5JHUA 3GO5A 2JT1A 2VC0A 1YW7A 5AIQA 1ZLKA 3V7RA 2FA5A 2EFNA 5BPIA 1IRFA 2MC3A 3WGHA 1SFXA 3KP5A 4EJUA 5TRDA 4M72A 3LAJA 1WSUA 3CO6C 4IPAA 3ZMTA 2HWVA 1KU2A 2UWMA 4BH9A 2KKOA 4RGRA 1I1GA 2ZBKA 3NEUA 4HLXA 3I4PA 2QUFA 3NQOA 5K5RA 1MDMA 1ULYA 5HDGA 1FP1D 4UHTA 4GO1A 1O7LA 3FXQA 3GFMA 1JE8A 1XB4A 2XAJA 3HTUA 3WE3A 5K5QA 4HQEA 2F5EA 3TDUC 3WTWC 2M45A 1I1SA 4OINF 3ZMVA 1PP7U 2QQBA 3HSEA 2LNBA 2L4AA 1I5ZA 4ESBA 4EJOA 1BBYA 1XN7A 2WV0A 3LAPA 2MD5A 2MH2A 2OD5A 3BWGA 1E2XA 3BJ6A 4AVPA 2VE8A 5CLSA 1FNNA 2UXXA 2IW5A 4HQMA 2DPUA 1J0RA 2M5WA 3WTXC 1Y0UA 2J5OA 1JHFA 1IN8A 3SZTA 4DQ2A 2XAHA 2XV4S 3V8KA 2Z5UA 5EEGA 1TNSA 4ESJA 1K6OA 2O6GE 5ILSA 1IXSB 4MQVA 3PQKA 1HW5A 1LVAA 3E6DA 5A2QZ 4ZYGA 4RB0A 2ISZA 4A12A 3WU1B 3V8LA 3CLOA 2ZNYA 5KVRA 1U5TA 1FSHA 5FLXZ 5D5VB 1IN6A 2Y75A 3BZ6A 2DAOA 3TQNA 5F64A 3E5UA 3H92A 1XGOA 1NHAA 4U7DA 4KUMA 1XDSA 2NYXA 1U8RA 4IRHA 2NAZA 1EH6A 3KETA 5D5XB 1QGPA 5E1WA 1ZGAA 2BV6A 1J75A 2QYOA 4M73A 4EJWA 2VBWA 4HDVA 3MQ0A 3J81K 3SFZA 1S3JA 1J2XA 1TQIA 4LB5A 4I2OA 4RGXA 5E8GA 2FE3A 2OBPA 2DBBA 3OV8A 4Q47A 2F5DA 5CVRA 2DO7A 4LLNA 2HOEA 5L3BA 4BAYA 2OZ6A 3TOAA 5E1ZB 4AWXB 3IKTA 4ASNA 5ICEA 2K86A 2ADUA 4YFXF 1I6XA 1MGTA 3I64A 3TKYA 3GXOA 1DP7P 4QLCU 3LWFA 4G6DA 4ZYDA 3MZYA 1DUXC 1LNWA 2CW0F 1WQ2A 3SXKA 2P7VB 1SD6A 4XSXF 1O3SA 1YG2A 3CUQC 1T98A 3FX3A 5IT9Z 3E3VA 2F5CA 1B59A 3M8FA 1D8JA 3AAFA 3F8CA 3QU3A 3HSRA 1FP2A 1LDDA 3SXYA 4I0AA 1XD7A 5JI6A 3F6VA 1G3YA 3IWFA 1Q1HA 3F8NA 4IHSA 5ILVA 5KK1A 2HTSA 5JVTA 3L2CA 3GZ6A 5J8FA 1R5HA 2M8EA 3QPTA 4CDGA 4M9SA 2IA1A 4U7BA 3F72A 2M30A 1R1TA 2G9WA 2P7CB 5ILUA 2KIFA 5BQTA 3KP7A 2A68F 4EGZA 4OU0A 3GLXA 3ABUA 2FOKA 5DD8A 3KZYA 1R00A 3KCCA 1J9IA 2A5YB 1U78A 5ICFA 2L02A 3I59A 5CVJA 3T1BA 1O57A 2O61A 3EQLF 4RGSA 3D5LA 4PZJA 4AIHA 1U5TC 3KFWX 1YW8A 1U3EM 3WTVC 2HYGD 3RJPA 3RYPA 2WWYA 3P9CA 2IPQX 3T5XA 2L3DA 4OMZA 2K27A 1YTYA 2WTEA 2XKOA 2FXAA 1W7PD 3HOSA 2EB7A 2PMHA 4R79A 2H94A 2BEOA 1GXPA 4M9XA 4QWQA 4IHTA 2K02A 1YIOA 4A0ZA 1ZAOA 2X4HA 3HRUA 4GXOA 1QNTA 2HR3A 5E20A 3GZ5A 4U0YA 4IXAA 3N97A 2ZFWA 3OOPA 2YU3A 3HRMA 3KLOA 2JPCA 3FF5A 2JPBA 2XAGA 4PGHA 2COMA 3E6BA 4EQQA 2DK8A 3JAMK 5ICGA 3ELKA 4E70A 4EJVA 2B0LA 1IN4A 5LEKA 1DPUA 3P9IA 4U88A 4K2EA 3ECHA 1B1BA 4L9VA 2F2EA 3SZPA 3ZMUA 2DLLA 3TO6A 4MEXF 2HGCA 1XGSA 1FYLA 1TW2A 1YYVA 4L9TA 4S04A 3U9GA 1BN5A 4O6JA 4O3MA 3TOBA
chains in the Genus database with same CATH superfamily
1YS7A 4PK4A 1JUSA 4IQ4A 4CCMA 1UFMA 2ZSHB 1ONVA 3S15J 3IQ6A 4J00A 3EYYA 4WX9A 4KNYA 3TQOA 1VF9A 3CUQB 5F08A 1YA7O 3HJCA 1VYKA 1Y8QB 1E85A 3H65A 1RXQA 1BIAA 2OTLI 2NSFA 3SHFA 1ACIA 4JW1A 2HQAA 4MFDA 3HDDA 1VQOI 4ULVA 4HF1A 1L0OC 2A69F 2LKXA 3HG9A 3B02A 3PDMP 2XRNA 2DT7B 3QQAA 2P8TA 1LS4A 1ZHXA 4N9HA 1YS6A 3V4GA 3RZOJ 2J46A 3LSHA 2JVHA 2LSEA 2E71A 1V5GA 4W1UA 4Q5SF 2YL0A 4JTCB 5AC5A 1MJAA 3KP3A 2DGJA 2OEXA 2YKZA 4QDLA 2FRHA 3J80K 1EH8A 4KIGA 4M74A 2RQPA 4K0DA 1T95A 5J8CA 1B68A 2M2EA 4NC6A 5KAIC 3GTPJ 2CH0A 4RGUA 5GAGJ 4UNOA 3GZNB 5L0GA 1FMWA 1X1BA 4M3EA 3DM9B 1SVMA 2IA0A 1RUNA 5LEJA 4I7HA 1M2VB 3L8IA 2GQQA 5JRAA 3QPSA 1J09A 2PMZN 3IC7A 4B1RA 1XDUA 4B4CA 2QF7A 2R5YB 3K6GA 1X3WB 3ZRGA 2PJRB 1O7FA 2EIMH 4N0BA 1SYQA 4Q7CA 2EA4A 5M5YJ 1MBHA 2A05A 2E5NA 3COAC 2GWWA 3TEDA 2V9VA 3TGNA 3GYHX 3V5ZA 1OLTA 2V7FA 3CCRI 2UUIA 1M56C 3L0IA 2XUBA 1Z05A 3F8FA 2QGUA 3HPHA 3EYIA 4LITA 3B0VC 2O03A 3CJTB 5ED4A 4BACA 4I1MA 2AO9A 3EGXA 2CUZA 2CV1A 3LLIA 2X9DA 4I99C 1NSGB 4PCQA 3DP7A 3AL0B 3JRCA 2W00A 4XTKA 5AIPA 3RCOA 3DKAA 2VH3A 5TISC 3FXKA 1USTA 2OU2A 4P9UA 4RM2A 1SFUA 3KYIA 1CGPA 3BT9A 1ZH5A 1Y39A 2VONA 1T9KA 2LY1A 5ICCA 2G62A 4Y15A 1QZZA 3H5AA 5JVEA 2OV7A 1JT0A 3GFIA 1ST6A 2MG4A 3HPGA 3QYBA 1QQ3A 2QQAA 2JSPA 4CGZA 3PO2J 3CUOA 4CS8C 4NQWA 3JRDA 1H0MA 3HSFA 1Y4CA 3TDZC 2QQ8A 1LE2A 1RMVA 1IXCA 2IBDA 3W6JB 3B6CA 3NRVA 3GWLA 1YRNA 4PJLA 2R5ZB 4Z9HA 1TP4A 3IQTA 3JCUQ 1BR4A 2PMZA 3H3ZA 4YIFA 2V3CC 5IY5C 2I5UA 2KISA 2F22A 3F21A 3CC4I 5E79C 1NG1A 2ZO4A 1U5TB 4S05A 1TWFJ 2KDOA 5J3LA 2GOMA 2Y0SN 1BZ4A 4HZFA 3L1MA 2CUEA 3H36A 3OMYA 2HQNA 3TO7A 2BXZA 3JYHA 4B6IA 4XORA 4EM0B 4MEYF 1BA5A 3L8JA 1JHHA 1LDKB 1T08B 1C17M 3PHF2 3DFGA 4ZH4F 3ZQIA 5FD6A 5CI8A 3BQZA 3O3KA 1PV3A 2IT0A 1PD0A 4DZPA 2VC9A 1WFXA 4HEAJ 4IWBA 1IDYA 2DT5A 2J9UA 4PGGA 4DYCA 2D5VA 2FD5A 4UUTA 3WU2C 2M0MA 3OS1A 4WXCA 3FISA 2AS5F 1RJ9A 2L9JA 2LP0A 2ZXWC 4A6EA 4IRUA 1T5OA 2VXDA 2DU9A 3L09A 3QOEA 1IG7A 5B1BH 4JBAA 5CVVA 2QKLB 2IGOA 3PIPF 4KMFA 3S2DJ 3RIPA 4MLOA 2Y39A 2XASA 2Y0MA 1HY5A 2R03A 4BHBA 3OA1A 4BYYA 2BBYA 4P9TA 3QOPA 2G7UA 4QTRA 1TNTA 3V5XA 3ZIBA 3RPUA 5A6BD 3U3FA 2X85A 2K9QA 3KPHA 4L0ZB 3CMEI 5DCFA 4QSHA 3QYEA 5JHFA 3QPLA 1ZZPA 2OJED 2PBIA 1OKKD 1S7OA 4HNUA 4ZYHA 2VQGA 1KYZA 1HOMA 3SEOA 2J45A 2AXTC 1S5LC 2MGQA 2JD3A 3NMIA 4KIFA 5LLQA 3C7JA 4MVZA 2P5VA 5F0CA 3JSPA 2EIKH 3TBIA 1QKRA 2X6WA 5EEHA 2H09A 1HCRA 3KYJA 4OD5A 2YS9A 2BY1A 4Z2YA 4XLAA 2ME6A 4JQFA 4YIIA 2X0LA 2ETHA 3W2WA 2V1DA 2ZMEC 4C30A 2KRFA 2LFFA 2HZTA 4BHPA 2XGCA 4JYKA 5FFXA 2RAEA 4YN0B 4CYCA 3U8PA 3MKLA 1RKEB 3EUAA 3LSTA 4EVIA 3IRRA 1IC8A 1AKHB 3BTCA 2DN0A 2K4BA 4A0XA 1MBGA 4BQAA 2MC4A 4ZZDA 1SZIA 3H5RA 4FX4A 2Y9YA 4G7OF 1K05A 1N75A 4BS9A 1O87A 3HNJA 4I1OB 1WTYA 4YT8A 3HOXJ 4TV7A 3CCSI 5D4RA 4HNTA 1S05A 3MKYB 4A3LJ 1WWPA 3Q9SA 1ZHZA 5L0CA 1DGWY 1REPC 4GGGA 1QHGA 1HMOA 2ZNZA 3M4BA 3O39A 1JKRC 1FZPB 1IO2A 1HA8A 4R32A 4EBKA 4XOPA 2YHSA 3ZQ7A 3DI5A 2M87A 3CUQA 2JVGA 1HBXG 1VMAA 3H35A 2TRTA 4CCLA 3BJOA 1T0FC 1KQ8A 1I5NA 4FE7A 3IWZA 1TLHB 1JI8A 1HSJA 2XLMA 3BR3A 2ECBA 4CSAA 3I3LA 4G9YA 3TOBA 2LK2A 1R71A 5L3GA 1JKOC 4HX8A 3V42A 2IXSA 2L6HA 1GLNA 2BYVE 3UKGA 1UHWA 3EGDB 4FESA 5D91A 1WRJA 3B0PA 3LL7A 2VOOA 3HRTA 1WJEA 2XSEA 4IRIA 3DV8A 4LACB 1N1CA 2A5WA 3KP4A 4IB4A 3FIWA 1BR2A 4RDUA 3QW0A 5DEQA 5AONA 4L5EA 3CSKA 4O7GA 4EM1A 1D1BA 3IL2A 2WZLA 4ESFA 4LG3A 3CJNA 1LKXA 2O3FA 4R1HA 3WU0A 2PFBA 2TMVP 2IBFA 1YFHA 2V1UA 2NSGA 3NDBB 3N2ZB 4Y4RA 3ZMDA 1MBFA 1V55H 3ROUA 1M2VA 3PCVA 4JX5A 4LMYA 4BUPA 3K1IC 3T9OA 2IAIA 1G4DA 5GAHJ 1ETWA 4HG2A 2ECCA 4LB6B 2EILC 2CV0A 1WZ2A 4RLQA 3BCAA 4LGWA 2VQCA 2R5YA 2CYYA 2L9RA 5HDKA 4EUKB 2PJRA 2XS8A 3C8GD 2Y48A 2WC2A 4XLEA 4J7YA 5JP7A 3BR5A 3S9OA 3KEOA 2DFHA 1G5ZA 3KKBA 5LRRA 1X4OA 3I56I 4DYRA 2PQ8A 1JR8A 2CQ7A 1O3TA 2L81A 3M1CB 3MZ8A 4MVSA 5LHIA 5LGUA 1O3RA 2ZXPA 1CGME 4E7LA 3I59B 3ZQCA 2KJCA 3H5NA 1R1VA 2ZXHA 3R61A 3OYKA 1J8YF 4M3FA 3E5XA 2RREA 2BL2A 2YPRA 1A5JA 4HRIA 2V1XA 5K5OA 1VOMA 2DYRC 3VRCA 1IAWA 5M5XJ 3WGIA 2VLAA 5EK0A 1TWHJ 1S8NA 2R92J 3DM5A 1XMXA 3R0JA 2ESNA 3QP6A 5L0DA 2QY9A 3FHNA 1TWGA 4KT5C 5EG0B 1MJ9A 4DYQA 2VASA 2J7PA 3OEOA 4OIQF 3TP3A 5FD5A 3OS2A 1A7DA 1T38A 2E2JJ 3EFOB 3F22A 2X1EA 2XHKA 2R5ZA 9ANTA 4U5HA 1K6YA 2EILH 4CUGA 1RESA 2OQGA 4UV8A 1BI0A 2EV5A 3LEVA 1U6HA 4MO7A 2CFOA 3AFHA 3KE2A 1T33A 1UCRA 4HX4A 4RM3A 3OSFA 1OR3A 2KJGA 2QUPA 2M8GX 1DDNA 3ISPA 4CDYA 1ZW2A 2EIJC 4FCYA 3QAHA 3S3OA 3L2QA 2NVYJ 4HFKB 4IKFA 1Z3YA 2GFHA 3DLAA 3S27A 2B0JA 2QE9A 3FXMA 4KDPA 3FDYA 1IRZA 5D4SA 3K4NA 2W84A 4XKWA 4XN3A 5L3DA 4JJFA 5HS9A 2M4EA 1GVDA 2JRTA 3OYCA 3DBRB 1OYIA 4G8XA 2WB1A 3EUHA 5LGNA 1JGSA 3EZHA 1U2WA 3RZDJ 2I15A 5H2FC 3GODA 3Q0UA 2GLOA 3F3XA 1BL0A 4D4NA 4UV9A 3L00A 2DFIA 2EZKA 2GZWA 1YQAA 3ZN0A 4UUVA 1AHDP 2OG2A 5F5FA 3SXMA 1GQAA 2IP2A 2OEVA 1VTNC 1MNEA 4PDKA 3EPVA 3KLNA 4CJGA 5BQGA 1NH3A 5CYVA 1WKMA 3I5UA 1TFOB 2VIXA 4Q48A 1ERDA 2LFBA 2V26A 4BY7J 5FRNA 1J7KA 3L2WA 2L7FP 3JTHA 4WWCA 1VQ8I 1TQPA 3V7CA 3GX4X 5FZTA 5AC4A 4PACA 4WK8F 1XMKA 2STWA 2RSEB 1MKMA 2IGKA 3Q6MA 3S1NJ 1HXDA 4WF2A 4XRFA 2F6CA 2HJMA 4I76A 5KAFC 4HE8D 1F36A 1Z7LA 3ZMZA 1F43A 5H20A 1IRGA 1YA9A 4KNWA 4FT8A 3AG4H 4MQ9F 4XQFA 2HDDA 4CHUA 3Q7GA 3TD7A 2LREA 3S1RJ 2HS5A 4YK5A 3MCZA 4IJAA 2VI6A 5CVIA 2ID3A 3ECOA 3HHHA 3POVA 2DCEA 2PX0A 3FHZA 2A3SA 5CPRB 1MJBA 3LQRA 2DQLA 1YW9A 3JRBA 1YZCA 1ETVA 1ZW3A 1AA7A 1RKEA 1QQIA 4OIRF 2LF7A 4HYEA 1BOAA 4CDAA 4M3BA 1AKHA 5F28E 5DS9A 3DEWA 2O7OA 3J7YJ 4A3BJ 3H2UA 2VBZA 3JRHA 4HSRA 1R23A 3BPXA 2ZMEB 2R7VA 2IXOA 1MMGA 3MBGA 3MYIA 4OAYA 3GEEA 4RAGA 2QBYB 1Z5ZA 3E5QA 3J81Z 4G12A 3DEUA 1SF8A 1T6QA 4CCJA 1FTZA 1ZGJA 4GYIA 2AU5A 3MVPA 4IOAF 5E18F 1B9NA 2W45A 1OCRC 1R6RA 5L0IA 2D1HA 2PG4A 3GCMA 1A7EA 4NUBA 4JE9A 3DU5A 1EA8A 1XC5A 4L9NA 4IGGA 5DD4A 4XLPF 1EH7A 3MD2A 2MA3A 2DOFA 4YRVA 2Z33A 3S3MA 3CDIA 5LHGA 4P5OA 2LY9A 4WXDA 1P2FA 1R7JA 3IKVA 1NZEA 4CS9C 3ZTZA 2XAFA 4MS2A 3X1OA 2GA2A 2FUG2 3ATPA 4MTFA 1MW7A 1X2NA 2CQXA 4PUSA 3TW6A 3VOEA 1K7AA 1MMSA 3EGDA 2GAUA 4DJAA 1A6QA 4A0YA 4K1OA 3R0AA 4XRMA 2XM4A 1IN7A 3I53A 2DK5A 4V19K 4PFPA 4EEFG 1S9HA 3HYIA 2VOPA 4EM2A 1Y6DA 1ZTRA 1Z9CA 4ZC3A 5J47A 2LC2A 5J1RA 1FYMA 5LHHA 1K83J 3JCUC 2LTPA 1NG6A 1R1UA 1XMAA 4KT6A 1I39A 1G3WA 4DGWB 5LRSA 3H0DA 1NU9C 3BLYA 1JKQC 4DVYP 1UB9A 2P0WA 1BC8C 1X4PA 2DMPA 4KNVA 1TZLA 2L7AA 1QPMA 1J5YA 2VC1A 1YZAA 3TULA 1Y0NA 3MAJA 3K0LA 1QU3A 1W2WA 1RRJA 4JRZA 4BXXJ 1D1AA 1NFNA 3BR1A 2AQEA 5EGOA 2RDPA 4DW6A 4KBLA 1PP8F 3ULQB 3GEIA 2ZB9A 4YFKF 3PMRA 3S16J 1S6LA 5B66C 1NLXA 4LLCA 2P6SA 1LDJA 2JSCA 5L3CA 3W4YA 1HDDC 1ZYRF 2VBYA 1UZCA 3MEXA 1XSVA 5DM7F 3M1CA 3MN2A 2YR2A 4EIYA 3DTKA 4KA4A 1ON2A 2IYLD 1MD0A 3HRSA 5GPCA 5FKLA 1WHUA 2L9VA 3ZP5A 2L9NA 4A3EJ 5DV5A 4XLFA 1B6AA 2VUMJ 1Q0KA 5DDGA 1XZQA 4MGRA 2IA2A 3E6CC 3T8RA 5HLGA 2IGMA 4U5FE 4IX7A 4BBSJ 3C2BA 5GAEJ 1SFEA 1RR7A 2NS8A 3BPVA 3Q0WA 3O10A 2B9SA 1Y1VJ 1N78A 2R7SA 1ZQ3P 5T3WA 3UMHA 3CCEI 1MMDA 3GORA 2FOWA 3OWTA 1F1MA 4CJOA 1AU7A 5EG0A 3QU6A 1FBSA 4N4NB 3ZGKA 3G6EI 1YRNB 1JT6A 4XKBA 3W8HA 3VYSB 3EFOA 5HLIA 3JT1A 3US6A 3Q7LA 2WADA 4EBJA 3LESA 1HDPA 1DGRM 2ZXJA 5IPAA 5BQHA 2O0YA 5E8IA 1GDTA 1H9GA 4N6CA 2XKPA 1NK3P 3JSZA 4CS8A 3CCYA 5J40A 3HOWJ 2HVRA 5L0FA 1Q0GA 2QVOA 4MW8A 1TWHA 2EFOA 3LNMB 3O2PE 3A2KA 5HNHA 4BHCA 1XCBA 5B3SH 1U89A 1WN0A 3BZKA 2YX4A 1K4TA 4LIUA 3W2AA 3DF8A 4C3EA 3PL8A 4JKVA 3CMMA 3J7AY 4U5BE 3EG9B 2DXIA 2M7BA 4GDFA 3DE8A 1VTMP 2QQ9A 2VB6A 1IV6A 3G4ZA 2RVCA 2PEXA 1WJBA 2ZC2A 1W5SA 3JR9A 3L7WA 3M07A 1X58A 2STTA 1SMTA 5CJ9A 4AIJA 4I01A 3RTRA 3IUOA 1FX7A 4JX6A 2OF7A 4W97A 5F27A 1DU0A 1GHCA 1K4SA 4QPQA 3PO3J 3KMIA 4J30B 2CW8A 1RR8C 2Y3DA 4CBEA 1MMNA 1D0ZA 2V4JC 2V9PA 3A11A 4JEAA 3S2WA 4B48A 1OW6A 1JUMA 1TQMA 3A02A 2A6HF 4BE2A 2NNNA 2CCYA 2OJQA 4MNDA 3CDHA 1FOXA 2NNYA 3RQEA 2JA7J 3U9MA 2Y69C 2XM0A 2IJLA 2OQRA 1HC8A 1ZG5A 1W36D 1P6RA 2VJ4A 4AL1A 2IXMA 3GUDA 1QSPA 2VT2A 5FLMJ 1V74B 3U1KA 3K1PA 2QZ8A 3UMKA 3O55A 5HDNA 3SP1A 1P9QC 1X1AA 2W24A 2JN6A 4HSTA 1K04A 2PN6A 2E35A 1WWXA 5IT3A 2CNWA 1JUPA 2MSYA 1OR7C 3K4MA 3RPUD 4GCVA 2G3KA 2LKSA 3HEFA 3EZIA 2E1OA 1VLSA 4BG0A 2WVNA 3LFUA 3ZQFA 3G3ZA 1FMVA 2MW8A 2HYJA 3JSOA 1T6UA 1ZG3A 2VJ5A 4XLCA 4ON0A 2D45A 3LMMA 3BROA 3U2LA 4EKWA 4B47A 4HDUA 3L2VA 3KEYA 4UXNA 5D5WB 1VQ6I 3T4RA 2RKHA 2XGDA 3EETA 3IHUA 4M71A 3JRIA 2GOXB 2W4SA 3LOCA 1IXRC 2ZMEA 5F1JA 1Q0MA 1KA8A 3SQNA 1T6SA 2F5VA 2QBYA 5K7HA 1X3ZB 3ZWIA 2FJ1A 2GBYA 2AP3A 2R9RB 2IGNA 1R5GA 2Y69H 3DAGA 4JIOA 5ERIA 2P1AA 2BW3B 1E17A 3CQZJ 1BC7C 5HLHA 4CX9A 3K70D 2NUPA 5IYBJ 3D5SC 3HNKA 3K7AJ 4YFNF 2FBKA 3E6MA 2Q9BA 2LF8A 2F4MB 1YLFA 4KYWA 4CIHA 4XRSG 2NUTB 3ABTA 3G1OA 5TGTA 1XS9A 2XL4A 3WTSC 3KP2A 4AVZA 3IAS2 3JAMZ 3OYHA 3I0TA 3I4UA 5DTDA 2ELJA 4NNJA 2QSFX 3S84A 2Z3YA 1D8KA 3LJBA 2ELHA 4YELA 2AVKA 2MLGA 4O6NA 4BJ5C 1LFPA 3FXRA 4L9JA 1LQ1A 3B71A 4XIDA 4HPQA 1LE4A 2H6CA 3U21A 2ZD9A 4U5CE 1V4RA 1HKQA 2IVMA 4RB1A 1T0FA 4YG2F 1ZG1A 2OTJI 3GM3A 2JK3A 2W85A 3V7SA 3K4CA 4DXWA 4G6QA 1LS1A 4JP0A 5B1AH 1BIBA 1UG7A 3FZVA 2Y3BA 3OYJA 2VQHA 3CCUI 3CF5F 1U9NA 1O3UA 2M34A 1ETXA 2DJNA 5LBQA 4JK1X 4A4AA 2CO5A 3ABMH 3CZ6A 4N06A 2GXBA 3U5SA 3B73A 3KYDB 4E6KG 4G7HF 4AYBN 3IEEA 1SVLA 3CTAA 5JFRA 3F23A 3G1MA 3FMQA 3ZXSA 1LFUP 1I4ZA 1ZN2A 1M57C 2KRCA 2YSRA 2YLGA 3BY6A 1A0BA 1OR2A 2VODA 5DUIA 1DOWA 3BEHA 3LSIA 1MBJA 1TWGJ 4I09A 2VPLA 1KYWA 4XN0A 2R4GA 1JRAA 5IP7J 3C62A 3K1HA 4F55A 2L6GA 3L2RA 3RQ4A 3P5JA 4BQNA 3K1IA 1A41A 4M6YA 2XLEA 3FOOA 1J59A 3FXJA 4U87A 1YOVB 3HB9A 2GAQA 2EV0A 2LMDA 2M0CA 5EGYA 4ETSA 2EFWA 1GV5A 3OIQA 3GWZA 1RKWA 1OCOH 2KQRA 5D6EA 2EA2A 1A35A 1OQCA 5EHHA 3WTYC 4XEVA 3ERED 4IO9F 2VJIA 4L5JA 3ABLC 2M4GA 3FWEA 1MBEA 2EQRA 4CYDA 2FBIA 4LK0F 1DPRA 4F3QA 5M3MJ 1RUOA 5B1BC 2KDZA 4IHXA 3TJ5A 1HW1A 2OA4A 4QPOA 3KH2A 5T1DB 3J80Z 1U8BA 2KMUA 2WY8Q 4KFCA 5CVUA 1HE1A 2HTJA 1U6GA 2KQ9A 3BG7A 4C3HJ 3LS0A 2N8GA 2VKDA 2M3AA 3V5YA 2FF4A 4RS8A 2RGVA 4YL3A 1UJ8A 3D0SA 4PJJA 3BZCA 4AYBA 3GF2A 4L6RA 5DS6A 1ETOA 5JVGF 4FQGA 1S72I 4IQJA 3L34A 5JLXA 5FO5A 1JJ6C 3EHNA 4HF0A 1ETYA 2CUJA 4UDVA 2E7WA 2Z99A 2I10A 2BE5F 5J4YA 3R60A 1LVKA 4I6ZA 1O4XA 1NFOA 2J7PD 1PUFB 3MYFA 4BEMJ 3K1MA 2EIKC 2QCOA 3DLLF 3A4CA 1OMIA 2HKOA 1RNLA 1P4WA 2EPNA 5HLTA 5DCMA 2D1VA 2CV2A 1V4AA 3EG9A 2DTRA 5KYXB 3VODA 3C1DA 1P4AA 1CGNA 2IOQA 1RZ4A 4O5VA 3CP2A 4LD5A 3DCFA 3FAJA 4HA8A 2Y9ZA 4XONA 1X2MA 3ABLH 3HUGB 4ITVA 2VT3A 1QRYA 1RI7A 2Y3GA 1Z7Qc 3R4KA 1P7IA 1FEXA 3M7GA 4ZLDA 3G73A 1F9NA 5B5EC 3M79A 2P81A 3SZGA 1WGXA 3C3WA 2HNHA 2O9XA 3FK7A 2VE9A 2F4OB 4WCGA 3TO9A 2FMYA 2R7FA 1FBUA 2COBA 4DBQA 4ZYEA 4B3XA 1ORJA 2H7OA 2OOCA 2VKHA 2Q9CA 2HKXA 3BOQA 1ODDA 4CCNA 2H1LA 4FHTA 3GTOJ 2MH9A 1ZHYA 3NKEA 5FJ8J 1I27A 1VQ7I 5D5UB 2ZXIA 5E3OA 5FLVA 2OCEA 2ME0A 2GDCA 4XKVA 2LG4A 5KNLA 1CPQA 2EBIA 3S3NA 1GXQA 2Y0SA 1SD5A 3DBLB 5DS4A 2HQ5A 1Y56A 4XQ1A 2XLVA 3LSKA 5LD2C 4Y17A 3KZIC 2A1DD 3NMKA 3E97A 1FY7A 2CQQA 3WGGA 4BQQA 3OYIA 1LE8A 2J0XA 3T6GB 1RETA 3FXLA 3ONQA 3I58A 1IN5A 5FCLA 3HZJA 4D9JA 2PLYA 3I4NJ 4ANJA 2FNPA 2W1OA 4IAQA 1QHHD 2GXGA 4EATA 4J7TA 4L0YB 2CS3A 4MTGA 3RKOF 4FETA 2F48A 1O3QA 5H6QA 3DZAA 2P4WA 3S1MJ 3TOMA 2Q8KA 2GA1A 1CPRA 2DT6A 4F7ZA 1VK5A 4AIKA 2H7VC 4E0HA 3REOA 2R05A 4GRIA 3FDQA 2KK1A 1W1WE 3H3UA 5EYRA 3RYLA 3BR2A 1LFBA 2XAQA 1S7ZA 3AG3H 1ITYA 4G94A 3ASNH 3BP8A 2B0HA 2BC5A 4LLEA 1V55C 4MVUA 2F5FA 2FGYA 1EF4A 3RIRA 3QWLA 2R93J 1MZBA 1U0BB 1D3YA 1P92A 1ZRDA 3QVZA 4MFEA 2NRAC 3T6JA 1BR1A 2CSOA 3HOTA 1G8XA 1FTSA 2EFPA 2BW3A 2BY3A 3H9JA 2YEVA 1KGSA 1VNDA 1KU7A 1SAXA 1UHMA 2EWNA 2Y30A 2W4BA 3U2MA 4EHPA 2IS2A 2HXIA 3N4MA 2YQYA 2RNGA 3U1DA 3CCJI 1ZR4A 4XBFA 3RPQA 2NUTA 1F5TA 3J7AO 3B6AA 3CJRB 1LJ9A 2JQ7A 5FGMA 2FEZA 1POGA 2YL1A 3GLLA 4BEHB 4D4XA 2NS0A 1MSFC 1TWAA 1S7AA 2W48A 1JTYA 2LDUA 2Y31A 3C18A 1M2OA 2DJIA 2XGEA 2AHQA 4ZJZA 4LLLA 1HKSA 2YLDA 3IH2A 2RV8A 1RKCA 1I6HJ 2XB0X 4OIOF 5F1RA 2A6EF 3CQZA 4A69C 2DQRA 4XR6A 3IAM2 3I71A 5GPAA 1SANA 2W25A 4CS9A 2E1MC 4KIBA 4MHGA 2EPMX 1QBJA 2XF7A 2L4MA 3DQVC 3GBGA 3Q9VA 4NB5A 1HKTA 1GVJA 3EDPA 2J9VA 3U8VA 2IS1A 4PJNA 1Z1DA 3RKWA 4FASD 1EKYA 1TTYA 1FFHA 4CDVA 5E1XA 4JURI 4A3CJ 2R3SA 2IEKA 4A2NB 2MHRA 2E1NA 2XXAB 5A2QK 5EGOB 3ZR8X 2EV6A 5LFAA 4HV6A 3UMIA 4D5CA 3HIFA 4ENKA 1FLIA 4M3DA 3NWSA 1ON1A 4X0RA 1RIOH 2L0KA 2Q2EB 4XLHA 5DUKA 1ZU5A 2EPOA 2DA5A 2K3PA 1K79A 1UAAA 2E87A 2XAUA 4NC3A 1K61A 2AWCA 2CMPA 3IQCA 1FNTc 3S28A 2D2WA 2VPRA 2L7MP 5FLXK 2LK4A 1K78B 1X1PA 3F8MA 3DPUA 1R36A 256BA 4PJ0C 2Z15A 2ZJ2A 5DLJA 2XGXA 3K1NA 2Y2ZA 4LLGF 4DOZA 2L5QA 4KMUX 5K7FA 2W9YA 3JRTA 1RKTA 2EZHA 2YX7A 1CF7B 3DXJF 5HS7A 2DPDA 1G3SA 3K10A 4NY3A 2H6BA 1ZR2A 4D7MA 2NOGA 2XS1A 4XSZF 1JXSA 3R2PA 1YO5C 2CRGA 1MNMC 1AOYA 1ZGWA 3SEZA 5H6RA 2G3VA 4M9ZA 4CCKA 1ZRCA 4MIMA 2QLZA 3ITFA 3MFKA 4EGYA 2KIQA 4BQOA 4BXUA 2RD9A 2TCTA 1A04A 4ZYAA 1H7IA 1Z6RA 2R02A 3RI4A 1Z3IX 4UB8C 4F92B 3C63A 4XPXA 2FMLA 2LIGA 2NOJB 1QPUA 4UUSB 3QPHA 3GFJA 4U9DA 4ER9A 3PUBA 2ZKZA 4P55A 3DKXA 5HVQC 3K66A 3NG1A 1PUFA 3H3VK 2VCBA 1LM3B 3RDIA 3SNHA 1TBXA 2C6YA 1WJ5A 3BG3A 1QZEA 3BG9A 4PSXA 3RQIA 3AG4C 5KYXA 1T01A 2DMUA 2YL3A 1HMDA 1XGNA 2CGPA 2K9SA 5FKOA 3OYMA 2FSWA 2V79A 4JCZA 4PR9A 2HV7A 2QENA 2DW4A 1G4WR 2LP4A 2D5RB 2XL8A 3HUGA 3ML6A 1A7VA 3JW4A 4D5FA 2HV6A 1KU3A 2MYSA 3K4JA 1OYWA 3GM1A 2LRDA 2KLOA 3QODA 4NTFA 3DWWA 5DVWA 5K1YA 2IM8A 1L3PA 4BJ1A 1WCMJ 2XROA 4WABA 4RDAA 2XIGA 3GFLA 4LG0A 3LA3A 1D0XA 3CDLA 3WTZA 1W5TA 5BOXA 1AWCA 1C0WA 1USSA 4Z9IA 2UZKA 1IGNA 5A6BA 1B9MA 1STZA 1TWCJ 2DA1A 2RC4A 4A2UA 1UFBA 1R4NB 3GEHA 3HTKC 4FAPB 3IRQA 1OXKA 3T0YA 2Z9OA 2DYSH 5IT9K 4BU2A 3RKXA 4H54A 1NTCA 3NWTA 3A01B 3G4SI 1BJZA 4FX0A 4RAFA 1GT0C 3HNLA 1HE9A 4O6MA 1SD7A 3W3CA 4BEJA 5EZHA 3BG6A 5CQEA 1TT5B 1FBQA 4UVAA 1D1CA 3SXZA 4F4BA 5FKNA 1S7EA 1B4AA 2CQNA 1VI0A 3LSMA 1HSTA 2JA5J 2XRHA 4UB6C 2ISYA 4XK4A 5GPGB 3BTLA 3DJUB 4U5EE 5BPDA 3S2HJ 4YEJA 2EINC 2GM4A 3KEQA 3NMJA 3OYBA 3WODF 1WH5A 1FOKA 5D6FA 1LPEA 3BDDA 2J5PA 1RC9A 4B09A 4U0WA 5L3QA 4L18B 3FM3A 1QVTA 2Q9AA 1WJAA 1T39A 3DJNB 1R58A 4RAZA 3ZVRA 1OR7A 3GVAA 3QTHA 1W5CC 2DA4A 2CNWD 2NXNB 4A3FJ 4BE0A 4FISA 1KTMA 4KN7X 4MTEA 4CICA 5J1UA 3CF2A 3WAQA 5HODA 4U5GA 4RMNA 1APLC 3VEPA 4I3MA 5KCMA 1GS9A 3V8JA 2XSJC 2NUPB 5BS6A 4CXFA 4FTHA 2MABA 1YI2I 2JA8J 1GV2A 2ZJRF 4NTAA 5COMA 4M6XA 4C9YA 3RKYA 4IZZA 2A07F 2HFHA 1H88C 1MBKA 2KIUA 3VM6A 2HUJA 3P9KA 4A6DA 3CESA 4BEHA 3OYEA 3MZHA 2R7XA 3HHGA 2DMTA 3LA2A 1YJNI 2AXLA 4IRGA 4RD9A 1SD4A 1BJAA 4MW3A 3I55I 2JX0A 3D1NI 1KU9A 2XPUA 1XSXA 3M8EA 1JAFA 1V3FA 2WB7A 4I44A 1Y8RB 1A31A 4V2GA 2EINH 5DYMA 2K9LA 3DKYA 5IOYA 2JUCA 1JPNA 3S90A 2NG1A 2PX3A 1Z0XA 2P5LC 2EPLX 5IOZA 2PI0A 2P6TA 3JSEO 3DPLC 4H0EA 4FE4A 4DRHB 2HJ3A 1B8IB 3A0HC 3AGTA 4I98B 1QZYA 1YJ9I 1W0TA 2YWAA 3TMOA 2CW7A 2GIVA 4ZZLA 3ASOC 2CFXA 3T8TA 1H9TA 1CGOA 3EH2A 3DPTA 2OCCH 2HYFA 4IF4A 4XL9A 2LSOA 4BJ5A 1ZHFA 2XXAA 1VYIA 3W6KB 2ID6A 4UVCA 1FT9A 1KQ9A 3N05A 4OAZA 2O8XA 2HVQA 2O9LA 2X0CA 3BC8A 4HAMA 2TDXA 2KGOA 2E1MB 3TOLA 2X6XA 2Q2EA 4I02A 4ULWA 1SAUA 2LOOA 1Z6TA 3Q5FA 3I54A 5B3SC 4XPYA 4A5NA 2WBMA 3SFIA 3HJEA 3GW2A 4IHYA 3KX2A 3HM5A 4BJ6C 1K78A 2HDCA 3VYRB 2A61A 1TW3A 1K40A 5EDNA 2XLHA 1A6IA 1CF7A 3HL2A 3TK0A 2K3FA 3T6BA 3Q0VA 1OCCC 1SVOA 3OIOA 3IQ5A 4XWJA 2HOSA 1GM5A 3VFZA 3OSGA 2KFDA 3ZQHA 2OKUA 1XSDA 2M9HA 4KN4X 2I8DA 4OD4A 1OCZC 1T6IA 2EH3A 3DKWA 1XWJA 1XZPA 4HW0A 3WG9A 3MMYB 1L3LA 3ASOH 2QWWA 2J0WA 4B43A 3WE2A 1Z7UA 3SJMA 3SEQA 3LQQA 1YIJI 5DQZA 4I0BA 4XKCA 3W2VA 2IRFG 3ZC4A 1FPQA 3KZZA 2ICWG 2JZYA 1SMYF 2HVSA 2UXNA 1WH7A 2K4JA 3GWNA 5COFA 2VJJA 1W7PB 5HOOA 3IH4A 5E3AA 2DI3A 2EK5A 4UUSA 1IUYA 2OPTA 4AC0A 1Q0DA 3U9JA 4A5MA 4LERA 4HV5A 2QEXI 5FB2A 5CKTA 4HF2A 2E7XA 3CMAI 3BRJA 3O8HA 4Q4ZF 3LFKA 4XLNF 4CH7A 2VQLA 3F8BA 4JTAB 5FFZA 3O8GA 1TQGA 2L7ZA 5DCMB 1ZK8A 2RN7A 3I4MJ 2JPUA 3DAFA 4F52A 1Z91A 3EUKL 4ENMA 4OIPF 1QVUA 5J6XA 4ZTFA 2YVKA 2R7OA 4BDYA 1LEAA 1XCVA 3CC2I 5F6FA 1ZLJA 2CWEA 3F6OA 5J1YA 5EEAA 3M15A 2R7DA 2IXPA 4XOTA 3MLGA 1XX5A 1OCCH 3LSGA 2GWRA 1IZ1A 3MKWB 4LJZF 2DA3A 3M9AA 3VDXA 2QLAA 1KNYA 3LA7A 4P9FA 3NYJA 2G0EA 1OCZH 1P4XA 3GTGJ 1TKNA 1D0YA 5L0HA 3P7NA 4C3DA 2O5RA 5D8LB 2K9NA 4ENJA 1VQPI 2HEOA 1OYYA 3K33A 1BM9A 4AD9A 4DBRA 3FMSA 4DRJB 1CQTA 4O6YA 4XM3A 2HKVA 2M64A 4CZZA 4NQFA 2L7KA 1X19A 4KICA 3QW1A 4EJTA 2LKPA 3R6SA 2OZUA 1FSEA 2BGCA 4JX4A 1R4MB 3PQJA 3ZMSA 3A01A 4D0PA 2L01A 4P1WA 2X1CA 3WTTC 3BR6A 3FBNB 4IOCF 1YE9A 2M4KA 3IP4B 1LE8B 3TJ6A 2DA2A 2NS7A 1VQNI 4L5IA 2YRFA 4RB2C 2BHZA 3OYFA 1BI2A 3A1YA 2BVMA 3CLQA 1F4KA 2R7ZJ 4N4OB 1WGWA 3ZN1A 2A6TA 3H2VA 2NVXJ 4AM3A 3K9TA 4XEFA 3K2ZA 1IF1A 4DIQA 3WTUC 4NTBA 2FBHA 2DFFA 3KIOA 4B8XA 3CCMI 4C2TA 1FIAA 1V5EA 2WAFA 3SDBA 2VXZA 1LPQA 1TWCA 1BI1A 2I8BA 3ZQYA 3VB2A 4C3IJ 3PSIA 1YJWI 2ZPAA 2HFIA 1PD1A 3JTLO 5L3VA 1HW2A 5B1AC 1TWAJ 2KJBA 5L3EA 4XPWA 4C7OB 4DZJA 1EV7A 1JMWA 2JJ7A 3S0XA 4EV0A 2CJJA 4MTDA 3LNRA 1FR0A 3M4OJ 1E3HA 4A3KJ 3CJQB 4AUXA 4WXHA 3ABMC 2VBXA 3MWMA 4IEJA 1Q0FA 4YT2A 2DOEA 2PMUA 1VQKI 1LB2A 4Z9JA 3OYLA 1MDMB 2VL8A 4RAYA 3B29A 5E3MA 2ESHA 2ZSIB 4DJ9A 1OPCA 1IW7F 3A9CA 5E17F 4MTOA 2XDVA 4OOIA 4MNUA 1BI3A 2KSFA 2WAQN 5JR3A 1T56A 3OL4A 2V1NA 5LGTA 4A3MJ 2DODA 4HOBA 1SEUA 1HQCA 3AQCA 4F91B 3FM5A 5F5HA 4HBLA 4U0VA 3ZQLA 1LEBA 3CAXA 3LS1A 5DQTA 3W8IA 1G6NA 5F0HA 5L3FA 4UY8I 2MLKA 1OCOC 3KP6A 4E7IA 1PCXA 1ZKGA 1XGMA 1TL8A 2MBFA 1NBBA 2K7LA 3RQGA 1EJ9A 1WOLA 4LK1F 3LEOA 1F1ZA 3RQFA 1OKRA 2QSHX 2JTVA 4XMYA 4Y13A 3QRFF 5A6JA 3CEXA 2G7HA 3MX3A 1YYJA 2P0NA 5E3NA 2C04A 4BJTA 2XPVA 2VKEA 3FMRA 3HTSB 3PFYA 1G59A 4LFUA 4OMYA 5KYYB 2W4MA 1B8IA 2FFHA 4GYGA 1NK2P 2FU4A 3L9FA 2Q0OA 4E7HA 1HF0A 1ZELA 3W6VA 1EA3A 2K5CA 6PAXA 1D5VA 1I4YA 2YL7A 4K7BA 2XVCA 2PJPA 1QO0D 2KIMA 3QP5A 5F0FA 4JJGA 2DB4A 2KP6A 3WHNA 3H9QA 5IP9J 1FC3A 3AG2H 2IS6A 3PFIA 2Q7RA 2E60A 3F0CA 3VPRA 1VLTA 1Z23A 3OYDA 4G78A 2EFQA 2OUMA 4ZDPA 1E0EA 1LI7A 2EJRA 2CUFA 3VSLA 2OAZA 1MH4A 4Z6YA 2WAQA 1ZREA 1R4TA 1VB5A 2L54A 3EH1A 3ZPLA 2XL6A 4HLYA 3IH3A 1YARO 3B0UX 3M1EA 3K7DA 3ABKC 2OU6A 4ENNA 3DE9A 4M63A 1OXBA 4P96A 2QNLA 3FXUA 1M1EB 4IVNA 2ELKA 4NDLA 5BUOA 3ZCOA 4G7ZF 2AQFA 4CO8A 4FWVA 4MVQA 2BOLA 4XICA 4NHJA 1BOBA 3JRAA 3GTJJ 1OCTC 1SR2A 4Y52J 1YAUO 2Q3TA 3V7OA 2HMZA 5HS8A 2DFEA 3JTGA 1PUEE 2E1CA 4NC7A 3HGYA 3PSFA 5D8KB 3CCVI 1AEPA 4UVBA 1T2KA 1QVXA 3CO7C 2R7UA 1Z67A 2VN2A 1W4MA 3HOYJ 2V6CA 1GGQA 3ZQVA 2QA4I 4E18A 3C2GA 3BG5A 2QM3A 2BXYA 4EMSA 2FQ3A 3O6BB 3ZTMA 1ZARA 4HEA2 4IJJA 5BMZA 1S29A 2H27A 5TJJA 1FFTC 1W7PA 1E84A 1AVOB 5CI9A 1X3UA 3L1PA 3BCBA 3BJAA 2HDWA 3S14J 4C2MJ 1C03A 4KC9A 2ACJA 2HQRA 1LI5A 4DNCA 2YUSA 1FWZA 4AL0A 3K69A 2FNAA 3RYRA 2Z16A 4C3JJ 3ABKH 1FYKA 3H0GJ 3MFNA 1KQ0A 4R8HA 4E7SA 1WI9A 1H8AC 2A0BA 4W8KA 4X6AJ 1M6TA 1ZHWA 3FOPA 4IARA 2JWTA 1BBHA 1PDNC 2XSDC 1R22A 2W7NA 3FHDA 2P5KA 2P6VA 2B7EA 1G3TA 1Z21A 1V54C 2M1BA 3U2RA 2CG4A 2ZCWA 1ZU4A 3E7LA 5KYUB 1YITI 1ZRFA 4C2UA 5DM6F 2WVOA 4YWQA 2W57A 3CCQI 1VQ4I 4AE4B 3HOVJ 4HX7A 4BNCA 3AG3C 3ASNC 3JRMO 2GXAA 4WGZA 4GFBA 1WATA 2RNJA 3JRFA 4LG0B 3SYNA 4N9IA 4RB3C 3JYYA 3GEZA 2CQKA 3JRGA 1MIJA 3R7CA 1Z63A 5JHUA 3GO5A 1QLEC 1KONA 2JT1A 2O8KA 2JRMA 4AK9A 1WI3A 2LD6A 2VC0A 2MFZA 1YW7A 3NYMA 3K4LA 5IP6A 5AIQA 3CD6I 2NVQJ 2GIZA 2R7QA 1ZLKA 3V7RA 4NC8A 2R0QC 5T3TA 1FJLA 2E34A 2FA5A 2KZVA 2EFNA 1FTTA 5BPIA 1IRFA 5C3EJ 4EWCA 4U9EA 2MC3A 1QZXA 1EI7A 1RPWA 3QMKA 5JLIA 3WGHA 1SFXA 3KP5A 4EJUA 5IY5H 3GTQJ 4II3A 2YZSA 3AJMA 3F47A 2ZJPF 1X1DA 5TRDA 3G4XA 3FKIJ 3GANA 4II2A 3GTLJ 4M72A 1XG1A 1V54H 3HXLA 3LLKA 3LAJA 1WSUA 2PFDA 2WA0A 1I3QJ 3OYNA 3CO6C 5EF6A 1Z6AA 2HU9A 4IPAA 2XPWA 4BDZA 3VWBA 3A0BC 2D4UA 4JEBA 4JZAA 1OQYA 4KJZA 4Y33A 3ZMTA 4C7OA 2L2OA 2QKMB 3FBIB 2R7WA 1FOYA 4A3IJ 3NRHA 2HWVA 1KU2A 2UWMA 2WL8A 4BH9A 2KKOA 2UUHA 1G4US 3FXOA 4RGRA 1I1GA 2J9WA 2ZBKA 3NEUA 4HLXA 2H8AA 3Q6NA 3I4PA 4A3DJ 3LUTB 3HNIA 2QUFA 3NQOA 5K5RA 1A36A 1MDMA 2ZXWH 4LDRA 4IL6C 3ZOBA 1ULYA 5HDGA 1FP1D 4UHTA 4JTDB 2BHYA 1IJWC 4GO1A 2WVQA 1O7LA 3FXQA 3NAUA 1BDJB 3K2AA 1IV8A 3GFMA 3D5RC 3PNTA 2BY2A 1XB4A 2X6OA 1JE8A 2UUZA 3BQYA 2B63J 2XAJA 3NARA 3K4BA 1B72B 2KYHA 2IS4A 2CU7A 3AQBA 3SZRA 1JTXA 1TC3C 3HTUA 4X0GA 3WE3A 5K7ZA 1VQMI 4CSWA 5K5QA 4HQEA 1ETQA 2HZ8A 2F5EA 4HNVA 2MWQA 5AGFA 2H1KA 1G2HA 3TDUC 2X6YA 1PYVA 2PX9A 2Y3HA 3N24A 4JCHA 3B9QA 5B3IA 5GADJ 1PVEA 3G71I 1OW7A 3ZDLA 3WTWC 3DTIA 2M45A 2KT0A 3KYCB 2DMQA 4OINF 1I1SA 3ZMVA 1PP7U 2R7RA 1E86A 1OCPA 2OQMA 5KYYA 3ZQQA 2QQBA 3HSEA 3GTKJ 2LNBA 2L4AA 1I5ZA 4RLFA 5IYCJ 1Y6IA 2ASRA 1TR2A 1WPKA 3ZSUA 4ESBA 3PUFA 5KYWB 3C8GB 4LDKA 2LY2A 4EJOA 1BBYA 1XN7A 2WV0A 3LAPA 3QZCA 2MD5A 3J7ZI 2MH2A 2OD5A 3UR3C 4ZLCA 3BWGA 1OJLA 1E2XA 2UV1A 3ECSA 3BJ6A 1UG2A 1JKPC 3SDGA 5C4JJ 2KHMA 4AVPA 3EHMA 5HSWA 4V2FA 3HGGA 3LSRA 2VE8A 2WZGA 3RVZA 4YIRX 5CLSA 3AG1C 5JUAA 1T8IA 1FNNA 2UXXA 4XRSA 2IW5A 4HQMA 2DPUA 4QI2A 1PJRA 2YU9J 4IAOA 1YX5A 1J0RA 4BY1J 3Q3SA 3HOUJ 2M5WA 2HXOA 1I3AA 5FKKA 3LAYA 2R7TA 3I9V2 2X1DA 3WTXC 1Y0UA 2WAEA 4A3GJ 2J5OA 3G1LA 4PSWA 4KISA 5CQGA 3TP0A 1JHFA 2W82A 1YHQI 1IN8A 3SZTA 4DQ2A 2XAHA 2XV4S 3O6XA 3V8KA 4OWRB 4BJ6A 2Z5UA 2WB1N 5EEGA 1Z3XA 2L9SA 3X2QC 5HNFA 5FROA 1TNSA 4ESJA 1LIHA 2DDAA 5JS5A 3HKZN 1K6OA 2X48A 2L6FA 5EZGA 4EBBA 2O6GE 4BBRJ 2HPMA 5ILSA 1IXSB 2DYSC 4MQVA 3PQKA 1HW5A 1TT0A 4E7ZA 1LVAA 3UGPA 3E6DA 3DTEA 5F04A 5A2QZ 2HPIA 3S17J 4ZYGA 4CIPA 4BGDA 4YT4A 4QIWN 4RB0A 3H1CA 4MVMA 1VZ0A 4X1EA 5KHDA 4HFFB 3AG1H 2FX0A 2ISZA 3S93A 4A12A 3CC7I 3WU1B 1R49A 2AWYA 3V8LA 2RQQA 3CLOA 2ZNYA 5FRMA 5KVRA 3EPZA 3HC7A 4E4HA 1U5TA 1FSHA 1WJDA 3RVYA 2XRLA 3RH3A 5FLXZ 5D5VB 1IN6A 4AU7A 2HZDA 2Y75A 2HOAA 3BZ6A 2DAOA 3OL3A 3TQNA 3KL4A 5F64A 1W36C 1VQ9I 3E5UA 2QSGX 4QI0A 5KYUA 1E3OC 3H92A 1J8MF 1XGOA 2KW3C 3ERMA 1NHAA 4AE4A 4U7DA 2XLWA 4KUMA 2KPMA 3SYTA 3LSPA 3S8PA 3UNGC 1XDSA 2NYXA 1U8RA 1IUFA 1YX3A 4BKXA 3X2QH 2EZIA 4IRHA 2NAZA 5J4VA 1QA6A 3M3YJ 1DP3A 1EH6A 4D1QA 2X51A 2IXNA 2DYRH 3KETA 2ZJQF 3N0TA 5TJ5E 3TW7A 5D5XB 2PBEA 3HKZA 1QGPA 3GMEA 1ZGAA 5E1WA 1OKKA 2J9BA 2BV6A 1J75A 2Q00A 4O79A 2QYOA 4M73A 4EJWA 1FIPA 4IHWA 4S0HB 2LYCA 2VBWA 4HDVA 2BY0A 4A93J 2LVSA 3MQ0A 4GEHA 3J81K 3ZG1A 1Y1WJ 3SFZA 5C44J 3QYFA 1S3JA 4AX2A 3K4KA 1J2XA 3JZ0A 2LCHA 1APCA 1TQIA 5GP9A 4LB5A 4I2OA 3G50A 4NCQA 4RGXA 5JLWA 1TFKB 4KITB 5BQIA 5E8GA 2FE3A 4GYTA 3OOUA 5E3CA 3K6BA 4JC7A 2OBPA 2DBBA 3ESWB 3OV8A 4Q47A 2LD5A 2F5DA 4RBOA 5CVRA 2E2IJ 2DO7A 3VYWA 3VF0A 2EIJH 3HKKA 3CMYA 3K70C 1FOWA 2HOEA 4LLNA 3S32A 3OS0A 5L3BA 1C02A 4BAYA 2OZ6A 3TOAA 5E1ZB 4AWXB 3IKTA 4A3JJ 3FVYA 2K9MA 3FKJA 5D92A 1DU6A 4ASNA 3RW0A 1RCPA 4ZDOA 2OC6A 5ICEA 2K86A 4J32B 4P6IC 2ADUA 3OY9A 1MNDA 1N25A 4YFXF 3CCLI 1I6XA 2LBFB 5HV9A 3DEEA 3FK6A 1MGTA 3I64A 2OCCC 1SFKA 3TKYA 3GXOA 1MSEC 3E0JB 1DP7P 4QLCU 2ETSA 3PM1A 3LWFA 4G6DA 3MKZA 2K85A 3BR0A 4ZYDA 3MZYA 1DUXC 2NVTJ 4N6HA 1LNWA 2LH9A 1R5ID 1WQ2A 2CW0F 3SXKA 3RF3A 2P7VB 1SD6A 2Z2SB 4E17A 4XSXF 1O3SA 1YG2A 5E2QA 3BTIA 4H4KC 3CUQC 1T98A 3FX3A 1B72A 5IT9Z 4DRIB 3E3VA 3AKZA 2E36A 2F5CA 2ZXRA 2HI3A 1WVRA 1BW5A 1B59A 4CS7A 5JT4A 1EQ1A 4CSAC 3M8FA 1D8JA 5L0JA 1JOGA 4ABZA 3VAYA 3G2BA 2DA6A 3M8JA 4YJWA 3AOUA 4LIVA 3F8CA 3QU3A 3HSRA 3AAFA 1FP2A 5E33A 2CYDA 1LDDA 1LUJB 1R9TJ 5K0IA 3SXYA 2M7AA 4I0AA 1YYXA 2P61A 4BL0B 1XD7A 5JI6A 3F6VA 3DWLE 1G3YA 4PJMA 2EPKX 3PNYA 3WG7C 1MH3A 4YL1A 2KL4A 2LLKA 3IWFA 1Q1HA 3F8NA 1IZMA 3RFYA 3UGOA 3A03A 4U5DE 1U0JA 4IHSA 3HOZJ 2F4IA 5KK1A 3BTJA 2HTSA 5ILVA 5JVTA 3L2CA 4XNFA 3GZ6A 5J8FA 1H89C 2VCCA 4N4WA 2NPUA 1R5HA 2M8EA 3QPTA 2DA7A 4CDGA 5KYWA 3C8GA 2LFDA 4M9SA 5FKMA 1EKEA 2VKVA 2IA1A 4B3AA 2PNOA 4U7BA 3F72A 2M30A 1R1TA 1JJ8C 1DOVA 2G9WA 4BE1A 2H8RA 1JPJA 4FX5A 3RKQA 2DOAA 2HOTA 4GQHA 4WJ0A 1E3PA 2WY7Q 3NYLA 2XF5A 2P7CB 2A0UA 1VQLI 5CIVA 5JSLA 5ILUA 3OIPA 2Q4FA 4E7JA 4J01A 2KIFA 3VSKA 4G0HA 2HMQA 5BQTA 2JA2A 3PJRA 3I5PA 3KP7A 2PF4E 1MMAA 2A68F 1IDZA 5COGA 4EGZA 3E9VA 4OU0A 4CA0A 4E7KA 3GLXA 3AL0C 3OR2C 3ABUA 2FOKA 2XLDA 4WGYA 5DD8A 4YT5A 3KZYA 1UELB 3S29A 2DTZA 1R00A 1OCRH 1YJGA 4DVZA 3J06A 3JREA 3KCCA 1J9IA 5BNGA 2WZFA 3F9KA 4BXFA 2XC7A 4G6TB 2V9KA 3WG7H 3E70C 3OR1C 2A5YB 4Y3OA 1P7JA 2JMWA 1ZHTA 1HLVA 1U78A 5ICFA 4RA2A 2L02A 3I59A 3EGXB 3LNQA 5CVJA 4W8PA 1VQ5I 3T1BA 1O57A 2O61A 3EQLF 2FQ4A 4LOCA 3RSNA 4RGSA 3DU6A 3OYAA 5KYNA 1ORKA 5DS5A 3D5LA 5GTIC 3KYLA 4JVSA 3CP8A 4PZJA 5E3LA 3FXHA 2E19A 1DQUA 4JOMA 2PP4A 4AIHA 1U5TC 3KFWX 1YW8A 1WASA 1U3EM 3WTVC 1OFCX 3F46A 2HYGD 1MQVA 2YLIA 4NQWB 3RJPA 1UHSA 3C2HA 2EPFA 3RYPA 2WWYA 3P9CA 5M5WJ 2IPQX 1FAPB 3GM2A 3T5XA 1YDIA 2L3DA 4OMZA 4PFOA 4CCOA 1UMQA 4AIDA 4E0IA 3VYTB 4YL0A 2K27A 1YTYA 1OISA 2WTEA 3HLZA 4MVOA 4RBNA 3DD7A 4MVRA 2K40A 2MD0A 2XKOA 3EUHC 2CDQA 3I5QA 4M6VA 2FXAA 1W7PD 4NBQA 4IHVA 3HOSA 3LSJA 1O5HA 2EB7A 2PMHA 5GTHC 3WHCA 1NG7A 4R79A 1NU7D 5C4XJ 2BVLA 2H94A 2JA6J 2WV1A 2BEOA 1GXPA 5IYDJ 4M9XA 4QWQA 3EJNA 1SC7A 3H9GA 2ZXOA 3IV5A 1N77A 2KRHA 1VFCA 4IHTA 1H6GA 2K02A 1YVIA 1YIOA 3GTMJ 2ZFUA 1ZVZA 3C8ZA 3S1QJ 4A0ZA 1ZAOA 2BZTA 2KNHA 2KC3A 2X4HA 3HRUA 4GXOA 3U3BA 2XB5A 1QNTA 2HR3A 1OW8A 5E20A 1RJ9B 3GZ5A 4U0YA 4IXAA 3PNVA 3N97A 2HSBA 2ZFWA 3OOPA 2JUGA 3QVYA 2YU3A 3PIOF 1ETKA 3U0CA 2HSQA 2DDBA 4CZCA 1ORYA 5EJCA 2NVUB 1AUEA 2XLOA 2LR8A 2QTVA 2C03A 2XF6A 5A6KA 4C3BA 1WJFA 3HRMA 3DBHB 3KLOA 1BW6A 2JPCA 1Q1VA 3WHBA 3IPMO 3FF5A 4M3GA 2JPBA 2XAGA 4PGHA 3ZQGA 2DMNA 2Z1DA 4ZDLA 5M3FJ 2COMA 3E6BA 3NKDA 4F93B 3TL4X 1L7CA 3L2UA 2LQGA 4EQQA 2DK8A 3JAMK 4B44A 1W0UA 1XPXA 1KZHA 3M4CA 2VCAA 2V6EA 5ICGA 1YLMA 3ELKA 1QPIA 1WJCA 2E2HJ 1JGGA 2H7BA 4E70A 1V5FA 4ONSA 4EJVA 2B0LA 3E1SA 1IN4A 1E83A 2LBFA 1I50J 1ORSC 5LEKA 1DPUA 3P9IA 4XEKA 4U88A 4K2EA 3FAPB 2R25A 3ECHA 1GUUA 1B1BA 3HBLA 4L9VA 4CYCB 2FAPB 3AG2C 2EZLA 2F2EA 1XTAA 3SZPA 1X1CA 2P7VA 1U9OA 1Z77A 3ZMUA 2DLLA 3TO6A 4ZTJA 2J8WA 4MEXF 2HGCA 3AGUA 4LDQA 1IRXA 2CGEA 4BPMA 5A69A 2GA0A 1XGSA 1FYLA 1TW2A 3OYGA 2H8WA 4J19A 1YYVA 3VYUB 1ENHA 2KZGA 2E5ZA 4L9TA 2Q1ZB 4D7NA 4Y7NJ 4S04A 3U9GA 5A6AA 1BN5A 4O6JA 1D5YA 1SFOJ 4O3MA 1UG0A 2EIMC 4KI2A 3DMDA
chains in the Genus database with same CATH topology
1YS7A 1UFMA 1ONVA 3EYYA 4WX9A 4KNYA 3CUQB 1BIAA 3SHFA 4HF1A 1L0OC 2A69F 3B02A 2XRNA 2P8TA 4N9HA 1YS6A 3V4GA 4Q5SF 1MJAA 3KP3A 2FRHA 3J80K 1EH8A 4KIGA 4M74A 2RQPA 5J8CA 4RGUA 4UNOA 2IA0A 1RUNA 5LEJA 4I7HA 2GQQA 3IC7A 1XDUA 1O7FA 4N0BA 2EA4A 3COAC 2V9VA 3TGNA 3GYHX 2XUBA 1Z05A 3F8FA 3EYIA 2O03A 5ED4A 4PCQA 3DP7A 5AIPA 1USTA 2OU2A 4P9UA 1SFUA 1CGPA 1ZH5A 2VONA 5ICCA 4Y15A 1QZZA 3GFIA 2QQAA 4CGZA 3CUOA 4NQWA 1H0MA 3HSFA 3TDZC 1IXCA 3W6JB 3NRVA 3H3ZA 4YIFA 3F21A 2ZO4A 1U5TB 4S05A 4HZFA 3TO7A 2HQNA 4EM0B 4MEYF 1JHHA 1LDKB 3DFGA 4ZH4F 5FD6A 3O3KA 2IT0A 2DT5A 4PGGA 2AS5F 4WXCA 4A6EA 2DU9A 3L09A 4JBAA 5CVVA 4KMFA 2XASA 2Y0MA 4BHBA 4BYYA 2BBYA 3QOPA 2G7UA 1TNTA 3RPUA 4L0ZB 5DCFA 2PBIA 1S7OA 4ZYHA 1KYZA 4KIFA 5LLQA 3C7JA 2P5VA 3JSPA 5EEHA 2H09A 4Z2YA 4JQFA 4YIIA 2X0LA 2ETHA 2V1DA 2KRFA 2HZTA 4BHPA 5FFXA 3LSTA 4EVIA 3IRRA 2K4BA 4A0XA 4BQAA 4ZZDA 4FX4A 4G7OF 4TV7A 5D4RA 3Q9SA 1REPC 4GGGA 2ZNZA 1FZPB 3ZQ7A 2M87A 3CUQA 1HBXG 3BJOA 1KQ8A 3IWZA 1TLHB 1HSJA 4G9YA 5L3GA 4HX8A 2BYVE 1UHWA 1WRJA 2VOOA 3HRTA 4IRIA 3DV8A 3KP4A 5DEQA 5AONA 4EM1A 3IL2A 4ESFA 3CJNA 3WU0A 2O3FA 4R1HA 2PFBA 1YFHA 2V1UA 3ZMDA 3ROUA 4LMYA 1G4DA 4LB6B 4LGWA 2CYYA 5HDKA 2Y48A 2WC2A 3KEOA 5LRRA 2PQ8A 1O3TA 5LHIA 5LGUA 1O3RA 3I59B 2KJCA 1R1VA 3R61A 3E5XA 2YPRA 2V1XA 5K5OA 1IAWA 3WGIA 1S8NA 3R0JA 2ESNA 3QP6A 4KT5C 1MJ9A 4OIQF 5FD5A 1T38A 3F22A 2XHKA 4UV8A 2OQGA 1BI0A 2EV5A 3KE2A 4HX4A 1UCRA 1DDNA 3ISPA 3QAHA 4KDPA 5D4SA 2W84A 5L3DA 5HS9A 2JRTA 4G8XA 1OYIA 5LGNA 3EUHA 1JGSA 1U2WA 3F3XA 4UV9A 3L00A 2DFIA 2GZWA 1YQAA 3ZN0A 4UUVA 3SXMA 2IP2A 1VTNC 4PDKA 3KLNA 5CYVA 1WKMA 3I5UA 4Q48A 1J7KA 3JTHA 4WWCA 1TQPA 3V7CA 3GX4X 4WK8F 1XMKA 2STWA 1MKMA 1HXDA 4WF2A 4XRFA 3ZMZA 5H20A 1IRGA 4FT8A 4MQ9F 4CHUA 2HS5A 3MCZA 4IJAA 5CVIA 3ECOA 3HHHA 3FHZA 2A3SA 1MJBA 3LQRA 2DQLA 1YW9A 1QQIA 4OIRF 2LF7A 4HYEA 1BOAA 2VBZA 1R23A 3BPXA 2ZMEB 2QBYB 3E5QA 3J81Z 3DEUA 1ZGJA 4GYIA 5E18F 1B9NA 2D1HA 2PG4A 4L9NA 5DD4A 4XLPF 1EH7A 2MA3A 2Z33A 5LHGA 4P5OA 4WXDA 1P2FA 1R7JA 3IKVA 2XAFA 2GA2A 3VOEA 1K7AA 2GAUA 4A0YA 3R0AA 1IN7A 3I53A 2DK5A 3HYIA 2VOPA 4EM2A 1Z9CA 1FYMA 5LHHA 1XMAA 1R1UA 5LRSA 1G3WA 1UB9A 1BC8C 1QPMA 1J5YA 2VC1A 3MAJA 3K0LA 2RDPA 1PP8F 3ULQB 4YFKF 1S6LA 2P6SA 1LDJA 2JSCA 5L3CA 1ZYRF 2VBYA 3MEXA 1XSVA 2YR2A 4KA4A 1ON2A 1MD0A 3HRSA 3ZP5A 5DV5A 1B6AA 5DDGA 4MGRA 2IA2A 3E6CC 3T8RA 5HLGA 1SFEA 3BPVA 3QU6A 1FBSA 5HLIA 2ZXJA 2O0YA 5E8IA 1H9GA 2XKPA 2QVOA 2EFOA 3O2PE 4BHCA 1XCBA 2YX4A 3DF8A 2QQ9A 2RVCA 2PEXA 1W5SA 3L7WA 2STTA 1SMTA 5CJ9A 4AIJA 4I01A 3RTRA 1FX7A 1GHCA 3S2WA 1TQMA 2A6HF 2NNNA 3CDHA 2NNYA 2IJLA 2OQRA 1ZG5A 1P6RA 3GUDA 2VT2A 3K1PA 2QZ8A 5HDNA 2W24A 2PN6A 5IT3A 1WWXA 4GCVA 3G3ZA 3JSOA 1ZG3A 4ON0A 2D45A 3BROA 4HDUA 4UXNA 5D5WB 2RKHA 3EETA 3IHUA 4M71A 1IXRC 2ZMEA 1KA8A 3SQNA 1T6SA 2QBYA 1R5GA 5ERIA 1E17A 1BC7C 5HLHA 4YFNF 2FBKA 3E6MA 2LF8A 1YLFA 4KYWA 3ABTA 3WTSC 3KP2A 3JAMZ 3I0TA 2Z3YA 1D8KA 2ELHA 2MLGA 1LQ1A 3FXRA 4L9JA 2H6CA 1V4RA 1HKQA 2IVMA 4RB1A 1T0FA 4YG2F 1ZG1A 2W85A 3V7SA 4G6QA 1BIBA 3FZVA 5LBQA 4JK1X 2CO5A 2GXBA 3B73A 4G7HF 3CTAA 5JFRA 3F23A 3FMQA 1ZN2A 2YSRA 3BY6A 2VODA 5DUIA 4I09A 1KYWA 4M6YA 1J59A 2EV0A 4ETSA 2EFWA 3GWZA 5D6EA 2EA2A 3WTYC 3ERED 4L5JA 3FWEA 4CYDA 2FBIA 4LK0F 1DPRA 1RUOA 1HW1A 2OA4A 3J80Z 4KFCA 5CVUA 2HTJA 1U6GA 2FF4A 4RS8A 2RGVA 3D0SA 3GF2A 5FO5A 4HF0A 2E7WA 2Z99A 2BE5F 3R60A 3K1MA 1OMIA 2HKOA 1RNLA 1P4WA 5DCMA 2D1VA 2DTRA 3VODA 3C1DA 1P4AA 1RZ4A 4O5VA 4LD5A 4HA8A 2VT3A 1RI7A 3R4KA 3M7GA 3G73A 1F9NA 3C3WA 2VE9A 4WCGA 3TO9A 2FMYA 4ZYEA 1FBUA 2R7FA 2HKXA 3BOQA 1ODDA 4FHTA 2MH9A 1I27A 5D5UB 1GXQA 1SD5A 4Y17A 3E97A 1FY7A 3WGGA 3I58A 1IN5A 2PLYA 2FNPA 2GXGA 4L0YB 1O3QA 5H6QA 2P4WA 2Q8KA 2GA1A 4F7ZA 4AIKA 3REOA 3H3UA 2XAQA 4G94A 3BP8A 2F5FA 3RIRA 1MZBA 1D3YA 1P92A 1ZRDA 2NRAC 2CSOA 3HOTA 2EFPA 1KGSA 1KU7A 1SAXA 1UHMA 2EWNA 3N4MA 3U1DA 4XBFA 3RPQA 1F5TA 3J7AO 1LJ9A 5FGMA 2FEZA 2NS0A 1S7AA 2LDUA 3C18A 4LLLA 1HKSA 2RV8A 4OIOF 5F1RA 2A6EF 2DQRA 3I71A 2W25A 4KIBA 4MHGA 1QBJA 3DQVC 2L4MA 4NB5A 1HKTA 3Q9VA 1GVJA 3EDPA 1Z1DA 3RKWA 1TTYA 5E1XA 2R3SA 2E1NA 5A2QK 2EV6A 4HV6A 3HIFA 4ENKA 1FLIA 1ON1A 1RIOH 5DUKA 1K79A 2D2WA 5FLXK 1K78B 3F8MA 1R36A 2ZJ2A 2XGXA 3K1NA 4LLGF 4KMUX 2YX7A 1CF7B 3DXJF 5HS7A 2DPDA 1G3SA 2H6BA 4XSZF 1JXSA 1YO5C 1AOYA 5H6RA 4M9ZA 1ZRCA 2QLZA 3MFKA 4EGYA 4BXUA 1A04A 1Z6RA 3RI4A 2FMLA 3QPHA 3GFJA 2ZKZA 4P55A 5HVQC 3RDIA 1TBXA 2C6YA 1XGNA 2CGPA 2FSWA 2V79A 2QENA 2DW4A 3HUGA 3ML6A 3JW4A 1KU3A 1OYWA 5K1YA 2XROA 2XIGA 3GFLA 4LG0A 3LA3A 3WTZA 1W5TA 5BOXA 1AWCA 1C0WA 1USSA 2UZKA 1B9MA 1STZA 2RC4A 4A2UA 3IRQA 3T0YA 2Z9OA 5IT9K 3RKXA 4FX0A 1SD7A 1FBQA 4UVAA 3SXZA 1B4AA 1HSTA 2ISYA 5BPDA 3KEQA 3WODF 1FOKA 5D6FA 3BDDA 2J5PA 4B09A 4U0WA 4L18B 3FM3A 1T39A 1R58A 4RAZA 1OR7A 3GVAA 4KN7X 4MTEA 4CICA 3VEPA 3V8JA 5BS6A 4CXFA 4M6XA 3RKYA 2A07F 2HFHA 2KIUA 3P9KA 4A6DA 3MZHA 3HHGA 3LA2A 2AXLA 4IRGA 1SD4A 1BJAA 1KU9A 1XSXA 3M8EA 1V3FA 5DYMA 2P5LC 2PI0A 2P6TA 3DPLC 4H0EA 4I98B 1QZYA 2GIVA 4ZZLA 2CFXA 3T8TA 1H9TA 3DPTA 2HYFA 4IF4A 2LSOA 1ZHFA 3W6KB 4UVCA 1FT9A 1KQ9A 2O8XA 4HAMA 2TDXA 2Q2EA 4I02A 3Q5FA 1Z6TA 3I54A 4A5NA 3GW2A 1K78A 2HDCA 2A61A 1TW3A 1CF7A 3VFZA 1XSDA 4KN4X 3DKWA 4HW0A 3WG9A 1L3LA 2QWWA 3WE2A 1Z7UA 3LQQA 4I0BA 2IRFG 1FPQA 3KZZA 2JZYA 1SMYF 2UXNA 2K4JA 1W7PB 5HOOA 2DI3A 2EK5A 1IUYA 4A5MA 4HV5A 5FB2A 4HF2A 2E7XA 4Q4ZF 3LFKA 4XLNF 3F8BA 5FFZA 5DCMB 2RN7A 1Z91A 4ENMA 4OIPF 5J6XA 1LEAA 1XCVA 5F6FA 1ZLJA 2CWEA 3F6OA 2R7DA 2GWRA 1IZ1A 4LJZF