3SXYA

Metal-free full-length structure of tm0439, a metal-binding fcd family transcriptional regulator
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
201
structure length
201
Chain Sequence
b'RTKVYNLLKEMILNHELKLGEKLNVRELSEKLGISFTPVRDALLQLATEGLVKVVPRVGFFVTDVDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVEKSAKREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, GntR family
publication title Metal-free full-length structure of Tm0439, a metal-binding FCD family transcriptional regulator
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 83
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3sxyA01
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxyA02
5AONA 4I7HA 3BZ6A 4KUMA 4LLGF 5DD4A 5EEGA 1H9TA 3J81Z 2NNNA 2PG4A 4S04A 2QWWA 2QUFA 3GEZA 5J8FA 1FYLA 2M30A 3MEXA 1ZN2A 2QQ9A 1K6OA 2RKHA 2YPRA 1BIAA 3QPTA 2OQRA 2RV8A 1OPCA 5TJJA 1XD7A 2GQQA 1U5TA 3WTXC 3KZZA 4LG0B 2E7XA 5HLIA 3FHZA 2WWYA 1BC8C 2ADUA 2ZCWA 2PLYA 4Q5SF 1RUOA 4YFXF 2VE8A 5E1ZB 1G4DA 1QBJA 1R5HA 1FX7A 1HW1A 4WXDA 1FYMA 1YW7A 2DAOA 1ULYA 2VBYA 3MZYA 2GIVA 2P8TA 4HLXA 2VE9A 3HIFA 4B8XA 1PUEE 2RDPA 3Q5FA 4UUVA 1QO0D 4P9UA 3BROA 5BQTA 4ZYEA 2L02A 3WTWC 4MGRA 2P6TA 4LB5A 3FXQA 3U1DA 3GVAA 5F6FA 1IZ1A 4RS8A 5FO5A 3KETA 3HRMA 1TW2A 2O6GE 5E18F 2HZTA 3I59A 5HS8A 1IUYA 4FX0A 4YIIA 3FZVA 4L9JA 3ZMUA 5J6XA 3LA2A 1ZRCA 2DT5A 5AIPA 2K27A 4LG0A 2W85A 5LGNA 1RZ4A 2BBYA 2EFQA 3DPLC 3DV8A 3MWMA 1HSTA 4Q4ZF 3HOTA 1B59A 1BBYA 3RPQA 5BS6A 5HDKA 3M8EA 1JHFA 4HQEA 5DCMB 5ICGA 1UFMA 5A2QK 5IT3A 3I0TA 1B1BA 4R79A 3F6VA 3RJPA 4G7OF 1P92A 3H3ZA 3DXJF 3LQQA 3LQRA 1YW9A 1ODDA 3KFWX 2MC3A 2ISYA 3JSPA 1P6RA 4A6EA 4BHBA 3J80K 2HKXA 3JTGA 4HDVA 6PAXA 1IN4A 3ZPLA 3BJ6A 3BPXA 3C3WA 2W84A 2X0LA 1OMIA 1R36A 2LKPA 3OV8A 3F8NA 3F21A 4NQWA 1HW5A 4FX4A 3KEOA 4HZFA 1E17A 4BHPA 1ZYRF 2HS5A 3GFIA 2EK5A 1AOYA 4XSXF 5DCMA 5L3GA 1KU2A 2P5KA 3WTZA 2VBZA 3TDZC 4IJAA 3FMSA 1XCVA 3I64A 3HRUA 3HOSA 1R22A 4MQVA 3RYRA 3HRTA 2O61A 2YX7A 4A2UA 3QRFF 4D0PA 3J7AO 2DPDA 3KP6A 2A5YB 4ETSA 3HTSB 1MJAA 3JAMZ 5L3CA 1RUNA 5CLSA 3GO5A 3IKVA 2DTRA 3L7WA 1Q1HA 5LGTA 2Y75A 1Z7UA 2MD5A 1P2FA 2Z99A 4WCGA 1I1SA 3BY6A 1ZH5A 1F1ZA 3PFIA 3QP5A 3GFLA 2XGXA 1YW8A 3GZ6A 2BEOA 4L18B 2ZBKA 1MJBA 2KJCA 1HKSA 1K78B 2K02A 2ZFWA 1IXSB 4ESJA 4N0BA 3H92A 4IXAA 1R00A 2HQNA 4HX7A 2PJPA 4EVIA 2AS5F 3CUOA 4P5OA 3N4MA 1LEAA 1EH7A 2BV6A 2H94A 2RVCA 2ZNZA 1D3YA 5ILSA 2M87A 4RAYA 2OBPA 2XAHA 1J0RA 1F5TA 5L3DA 3EETA 1FBQA 3Q9SA 5DV5A 2R7FA 4WWCA 3KEQA 2A68F 2IVMA 2P6SA 4OMYA 1XMAA 1YFHA 3RKWA 2ETHA 4EJOA 2HR3A 1TW3A 3RDIA 1USSA 5F1RA 3BWGA 3GW2A 3K1PA 1BIBA 3MAJA 5HLGA 2DU9A 4YFNF 3R0AA 1K78A 4M74A 1U8RA 1U6GA 2Y48A 2VOPA 2YSRA 5JFRA 2CSOA 5FB2A 1Z91A 2L3DA 2FSWA 3EQLF 1FBSA 2J5OA 4M6XA 5L3EA 5D5UB 3RKXA 3G73A 5ILUA 1BI3A 1QGPA 1YS7A 1YO5C 1RNLA 1TBXA 2PBIA 3ZMDA 3H3UA 1PDNC 2A69F 1XB4A 2P7VB 3F72A 5H6QA 1YS6A 1J2XA 2EA4A 4Y13A 3ZMTA 4ENNA 3QOPA 5J8CA 3I54A 5D8LB 2HYGD 3SZPA 1TQMA 1Z9CA 2DBBA 1YLFA 4AIJA 3TO9A 3DP7A 1S3JA 2QQBA 1YYVA 5ERIA 3VODA 2JZYA 4NB5A 4RGSA 1USTA 3VB2A 3TGNA 2WV0A 1ZRFA 4U7DA 3SHFA 1FC3A 3MZHA 2ZMEA 3P7NA 4LB6B 3ERED 1BOAA 2K4BA 3ELKA 4RGRA 2GA1A 5DDGA 3B02A 2FBIA 5D5XB 1X3UA 1O3TA 4EV0A 4AWXB 3F8CA 1HQCA 1DP7P 4CICA 2EV6A 1FYKA 1FP1D 3D5LA 3K2ZA 3BJOA 4RGXA 3VFZA 3J81K 2K86A 1CF7B 3L2CA 1K79A 2QQAA 2CO5A 3IHUA 2XROA 1L3LA 1LEBA 4M9ZA 2HEOA 3M9AA 3JSOA 3P9CA 2NYXA 1JXSA 2IA0A 2H09A 2FQ3A 2XAQA 4HAMA 3D0SA 4N9IA 3E6DA 2L4MA 1WWXA 2PI0A 2UWMA 1ZG3A 2M5WA 3E97A 3ABTA 3R0JA 3T0YA 4B09A 4EGYA 4XLNF 1XGMA 4LK1F 3GFJA 4BYYA 2A3SA 2FBKA 4PDKA 3WU1B 1S8NA 2GZWA 2JT1A 3RIRA 5D8KB 4UXNA 3I59B 5HDNA 3U9GA 3FM5A 3SZTA 2K7LA 2Z5UA 5E8GA 2X4HA 1OKRA 5BPDA 3N97A 1DDNA 3L00A 4LLNA 2WC2A 1TLHB 5K1YA 3NEUA 5IT9Z 4M6YA 5HS9A 2B0LA 3F8MA 3WU0A 5FD6A 3TO6A 1CF7A 3V7SA 2FEZA 3CDHA 1KQ8A 2OU2A 3ECHA 5LRSA 5JR3A 4G9YA 2QLZA 3DPTA 3LA3A 3C18A 1P4AA 3DF8A 2Q0OA 1BN5A 1IN6A 2OQGA 1NHAA 3M7GA 3CJNA 1MZBA 2OAZA 1GXPA 4A5NA 2XASA 3LWFA 1U3EM 2D2WA 3ROUA 2RN7A 4HF0A 4I01A 5CYVA 1U78A 4I2OA 2VN2A 4ASNA 5CVVA 1W7PD 2L01A 1WKMA 3K0LA 4U0WA 5TRDA 4EJTA 4S05A 2HTSA 1IRFA 3W6KB 4G94A 3T8RA 2JTVA 3B73A 1XDUA 4G7HF 2JRTA 1UCRA 4M73A 3TO7A 4GO1A 4WF2A 2HDCA 3R61A 3HTUA 3NQOA 4M72A 2DK5A 4XBFA 1XDSA 2K4JA 1G3WA 2XIGA 3WODF 2ZO4A 2FU4A 3ABUA 5LHGA 1T38A 3IC7A 4EQQA 1TQPA 2ESHA 3FM3A 2Q8KA 3IWZA 3FXUA 4MEYF 3KLOA 2EA2A 5HVQC 2Q2EA 4N9HA 1BC7C 2IRFG 1KU9A 4MHGA 1SAXA 1ONVA 3HHGA 4E70A 2IT0A 3F6OA 3I58A 3SXZA 2DQLA 4AIKA 2MLKA 2ISZA 2YU3A 1SFXA 4DQ2A 2KKOA 1O3QA 2ZKZA 3CO6C 4HW0A 3Q9VA 3WE3A 1ZG5A 2PQ8A 2XKPA 3F22A 1JGSA 2O8XA 2M45A 2RGVA 2STTA 1R58A 2W25A 1E2XA 1YQAA 4YIFA 3JAMK 4Q47A 2QENA 1O7FA 3DQVC 1U2WA 2HYFA 3TOBA 4EJWA 2MBFA 2F2EA 2KRFA 4I98B 2F5CA 2V1UA 1XN7A 2YR2A 4EJUA 3ULQB 2W57A 3GUDA 4ZH4F 2CWEA 2CGPA 2V79A 3IL2A 5K5RA 3FMQA 1QPMA 4M9SA 1SFUA 3R60A 2OZUA 5E17F 5ED4A 1R1VA 4JBAA 3GXOA 2A07F 1ZHFA 1SD6A 5CVUA 1AWCA 2VOOA 4XRFA 4JK1X 3CLOA 1B9NA 3GLXA 4CHUA 3I5UA 3I4PA 1WRJA 1KQ0A 3R6SA 3KP3A 3V7RA 2F5EA 3QPHA 1MDMA 4O3MA 4UV9A 1H9GA 1LDKB 2FXAA 4IPAA 3REOA 2VC1A 1BI2A 4MTEA 3I53A 3WGIA 3E6BA 2XAJA 2GAUA 1R5GA 5E1WA 3ZQ7A 4OINF 1XGOA 1KYZA 2NNYA 2XHKA 4WXCA 2PFBA 1ZAOA 3C7JA 3ZN0A 2FMYA 1ZG1A 4P55A 4KT5C 3MFKA 5H6RA 1IN5A 1FLIA 1ON1A 3PQJA 1D5VA 1T6SA 3F8FA 4KMUX 2KIMA 2QBYB 4CDGA 2D1HA 3VEPA 2XKOA 1H0MA 1FOKA 2PMHA 1WI9A 1ZGAA 2A6HF 2C6YA 1EH6A 3K69A 4ON0A 1J59A 1DUXC 2ESNA 2H6CA 3JW4A 2VT3A 1MJ9A 3KLNA 1S6LA 3KP2A 4MEXF 3WG9A 4L9TA 1TNTA 2OD5A 2E7WA 4F7ZA 2M1BA 3E3VA 2RQPA 3T5XA 4KN4X 2GXBA 2CG4A 1OYIA 4M9XA 3T1BA 3BOQA 2BE5F 2HTJA 3KCCA 4IRHA 4LK0F 3SXMA 2VC0A 4EMSA 3K1MA 4QWQA 4L5IA 2E1CA 2PN6A 4HYEA 2ZMEB 1FSEA 4HDUA 5K5OA 5FFXA 1FPQA 1KQ9A 4KDPA 2QBYA 4DNCA 1ZLJA 1XGSA 2FBHA 4HLYA 4U0VA 4TV7A 2XAGA 4KIBA 1ON2A 1BM9A 5LRRA 2BYVE 2HKOA 1XGNA 2HFHA 4A5MA 3SXYA 4M71A 3FMRA 2MH2A 1W5TA 5KK1A 1R1TA 3KP5A 4WX9A 4HOBA 4HF2A 3F8BA 1RIOH 1VTNC 1HKQA 4MTDA 4NHJA 1LDJA 2IP2A 3BPVA 4HQMA 5CVRA 2LDUA 5DUKA 5ICFA 4LFUA 1GHCA 1O7LA 3E5QA 4RGUA 4KN7X 2IW5A 3KZYA 4HX8A 1KYWA 1RI7A 4AIHA 1DPUA 4LJZF 2D45A 5JHUA 4CO8A 1G3TA 2A6EF 2D1VA 4AD9A 1IAWA 5H20A 2L54A 1R23A 4KIFA 1SMYF 1W7PB 2DLLA 1O57A 3WTTC 2G7UA 2YX4A 4RAZA 5EEHA 3BDDA 1O3RA 1F9NA 1OYYA 1UHMA 1UHWA 4HX4A 1REPC 3AAFA 1B6AA 1O3SA 5D6EA 3BJAA 1GXQA 2XAFA 4ESBA 4XSZF 3L9FA 2EFWA 2JPBA 4GGGA 5ICEA 3SXKA 1B4AA 2VODA 3ZN1A 5IT9K 3LSTA 4PZJA 3JTHA 1TNSA 3V8JA 4ZYDA 4L5JA 5FLXZ 4OIOF 2Y0MA 3BP8A 1IN7A 1WSUA 1LB2A 2UZKA 2DFIA 4P96A 1FY7A 1QZYA 3HRSA 2XUBA 3RKYA 1J7KA 4A6DA 1KU7A 1HSJA 1BJAA 2P5LC 1W7PA 5D4RA 3WTVC 2M8EA 4GYGA 3ZMZA 5FFZA 3E6CC 1SD7A 3EDPA 2NRAC 4I0AA 4GXOA 3IKTA 5AIQA 4Z2YA 5DUIA 2EB7A 3HSRA 1HXDA 1G3YA 4Y17A 1FZPB 3DEUA 1PP8F 1MKMA 2ZJ2A 4Y15A 1Y0UA 4YG2F 4R8HA 1GVJA 2MA3A 4OIQF 5LHHA 3IRQA 1ZARA 3EYYA 4CGZA 5DD8A 3GF2A 2LSOA 4IHSA 1ZGJA 4JQFA 4KMFA 1OR7A 5JVTA 1KGSA 4A0XA 1WQ2A 2CQKA 1I5ZA 3T8TA 3CTAA 4UVAA 2V1XA 5KVRA 2ELHA 2F5FA 4G6QA 3HYIA 2LF8A 1QQIA 2V9VA 4PGHA 2FRHA 2EFPA 4HV5A 2FMLA 1S29A 1FSHA 1LNWA 4ZZDA 5L3FA 1YIOA 3GX4X 1IXRC 2Z9OA 4UVBA 2DW4A 1UB9A 3S2WA 1J9IA 2HWVA 2QYOA 1QZZA 2UXNA 3V8LA 4FT8A 2E1NA 3F23A 1C0WA 5F64A 3WTSC 2LNBA 4O5VA 2L4AA 4IRGA 4LGWA 1PP7U 4OMZA 2XVCA 1YTYA 2DQRA 4EM0B 1CGPA 2Z3YA 3QAHA 2IA1A 1SMTA 1ZRDA 3QU3A 3FX3A 3LA7A 3GFMA 1SD4A 1S7OA 3ECOA 4ESFA 2QZ8A 3WE2A 1T0FA 2OZ6A 1W4MA 1L0OC 3QP6A 1IF1A 1LQ1A 1XSXA 3TOAA 1W5SA 1STZA 3TDUC 4ZYGA 1HW2A 2P5VA 4G8XA 2TDXA 3HHHA 4UNOA 4G7ZF 1G3SA 2R3SA 1LVAA 2EV0A 3V4GA 3LAPA 3V8KA 5A2QZ 3QU6A 1MDMB 4BXUA 4CZZA 2P7CB 4EM2A 2G9WA 2FNPA 2EV5A 3HSFA 1FNNA 3O2PE 4P9FA 1IRGA 4AVPA 3K9TA 2V6CA 1KU3A 3FF5A 2CFXA 1FBUA 1K7AA 1P4WA 5DEQA 2WTEA 1T98A 2BGCA 1I27A 4BHCA 2FF4A 2ZXJA 3J80Z 4IHTA 4HF1A 4I09A 3SQNA 4UHTA 2HQRA 3KP7A 4R1HA 3I71A 1P4XA 2FA5A 5HLHA 1TTYA 4PGGA 1IXCA 4MQ9F 2XV4S 4KIGA 1XSVA 2O03A 5DYMA 2JSCA 3OOPA 4ZYHA 5BPIA 4WXHA 1T39A 2MH9A 3R4KA 3EUHA 3GYHX 4A0ZA 2OA4A 2F5DA 1SD5A 2H27A 2EWNA 4I02A 5E8IA 5D5VB 2UXXA 5LHIA 3CUQC 1KA8A 4KA4A 5LEJA 2CW0F 2VBXA 3WGHA 1D8KA 3CUQB 2DI3A 2JPCA 2NS0A 4IF4A 5CVJA 1QNTA 1ZLKA 4OOIA 5D6FA 1HKTA 4RB0A 1V3FA 4OU0A 5LEKA 2A61A 3VOEA 4PCQA 4IVNA 3DKWA 2VBWA 3F3XA 1IW7F 4K2EA 1XSDA 4KICA 2G7HA 2QVOA 3TQNA 2KJBA 4A12A 1FP2A 3HSEA 4G6DA 4MNUA 1Z1DA 2PEXA 3WTYC 4LD5A 4A0YA 5D4SA 1TQIA 3COAC 2STWA 5L3BA 1I6XA 2RC4A 2CYYA 4L0ZB 1YG2A 3EYIA 1Z05A 2IJLA 2O0YA 4BAYA 3NRVA 2XRNA 4BH9A 4WK8F 4ZZLA 2KIUA 5JI6A 1D8JA 4LLLA 1DPRA 4GYIA 2R7DA 1BI1A 1XCBA 2EFOA 1R7JA 1MGTA 2AXLA 3E6MA 3IRRA 4KYWA 3CUQA 2DPUA 5E20A 5CVIA 4XLPF 3DFGA 3IWFA 3K1NA 4O6JA 5K5QA 4U88A 5HDGA 3ML6A 2H6BA 3WTUC 4L9NA 5LBQA 1JHHA 2COMA 3C1DA 2DK8A 2FE3A 1FT9A 4I0BA 4H0EA 3KP4A 4HBLA 1SFEA 4OIRF 4ENKA 2LF7A 5ILVA 4FHTA 5D5WB 1T2KA 1HBXG 2QM3A 5FD5A 2IA2A 3O6BB 3PQKA 1F4KA 5ICCA 3ZMVA 2GWRA 1R1UA 1Z6RA 1EV7A 3TKYA 2P4WA 3HUGA 1EH8A 1G6NA 5CJ9A 5HOOA 3V7CA 1JE8A 5BMZA 4EM1A 2PMUA 3LAJA 4YFKF 3FXRA 3M1EA 1FWZA 3RI4A 4GCVA 4ENMA 3CO7C 3U2RA 1IN8A 1LJ9A 4U7BA 4LMYA 5HS7A 1J75A 2O3FA 4ENJA 4EGZA 4UV8A 3SFZA 2KIFA 3M8FA 4UVCA 4CXFA 2RNJA 2GA2A 4RB3C 3MCZA 2EFNA 2HGCA 2FOKA 1MD0A 3GZ5A 2EJRA 3RPUA 4RB2C 3E5XA 3P9KA 1LDDA 2V1DA 2ZNYA 2Z33A 1Z6TA 2J5PA 1B9MA 1J5YA 3RTRA 5DCFA 4KFCA 3FWEA 3E5UA 3RYPA 3G3ZA 1ZREA 4U0YA 1BI0A 5LLQA 2ACJA 2VXZA 3LFKA 4L9VA 4KNYA 2MLGA 5FGMA 2GXGA 4OIPF 4BQAA 1I1GA 2W24A 4BNCA 3KE2A 2VT2A 4EJVA 5E1XA 1U5TC 1XMKA 1OYWA 2DO7A 3WGGA 3MQ0A 1A04A 1U5TB 3L09A 5BOXA 2HOEA 2FNAA 4QLCU 3GWZA 4HV6A 2IPQX 5FLXK 3ZMSA 4L0YB 4CYDA 3W6JB 4RB1A 5LGUA 2NAZA 1S7AA 3ZP5A 4IRIA 3ISPA 4Q48A 3P9IA 3O3KA 2VONA 1V4RA 4HA8A
chains in the Genus database with same CATH superfamily
3CCYA 4IHYA 3ZWIA 1YVIA 1LE8A 3ZTMA 1AVOB 5AONA 3S14J 4I7HA 3UMIA 3S16J 2WA0A 3NWSA 2HYJA 1IRXA 3BZ6A 4XMYA 4KUMA 2Y9YA 4G6TB 3I5PA 3BTJA 4LLGF 5DD4A 5EEGA 3OSFA 3CCVI 1H9TA 1NU9C 1U0BB 3J81Z 2NNNA 3TBIA 1H6GA 1B68A 2PG4A 3OL3A 4S04A 2HUJA 2QWWA 3HNKA 3KX2A 4NQFA 2QUFA 3GEZA 5J8FA 4FETA 2W9YA 2LG4A 2M30A 3SEQA 1UG2A 1FYLA 3VYRB 2HSQA 3ABMC 3MEXA 1LFUP 1G4US 1X4OA 1ZN2A 1ZVZA 2BXYA 2QQ9A 3BG3A 2QEXI 5L3VA 3AGUA 1ACIA 1ETXA 1K6OA 3GLLA 3TJ5A 3H5RA 5TISC 1GDTA 1TWHA 2IXPA 4JC7A 4IAQA 2DFFA 4JJGA 2A5WA 2RKHA 2YPRA 2Q9AA 4F4BA 3V7OA 2VCBA 4JIOA 1BIAA 2F48A 2M3AA 3E1SA 3QPTA 4BUPA 2OQRA 2RV8A 1OPCA 4RA2A 5TJJA 1XD7A 2GQQA 3U3BA 3W8IA 2VQGA 5KYUA 1U5TA 3SEZA 3WTXC 3KZZA 5HSWA 4PFOA 4UB6C 4XKWA 4LG0B 1Z3XA 2E7XA 5HLIA 3L0IA 2DOEA 3FHZA 5HLTA 2WWYA 1ZW3A 1BC8C 4XONA 2ADUA 2J7PA 3RQFA 2ZCWA 2DOAA 3FXMA 2PLYA 3HKZA 2O9LA 4Q5SF 3O6XA 2J46A 1RUOA 4YFXF 4QI2A 2VE8A 3FXOA 5DS5A 5E1ZB 5EDNA 1G4DA 3RF3A 1QBJA 1R5HA 3BTCA 1FX7A 2CQNA 1HW1A 4I6ZA 4BXXJ 1D0YA 3D5SC 4WXDA 2IS6A 3ZQVA 3HBLA 1FYMA 1YW7A 2DAOA 2AXTC 5IP7J 3OIQA 3JRCA 4IQJA 2NPUA 2Y3DA 1PV3A 1ULYA 2VBYA 1ZU5A 3MZYA 2WV1A 2GIVA 4RBOA 2P8TA 4HLXA 4FE4A 3IP4B 4I3MA 2VE9A 3HIFA 3AKZA 3WHCA 4B8XA 3CCRI 1PUEE 2BW3B 2XSEA 2E5ZA 2X1DA 1VTMP 2RDPA 2HXOA 3DE8A 3Q5FA 4UUVA 2JX0A 1QO0D 2TCTA 4JX6A 2DMQA 1W1WE 1L3PA 3VSKA 4XL9A 3BROA 4P9UA 1JAFA 1MBKA 4D7NA 5BQTA 2EIMC 3R2PA 4IX7A 4LIVA 3M4BA 4QPQA 4ZYEA 2NUTB 2L02A 2YS9A 3WTWC 4MGRA 3KL4A 2P6TA 4J00A 4LB5A 4EIYA 2Y0SA 2E35A 2BY0A 2E2HJ 3FXQA 1EKYA 1X4PA 3U1DA 2H7VC 2JUCA 3DTEA 2NSGA 3GVAA 5F6FA 3S3NA 3HLZA 1XPXA 1RMVA 3NKDA 1IZ1A 4RS8A 5FO5A 4XRSA 3KETA 1ZTRA 3H36A 1BR4A 3HRMA 1TW2A 4YIRX 2CNWA 3HOZJ 2K9NA 2O6GE 5E18F 3BR2A 1CGNA 2HZTA 3I59A 3M15A 2Y3BA 5HS8A 1LKXA 1IUYA 1WASA 4FX0A 4YIIA 5M3FJ 3U8PA 2EIMH 3FZVA 3W2AA 2JRMA 1T8IA 1QHHD 1N77A 1JRAA 4JCHA 4JTDB 4L9JA 3ZMUA 2LY2A 4CA0A 3G2BA 2YL0A 5J6XA 1DOVA 2ZC2A 3LA2A 4YN0B 1ZRCA 4XQ1A 3JT1A 2DT5A 1SZIA 4BE0A 3S2DJ 2PF4E 2QTVA 5AIPA 1IUFA 2Y2ZA 4NQWB 1ZHYA 4G0HA 5M5WJ 1A36A 1FR0A 2K27A 2LFBA 4LG0A 2W85A 5LGNA 4H54A 3V5YA 3EZIA 1RZ4A 2BBYA 2LH9A 1NFOA 2EFQA 3DPLC 2NVYJ 3DV8A 3MWMA 2JUGA 1JKOC 3HNLA 3ITFA 4HE8D 5D91A 1HSTA 1VOMA 3DJNB 4Q4ZF 1B59A 2UV1A 2WB1A 3HOTA 5HV9A 2COBA 4A69C 2L6GA 5B3SC 3BG6A 1BBYA 3RPQA 4XOTA 5BS6A 5HDKA 3M8EA 1JHFA 4HQEA 3ZQCA 3SZRA 5F5HA 5DCMB 2HQAA 3B9QA 5ICGA 1UFMA 3L34A 3H5NA 5A2QK 5IT3A 2LCHA 1MBGA 3I0TA 3Q6MA 4DBQA 2Q1ZB 1B1BA 4FCYA 5L0GA 4R79A 1K61A 3F6VA 3RJPA 1X1AA 4G7OF 4I99C 5KYXB 4YEJA 3LUTB 1P92A 1NFNA 2BW3A 3QYEA 4MVQA 4XRSG 1XG1A 3FXHA 4CCMA 3H3ZA 2YL3A 4KI2A 3DXJF 3KYCB 4CS7A 5AGFA 4BEHB 3LQQA 2IXNA 3KH2A 1ZR2A 3LQRA 1VQNI 5COFA 2CNWD 4HSRA 1KONA 1YW9A 4AUXA 1Y1WJ 3HB9A 4M3DA 1ODDA 3BR3A 1WZ2A 4U5HA 3KFWX 2MC3A 3K10A 3PUFA 3CQZA 4BACA 1A0BA 2ISYA 3JSPA 3MD2A 2AWYA 3S1QJ 1FTSA 4ZTFA 3S17J 1P6RA 2OKUA 3OOUA 4LDQA 4A6EA 4BHBA 3J80K 2HKXA 2EZHA 3JTGA 2A0UA 3CMYA 3LSGA 2PMZA 1JR8A 2Y39A 1YZAA 4HDVA 3EH2A 4ULWA 1PCXA 3NAUA 2KK1A 1W0UA 4QPOA 6PAXA 4QI0A 4EHPA 3AQBA 1IN4A 3ZPLA 3BJ6A 2VJIA 3BPXA 3C3WA 2O8KA 2W84A 2X0LA 2OG2A 1OMIA 2NOJB 1R36A 3POVA 2LKPA 1EF4A 4B6IA 1LVKA 3H0GJ 1WOLA 3OV8A 5IYCJ 4QIWN 3F8NA 3F21A 2Y69C 1I3QJ 1Z7LA 4NQWA 1HW5A 4ZLDA 3SDBA 3RVYA 3MKWB 1YJWI 4FX4A 2WAEA 5DQZA 2IS1A 3KEOA 5F1JA 1K4SA 4F52A 4HZFA 2L9JA 2M7AA 1E17A 1Z3YA 4BHPA 1CGOA 3IEEA 5EHHA 2E71A 3Q7LA 1ZYRF 2M7BA 4XOPA 2HS5A 3GFIA 4MLOA 2XB5A 2QLAA 2IYLD 2EK5A 5F27A 1AOYA 1X2NA 4XSXF 5DCMA 2ME0A 3SFIA 4D5FA 5L3GA 1KU2A 1OCCC 2Q9BA 4I44A 4CBEA 2P5KA 2X6XA 3WTZA 2UUIA 2VBZA 4U5CE 4IOAF 3TDZC 2DA1A 4IJAA 2Y69H 3FMSA 2FD5A 2E87A 3C8GA 1XCVA 3I64A 3HRUA 4B47A 3HOSA 3LS1A 1MBJA 1R22A 4NBQA 4MQVA 3E9VA 3G50A 4IQ4A 3RYRA 1ST6A 5KCMA 3HRTA 1Q1VA 5FKLA 2YLDA 2O61A 2DOFA 3W6VA 4J7YA 2F4IA 4BEHA 2YX7A 4A2UA 3QRFF 4FX5A 1E84A 2ID3A 4D0PA 2DB4A 4NC8A 2GM4A 2JQ7A 4BG0A 3NYLA 1OCCH 3OL4A 3G1LA 3J7AO 2K5CA 4X6AJ 1Q0FA 2XLWA 3U9MA 2DPDA 2LQGA 3PCVA 3KP6A 1XWJA 2J9VA 2A5YB 4ETSA 1WJFA 2I5UA 3HTSB 2W45A 1MJAA 2FAPB 3JAMZ 4Z9HA 4A3CJ 5L3CA 3IUOA 1RUNA 3S2HJ 1C02A 2JVHA 3A02A 5CLSA 2F5VA 1WHUA 3GO5A 3IQ6A 4CS8A 3IKVA 3ZQHA 3EPVA 4RM3A 4ZDPA 2XRHA 2DTRA 4IHWA 3L7WA 2HVQA 1FMWA 4CYCA 1Q1HA 1XTAA 1TWAJ 2BHYA 5LGTA 2R05A 3GEHA 3HNIA 3JSEO 1MMSA 4O79A 2Y75A 5IOYA 1Z7UA 2DMUA 2MD5A 3G4XA 4PJJA 2HOAA 2PFDA 5C44J 1OCOC 1P2FA 2Z99A 3K2AA 4PK4A 3IQTA 4BJ6C 2CGEA 4WCGA 3A11A 5DVWA 1GLNA 1VYIA 2DJIA 1HF0A 2NG1A 3AG1H 3WU2C 4E0HA 1R5ID 3QVYA 3L1MA 4YT2A 5B3IA 1I1SA 5A6BA 3BY6A 1ZH5A 1VLSA 2FJ1A 2UUZA 3G6EI 4A3MJ 1Y1VJ 1F1ZA 1HA8A 4EBJA 2CFOA 2K9SA 5LD2C 3OIPA 3DU6A 2DA4A 4Y4RA 4DJ9A 4C3BA 3LSMA 3O8GA 3LSRA 1MQVA 3PFIA 3FISA 3QP5A 3GFLA 2BY1A 3C8GD 3MZ8A 5E3OA 5FLMJ 2XGXA 1YW8A 1OCOH 2HJMA 1FFHA 3PIOF 4W8PA 5B1BC 3GZ6A 2BEOA 4L18B 2YL1A 2Z16A 2ZBKA 1MJBA 2MFZA 2VQLA 3O8HA 1YA9A 3DE9A 1LE2A 4N4OB 2K3PA 2KJCA 1HKSA 3Q6NA 1K78B 2K02A 2ZFWA 1ETVA 3GTLJ 1IXSB 4ESJA 2HQ5A 1NLXA 1TKNA 3C62A 4N0BA 3GTQJ 1LS4A 3TP0A 3H92A 2EIKH 1TWCA 4BEMJ 4CJOA 2BZTA 2EBIA 1WGWA 4IXAA 1R00A 2HQNA 4HX7A 3NARA 1BOBA 4EVIA 2AS5F 2PJPA 3CUOA 4P5OA 3T6GB 2EINH 1CQTA 3N4MA 1LEAA 5B1BH 1EH7A 2BV6A 2EPKX 1V55C 3LEVA 2H94A 3JREA 2RVCA 5EZGA 2ZNZA 4S0HB 5B66C 3TULA 2G0EA 1JJ8C 1RKWA 4L5EA 2X9DA 4F93B 1D3YA 3OWTA 2M87A 5ILSA 4D5CA 1O87A 4RAYA 2O9XA 1JUMA 2ELJA 2OBPA 2NVQJ 3J7YJ 3ZC4A 2XAHA 1H88C 2KW3C 5FKMA 1J0RA 1F5TA 5L3DA 1T08B 3EETA 1FBQA 3K1IC 1WATA 4RLFA 3Q9SA 5DV5A 5A6BD 2R7FA 1QQ3A 5E2QA 2VPLA 4NDLA 2LK4A 4GYTA 1VZ0A 5FKKA 1IV8A 3HXLA 2LD6A 1TWGJ 1HOMA 4WWCA 4IHXA 4NY3A 3QW1A 3KEQA 4BJ1A 1OISA 3ZQGA 3HOXJ 4BJTA 2A68F 5JLWA 2IVMA 2BHZA 2R9RB 2P6SA 4OMYA 1OJLA 2VQCA 2KLOA 1TL8A 3TOMA 4ZLCA 1XMAA 1YFHA 5L0HA 3RKWA 3AJMA 1R6RA 3QOEA 2ETHA 4BJ6A 4IARA 4EJOA 1Y4CA 3U3FA 2HR3A 1TW3A 2KQRA 3DMDA 2ZFUA 4NC7A 2R7OA 1D0ZA 1OW7A 3RDIA 4HFFB 2L9RA 1USSA 3IH3A 2JD3A 3C2BA 1DOWA 3ATPA 1UG0A 2DT6A 3QTHA 1JT6A 2CW7A 5F1RA 1TQGA 2MABA 3HZJA 3JRIA 3BWGA 5EG0B 1N78A 1L7CA 3GW2A 3NG1A 1EKEA 4ITVA 3PFYA 3UR3C 3UGPA 3K1PA 1FOXA 2LR8A 2EILH 3PUBA 1BIBA 2R7TA 3ESWB 4BXFA 3MAJA 5HLGA 3EHMA 2DMTA 2DU9A 2XDVA 1T6IA 4YFNF 4MTGA 3R0AA 2ZMEC 1K78A 1C17M 4LLCA 4M74A 1P7JA 3G4ZA 1U8RA 2XRLA 1U6GA 2Y48A 5J4VA 2VOPA 1S5LC 3CJQB 3H9QA 1H89C 2H7OA 2R92J 2RAEA 4DVYP 2YSRA 5JFRA 4XK4A 2CSOA 3VYTB 5FB2A 1Z91A 2F6CA 2L3DA 4A93J 2X1CA 2FSWA 4A3FJ 3CCQI 1VB5A 3S27A 4BE1A 4O7GA 3VYSB 5HNHA 1YZCA 2MHRA 1RR7A 3EQLF 1BW5A 5JP7A 3SNHA 1UHSA 1FBSA 2J5OA 1IC8A 4M6XA 2ZPAA 5L3EA 5D5UB 1AU7A 3RKXA 3CSKA 3G73A 5ILUA 4XNFA 4JEAA 4HPQA 2MC4A 2VL8A 1BI3A 1MNEA 3QYFA 4IL6C 4XM3A 1QGPA 5BNGA 1B8IA 1HDDC 1YS7A 2E2JJ 3RYLA 4PJNA 3CAXA 1YO5C 1RNLA 4MW8A 2ZXHA 3OYEA 1A41A 3LEOA 3VYWA 1TBXA 2PBIA 2HV6A 3GM1A 4CIPA 2XPUA 3ZMDA 2M8GX 3OS0A 3H3UA 3HPHA 1PDNC 2A69F 1JI8A 1XB4A 1BBHA 2AQEA 1T6QA 3MFNA 2P7VB 3F72A 4UY8I 2QNLA 3K1IA 2WY7Q 5H6QA 2LY1A 4XIDA 4U5EE 4A3BJ 2LC2A 3NDBB 3H5AA 1YS6A 4F3QA 1J2XA 1OXBA 3V5XA 2EA4A 4Y13A 3ZMTA 5GAGJ 2W1OA 3AG4H 4ENNA 3QOPA 3FOPA 3OYAA 4RMNA 3DKAA 3A0HC 5J8CA 3CCUI 1I6HJ 3DEEA 2HMZA 3I54A 5D8LB 1VQPI 2OTLI 1G5ZA 2HYGD 4QSHA 3N0TA 2KC3A 3SZPA 1TQMA 5T1DB 1VNDA 1Z9CA 3HOVJ 2DBBA 2JPUA 1YLFA 4XPXA 4XLFA 5EG0A 3S8PA 4AIJA 4XORA 3TO9A 4B3XA 4GFBA 1RXQA 1WCMJ 3BTLA 3DP7A 3K1HA 1S3JA 2QQBA 3C2HA 4C3IJ 2Y0SN 3OEOA 1YYVA 5ERIA 1YARO 3VODA 1M1EB 2JZYA 3S1NJ 4NB5A 1T6UA 4RGSA 3FXJA 5E3NA 4MIMA 1USTA 2J9BA 3VB2A 1Y8QB 1J8MF 2A0BA 1NG6A 3TGNA 2DA2A 3GM3A 1X2MA 1YITI 2WV0A 1ZRFA 4U7DA 2FUG2 2VKDA 3SHFA 1FC3A 3MZHA 5K0IA 2ZMEA 3P7NA 1ORKA 4LB6B 1SVLA 4JJFA 1OQCA 4C3HJ 4PACA 3SJMA 1TZLA 1A6QA 1LUJB 3ERED 2WVQA 1BOAA 2K4BA 2OEXA 1AA7A 5GADJ 1NG7A 3HJEA 4FTHA 3ELKA 3ZGKA 4RGRA 3LNRA 2GA1A 5DDGA 3B02A 2FBIA 3TD7A 4RD9A 2M0CA 5D5XB 1X3UA 1O3TA 4EV0A 2DT7B 2OCEA 3U21A 2P0WA 1MBFA 3A9CA 4BS9A 4CCLA 1VQMI 3ABLC 3ONQA 1P7IA 3QPSA 3W2VA 4YJWA 5KYUB 4AWXB 2H8WA 4A3DJ 3F8CA 3S1RJ 1A7DA 3JRMO 1J09A 1HQCA 3QPLA 1DP7P 1ORYA 3V5ZA 3OMYA 3T6JA 4AK9A 4CICA 2EV6A 1FYKA 2H1KA 1FP1D 2WB1N 3N2ZB 2O7OA 3D5LA 3K2ZA 1JKQC 3BJOA 4RGXA 4G12A 5E3MA 2ELKA 3VFZA 3J81K 2K86A 4XN3A 1CF7B 2P7VA 4XEKA 1JMWA 3I9V2 3L2CA 3M8JA 1K79A 3JRFA 2QQAA 2CO5A 3IHUA 5JLXA 2XROA 2P1AA 3B0UX 2W7NA 1L3LA 1UZCA 1LEBA 4M9ZA 5CQGA 2HEOA 3M9AA 4C30A 3P9CA 3JSOA 2NYXA 4C3DA 3A01B 3K70D 2IA0A 1JXSA 1GM5A 3ABLH 2H09A 2FQ3A 2M34A 4YRVA 2OTJI 3ZVRA 3RKQA 2XAQA 1F1MA 4HAMA 3D0SA 2XGEA 4N9IA 2WZFA 4DZPA 3E6DA 2M4EA 2VXDA 1QVUA 2QKMB 4IOCF 2L4MA 2WAQA 4BQNA 5M3MJ 1NH3A 4PJ0C 4FWVA 5EYRA 1WWXA 3RQGA 2PI0A 2UWMA 1E86A 1ZG3A 2DODA 2M5WA 3E97A 3ABTA 2DDAA 3R0JA 3T0YA 1F43A 2KQ9A 4B09A 4EGYA 3WG7C 4XLNF 3GORA 1XGMA 2XM4A 2IEKA 1W2WA 4RAFA 4LK1F 3QVZA 3GFJA 4D4NA 5KYYB 2IXSA 3CMMA 4BYYA 1IV6A 2A3SA 2I15A 3WAQA 3QYBA 3B29A 2OC6A 2DA5A 4CJGA 4XKVA 2VH3A 1E0EA 2FBKA 4PDKA 4JZAA 3WU1B 1S8NA 3OR1C 1VQ5I 4W8KA 2PMZN 4PSWA 1Y6IA 2ZSIB 2GZWA 2JT1A 4BPMA 3FHDA 3PNVA 3RIRA 3CESA 5D8KB 3KZIC 2WVNA 3RW0A 1VQKI 1BL0A 5IPAA 4UXNA 5L0CA 3I59B 1VI0A 2R0QC 4RDAA 2K9MA 5HDNA 1MNDA 3FM5A 3U9GA 2JWTA 4NUBA 3SZTA 3WG7H 3MKZA 2K7LA 2VCCA 2CV0A 2YHSA 1JJ6C 2Z5UA 5E8GA 2X4HA 5HODA 1YA7O 1D0XA 3LL7A 3G4SI 2CYDA 2LY9A 1WPKA 1OKRA 2IM8A 4BBSJ 1TWFJ 1VYKA 4RLQA 2Y9ZA 5BPDA 3N97A 2I10A 1DDNA 3L00A 4HSTA 5E33A 4LLNA 1QVTA 1TLHB 2WC2A 3NEUA 5K1YA 4C7OB 1HMDA 3AGTA 3H9JA 3OSGA 2P81A 2HSBA 5IT9Z 4M6YA 2IOQA 5HS9A 5FJ8J 5C4XJ 2R02A 2B0LA 3F8MA 1Z0XA 3WU0A 5FD6A 3TO6A 4E7KA 1CF7A 5IOZA 1M2VB 3LAYA 3V7SA 4CCJA 1WJBA 4A3LJ 2FEZA 3TOLA 3J7ZI 3A01A 4E4HA 3CDHA 2VASA 2QA4I 2XXAA 1KQ8A 4CDVA 3ZQIA 2OU2A 3ECHA 3R7CA 5LRSA 5JR3A 1FTTA 4KNWA 4U5BE 5FKNA 4G9YA 2QLZA 3DPTA 1XX5A 1LI7A 3LA3A 3L8JA 4JVSA 2G62A 3C18A 5FRMA 3PHF2 1P4AA 3UGOA 2WZLA 3DF8A 3JCUC 3L2UA 2L7MP 2Q0OA 1BN5A 1IN6A 2OQGA 1NHAA 2TRTA 3M7GA 1MMNA 3OYHA 2LIGA 3ZQYA 5KYWA 5KYYA 2XLDA 1DU6A 3LSPA 3CJNA 4X1EA 1MZBA 2KISA 3DBHB 2OAZA 4ANJA 1G4WR 4CSWA 2R7VA 5F04A 4DRJB 1BA5A 1GXPA 1FIAA 4EEFG 4A5NA 3J06A 4JKVA 2ECBA 4B43A 2W00A 1K6YA 3H1CA 2XASA 1OXKA 2WL8A 3LWFA 1U3EM 1U9NA 2I8DA 2RSEB 2XF6A 5GAHJ 2D2WA 2Q2EB 3ROUA 4CCKA 3K4LA 1S9HA 2RN7A 1Z63A 3S29A 4HF0A 1CPRA 1TWAA 3PMRA 5A69A 4I01A 3Q0VA 4MVMA 4JEBA 5CYVA 1SVOA 5KNLA 2VKHA 3L2WA 3UKGA 1ZW2A 4RDUA 1VF9A 4CCOA 4MVRA 4DYCA 2JSPA 3H35A 1S7EA 3HPGA 3O39A 1U78A 3I4UA 2L7KA 3T9OA 2HVSA 3GTMJ 4I2OA 2VPRA 3VAYA 1YX5A 2VN2A 4ASNA 1I4ZA 5CVVA 3VDXA 1W7PD 3M1CB 4PR9A 2L01A 2XLOA 1WKMA 3K0LA 1YOVB 1V74B 1JUSA 5B1AH 2R7UA 3LLKA 3QQAA 1RKTA 5C4JJ 2WZGA 3PM1A 4U0WA 4C7OA 3Q0WA 5TRDA 4X0GA 4EJTA 1V54C 2VC9A 1O4XA 5JSLA 1MMGA 4S05A 2QUPA 3HEFA 4U5DE 2HTSA 3B6AA 1IRFA 4B1RA 2GXAA 3K6GA 1VFCA 3FK7A 2EPNA 1EJ9A 1X19A 1M2VA 3W6KB 3E7LA 3EGDB 4G94A 3FKIJ 3S9OA 3FBNB 3T8RA 2JTVA 3OYNA 1N1CA 2PX3A 5B5EC 3OYGA 3B73A 1XDUA 3I56I 3HL2A 4G7HF 2JRTA 1UCRA 4M73A 3TO7A 4XLHA 1CPQA 3C8GB 3RQEA 3OYKA 2R25A 2MD0A 3HGGA 4GO1A 4WF2A 3TQOA 2QGUA 1V54H 1FAPB 2HDCA 3R61A 3HTUA 1SAUA 3NQOA 4W1UA 1Z6AA 3CC7I 2YWAA 4M72A 2DK5A 4XBFA 1XDSA 2K4JA 1G3WA 4MFEA 1OLTA 2XIGA 1Z3IX 1LFPA 2LMDA 3WODF 4K7BA 4E7SA 2ZO4A 2FU4A 3ABUA 4DYQA 3UMKA 5LHGA 4LOCA 1T38A 3BZCA 3B71A 3IC7A 4EQQA 3ZIBA 5JUAA 3TK0A 1PVEA 2XGDA 1TQPA 2ESHA 4E0IA 4CS8C 1V5GA 3FM3A 2ZJQF 2Q8KA 3QW0A 4IGGA 3CP8A 2DN0A 1AKHB 3DAFA 3IWZA 3FXUA 4MEYF 3DM9B 4XKCA 3W2WA 2DDBA 3KLOA 2EA2A 5HVQC 2Q2EA 4N9HA 2CRGA 1SVMA 1YIJI 1BC7C 2IRFG 1KU9A 2KPMA 3OIOA 4E7HA 1AHDP 4MHGA 4YT5A 1SAXA 2JA8J 1ONVA 3LSIA 4F55A 1APCA 3DM5A 5JT4A 3HHGA 1SR2A 4E70A 4CYCB 2XC7A 4AM3A 2IT0A 4LERA 3F6OA 3I58A 2DA6A 1ETWA 3SYTA 4DGWB 1JPJA 4O6MA 2DQLA 3SXZA 4AIKA 1MMAA 2MLKA 2ISZA 2YU3A 1SFXA 4DQ2A 2KKOA 1O3QA 2HXIA 2ZKZA 5J1YA 3CO6C 4HW0A 3M1CA 4U5FE 2HDWA 2XAUA 3DBRB 3OYCA 1ZGWA 2EPOA 3Q9VA 3WE3A 4V19K 1ZG5A 3ZSUA 2CW8A 1MBHA 2PQ8A 1VQLI 3L1PA 2XKPA 2OJED 1NK2P 3F22A 1QZXA 2AP3A 1JGSA 2O8XA 3JRHA 3E70C 3DWWA 2V7FA 3OR2C 1RC9A 2M45A 1T95A 2RGVA 1DU0A 2STTA 1R58A 2W25A 2VCAA 2YLGA 3VM6A 4CS9C 2ZXOA 2OCCH 2EPFA 2H1LA 2HOTA 1E2XA 3EGDA 3NKEA 1OW6A 1YQAA 4YIFA 3I55I 1K40A 2Z2SB 3JAMK 1PUFB 2W4MA 4NC3A 2AWCA 3RSNA 4Q47A 5LFAA 2QENA 3C8ZA 1O7FA 3DQVC 3OYJA 1DGWY 1U2WA 3CEXA 2HYFA 1A31A 2MYSA 2DA3A 3F0CA 3K7AJ 3TOBA 4EJWA 1M57C 2ZXRA 2MBFA 5L0IA 3AQCA 3ECSA 3GTGJ 3D1NI 5HNFA 4XPWA 2F2EA 2KRFA 4I98B 2F5CA 2V1UA 2NSFA 1XN7A 1J8YF 3OY9A 2YR2A 3PO2J 2PBEA 4EJUA 1M2OA 3ULQB 3EZHA 2W57A 2XPVA 3EUKL 5E3LA 2L9SA 3GUDA 3FIWA 5KAIC 3RQ4A 1Y39A 2CUEA 5COMA 2ZXWH 3I5QA 3QWLA 4ZH4F 1ZZPA 2CWEA 2GBYA 2R7RA 2V79A 2CGPA 3IL2A 1YJNI 1RETA 3RIPA 3T6BA 3ASOC 2CS3A 4GEHA 4U5GA 4JP0A 5K5RA 4XLAA 1GV5A 2IXOA 4A3GJ 1N75A 3FMQA 3WHNA 1FOYA 1QPMA 4M9SA 3SZGA 1SFUA 3AG1C 3K33A 5DLJA 3U2MA 3R60A 2OZUA 3Q0UA 1AKHA 5E17F 1K04A 5ED4A 1R1VA 2P0NA 4JBAA 4YELA 3IQCA 3GXOA 4NNJA 2A07F 1ZHFA 5GP9A 1SD6A 5CVUA 1AWCA 2VOOA 4XRFA 1EA3A 4PJLA 2KSFA 3HTKC 2GAQA 4JK1X 3CLOA 1B9NA 3GLXA 4CHUA 3CCEI 2FX0A 3PL8A 3CDLA 3I5UA 4OD4A 1PJRA 3GANA 4MNDA 3I4PA 4D9JA 2H8AA 2WADA 3ASOH 3M79A 2W48A 5J4YA 1WRJA 1KQ0A 3R6SA 3RZOJ 1BR1A 4CZCA 3KP3A 2L6FA 1B72B 3V7RA 2OU6A 2F5EA 1Q0KA 3QPHA 4DIQA 1MDMA 3AG3C 4O3MA 3K4BA 3GTPJ 3FKJA 2E36A 2L6HA 1QLEC 2BOLA 4UV9A 3FXKA 1H9GA 1LDKB 4AVZA 5F08A 1X3WB 2HJ3A 2FXAA 2Y31A 4ZC3A 4IPAA 3REOA 2VC1A 1BI2A 4MTEA 2Q3TA 4HEAJ 4U9DA 2EIKC 4N4NB 3I53A 3WGIA 2E60A 3E6BA 4M3GA 5DM6F 2XAJA 2YU9J 1K05A 2RREA 4GDFA 3BRJA 2JJ7A 2GAUA 1FIPA 4O6YA 3BG7A 2Z15A 1PUFA 1R5GA 2GOMA 5E1WA 3ZQ7A 2EINC 2XF7A 4OINF 5EF6A 1XGOA 4CS9A 1KYZA 1RPWA 2J0XA 2HU9A 3HOWJ 1A5JA 2HV7A 3NMIA 4K1OA 3DPUA 5L3QA 3AG3H 2NNYA 2XHKA 4WXCA 1Y6DA 3JRBA 2KP6A 2PFBA 2YRFA 2V4JC 1ZAOA 3VSLA 2LD5A 2CH0A 3C7JA 1Y0NA 3ZN0A 3KKBA 2FMYA 1ZG1A 1QRYA 4P55A 4L6RA 4KT5C 3MYFA 1SF8A 3MFKA 1QA6A 2RNGA 5H6RA 3E0JB 1IN5A 1FLIA 2WY8Q 1ON1A 3CLQA 2GWWA 4C3EA 3PQJA 1I50J 1D5VA 1T6SA 1YRNB 3F8FA 4KMUX 1X58A 2KIMA 4CDGA 2D1HA 2QBYB 2DGJA 5J1UA 5C3EJ 3VEPA 2XKOA 1H0MA 4HEA2 1GGQA 2L7AA 3TJ6A 1WGXA 1FOKA 4Q7CA 2PMHA 2A1DD 3JRDA 1B8IB 3A1YA 3EG9B 1WI9A 3S32A 3ZDLA 1ZGAA 2J9WA 5CI8A 5CIVA 2A6HF 4F91B 1KTMA 2KDOA 1EH6A 2C6YA 4DRIB 3K69A 2XPWA 3MVPA 4ON0A 2M2EA 4IO9F 1J59A 1DUXC 3CDIA 2ESNA 2H6CA 3BR5A 3CQZJ 4AX2A 3JW4A 3RCOA 2VT3A 1MJ9A 3KLNA 1S6LA 1B72A 2XL8A 3KP2A 4MEXF 2EILC 3WG9A 4L9TA 1TNTA 1RJ9B 4CIHA 4WGZA 1X1DA 1BR2A 3ZG1A 2OD5A 2WAQN 3GTOJ 5F5FA 2NVUB 3K70C 2X1EA 2E7WA 4F7ZA 2M1BA 3E3VA 2RQPA 1YJGA 3NYMA 4QDLA 3T5XA 2R5YB 4KN4X 1FEXA 2LRDA 2LYCA 2XF5A 2GDCA 1U6HA 4PSXA 2GXBA 5IYDJ 2CG4A 1FOWA 1OYIA 2KT0A 4M9XA 4RAGA 1UAAA 3M3YJ 2LLKA 3T1BA 3GZNB 256BA 3BOQA 2J0WA 2BE5F 2HTJA 3ZCOA 4MVUA 3B0VC 3KCCA 4E17A 4IRHA 4LK0F 3SXMA 2VC0A 2H8RA 2NVTJ 4EKWA 3HKKA 4EMSA 4KC9A 3DD7A 1VMAA 3FVYA 3PO3J 3K1MA 4QWQA 2BL2A 4C9YA 4L5IA 2Y3HA 3BT9A 2A6TA 5FKOA 3OYMA 1PD1A 2YEVA 4GQHA 4OD5A 2E1CA 1E3OC 3W4YA 2PN6A 1YJ9I 4HYEA 1VLTA 1IZMA 2ZMEB 4DW6A 4NCQA 1FSEA 5IY5C 2V6EA 4HDUA 1FFTC 5K5OA 4J30B 3RFYA 1XS9A 1MW7A 5FFXA 3KMIA 4LLEA 1FPQA 3Q7GA 4KBLA 1XMXA 3Q3SA 3H2UA 1KQ9A 3F46A 2MWQA 2JA2A 1YRNA 4KDPA 1I4YA 1ORJA 2HZ8A 2Y30A 2QBYA 1NG1A 1D5YA 1WJEA 4Z9JA 1MIJA 2EIJC 4DNCA 1Z21A 2LKXA 3AG4C 2ZSHB 1ZLJA 2ZB9A 1VQ6I 1AUEA 2ECCA 3G71I 1XGSA 3FBIB 1BZ4A 3EG9A 2FBHA 3S1MJ 1IJWC 1LS1A 4HLYA 4ZDOA 2P6VA 3MN2A 4IJJA 4U0VA 5IY5H 4TV7A 3ZQLA 4ZTJA 2XAGA 2EPMX 4KIBA 2Q9CA 2VKEA 3JRAA 1WFXA 1ON2A 3GM2A 2O5RA 1BM9A 3T4RA 5LRRA 2BYVE 2YUSA 1W36D 2HKOA 1HC8A 2UUHA 1RJ9A 1XGNA 5GPCA 2EIJH 4JX4A 2HFHA 4A5MA 3SXYA 3AG2C 1G2HA 1NBBA 5JLIA 4M71A 3H65A 2JA7J 3FMRA 4RM2A 4C2TA 3S84A 1E3HA 1KNYA 2MH2A 3U5SA 1W5TA 2KGOA 4DVZA 5KK1A 4Z6YA 2R5YA 4RBNA 2WVOA 5FZTA 1R1TA 3KP5A 2OEVA 4PFPA 4WX9A 3IAS2 4HOBA 2IS2A 4HF2A 3F8BA 3LLIA 2OPTA 4B3AA 1RIOH 4XEVA 3RVZA 3MBGA 3JSZA 3H9GA 1HKQA 4MTDA 1VTNC 4NHJA 1LDJA 4LG3A 1C03A 2IP2A 2R4GA 3BPVA 4HQMA 4C2MJ 4CUGA 2PNOA 5CVRA 1Q0MA 2LDUA 4LDRA 3GTKJ 1N25A 5DUKA 2XS1A 5ICFA 1QHGA 3AG2H 4MVOA 4LFUA 2X6OA 2QSFX 4MW3A 1GHCA 3FXLA 4XR6A 1O7LA 2IGMA 2QF7A 3E5QA 2HZDA 4KN7X 4RGUA 4E6KG 2IW5A 4B44A 4YT8A 2IBDA 3KZYA 4HX8A 2F4OB 4HNVA 1KYWA 1RI7A 3KEYA 4AIHA 1YYJA 2Q4FA 3JZ0A 2VIXA 1IDYA 1DPUA 5TJ5E 2XLMA 5A6AA 3S15J 3EHNA 4H4KC 2LK2A 4LJZF 4BJ5A 2D45A 1U89A 2KFDA 4AYBA 4WGYA 2VQHA 5JHUA 4IB4A 4CO8A 3DTIA 4CDAA 1G3TA 3LESA 2A6EF 4F92B 1R9TJ 2D1VA 2IXMA 2EH3A 4AD9A 1OCZH 2L2OA 2BC5A 1SC7A 4JURI 1IAWA 2ICWG 2EZLA 1TWCJ 5H20A 2CJJA 2L54A 2D5RB 3VYUB 4MTOA 5TGTA 3SYNA 2M4KA 4Z9IA 4FESA 1R23A 4M3EA 4KIFA 1ETKA 1A6IA 1SMYF 2B0JA 2FQ4A 1W7PB 2DLLA 5J3LA 1UG7A 4MVSA 1DQUA 5JVGF 4A3EJ 4WJ0A 1O57A 3WTTC 3AL0C 4XTKA 4HRIA 5CKTA 2G7UA 2YX4A 4RAZA 2GIZA 5EEHA 3FHNA 3BEHA 4K0DA 5JVEA 3BDDA 3CC2I 1OR3A 1O3RA 2R7ZJ 1F9NA 1QPIA 5CI9A 3G1MA 3OYIA 1TFOB 2R93J 1IG7A 1OYYA 1UHMA 1UHWA 1X1CA 2MW8A 3CP2A 2AVKA 4HX4A 3GMEA 3AL0B 2XXAB 4I76A 1REPC 4UDVA 1Z67A 2E34A 2I8BA 4P1WA 2YVKA 1TT0A 1F36A 3AAFA 3ZQQA 1YLMA 3M07A 4YT4A 1B6AA 1O3SA 5DS6A 5D6EA 4BGDA 3BJAA 1R49A 1JPNA 1GXQA 2R7QA 2KRHA 2XAFA 2J45A 3S93A 4ESBA 2X48A 3L9FA 4XSZF 4N06A 1ZQ3P 2EFWA 2JPBA 2VJ5A 4GGGA 1YDIA 5ICEA 2QE9A 2ASRA 3ZQFA 4Y52J 2E5NA 2L9NA 2YL7A 4AE4A 3SXKA 1B4AA 3MMYB 2VODA 1QKRA 1IDZA 2RQQA 5A6JA 4N6HA 3ZN1A 3CJRB 1WVRA 4FQGA 1RRJA 2LP0A 5IT9K 2CUZA 3V42A 3JYHA 2H7BA 1MH3A 1OR7C 2CQ7A 4U87A 3JCUQ 4LITA 3LSTA 4PZJA 3DZAA 3JTHA 1VQ4I 1TNSA 4GRIA 2IGKA 3V8JA 4ZYDA 3RZDJ 2AO9A 4L5JA 1FJLA 5FLXZ 4OIOF 4BU2A 5GAEJ 2Y0MA 3BP8A 3BG5A 1IN7A 1WSUA 1LB2A 3KYLA 1U9OA 2UZKA 3I4MJ 1Z7Qc 2DFIA 4P96A 3LSHA 1FY7A 1QZYA 3HRSA 2XUBA 5FROA 3W3CA 2HPMA 3ERMA 3DEWA 3BR1A 4KT6A 3RKYA 1J7KA 4A6DA 4XQFA 1KU7A 5BQIA 5AC4A 1HSJA 3BLYA 1BJAA 1ZHXA 4M63A 2P5LC 2XGCA 2NOGA 3S0XA 1W7PA 1MNMC 1P9QC 3NWTA 3TP3A 5KYNA 2R7XA 1HY5A 3EPZA 4YL3A 1SFKA 2NS7A 3IAM2 1M6TA 5F0HA 3MYIA 4ABZA 5D4RA 3WTVC 1WJCA 2M8EA 3X2QC 4GYGA 1T9KA 2NVXJ 2XLHA 3ABMH 3B6CA 1S7ZA 3ZMZA 5FFZA 5KHDA 2L5QA 3HOUJ 3E6CC 1SD7A 3EDPA 2NRAC 3ASNC 4AL1A 4I0AA 5DTDA 4ZYAA 4GXOA 3IKTA 1POGA 4UUSB 5AIQA 4Z2YA 1RCPA 5DUIA 4DZJA 2BY2A 2EB7A 3HSRA 4LACB 4YWQA 2E1MC 1WWPA 1HXDA 1G3YA 4FASD 4Y17A 4XICA 1FZPB 3K7DA 3DEUA 4IZZA 1PP8F 1AEPA 1MKMA 5K7ZA 2ZJ2A 4Y15A 1Y0UA 4YG2F 5M5YJ 3GTJJ 4KNVA 2LTPA 2E1MB 2LFDA 4R8HA 1GVJA 1T0FC 2MA3A 4OIQF 3X2QH 5LHHA 4JTAB 3DAGA 2W4SA 3IRQA 3EH1A 4J19A 1ZARA 2W4BA 3ASNH 2DJNA 3EYYA 4CGZA 4I1OB 5B1AC 5DD8A 2RD9A 3GF2A 1UJ8A 2LSOA 4IHSA 3PDMP 3O55A 4NTAA 3OA1A 5DM7F 1YX3A 1ZGJA 3LMMA 4JQFA 5J47A 3K4CA 2CCYA 4X0RA 1UMQA 1TFKB 4KMFA 4BE2A 2C03A 1OR7A 5JVTA 1KGSA 3K4NA 2DYRC 4A0XA 1WQ2A 1WH7A 2CQKA 1I5ZA 3T8TA 2LREA 3CTAA 4ER9A 1SFOJ 5EGOB 2K9LA 1MMDA 2M0MA 2QKLB 4UVAA 3US6A 2V1XA 5KVRA 2HOSA 2ELHA 2F5FA 4G6QA 3HYIA 2KIQA 4J7TA 1XZQA 2LF8A 1QQIA 2V9VA 2LVSA 4PGHA 2FRHA 1ZHTA 1E85A 3QZCA 4EWCA 3S90A 4OWRB 2VUMJ 2EFPA 3BQZA 1ITYA 4HV5A 2FMLA 5FCLA 2L9VA 2DTZA 1S29A 1FSHA 1NSGB 2L81A 3PSIA 1MBEA 2OUMA 2DYRH 2V26A 2HKVA 1HE9A 1LNWA 4EUKB 4ZZDA 5L3FA 4NTBA 2BY3A 1GUUA 3OYFA 1YIOA 2X6WA 5KAFC 2J7PD 2XS8A 1R4MB 3GX4X 4AC0A 1IXRC 3JRTA 2WAFA 2Z9OA 3RH3A 1G8XA 3DBLB 2XLVA 4P9TA 4I1MA 4UVBA 2LOOA 2DW4A 1UB9A 3S2WA 1J9IA 1O5HA 2PJRB 2HWVA 4A3JJ 1T56A 1PD0A 2QYOA 1ETYA 3IH4A 1QZZA 2UXNA 2MGQA 4II2A 3V8LA 4FT8A 2E1NA 3F23A 1C0WA 2PP4A 5F64A 4UUSA 3WTSC 4XEFA 2LNBA 4O5VA 2VI6A 2L4AA 4IRGA 4LGWA 5IP9J 1PP7U 2OQMA 4B4CA 4OMZA 2XVCA 1YTYA 1OCRC 2DQRA 5GPGB 4EM0B 2E2IJ 2EZKA 1NTCA 2Z3YA 3QAHA 1U8BA 5DS9A 1ETOA 1CGPA 1HMOA 3GEEA 3U0CA 4DOZA 3MLGA 2KZVA 2IA1A 3OS1A 3NMJA 5GPAA 1SMTA 1ZRDA 5FLVA 2QCOA 1R4NB 1JGGA 1OFCX 3M4OJ 4M6VA 3QU3A 3FX3A 4XN0A 3ZXSA 3LA7A 3JYYA 3GFMA 2KJGA 1SD4A 5K7HA 1S7OA 3U1KA 3U9JA 3ECOA 3EUHC 3FK6A 5J40A 4ESFA 3EFOB 3IPMO 4ZDLA 2ID6A 2QZ8A 3VRCA 3WE2A 1T0FA 2OZ6A 1W4MA 3AOUA 5COGA 1L0OC 3DJUB 1JUPA 3DLAA 2VLAA 1JTXA 1WN0A 3QP6A 3HG9A 2GOXB 2J9UA 2IGOA 1OCRH 1IF1A 5B3SH 2ZD9A 1LQ1A 3CD6I 1XSXA 3FAJA 2DFEA 3TOAA 1W5SA 3H3VK 1STZA 3DLLF 1RKCA 2NUTA 1QU3A 3TDUC 4ZYGA 1HW2A 2P5VA 4G8XA 2TDXA 1TWGA 3IH2A 2OCCC 3HHHA 4UNOA 1W0TA 4G7ZF 5EGOA 1G3SA 4HNUA 2R3SA 4A3KJ 1LVAA 1Y56A 5T3TA 2EV0A 3KIOA 4FISA 3V4GA 2F4MB 3LAPA 3V8KA 1Q0GA 5A2QZ 4DXWA 3QU6A 1MDMB 4BXUA 4CZZA 3DKXA 4LDKA 2P7CB 4EM2A 2G9WA 4CCNA 1E83A 2FNPA 2Q00A 1EA8A 3SP1A 1NU7D 2X0CA 4NC6A 2EV5A 3HSFA 2DYSC 1SANA 1FNNA 5JS5A 1TWHJ 1QZEA 2ZXWC 3O2PE 4P9FA 3L2VA 9ANTA 4IAOA 1E3PA 1IRGA 3D5RC 1OKKA 4AVPA 3K9TA 3BR0A 4XLCA 3F47A 2V6CA 4V2GA 3IV5A 5EGYA 4C3JJ 2NXNB 5IYBJ 2FFHA 1KU3A 1T01A 2IS4A 2MSYA 3FF5A 2CFXA 5F0FA 5IP6A 1FBUA 5F0CA 1K7AA 2HDDA 2PJRA 4PUSA 1P4WA 1NK3P 5DEQA 1QPUA 2WTEA 1T98A 3ZRGA 3MX3A 1ZK8A 2BGCA 1JT0A 1I27A 4BHCA 1SEUA 2FF4A 2ZXJA 3LSJA 3J80Z 2IGNA 4IHTA 3SDGA 1V5FA 4HF1A 1H7IA 3KYIA 2DYSH 4I09A 3SQNA 5GTHC 2HVRA 4UHTA 2HQRA 3KP7A 3NYJA 2V3CC 1G59A 4C2UA 4JX5A 3U2LA 4R1HA 2OF7A 3I71A 1P4XA 3J7AY 2FA5A 3LS0A 5HLHA 1TTYA 2EZIA 4PGGA 1FMVA 2M9HA 3K66A 2M4GA 1IXCA 4MQ9F 2FOWA 2DFHA 2B7EA 2XV4S 4KIGA 1XSVA 2O03A 5DYMA 2G3VA 2JSCA 4BY7J 4BY1J 3OOPA 3EFOA 5KYXA 2MG4A 2V9KA 4ZYHA 3WHBA 5BPIA 1X1BA 3BQYA 2VB6A 4WXHA 1RKEB 1T39A 2MH9A 2QQ8A 3R4KA 1DP3A 4CSAC 3EUHA 3GYHX 4A0ZA 1PYVA 4E7IA 5FRNA 2OA4A 3EJNA 3GCMA 2F5DA 2W82A 1SD5A 2AQFA 2KHMA 2H27A 4IEJA 1X1PA 2CMPA 2EWNA 1M56C 4I02A 2B63J 2VJJA 5E8IA 3HC7A 5D5VB 2LKSA 2UXXA 5LHIA 3CC4I 3CUQC 3DWLE 1JKPC 1LPEA 1KA8A 4KA4A 2XM0A 1A7EA 2EPLX 5DS4A 5LEJA 2Y3GA 3N24A 1TC3C 4CDYA 2CW0F 1DGRM 1W36C 1GS9A 1Z23A 2VBXA 3WGHA 1D8KA 3CUQB 2DI3A 2JPCA 5JHFA 1MSEC 2CV1A 2NS0A 3TW7A 4KITB 3BCAA 3CMAI 1OKKD 2LFFA 2YZSA 4IF4A 5CVJA 3BC8A 2LP4A 1R71A 1QNTA 1HLVA 1ZLKA 4OOIA 5D6FA 4MFDA 4M3BA 1HKTA 4RB0A 2L0KA 1V3FA 4OU0A 5EZHA 5LEKA 2A61A 3VOEA 3CMEI 3CCJI 3H2VA 4PCQA 4IVNA 3DKWA 4OAYA 2KDZA 3S3OA 4BDYA 1BJZA 2VBWA 3P5JA 4HNTA 5L0DA 3F3XA 1IW7F 4K2EA 1XSDA 2CQQA 4KICA 3CCMI 1UFBA 2G7HA 2QVOA 5GTIC 3VF0A 3TQNA 3K6BA 1V5EA 1T33A 2KJBA 2KL4A 1FP2A 4A12A 2CDQA 3IQ5A 3HSEA 3DKYA 2KMUA 2YKZA 4G6DA 4MNUA 2D5VA 1Z1DA 2PEXA 2G3KA 3L2QA 3WTYC 1ZU4A 4LD5A 4A0YA 4KISA 5T3WA 4R32A 3A2KA 1NZEA 5EJCA 3TL4X 4JRZA 5D4SA 2PX0A 4AYBN 4AIDA 4JTCB 2WB7A 4JW1A 1O3UA 4CX9A 1TQIA 3COAC 2STWA 1S05A 5L3BA 2KNHA 4B48A 1I6XA 2RC4A 1OQYA 4BL0B 2CYYA 2E1OA 3BR6A 4A2NB 4YL0A 4L0ZB 1LPQA 1WJAA 3A4CA 1YG2A 3MKYB 3EYIA 5AC5A 2X6YA 3CF2A 1LIHA 3HUGB 1Z05A 4IHVA 2ZXPA 3M4CA 2IJLA 2N8GA 1VK5A 2XSDC 2XL6A 2HI3A 4J32B 3HOYJ 3OYDA 5K7FA 2OV7A 2O0YA 2Z1DA 1RKEA 4BAYA 2GFHA 3KYJA 4XKBA 3PNYA 4FE7A 2FGYA 2V1NA 3NRVA 2XRNA 3I4NJ 4DBRA 1R4TA 3TEDA 1BDJB 4BH9A 1WJDA 4M3FA 4Y7NJ 4ZZLA 4WK8F 2KIUA 5JI6A 3QODA 2CV2A 3C2GA 5JRAA 3HJCA 1D8JA 2BXZA 1SYQA 4O6NA 4G78A 4LLLA 4JCZA 1DPRA 2X51A 4GYIA 3F9KA 3BTIA 3K4MA 4CSAA 2CQXA 2R7DA 1ERDA 1YAUO 2B0HA 1I5NA 1BI1A 3UMHA 1XCBA 3OS2A 2QSHX 1Z5ZA 2EFOA 3LFUA 2B9SA 1R7JA 1MGTA 3DI5A 3KPHA 1ZELA 2ZJPF 1HE1A 3EGXB 4AL0A 2AXLA 3E6MA 2M64A 4WABA 3IRRA 4KYWA 3CUQA 2DPUA 2DCEA 3N05A 5E20A 2JK3A 1CGME 4UB8C 4JYKA 5CVIA 2GLOA 2GA0A 2QY9A 3LNMB 4XLPF 3DFGA 1ZHWA 3NRHA 4BDZA 3IWFA 3K1NA 4O6JA 5K5QA 3K4JA 2BVLA 5CPRB 5L0JA 5E3AA 1LFBA 2HPIA 3PIPF 3RQIA 1V55H 4U88A 3LNQA 1OW8A 5HDGA 3ML6A 1JKRC 2H6BA 3OYLA 3LJBA 3WTUC 4L9NA 5LBQA 2Q7RA 2R7SA 1JHHA 2COMA 3A03A 1GVDA 3C1DA 3CZ6A 3ZOBA 2DK8A 1FNTc 1Y8RB 2CU7A 2FE3A 1FT9A 4I0BA 2XLEA 4H0EA 4BKXA 3KP4A 4HBLA 2KYHA 1SFEA 3H0DA 3I3LA 4OIRF 4ENKA 2LF7A 5EEAA 5ILVA 1W5CC 4IKFA 4Y3OA 4A4AA 1D1BA 2JMWA 4FHTA 4BJ5C 5D5WB 1T2KA 2IBFA 4D4XA 1HBXG 4EATA 2L7ZA 1OCPA 4JOMA 2KRCA 2QM3A 5FD5A 2ME6A 2DMNA 2IA2A 3O6BB 3LSKA 3PQKA 1F4KA 3QMKA 5ICCA 1ORSC 3DTKA 2R5ZB 2LSEA 3ZMVA 4IWBA 2GWRA 3OYBA 1R1UA 2AHQA 4MVZA 1Z6RA 1EV7A 3TKYA 2OJQA 2J8WA 2OOCA 1MH4A 2P4WA 3BZKA 3HUGA 5M5XJ 1EH8A 1G6NA 5CJ9A 5HOOA 5E79C 3CCSI 3GODA 3V7CA 3NMKA 1JE8A 2LBFB 5BMZA 4EM1A 2PMUA 3LAJA 1JOGA 3S28A 3A0BC 1XZPA 4YFKF 3EUAA 3DCFA 3FXRA 3M1EA 1FWZA 3RI4A 4GCVA 5BQHA 3ZTZA 5CQEA 1VQ8I 4A3IJ 4ENMA 3CO7C 1YE9A 1HCRA 1U0JA 4BQOA 3U2RA 4MTFA 2X85A 1K4TA 1IN8A 4II3A 4U9EA 1LJ9A 3C63A 1GQAA 4PJMA 4U7BA 4LMYA 5HS7A 4BBRJ 4V2FA 2O3FA 1J75A 2R03A 2CUJA 4W97A 4LIUA 1IO2A 1YI2I 1K83J 2WBMA 4ENJA 1RR8C 3EGXA 4QTRA 1GT0C 2NUPB 4NTFA 1T5OA 2A05A 2L7FP 3K4KA 4EGZA 4UV8A 3SFZA 1YHQI 1OR2A 1WTYA 3HKZN 3FDQA 2KIFA 3M8FA 5BUOA 2K85A 2YQYA 3L2RA 1TP4A 3L8IA 4UVCA 1Z77A 1ZKGA 2RNJA 4CXFA 2D4UA 4UUTA 1A7VA 1YYXA 4DJAA 4FAPB 1BW6A 2JN6A 1KZHA 3ZR8X 2DA7A 4EBBA 2GA2A 4D1QA 4BQQA 1WJ5A 4HG2A 4ZJZA 3VWBA 4RB3C 4D7MA 3MCZA 4AE4B 2EFNA 2HGCA 2FOKA 1MD0A 3CJTB 3GZ5A 2EJRA 3LOCA 4E7JA 3GWNA 4DYRA 1LM3B 3RPUA 4RB2C 3E5XA 2XB0X 3P9KA 1LDDA 2V1DA 2AU5A 4N6CA 4YK5A 4DRHB 5L0FA 2ZNYA 3AFHA 4E18A 2JVGA 1EI7A 1S72I 1OCZC 2Z33A 2BVMA 1Z6TA 1ENHA 2J5PA 3HGYA 1FTZA 1D1CA 1B9MA 4XRMA 3S3MA 3FDYA 1J5YA 3RTRA 5KYWB 5DCFA 1WI3A 1LE8B 3GEIA 4KFCA 2P61A 2QSGX 3VPRA 2C04A 3FWEA 5DQTA 1UELB 5BQGA 2PX9A 4OAZA 1QSPA 4J01A 3E5UA 3RYPA 1QVXA 2R5ZA 3G3ZA 3MKLA 1ZREA 4U0YA 1BI0A 3BCBA 4ONSA 2TMVP 5LLQA 4HFKB 1Q0DA 4N4WA 1VQ9I 3TMOA 2JA6J 1ETQA 2ACJA 2VXZA 3LFKA 1D1AA 4XLEA 2JA5J 4XPYA 4ULVA 1WH5A 2HFIA 2DXIA 4YL1A 4L9VA 1H8AC 4KNYA 3PJRA 4JE9A 2LBFA 1A35A 2MLGA 2VKVA 5FGMA 1LE4A 2EQRA 2ZXIA 2GXGA 3BG9A 4OIPF 3B0PA 4BQAA 1I1GA 2W24A 4BNCA 3G1OA 1IRZA 3KE2A 2VT2A 4CH7A 4MO7A 4EJVA 3CF5F 2XL4A 2ETSA 4XWJA 5A6KA 3PNTA 5E1XA 3GBGA 1APLC 1LI5A 1U5TC 3CCLI 3O10A 1XMKA 3W8HA 3U8VA 1I39A 4KJZA 1JTYA 1OYWA 2DO7A 1EQ1A 3JTLO 5J1RA 3TW6A 3WGGA 2V9PA 3MQ0A 4Y33A 1A04A 1U5TB 3L09A 5BOXA 1ZR4A 2HMQA 2NUPA 2XSJC 3HDDA 2IAIA 3HM5A 3PSFA 1GV2A 3ABKC 2VJ4A 2HOEA 3FAPB 2FNAA 1V4AA 4QLCU 4EBKA 2KZGA 3GWZA 4HV6A 1X3ZB 2IPQX 5FLXK 1MSFC 2DMPA 2K9QA 3ZMSA 5E3CA 4L0YB 3HNJA 2E19A 3RPUD 1IGNA 4MS2A 3X1OA 3UNGC 4CYDA 2F22A 3W6JB 4RB1A 1TR2A 2CUFA 2K40A 3FOOA 1XC5A 3SEOA 2HNHA 5H2FC 4E7ZA 4E7LA 5LGUA 1ZHZA 5F28E 3KYDB 3GWLA 5EK0A 2NAZA 1S7AA 3ZP5A 3JR9A 2ZJRF 2NS8A 4P6IC 1I3AA 4IRIA 1VQ7I 2R7WA 3RKOF 4BEJA 1OCTC 1RESA 3ABKH 4IRUA 5D92A 3ISPA 4AU7A 4Q48A 2K3FA 1HDPA 3P9IA 3O3KA 1VQOI 2VONA 2YLIA 1TT5B 3JRGA 3DU5A 1V4RA 4HA8A
chains in the Genus database with same CATH topology
5AONA 4I7HA 3BZ6A 4KUMA 4LLGF 5DD4A 5EEGA 1H9TA 3J81Z 2NNNA 2PG4A 4S04A 2QWWA 2QUFA 3GEZA 5J8FA 1FYLA 2M30A 3MEXA 1ZN2A 2QQ9A 1K6OA 2RKHA 2YPRA 1BIAA 3QPTA 2OQRA 2RV8A 1OPCA 5TJJA 1XD7A 2GQQA 1U5TA 3WTXC 3KZZA 4LG0B 2E7XA 5HLIA 3FHZA 2WWYA 1BC8C 2ADUA 2ZCWA 2PLYA 4Q5SF 1RUOA 4YFXF 2VE8A 5E1ZB 1G4DA 1QBJA 1R5HA 1FX7A 1HW1A 4WXDA 1FYMA 1YW7A 2DAOA 1ULYA 2VBYA 3MZYA 2GIVA 2P8TA 4HLXA 2VE9A 3HIFA 4B8XA 1PUEE 2RDPA 3Q5FA 4UUVA 1QO0D 4P9UA 3BROA 5BQTA 4ZYEA 2L02A 3WTWC 4MGRA 2P6TA 4LB5A 3FXQA 3U1DA 3GVAA 5F6FA 1IZ1A 4RS8A 5FO5A 3KETA 3HRMA 1TW2A 2O6GE 5E18F 2HZTA 3I59A 5HS8A 1IUYA 4FX0A 4YIIA 3FZVA 4L9JA 3ZMUA 5J6XA 3LA2A 1ZRCA 2DT5A 5AIPA 2K27A 4LG0A 2W85A 5LGNA 1RZ4A 2BBYA 2EFQA 3DPLC 3DV8A 3MWMA 1HSTA 4Q4ZF 3HOTA 1B59A 1BBYA 3RPQA 5BS6A 5HDKA 3M8EA 1JHFA 4HQEA 5DCMB 5ICGA 1UFMA 5A2QK 5IT3A 3I0TA 1B1BA 4R79A 3F6VA 3RJPA 4G7OF 1P92A 3H3ZA 3DXJF 3LQQA 3LQRA 1YW9A 1ODDA 3KFWX 2MC3A 2ISYA 3JSPA 1P6RA 4A6EA 4BHBA 3J80K 2HKXA 3JTGA 4HDVA 6PAXA 1IN4A 3ZPLA 3BJ6A 3BPXA 3C3WA 2W84A 2X0LA 1OMIA 1R36A 2LKPA 3OV8A 3F8NA 3F21A 4NQWA 1HW5A 4FX4A 3KEOA 4HZFA 1E17A 4BHPA 1ZYRF 2HS5A 3GFIA 2EK5A 1AOYA 4XSXF 5DCMA 5L3GA 1KU2A 2P5KA 3WTZA 2VBZA 3TDZC 4IJAA 3FMSA 1XCVA 3I64A 3HRUA 3HOSA 1R22A 4MQVA 3RYRA 3HRTA 2O61A 2YX7A 4A2UA 3QRFF 4D0PA 3J7AO 2DPDA 3KP6A 2A5YB 4ETSA 3HTSB 1MJAA 3JAMZ 5L3CA 1RUNA 5CLSA 3GO5A 3IKVA 2DTRA 3L7WA 1Q1HA 5LGTA 2Y75A 1Z7UA 2MD5A 1P2FA 2Z99A 4WCGA 1I1SA 3BY6A 1ZH5A 1F1ZA 3PFIA 3QP5A 3GFLA 2XGXA 1YW8A 3GZ6A 2BEOA 4L18B 2ZBKA 1MJBA 2KJCA 1HKSA 1K78B 2K02A 2ZFWA 1IXSB 4ESJA 4N0BA 3H92A 4IXAA 1R00A 2HQNA 4HX7A 2PJPA 4EVIA 2AS5F 3CUOA 4P5OA 3N4MA 1LEAA 1EH7A 2BV6A 2H94A 2RVCA 2ZNZA 1D3YA 5ILSA 2M87A 4RAYA 2OBPA 2XAHA 1J0RA 1F5TA 5L3DA 3EETA 1FBQA 3Q9SA 5DV5A 2R7FA 4WWCA 3KEQA 2A68F 2IVMA 2P6SA 4OMYA 1XMAA 1YFHA 3RKWA 2ETHA 4EJOA 2HR3A 1TW3A 3RDIA 1USSA 5F1RA 3BWGA 3GW2A 3K1PA 1BIBA 3MAJA 5HLGA 2DU9A 4YFNF 3R0AA 1K78A 4M74A 1U8RA 1U6GA 2Y48A 2VOPA 2YSRA 5JFRA 2CSOA 5FB2A 1Z91A 2L3DA 2FSWA 3EQLF 1FBSA 2J5OA 4M6XA 5L3EA 5D5UB 3RKXA 3G73A 5ILUA 1BI3A 1QGPA 1YS7A 1YO5C 1RNLA 1TBXA 2PBIA 3ZMDA 3H3UA 1PDNC 2A69F 1XB4A 2P7VB 3F72A 5H6QA 1YS6A 1J2XA 2EA4A 4Y13A 3ZMTA 4ENNA 3QOPA 5J8CA 3I54A 5D8LB 2HYGD 3SZPA 1TQMA 1Z9CA 2DBBA 1YLFA 4AIJA 3TO9A 3DP7A 1S3JA 2QQBA 1YYVA 5ERIA 3VODA 2JZYA 4NB5A 4RGSA 1USTA 3VB2A 3TGNA 2WV0A 1ZRFA 4U7DA 3SHFA 1FC3A 3MZHA 2ZMEA 3P7NA 4LB6B 3ERED 1BOAA 2K4BA 3ELKA 4RGRA 2GA1A 5DDGA 3B02A 2FBIA 5D5XB 1X3UA 1O3TA 4EV0A 4AWXB 3F8CA 1HQCA 1DP7P 4CICA 2EV6A 1FYKA 1FP1D 3D5LA 3K2ZA 3BJOA 4RGXA 3VFZA 3J81K 2K86A 1CF7B 3L2CA 1K79A 2QQAA 2CO5A 3IHUA 2XROA 1L3LA 1LEBA 4M9ZA 2HEOA 3M9AA 3JSOA 3P9CA 2NYXA 1JXSA 2IA0A 2H09A 2FQ3A 2XAQA 4HAMA 3D0SA 4N9IA 3E6DA 2L4MA 1WWXA 2PI0A 2UWMA 1ZG3A 2M5WA 3E97A 3ABTA 3R0JA 3T0YA 4B09A 4EGYA 4XLNF 1XGMA 4LK1F 3GFJA 4BYYA 2A3SA 2FBKA 4PDKA 3WU1B 1S8NA 2GZWA 2JT1A 3RIRA 5D8KB 4UXNA 3I59B 5HDNA 3U9GA 3FM5A 3SZTA 2K7LA 2Z5UA 5E8GA 2X4HA 1OKRA 5BPDA 3N97A 1DDNA 3L00A 4LLNA 2WC2A 1TLHB 5K1YA 3NEUA 5IT9Z 4M6YA 5HS9A 2B0LA 3F8MA 3WU0A 5FD6A 3TO6A 1CF7A 3V7SA 2FEZA 3CDHA 1KQ8A 2OU2A 3ECHA 5LRSA 5JR3A 4G9YA 2QLZA 3DPTA 3LA3A 3C18A 1P4AA 3DF8A 2Q0OA 1BN5A 1IN6A 2OQGA 1NHAA 3M7GA 3CJNA 1MZBA 2OAZA 1GXPA 4A5NA 2XASA 3LWFA 1U3EM 2D2WA 3ROUA 2RN7A 4HF0A 4I01A 5CYVA 1U78A 4I2OA 2VN2A 4ASNA 5CVVA 1W7PD 2L01A 1WKMA 3K0LA 4U0WA 5TRDA 4EJTA 4S05A 2HTSA 1IRFA 3W6KB 4G94A 3T8RA 2JTVA 3B73A 1XDUA 4G7HF 2JRTA 1UCRA 4M73A 3TO7A 4GO1A 4WF2A 2HDCA 3R61A 3HTUA 3NQOA 4M72A 2DK5A 4XBFA 1XDSA 2K4JA 1G3WA 2XIGA 3WODF 2ZO4A 2FU4A 3ABUA 5LHGA 1T38A 3IC7A 4EQQA 1TQPA 2ESHA 3FM3A 2Q8KA 3IWZA 3FXUA 4MEYF 3KLOA 2EA2A 5HVQC 2Q2EA 4N9HA 1BC7C 2IRFG 1KU9A 4MHGA 1SAXA 1ONVA 3HHGA 4E70A 2IT0A 3F6OA 3I58A 3SXZA 2DQLA 4AIKA 2MLKA 2ISZA 2YU3A 1SFXA 4DQ2A 2KKOA 1O3QA 2ZKZA 3CO6C 4HW0A 3Q9VA 3WE3A 1ZG5A 2PQ8A 2XKPA 3F22A 1JGSA 2O8XA 2M45A 2RGVA 2STTA 1R58A 2W25A 1E2XA 1YQAA 4YIFA 3JAMK 4Q47A 2QENA 1O7FA 3DQVC 1U2WA 2HYFA 3TOBA 4EJWA 2MBFA 2F2EA 2KRFA 4I98B 2F5CA 2V1UA 1XN7A 2YR2A 4EJUA 3ULQB 2W57A 3GUDA 4ZH4F 2CWEA 2CGPA 2V79A 3IL2A 5K5RA 3FMQA 1QPMA 4M9SA 1SFUA 3R60A 2OZUA 5E17F 5ED4A 1R1VA 4JBAA 3GXOA 2A07F 1ZHFA 1SD6A 5CVUA 1AWCA 2VOOA 4XRFA 4JK1X 3CLOA 1B9NA 3GLXA 4CHUA 3I5UA 3I4PA 1WRJA 1KQ0A 3R6SA 3KP3A 3V7RA 2F5EA 3QPHA 1MDMA 4O3MA 4UV9A 1H9GA 1LDKB 2FXAA 4IPAA 3REOA 2VC1A 1BI2A 4MTEA 3I53A 3WGIA 3E6BA 2XAJA 2GAUA 1R5GA 5E1WA 3ZQ7A 4OINF 1XGOA 1KYZA 2NNYA 2XHKA 4WXCA 2PFBA 1ZAOA 3C7JA 3ZN0A 2FMYA 1ZG1A 4P55A 4KT5C 3MFKA 5H6RA 1IN5A 1FLIA 1ON1A 3PQJA 1D5VA 1T6SA 3F8FA 4KMUX 2KIMA 2QBYB 4CDGA 2D1HA 3VEPA 2XKOA 1H0MA 1FOKA 2PMHA 1WI9A 1ZGAA 2A6HF 2C6YA 1EH6A 3K69A 4ON0A 1J59A 1DUXC 2ESNA 2H6CA 3JW4A 2VT3A 1MJ9A 3KLNA 1S6LA 3KP2A 4MEXF 3WG9A 4L9TA 1TNTA 2OD5A 2E7WA 4F7ZA 2M1BA 3E3VA 2RQPA 3T5XA 4KN4X 2GXBA 2CG4A 1OYIA 4M9XA 3T1BA 3BOQA 2BE5F 2HTJA 3KCCA 4IRHA 4LK0F 3SXMA 2VC0A 4EMSA 3K1MA 4QWQA 4L5IA 2E1CA 2PN6A 4HYEA 2ZMEB 1FSEA 4HDUA 5K5OA 5FFXA 1FPQA 1KQ9A 4KDPA 2QBYA 4DNCA 1ZLJA 1XGSA 2FBHA 4HLYA 4U0VA 4TV7A 2XAGA 4KIBA 1ON2A 1BM9A 5LRRA 2BYVE 2HKOA 1XGNA 2HFHA 4A5MA 3SXYA 4M71A 3FMRA 2MH2A 1W5TA 5KK1A 1R1TA 3KP5A 4WX9A 4HOBA 4HF2A 3F8BA 1RIOH 1VTNC 1HKQA 4MTDA 4NHJA 1LDJA 2IP2A 3BPVA 4HQMA 5CVRA 2LDUA 5DUKA 5ICFA 4LFUA 1GHCA 1O7LA 3E5QA 4RGUA 4KN7X 2IW5A 3KZYA 4HX8A 1KYWA 1RI7A 4AIHA 1DPUA 4LJZF 2D45A 5JHUA 4CO8A 1G3TA 2A6EF 2D1VA 4AD9A 1IAWA 5H20A 2L54A 1R23A 4KIFA 1SMYF 1W7PB 2DLLA