3SXYA

Metal-free full-length structure of tm0439, a metal-binding fcd family transcriptional regulator
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
201
structure length
201
Chain Sequence
RTKVYNLLKEMILNHELKLGEKLNVRELSEKLGISFTPVRDALLQLATEGLVKVVPRVGFFVTDVDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVEKSAKREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-free full-length structure of Tm0439, a metal-binding FCD family transcriptional regulator
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, GntR family
total genus 83
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3sxyA01
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxyA02
1MJ9A 1UCRA 1W5SA 1G4DA 1IN7A 1XGOA 2UZKA 1I5ZA 3B73A 1KYZA 4M9SA 4Y13A 4ESFA 2WWYA 4BQAA 1SFEA 4ZZLA 4EJTA 3WTTC 1SD6A 4XLNF 3ABUA 3GFMA 3ZPLA 1ZRFA 2NS0A 4FX4A 3BPVA 2JTVA 1LEAA 1FBQA 3I4PA 2E7XA 1X3UA 3ISPA 2AXLA 4KUMA 2FOKA 3DP7A 2DQLA 5HS9A 5D8KB 3DPTA 3HYIA 2F5EA 1IXSB 3GFLA 3KLNA 4IRHA 4I2OA 2ISYA 2VBWA 5KVRA 5L3GA 2OBPA 1LEBA 1TW3A 5JFRA 2QQ9A 1L0OC 4U7DA 3RI4A 4P55A 2CQKA 3GUDA 5J8CA 3RYPA 2QZ8A 3RKWA 2MH9A 5HOOA 3SXZA 2XV4S 2M87A 4A0XA 4O6JA 2FU4A 5TJJA 3TDZC 3CO7C 2HDCA 2QQAA 2Y75A 5ED4A 2KJCA 1CF7B 1I1GA 4GYGA 2NNNA 4LFUA 4HYEA 1BI3A 1XSVA 3ZN0A 5D6EA 3WODF 2CGPA 3HRSA 3QPTA 3EQLF 1BC7C 2BYVE 3TOAA 2MLGA 2Z99A 1P4WA 2DPUA 2COMA 5E1WA 1R00A 3I59B 1KQ0A 5E18F 5H20A 2OU2A 2ZXJA 3O6BB 4EVIA 1HQCA 4FHTA 5HVQC 4DQ2A 4JK1X 4R1HA 4HV5A 1SMTA 5DD8A 6PAXA 3EUHA 3SZPA 4A2UA 2DO7A 4UNOA 2H6BA 1EH6A 4EQQA 2HZTA 2P7VB 3B02A 1P4XA 4ASNA 1FYLA 2FEZA 1ZRCA 2P5VA 3I59A 5D5UB 5FFZA 4WXCA 1IRFA 4LB5A 1HKTA 3RIRA 4U88A 2P5KA 2BV6A 2W85A 4AIJA 1C0WA 2LKPA 2KIUA 2HTJA 2J5PA 3CLOA 5ICGA 1FYMA 2IA2A 4UXNA 4UHTA 3MQ0A 3JTHA 5LGUA 2XAGA 5JVTA 1T0FA 2FBKA 4MTDA 4MEYF 5E1XA 1XSXA 4EV0A 1A04A 1O7FA 3I0TA 4KDPA 2DK5A 2P6TA 3E6MA 2Q2EA 3DEUA 3ZMZA 4MNUA 1OYIA 2F5DA 3WG9A 3HRTA 2WTEA 2Q8KA 1WKMA 3CJNA 3RPUA 4XLPF 3WU1B 1QPMA 2XIGA 4LK1F 4RGSA 3E5XA 3DV8A 1R36A 1Z05A 2MD5A 4HDVA 1TQPA 2LDUA 1Y0UA 3EYIA 4ZYDA 4WWCA 2P8TA 3FWEA 2XGXA 4L9JA 2PMHA 3FXRA 2GXGA 1BI1A 3L9FA 1F1ZA 4NHJA 3MWMA 4L5JA 2HS5A 2HKOA 3IKVA 2A6HF 1J5YA 3TDUC 5ILVA 1CGPA 4HZFA 5ICFA 1BN5A 3HSEA 3HSRA 2HQRA 1XDUA 3DFGA 5HLHA 5HLGA 5LRSA 1GXPA 2UWMA 5LBQA 2EFOA 3L2CA 5DDGA 4ZYHA 1J59A 1LDKB 2L4AA 2CG4A 1FX7A 2HGCA 1IW7F 2M45A 3I53A 1SD4A 5E8IA 1MJBA 1QZYA 2DT5A 3PQJA 5IT3A 3LQRA 5ICEA 1RUOA 1YW9A 1RIOH 5L3BA 4G6DA 2O3FA 1YTYA 4F7ZA 1SMYF 3CUQC 3IWFA 3DQVC 3RJPA 3L09A 2OA4A 2R3SA 4EJWA 2TDXA 4AWXB 4HLXA 3P9KA 4A0YA 4CYDA 5L3DA 2QWWA 4A5NA 2Y0MA 2MH2A 3BROA 3G3ZA 1D5VA 4I01A 3ELKA 3HOTA 1TQIA 3M8FA 2OD5A 2VE8A 1XN7A 4CICA 3V4GA 2L01A 5ILSA 3G73A 1AWCA 4UVBA 5J8FA 5CVJA 1ZGJA 1OR7A 2KKOA 1T2KA 3I64A 1HW1A 2XAFA 3VB2A 3BZ6A 1BOAA 5EEGA 3WTVC 2BGCA 2A69F 2FBHA 4EGZA 4HQEA 3L00A 3IC7A 3K2ZA 1OYWA 4RB3C 2YU3A 3F22A 2ZFWA 1O3QA 2HKXA 4Q47A 1I27A 3HIFA 1YS7A 4QWQA 3F8NA 2CWEA 3LAPA 4FX0A 1WI9A 4FT8A 3Q5FA 2CSOA 1Z91A 4YFNF 1G6NA 4OMZA 2VC0A 5LGNA 1REPC 3FMQA 4HLYA 2FQ3A 3DPLC 3RPQA 1USSA 1XMAA 3K0LA 1V3FA 2PI0A 1O3TA 1RZ4A 3HTSB 5JI6A 4YFXF 4BXUA 5DCMA 3GLXA 3GFIA 3V8LA 1MGTA 1K78A 2FXAA 4HX8A 3NQOA 3V8KA 4WF2A 3GFJA 4OMYA 3VFZA 1U3EM 4HQMA 1U5TC 3TO9A 3SXKA 2OQRA 1S7OA 1DP7P 4P5OA 1O7LA 2LSOA 5KK1A 1LQ1A 4KT5C 2JZYA 4P9UA 1BI2A 2VBXA 1XGMA 1BI0A 4L0ZB 1MDMA 3COAC 1YG2A 1FYKA 2VT3A 3BOQA 2ESHA 3LAJA 4ESJA 1S3JA 5L3CA 2EB7A 5LHHA 1U2WA 2V1XA 2IVMA 3JAMZ 1ONVA 2M30A 2D1HA 3AAFA 4M9ZA 2VBZA 3KE2A 3F21A 1FC3A 3QRFF 3K1PA 2O8XA 4Y17A 3MZHA 1H0MA 3KEOA 1BBYA 2QLZA 3V7CA 2BEOA 3EETA 3F8MA 4BHBA 1STZA 3V8JA 3MCZA 2P5LC 2B0LA 4BHCA 3FZVA 3WTUC 3GZ5A 3VEPA 2LNBA 2E7WA 1IF1A 1U5TB 1WSUA 1FNNA 3HOSA 1KA8A 2NRAC 3EYYA 1LDDA 3KCCA 4I02A 3WGGA 4ZH4F 2IPQX 3QPHA 3HRMA 2VOPA 3GW2A 5AONA 4L9TA 2X4HA 1SFXA 2IA1A 2F2EA 3LA2A 4AIHA 1MJAA 3R60A 2DFIA 3IRQA 3W6KB 3JW4A 1G3YA 4P96A 3WTZA 1OPCA 2IW5A 1ZRDA 3EDPA 3SQNA 4CZZA 1YQAA 2WC2A 1B1BA 3I54A 2HWVA 4RS8A 1JHFA 1F9NA 4BYYA 4LGWA 1E2XA 2VBYA 1J9IA 1FBUA 1R5HA 1FPQA 4M72A 4XRFA 4TV7A 1SD5A 3F8BA 4HAMA 1TTYA 2XAJA 3M7GA 4IF4A 2HOEA 2FF4A 3R0AA 4A12A 2GXBA 1P6RA 4EGYA 1U8RA 2GQQA 3ZQ7A 1T38A 4LJZF 4HOBA 4P9FA 3U9GA 2F5CA 1K78B 3GO5A 3WU0A 4PGHA 3KP3A 2D45A 3ERED 4OIOF 3FM3A 2RQPA 2L02A 3J7AO 1ZLJA 2QVOA 4ZZDA 5FLXZ 4EJUA 2CO5A 5BMZA 1FP1D 4LB6B 4HDUA 1BIAA 4ENJA 1R23A 3GF2A 1KU3A 2EA4A 3E5UA 5LGTA 5BPIA 5F1RA 1MDMB 2EV6A 2EFWA 2CYYA 4HBLA 1UHWA 1BJAA 1XDSA 4U7BA 1SD7A 3BJAA 2PG4A 3GWZA 1YS6A 3ZMVA 3I5UA 3MZYA 1GHCA 5HDGA 1ZREA 1JGSA 1IUYA 3CUQB 2L54A 2W84A 1FSEA 5L3FA 1MKMA 2ZO4A 1G3SA 2W24A 4K2EA 3J81Z 3ZMSA 4LG0A 3SHFA 1XSDA 3N4MA 4RB2C 4OU0A 5HS8A 3HHGA 3TKYA 1IAWA 4M74A 2K4BA 3LQQA 2STTA 4A6EA 4YIIA 4LD5A 1CF7A 4KFCA 3TO6A 3WTWC 4GCVA 4YG2F 4HX4A 4OOIA 4DNCA 4LG0B 1QZZA 1ZG3A 2NNYA 1ZLKA 3R0JA 1B9NA 2OAZA 2QQBA 4N9HA 2RKHA 2ZMEA 1F4KA 5D6FA 3KP4A 4BH9A 3J81K 4GO1A 1OMIA 3GX4X 2GZWA 3T1BA 2GA1A 3F8CA 4O5VA 3O3KA 4ENKA 2UXNA 3FXQA 2V6CA 2NAZA 4ZYGA 4YFKF 2YR2A 3E6CC 1U78A 2EFNA 4BAYA 4OIPF 2Q0OA 1O3RA 2K7LA 2A61A 5D4SA 4L5IA 3SZTA 3BJ6A 3KETA 3ZMDA 1VTNC 1P92A 2UXXA 4XSZF 4QLCU 4LLNA 4I0AA 2EFPA 4HV6A 3ROUA 1O57A 4HX7A 3LFKA 2Z5UA 5LLQA 4KMUX 2XROA 5AIPA 3ML6A 2KIMA 3E3VA 5ERIA 4OINF 4PDKA 3H3ZA 1OKRA 3O2PE 2KJBA 2OZUA 3J80Z 4LMYA 2H27A 2FBIA 3RKXA 3PQKA 3GEZA 4IRIA 1FBSA 4RAYA 3E5QA 1HKQA 4MQ9F 4IRGA 1KYWA 4EM0B 1ON1A 3E6DA 1E17A 5CJ9A 3K1NA 5D8LB 4CO8A 3OV8A 2JSCA 2FMLA 4A6DA 4MEXF 1BM9A 4PZJA 4L0YB 2VE9A 5DUKA 3R4KA 1TNTA 2A07F 2ZNYA 3CO6C 2XKPA 4S04A 1GVJA 2QENA 4G9YA 2EV0A 3M1EA 1R22A 4IXAA 3ZMTA 5ILUA 4U0YA 3F23A 4Q5SF 2O0YA 1RI7A 5H6QA 1D8KA 3KZYA 3QP5A 3F72A 4NQWA 3Q9VA 2F5FA 2ESNA 3T8TA 5E8GA 1QBJA 3BPXA 1WQ2A 4KNYA 4L9NA 4KA4A 2K4JA 1UHMA 3VODA 4RAZA 5CVUA 1ZAOA 5HLIA 2HYGD 1W4MA 3H3UA 3T8RA 1Z1DA 3K1MA 2PEXA 4MHGA 2ZJ2A 5H6RA 2V9VA 4HW0A 1ZG1A 1D8JA 5LRRA 5DV5A 1R7JA 1LJ9A 1O3SA 4L9VA 4Q48A 3P7NA 4CDGA 1P4AA 1TBXA 3K69A 2MLKA 5FLXK 3FMRA 1QNTA 1JHHA 3D5LA 4HF1A 5F64A 3BDDA 2DPDA 2DU9A 1EH7A 2HQNA 2JPCA 2YSRA 4WK8F 4ENMA 1J7KA 1JXSA 5ICCA 3MFKA 4Y15A 3JTGA 2W25A 3JSPA 3QAHA 2A6EF 3ULQB 3HTUA 2XASA 3WTXC 4G94A 2GAUA 2MC3A 1B9MA 1S8NA 2NYXA 5HS7A 5FO5A 4EMSA 2G7HA 1ZHFA 3WE2A 3WTYC 1W5TA 1FSHA 5CLSA 3BY6A 2L3DA 1U5TA 2DBBA 4RB1A 3ZMUA 1R1TA 4Q4ZF 5F6FA 3CDHA 4N0BA 2K86A 4R79A 3TO7A 1ZGAA 5IT9Z 1YW7A 3Q9SA 1Z6TA 4LLLA 1XB4A 1MZBA 3S2WA 2Y48A 2EJRA 2YPRA 5D5WB 1IN5A 3IWZA 2IA0A 4XBFA 1R58A 5HDNA 1MD0A 2XHKA 2JRTA 4N9IA 4EM1A 2ZBKA 1ULYA 4G7ZF 1YLFA 4RGXA 1R5GA 4WCGA 5BQTA 3M9AA 3M8EA 2C6YA 3HUGA 1J75A 1KGSA 2FA5A 3QOPA 5FFXA 5DCMB 4A5MA 1T98A 1Z6RA 2VOOA 1QGPA 2BE5F 3CTAA 5D5XB 4G8XA 3F6VA 5TRDA 5LHIA 3ECOA 1H9GA 2RNJA 1WWXA 2M8EA 2D1VA 4E70A 2V79A 3FM5A 2ZCWA 5BS6A 1J0RA 3WE3A 1T6SA 1DDNA 4KN4X 3U2RA 1J2XA 1ZG5A 2GWRA 1IRGA 4NB5A 5FGMA 2ZKZA 4UV9A 1B59A 3DXJF 4U0VA 1FP2A 5DYMA 2DQRA 2RVCA 3C7JA 2PLYA 2XAQA 1I6XA 1IN6A 2W57A 2J5OA 1LDJA 4PGGA 1S6LA 3I58A 1GXQA 2MBFA 2M1BA 1FOKA 1ZYRF 1FY7A 2FSWA 2XUBA 4EJVA 1TNSA 2R7FA 3FF5A 4G6QA 4LLGF 1K79A 2M5WA 4M9XA 4IVNA 4EM2A 3T0YA 3RDIA 2RN7A 4D0PA 3KEQA 4BHPA 3LSTA 3R61A 3J80K 3BP8A 3LA7A 2DI3A 4RB0A 1S7AA 1LVAA 2E1CA 1W7PA 2RC4A 2PFBA 2P6SA 2CW0F 4M6YA 4AD9A 1USTA 1I1SA 2EA2A 2G9WA 3TQNA 1IXRC 5AIQA 3R6SA 4I7HA 1P2FA 5JHUA 2O03A 4U0WA 1EH8A 2ISZA 1IN8A 4JBAA 1F5TA 3HSFA 1R1VA 4BNCA 4IHSA 2QBYB 2DTRA 4UV8A 3LA3A 5K5QA 2VT2A 1QQIA 2OQGA 4YIFA 5K5RA 1FT9A 4AVPA 3F8FA 4G7HF 1LNWA 2PN6A 3KLOA 1XCBA 3KP6A 3C3WA 4ZYEA 1ON2A 3SFZA 3MAJA 3P9CA 5LEJA 2ACJA 5L3EA 1FWZA 5D5VB 1KQ8A 5IT9K 3FHZA 1B4AA 2Z33A 1XGNA 2PMUA 2O61A 1TQMA 4EJOA 4WXHA 1XMKA 5E1ZB 3W6JB 1UB9A 1BC8C 2YX4A 1YFHA 2EWNA 4M73A 3HHHA 3IL2A 2ELHA 2FNAA 3RYRA 2QM3A 4I98B 3ZN1A 3GVAA 3P9IA 5E17F 4I09A 1ODDA 2KIFA 3OOPA 2FNPA 4HF2A 5DCFA 3RTRA 3HRUA 2EFQA 1ZH5A 4JQFA 4RGUA 1KU7A 2JT1A 2P4WA 1R1UA 2IP2A 3RKYA 1W7PB 2GIVA 5DD4A 1HKSA 1RNLA 1G3TA 5BPDA 3IHUA 4GYIA 2K02A 4Z2YA 3E6BA 4IPAA 3QU6A 2MA3A 4HA8A 2YX7A 4WXDA 1JE8A 4OIRF 4B8XA 2HTSA 1YYVA 1LB2A 4ETSA 3U1DA 1RUNA 3WTSC 2XKOA 3MEXA 1V4RA 2DK8A 2XRNA 2VC1A 2AS5F 4ESBA 3V7SA 1WRJA 3F3XA 4M6XA 2Z3YA 2P7CB 1PP7U 2A3SA 4M71A 5FD6A 3WGHA 4PCQA 4GGGA 5J6XA 2ADUA 2BBYA 2JPBA 1PP8F 3D0SA 1TW2A 3DF8A 3L7WA 3GYHX 5EEHA 1Q1HA 3WGIA 1YIOA 1YO5C 2K27A 1DPUA 2O6GE 2A5YB 2RGVA 5LEKA 3REOA 1L3LA 2FE3A 2XVCA 3V7RA 2A68F 2DW4A 3CUQA 4LK0F 2X0LA 5JR3A 5DEQA 4KYWA 5CYVA 5A2QZ 3PFIA 4CGZA 2OZ6A 1B6AA 2H94A 4HF0A 3ECHA 1KQ9A 2QYOA 2FMYA 1K6OA 4O3MA 3GXOA 4B09A 2VN2A 3TGNA 2XAHA 2H6CA 3LWFA 4KIGA 1HW5A 5CVIA 3BJOA 1T39A 1AOYA 2VXZA 4R8HA 5FB2A 3C1DA 1QO0D 1DUXC 2QUFA 2EV5A 5BOXA 3NEUA 2VONA 3C18A 2PJPA 2HFHA 1XCVA 1HSJA 5A2QK 3KZZA 1FLIA 2ETHA 1S29A 3FMSA 1IXCA 4RGRA 2L4MA 1SFUA 1HW2A 1ZN2A 1DPRA 1H9TA 1BIBA 3F6OA 5LHGA 2STWA 4MQVA 1W7PD 1K7AA 2FRHA 3ZP5A 4A0ZA 3KP5A 4XSXF 4UVCA 1XD7A 3SXYA 3K9TA 3TOBA 2G7UA 4UUVA 3DKWA 2H09A 1IZ1A 3FXUA 1G3WA 3E97A 3T5XA 2PQ8A 1ZARA 3I71A 2LF7A 3KP2A 1HXDA 3SXMA 1PUEE 4L18B 4H0EA 2IJLA 1YW8A 1IN4A 5K1YA 2IT0A 4G7OF 4KMFA 4CHUA 3H92A 4KIBA 4S05A 4AIKA 4MGRA 3QU3A 3FX3A 5DUIA 3ABTA 3IRRA 1HSTA 1EV7A 5CVRA 2ZMEB 1U6GA 4KIFA 1UFMA 1HBXG 2V1UA 4IJAA 1FZPB 4KICA 5K5OA 4ENNA 3KP7A 3JSOA 2WV0A 3NRVA 4UVAA 1NHAA 1PDNC 1TLHB 2QBYA 2LF8A 2EK5A 1KU2A 2GA2A 3JAMK 2RDPA 3IKTA 2DAOA 5D4RA 2V1DA 1Z9CA 2D2WA 2HEOA 3QP6A 3GZ6A 5CVVA 1Z7UA 2HYFA 1SAXA 3N97A 3KFWX 2R7DA 2KRFA 5HDKA 2VODA 4KN7X 4WX9A 1XGSA 4GXOA 3CUOA 5E20A 1D3YA 2IRFG 2CFXA 1KU9A 4ON0A 3VOEA 4I0BA 2PBIA 2HR3A 4IHTA 2Z9OA 4OIQF 4CXFA 1OYYA 2ZNZA 2RV8A 4MTEA 5FD5A 3BWGA 2DLLA 2E1NA
chains in the Genus database with same CATH superfamily
2CW7A 1MJ9A 4BEJA 2EH3A 3G4XA 3SFIA 2R5YB 4BE0A 1UCRA 4OAYA 2RREA 3LJBA 5E3AA 4FESA 1W5SA 1G4DA 3A11A 2LC2A 1ZHTA 3W2AA 4KNVA 1IN7A 1OCCH 2L9JA 5E3CA 1XGOA 3DTIA 1ZU4A 4W8PA 2IXMA 3CF2A 3GTQJ 3KYJA 2UZKA 3U2MA 4RBNA 1I5ZA 2LBFA 3B73A 3GCMA 2VL8A 1QVXA 1KYZA 4M9SA 4Y13A 1WN0A 1MBGA 3FOPA 4ESFA 2WWYA 1VQ8I 2QSGX 4BQAA 3G6EI 1SFEA 4ZZLA 4BKXA 4H54A 3QPSA 3SNHA 4EJTA 1MBKA 3QW1A 3NYLA 3WTTC 1SD6A 4XLNF 2GFHA 3OEOA 2R5ZB 3ABUA 4LIVA 3GFMA 1U9NA 4DRHB 2AU5A 3ZPLA 1ZRFA 3L2QA 2NS0A 4FX4A 1JPNA 3BPVA 1K04A 2JTVA 4U5FE 1LEAA 1FBQA 3I4PA 2E7XA 1RKWA 1X3UA 2AXLA 3ISPA 4KUMA 4RM2A 4FASD 1EKEA 2EPOA 2FOKA 3DP7A 2DQLA 2VKDA 4AUXA 5HS9A 2JVHA 5D8KB 1APLC 2DXIA 4KJZA 3I56I 1XG1A 3DPTA 3HYIA 1YX5A 3K70D 3KEYA 3J7AY 2F5EA 2X48A 3CCYA 4LACB 1IXSB 3GFLA 3KLNA 4IRHA 3K4KA 5AC5A 4I2OA 2XLVA 1I3QJ 2ISYA 1IGNA 4J32B 3DU6A 3JSEO 3U3FA 4IHXA 2VBWA 2NUPA 5KVRA 5L3GA 3SYTA 3E70C 2OBPA 1LEBA 5CI8A 1P7IA 1TW3A 3DCFA 3MVPA 3OYLA 3LSKA 4HNVA 5JFRA 2QQ9A 1LI7A 3M8JA 1L0OC 4U7DA 3RI4A 1YDIA 4P55A 2CQKA 2E2HJ 2ETSA 4XPYA 2NG1A 2COBA 3ASNC 3NG1A 4ULWA 4MNDA 3GUDA 3CD6I 3HJEA 2LP0A 5J8CA 3RYPA 2QZ8A 3RKWA 3IPMO 4BGDA 2MH9A 5HOOA 3SXZA 1ZK8A 2XV4S 2JPUA 4A3IJ 3EGDA 3MLGA 2M87A 4A0XA 4O6JA 1NSGB 2LP4A 2FU4A 5TJJA 5BQIA 3FXMA 1YLMA 4MVZA 4MW8A 5F1JA 3TDZC 3OYHA 2OCCH 3OIOA 3CO7C 2JX0A 2HDCA 1GT0C 3GANA 2DT7B 5DM7F 4PUSA 2TMVP 2LH9A 1RMVA 3QYBA 2CV1A 2QQAA 4BEHA 1A31A 2ICWG 2Y75A 2ZPAA 5ED4A 2KJCA 1QVTA 1X1BA 3BTJA 3LSHA 3OYIA 3R2PA 3LNQA 4O79A 1JT6A 3E0JB 1CF7B 1WZ2A 2XSDC 3M3YJ 1Z0XA 1I1GA 2EPNA 4GYGA 4DBQA 2V9KA 2NNNA 4LFUA 4HYEA 4V2GA 3OYAA 2NS8A 1TWGA 1D0ZA 5F0CA 3CCLI 1BI3A 1XSVA 2JWTA 3ZN0A 3UMIA 3MN2A 5HSWA 5D6EA 2XF7A 3WODF 2CGPA 3BEHA 4UUSB 3HRSA 4O6YA 3AG3C 3A03A 3QPTA 2X6OA 5JHFA 3EQLF 2GLOA 3CCMI 1BC7C 2IS2A 4JCZA 3W4YA 5EGYA 2BYVE 2VPRA 2XGCA 1XTAA 3DWLE 3TOAA 5HODA 1A6IA 4BDYA 1QU3A 2MLGA 1XS9A 3VPRA 1SF8A 2Z99A 3FXHA 4KI2A 1P4WA 3RF3A 2DPUA 2COMA 5E1WA 3PJRA 1R00A 3C8GA 1JMWA 3I59B 3KMIA 1KQ0A 5E18F 2L9RA 3VRCA 2V9PA 1HE1A 2R4GA 1R4TA 5H20A 4BUPA 2R02A 4CZCA 2OU2A 1W5CC 2ZXJA 3O6BB 4EVIA 3CEXA 1HQCA 4FHTA 3B0UX 1Q0DA 5HVQC 1E3HA 3IH4A 4DQ2A 1B68A 4JK1X 4R1HA 4HV5A 4E7SA 1SMTA 3FISA 3PUFA 5DD8A 1Z3IX 3GEIA 4A3KJ 3UMHA 4H4KC 6PAXA 2VC9A 2WZLA 3AL0B 3EG9A 3EUHA 3N24A 2O5RA 3SZPA 4A2UA 4IGGA 2DO7A 3BR5A 5GPCA 3RFYA 1ITYA 4UNOA 2H6BA 4C3JJ 1EH6A 4EQQA 5FKLA 2HZTA 3OIPA 1PUFB 2P7VB 3B02A 4PR9A 2V1NA 1P4XA 3NKEA 4ASNA 1FYLA 3MZ8A 3DKYA 2FEZA 1ZRCA 2OG2A 2P5VA 1RKEA 5KYXA 3I59A 3JRCA 1MMSA 1NLXA 2X1DA 1XX5A 2VI6A 5D5UB 1LS4A 3B0PA 5FFZA 1I3AA 4WXCA 1IRFA 5COMA 4FCYA 4DIQA 4LB5A 3L2RA 2IGKA 2VCAA 3SDBA 1HKTA 3IAM2 3RIRA 1OR7C 1HA8A 4U88A 3S93A 3JR9A 2A05A 1H6GA 4E17A 2P5KA 2LD6A 5L3QA 1YVIA 2BV6A 2W85A 2PP4A 4QDLA 1FFTC 2VQGA 2M8GX 2L6HA 1RXQA 4QI0A 1BZ4A 3QYEA 3ESWB 5KAIC 4IQJA 4AIJA 1C0WA 2LKPA 4J00A 2KIUA 1NG7A 4BL0B 3M1CA 2HTJA 5F0FA 2E2JJ 2J5PA 3CLOA 2QKMB 5ICGA 1YOVB 3Q7LA 1FYMA 4ZYAA 2A1DD 3T9OA 4MTOA 3DLAA 4A4AA 2IA2A 4ER9A 4UXNA 3EGDB 1ETWA 2VIXA 4UHTA 1YITI 3J06A 1S72I 3MQ0A 4AE4B 1D0XA 3JTHA 5LGUA 1QSPA 2XAGA 3PO2J 4XM3A 3HPHA 4E18A 5JVTA 4NTFA 2Y31A 2VJ4A 1T0FA 2J7PA 4RBOA 2FBKA 2DOEA 2KIQA 1ZTRA 2OJED 4MTDA 1NH3A 1ZHXA 2L81A 3G50A 1Y0NA 3EFOA 4MEYF 3NYJA 5E1XA 1XSXA 4EV0A 3FHDA 4U5CE 1A04A 1O7FA 2M3AA 3I0TA 1VI0A 4KDPA 4HRIA 2DK5A 5DQTA 1UG7A 2M7BA 2P6TA 5IOYA 3E6MA 4IX7A 1GVDA 2Q2EA 3DEUA 3ZMZA 1N77A 3FXKA 4MNUA 5J1UA 4ZLDA 1OYIA 3VYSB 1MBJA 2F5DA 3WG9A 2YL1A 5K7HA 4O6NA 4JTAB 4IZZA 4ZDPA 3HRTA 1OQYA 2WTEA 2DMUA 4QTRA 1OR2A 5F0HA 2ZXPA 2Q8KA 2BW3A 3X2QH 1WKMA 3CJNA 3RPUA 4U5EE 4IRUA 2V3CC 4F92B 1TFOB 2WZGA 4XKCA 4XLPF 3WU1B 2Q4FA 4ZJZA 3M79A 4M63A 4HSRA 3ZQYA 1OCOH 1QPMA 3U9MA 2VXDA 2XIGA 2CJJA 2L5QA 3G1OA 4LK1F 1TZLA 2HDWA 4RGSA 1X3ZB 3GTGJ 5L0FA 3E5XA 2J9VA 3DV8A 1R36A 5FKOA 1Z05A 1HF0A 3LSJA 3NDBB 5E3NA 3DJUB 1BR4A 2ASRA 2MD5A 4HDVA 3D5SC 3O39A 3W6VA 1TQPA 2DGJA 2LDUA 3OYCA 4LLCA 3IEEA 1DOWA 1Y0UA 2VB6A 3EYIA 4JYKA 1OR3A 4ZYDA 1ZHWA 3VF0A 4WWCA 2P8TA 3FWEA 3Q3SA 3CDLA 2XGXA 4L9JA 2PMHA 4G12A 1ZELA 4LG3A 2AVKA 5GPGB 1JUPA 4N4WA 3FXRA 2NVQJ 2GXGA 1BI1A 3L9FA 4FE7A 1F1ZA 4NHJA 2CV0A 3JRFA 4EBBA 3FHNA 5EEAA 4DVZA 4N6HA 3MWMA 1E84A 3CSKA 3GMEA 2HS5A 4L5JA 1PYVA 2LR8A 2HKOA 1U89A 3IKVA 1VOMA 2A6HF 3CP8A 1J5YA 4U5BE 4G78A 3TDUC 2H8AA 2DMQA 5ILVA 1FTSA 2LK2A 1I4YA 1CGPA 4HZFA 5ICFA 2QSHX 1YYXA 1BN5A 2IXSA 1Y56A 3HSEA 3HSRA 2HQRA 1XDUA 2B9SA 2Q7RA 3DFGA 5HLHA 5KYWB 2ZMEC 1Z3XA 1B8IA 2Q9AA 2KGOA 1U0JA 2YUSA 4RDUA 1L3PA 5KNLA 5HLGA 5LRSA 1NU9C 1GXPA 2UWMA 4C3DA 4B6IA 5LBQA 3H65A 2DYSH 2HFIA 2EFOA 3H5RA 3L2CA 3CCJI 2CNWA 5B1AH 5M3FJ 1F43A 4FX5A 1Y8QB 3BZKA 5DDGA 5BQHA 4ZYHA 3DBRB 1J59A 2Y3BA 1LDKB 3LNMB 1FJLA 2XGDA 1WASA 3KYDB 2L4AA 2YZSA 2CG4A 5GPAA 4XEVA 1FX7A 2ID6A 1B72B 3H35A 3FDQA 2HGCA 4DVYP 4BJ6C 3H9JA 2IS1A 1IW7F 2KHMA 2M45A 4C3EA 3I53A 3S16J 3TOMA 2IBDA 1P9QC 1SD4A 3C8ZA 2I5UA 1VQ5I 1IRXA 5E8IA 1MJBA 1QZYA 4J30B 3SP1A 1S7EA 3LMMA 3IH3A 2DT5A 3U3BA 3PQJA 5IT3A 3LQRA 4K1OA 4CS8C 5ICEA 4CJGA 1RUOA 4JP0A 4BEMJ 1YW9A 1BR1A 3ZWIA 1K4SA 2GOMA 4BY7J 1RIOH 1IJWC 2VUMJ 5L3BA 2NSGA 4G6DA 1LFUP 1J09A 3DU5A 3S14J 4RD9A 2O3FA 2YL7A 4CCOA 2EIKH 1YTYA 4F7ZA 4N06A 1SMYF 3E1SA 3M07A 2EQRA 2LYCA 3CUQC 3IWFA 3HZJA 1GS9A 2AP3A 4RDAA 3HG9A 4J01A 4L5EA 1Z6AA 3EFOB 1FNTc 4E4HA 2M7AA 3DQVC 3RJPA 3UNGC 1LFBA 3RSNA 3L09A 3CMMA 4EBJA 4D5FA 2WAEA 2OA4A 4F3QA 2R3SA 3S2DJ 3TK0A 4EJWA 4Z6YA 2TDXA 4AWXB 1VQOI 3A1YA 4HLXA 2H8WA 2L7MP 5B1BC 3P9KA 3PDMP 4A0YA 1WGXA 4XK4A 4FAPB 3K4CA 1ERDA 1SANA 5JLWA 1JOGA 2ZXWC 1GM5A 4CYDA 4HNTA 5L3DA 4AK9A 4J7TA 2QWWA 2HKVA 2PMZA 1YHQI 1QQ3A 4U9EA 4A5NA 4C3IJ 4ZTFA 2Y0MA 2MH2A 3BROA 3G3ZA 3PNVA 1IRZA 1D5VA 2P61A 3ABMC 2DTZA 3ITFA 4I01A 1JKRC 5C4JJ 2R7VA 2E1MC 4JVSA 3ELKA 3LSGA 4KC9A 2QLAA 1MBFA 4NTBA 3A4CA 3HOTA 4IJJA 3V5XA 2R7OA 1TQIA 4XRSG 3ZXSA 2OQMA 3GEHA 4KNWA 4EUKB 3M8FA 4ITVA 1RJ9B 4E7IA 2OD5A 3L34A 2VE8A 4O6MA 1XN7A 4EBKA 3NAUA 1OW7A 5FZTA 3O10A 4CICA 3V4GA 1Z21A 4ANJA 2EINC 1D1BA 2L01A 2K9LA 3O8GA 1S5LC 3AFHA 5ILSA 3G73A 1AWCA 4UVBA 2XPUA 2HMQA 5J8FA 1OXKA 3BR6A 5CVJA 4I3MA 2AHQA 1WHUA 4YIRX 3S3NA 4QIWN 3IV5A 1JRAA 1ZGJA 4YT2A 1OR7A 2HXIA 2KKOA 5HNHA 3I64A 1T2KA 5CPRB 3GEEA 3DMDA 5KYUA 1HW1A 1ETVA 3BTCA 2XAFA 3VB2A 3BZ6A 2DJIA 1V74B 1BOAA 5EEGA 1FOXA 3WTVC 4BJ5C 4LOCA 4C2MJ 3K70C 2BGCA 5FRMA 4BPMA 2I8BA 2A69F 5IYDJ 3FXLA 3LSIA 1D5YA 2FBHA 4EGZA 3AG4H 2L0KA 4HQEA 2CNWD 3HLZA 3L00A 3IC7A 3K2ZA 3B71A 1A7EA 1OYWA 2XGEA 1T9KA 4RB3C 2ECCA 4LIUA 3GLLA 3VYTB 5GAGJ 4CSWA 3ZQIA 5J3LA 2YU3A 3JRIA 3F22A 4NBQA 1OCZC 2KYHA 2ZFWA 1O3QA 4D1QA 2HKXA 2XLWA 4JJGA 4Q47A 4MVRA 2BY2A 1JTYA 2ZXRA 4DXWA 2QE9A 1I27A 2KT0A 4CSAC 3LAYA 3HIFA 2CYDA 3E9VA 1YS7A 2NUTB 3BG9A 4QWQA 3F8NA 3RYLA 2O9XA 2CWEA 2XXAA 5DQZA 4JZAA 5KHDA 5LD2C 3EZHA 4PJLA 1ZW3A 2YU9J 3LAPA 4FX0A 1Z3YA 1MNMC 1WI9A 4G0HA 2DDBA 2DA2A 4FT8A 3Q5FA 4W8KA 4LDKA 5DS9A 4UB6C 2HU9A 3C2BA 2CSOA 3KIOA 4MVQA 3HGGA 3TOLA 1Z91A 4L6RA 4XKBA 1IO2A 3FDYA 3L8JA 2QF7A 2BL2A 4U5DE 3SZRA 4YFNF 1G6NA 5IP9J 4W1UA 1M6TA 4OMZA 4JKVA 4N6CA 2VC0A 5LGNA 2P0WA 1REPC 4GEHA 2WL8A 3FMQA 4HLYA 2FQ3A 2M0CA 4YT5A 3DPLC 3RPQA 2F4MB 2PNOA 1USSA 4MFEA 1XMAA 3K0LA 1V3FA 5B1BH 5H2FC 3H1CA 1O3TA 2PI0A 1RZ4A 3TULA 2NVTJ 3HTSB 5JI6A 2FAPB 4YFXF 4BXUA 3CMAI 2R5ZA 5DCMA 3GLXA 1T6IA 1K6YA 3GFIA 3BR0A 1WTYA 4A3FJ 3DE8A 3V8LA 2Y9YA 1MGTA 1O5HA 2XB5A 2LQGA 1QRYA 3PNTA 1K78A 1LE8B 5M5XJ 4A3DJ 2FXAA 2YLGA 4HX8A 3N05A 2DA4A 3NQOA 3VYUB 4BE1A 3V8KA 3ABKC 3AQCA 4IHWA 4WF2A 4MVSA 4MTFA 2RAEA 2CU7A 2XSJC 4C30A 3V5ZA 1VYIA 4XIDA 1S7ZA 5FCLA 1JTXA 3HOZJ 3GFJA 1MMDA 4OMYA 5IPAA 1SFKA 2XSEA 3VFZA 5K7FA 1SC7A 4E7ZA 1U3EM 2O8KA 4HQMA 4D9JA 3X2QC 1U5TC 3TO9A 3BLYA 3SXKA 2OQRA 4B43A 1S7OA 3GTPJ 1Q0FA 4JC7A 5B3SC 256BA 5T3TA 1DP7P 4P5OA 1VQ9I 1LVKA 5EF6A 3G1LA 4QPOA 1O7LA 4NC7A 1C17M 2LSOA 5KK1A 3V42A 1HDPA 3JRAA 1LQ1A 5BQGA 4KT5C 2GXAA 3B9QA 3H2UA 4XTKA 2JZYA 4PSXA 2HVSA 3ZOBA 2IYLD 3GBGA 1RPWA 3EHNA 4P9UA 2XL6A 5L0CA 2CGEA 4IWBA 1T95A 1BI2A 1V55C 2VBXA 3GTJJ 1XGMA 4XLFA 2NVUB 3BTIA 1BI0A 4L0ZB 4CIHA 2JUGA 1MDMA 1WCMJ 4DRJB 3RQFA 1UG0A 3MD2A 3COAC 1KNYA 2CRGA 3T6GB 3DKXA 1YG2A 4E7KA 1FYKA 2VT3A 2NVXJ 1LM3B 5B5EC 3BOQA 3DLLF 1I6HJ 2ESHA 3EZIA 5A69A 3LAJA 4IHYA 1VK5A 3OYFA 4ESJA 2MWQA 1S3JA 3CP2A 2EB7A 5L3CA 5T1DB 2OV7A 1VLSA 5LHHA 3FVYA 1U2WA 1ZKGA 2V1XA 3AL0C 2IVMA 3JAMZ 2CDQA 1ONVA 2M30A 2RQQA 1ETKA 3D5RC 4BS9A 4P9TA 2D1HA 5C3EJ 3AAFA 3K4NA 2PBEA 1Q1VA 2Y3HA 5F5HA 4M9ZA 2VBZA 3FXOA 4D7NA 2YLDA 1Y1VJ 3KE2A 3WU2C 2LY1A 3CJQB 3F21A 1FC3A 3QRFF 4F55A 4AL0A 3K1PA 2MC4A 2O8XA 4Y17A 4CCKA 5J4VA 1HMOA 3AJMA 4O7GA 3DEEA 3ZTZA 1G4WR 4FETA 3MZHA 1Z67A 5JUAA 1H0MA 3KEOA 4HNUA 1WJBA 3Q0WA 1NG6A 5AC4A 2ID3A 5BNGA 1C03A 1X1AA 1BBYA 2ZXWH 2QLZA 1WVRA 3V7CA 2BEOA 3EETA 1DQUA 3F8MA 4U9DA 1BJZA 4BHBA 5J4YA 4LDRA 3TD7A 1AU7A 2E5NA 1STZA 3QPLA 2R5YA 4IKFA 3V8JA 3MCZA 2WAQA 3SEZA 2P5LC 4JE9A 3OYNA 2B0LA 4BHCA 3FZVA 4XEKA 1SVOA 3GZ5A 3WTUC 1OW6A 3VEPA 4M3BA 2LNBA 2E7WA 4DRIB 1IF1A 1U5TB 3AQBA 3ZC4A 1WSUA 3LOCA 1ZW2A 4AYBA 1FNNA 4DZJA 5C44J 3HOSA 2EILH 1KA8A 3OY9A 4FWVA 4Z9IA 2NRAC 1ZZPA 2C04A 3EYYA 2XLEA 1LDDA 3H5AA 2JN6A 3KCCA 1R71A 1W2WA 2KISA 2KQRA 4I02A 3DD7A 3VM6A 3WGGA 2H1LA 2IPQX 3QPHA 4ZH4F 3HRMA 5EGOB 2HPMA 2VOPA 3GW2A 1ST6A 4JEBA 2HOAA 4XLCA 5AONA 4L9TA 1ORYA 4BEHB 2X4HA 1U6HA 1SFXA 1JGGA 2IA1A 3DEWA 2F2EA 3LA2A 2GIZA 2F48A 2JD3A 4AIHA 1I5NA 1RKCA 1MJAA 2AQEA 1XMXA 2LVSA 2MYSA 3I3LA 2DFIA 3R60A 3CCSI 4U5GA 4CCMA 3IRQA 1L7CA 2DMPA 1CGOA 4IEJA 3W6KB 1X1DA 4IO9F 4BJ1A 3JW4A 2H7OA 1N25A 2VQHA 4J7YA 5AGFA 1E86A 4OWRB 3NMIA 1G3YA 1KZHA 3DJNB 3AG1C 4P96A 2EILC 5EYRA 3WTZA 2ZXHA 1OPCA 2IW5A 1X4OA 1Y4CA 5CKTA 1ZRDA 2Y3DA 3EDPA 3SQNA 2WY7Q 4YEJA 3M4CA 3FBNB 5FJ8J 2DYRC 4CZZA 2R03A 3QWLA 1GLNA 1YQAA 2WC2A 4CJOA 2KDZA 1B1BA 1A6QA 3BR2A 1GQAA 2X85A 3OR2C 3LEVA 1TWGJ 3GM3A 2KLOA 4X0GA 1WGWA 3I54A 2DA5A 3WHNA 5B3SH 4J19A 3FIWA 2MSYA 2MW8A 3ZCOA 5A6AA 3GWNA 2HWVA 4RS8A 5KYYA 1JHFA 3EUHC 1F9NA 1JUMA 1WFXA 5C4XJ 4LERA 4BY1J 4C7OB 3K2AA 3K4MA 4BYYA 4LGWA 1E2XA 2VBYA 3F9KA 1FBUA 1R5HA 3S2HJ 1J9IA 1FPQA 2XLMA 3NYMA 3MMYB 4M72A 4XRFA 3IP4B 4TV7A 4I6ZA 5KYWA 3B29A 1SD5A 3F8BA 4HAMA 2Y9ZA 1TTYA 2GM4A 2EZLA 2K9MA 2XAJA 1YX3A 1IV6A 2R25A 2PX0A 4QPQA 1WH7A 3M7GA 4IF4A 2XF6A 2KK1A 2HOEA 2FF4A 1FR0A 3R0AA 4A12A 2GXBA 4C2UA 5JP7A 3CJRB 1B72A 5F27A 1VLTA 3O8HA 3K66A 1P6RA 5B1AC 2Y30A 4CUGA 4EGYA 2FOWA 2GQQA 1U8RA 3ZQ7A 1YRNA 1T38A 4LJZF 4HOBA 4P9FA 2LRDA 4WGZA 3U9GA 2F5CA 1RETA 3CQZJ 2VH3A 5T3WA 1TWAJ 1K78B 1RJ9A 3ABMH 3GO5A 3LUTB 5EZGA 3WU0A 1IDZA 1TQGA 2OPTA 2B63J 4PGHA 1SEUA 3KP3A 2QTVA 3GWLA 4EWCA 2D45A 4C7OA 1D0YA 3CF5F 5JLXA 3ERED 4OIOF 3FM3A 2RQPA 3TP3A 5JS5A 2L02A 5DTDA 4A3EJ 3FAJA 1W0UA 3J7AO 1OCOC 1SAUA 1ZLJA 2DMNA 2QVOA 2UUZA 1RR8C 4BJ5A 2ZB9A 4U87A 4ZZDA 3MKLA 4DYQA 5FLXZ 5L0GA 3W2VA 4KISA 1BA5A 2GOXB 4EJUA 2CO5A 5BMZA 4YN0B 2X51A 1FP1D 4LB6B 2BXYA 4HDUA 5J40A 1BIAA 1QVUA 3AG2H 4ENJA 3U8PA 4E0IA 4RLFA 1R23A 3GF2A 3GM2A 1KU3A 2EA4A 3E5UA 3QQAA 5LGTA 4AE4A 5BPIA 5F1RA 1MDMB 3POVA 5EK0A 2EV6A 3HOXJ 3ZSUA 3HGYA 2EFWA 4G6TB 1N1CA 1SR2A 2LD5A 2CYYA 3PSIA 2NUPB 4HBLA 1UHWA 2YRFA 1BJAA 1TT5B 1XDSA 4U7BA 1SD7A 3U21A 3BJAA 2PG4A 1MSFC 3GWZA 1TWCA 1I50J 1YS6A 3ZMVA 5M5YJ 3I5UA 4RAFA 3WG7C 3S0XA 1WH5A 3M15A 3S28A 2YKZA 1N78A 1LE2A 3MZYA 1GHCA 5HDGA 5KCMA 1JGSA 1ZREA 4V19K 3CUQB 2L54A 2P81A 1IUYA 1H7IA 2W84A 1FSEA 3PM1A 4JX6A 4X6AJ 2B0JA 5L3FA 3IQCA 1QPUA 2CCYA 3HJCA 1MKMA 1MNEA 2BW3B 2K40A 1YE9A 2ZO4A 1OKKD 1BBHA 1G3SA 1T0FC 2M9HA 2W24A 4K2EA 5FKNA 4DGWB 3J81Z 1YYJA 4HFKB 2R9RB 4XWJA 4OAZA 2LLKA 3ZMSA 2Z16A 1E83A 3TW6A 4LG0A 3NWSA 2F4IA 3SHFA 3N4MA 1XSDA 2E1OA 4RB2C 2E71A 4OU0A 3UGPA 5HS8A 4W97A 1GV5A 3HHGA 2E34A 3TKYA 1IAWA 5FLMJ 5L0DA 2QKLB 2ZJRF 2HUJA 1ETXA 4M74A 4XRSA 2K4BA 3EG9B 5D91A 3LQQA 2STTA 2JUCA 5DLJA 4A6EA 4YIIA 2M4KA 1T08B 2K9SA 4LD5A 1CF7A 3RKQA 1DU6A 3BR3A 4KFCA 3EHMA 3TO6A 3WTWC 4GCVA 2XS8A 2TRTA 4YG2F 1QKRA 1E3PA 4E7JA 4HG2A 3OYDA 3SJMA 2R7WA 4HX4A 1HMDA 3L2WA 4XICA 3BR1A 3JRDA 4OOIA 2EPFA 4DNCA 4M3EA 5IY5H 1TC3C 5KYXB 4LG0B 2XLHA 1QZZA 3NKDA 4EHPA 1ZG3A 2NNYA 1ZLKA 3GTKJ 2AWCA 3R0JA 1B9NA 2OAZA 3JCUQ 2QQBA 3ZDLA 3ZR8X 4N9HA 4XOPA 2RKHA 2ZMEA 1F4KA 5D6FA 3KP4A 1YARO 4BH9A 3J81K 4GO1A 1K61A 1X2NA 1Y8RB 4FE4A 1OMIA 3GX4X 2CQQA 2MABA 2W48A 4MLOA 3HOWJ 3CZ6A 2GZWA 3T1BA 9ANTA 1WPKA 2GA1A 4A69C 3F8CA 3ECSA 3K1IC 4O5VA 1VQKI 4NUBA 1TKNA 5E2QA 3C2HA 3VSLA 3DBHB 4PJMA 1NTCA 5HLTA 3O3KA 4CYCA 4ENKA 2UXNA 3TEDA 4P1WA 3FXQA 2EZIA 4NQFA 2V6CA 2NAZA 4ZYGA 2X1EA 4I76A 4XLEA 4YFKF 2JA6J 2YR2A 2XL4A 3E6CC 2PMZN 1U78A 1ZHZA 2EFNA 4BAYA 4OIPF 1OQCA 1FIAA 1LPQA 1FIPA 2HJ3A 2Q0OA 1O3RA 2K7LA 2A61A 5D4SA 1XZQA 4L5IA 2KNHA 3SZTA 4CCJA 1VQLI 4XOTA 1PCXA 3KL4A 3BJ6A 2LCHA 1WJCA 5KYNA 3KETA 3ZMDA 5EDNA 3J7YJ 4XKWA 4A3JJ 1VTNC 1OCCC 1P92A 2UXXA 4XSZF 4QLCU 2B0HA 1IDYA 1T5OA 3F46A 4LLNA 1EJ9A 1MH4A 2EZKA 4I0AA 2BY1A 2EFPA 4HV6A 3U2LA 3ROUA 4NTAA 1O57A 4HX7A 3QYFA 5M5WJ 2PJRA 4PK4A 3LFKA 2BHZA 2Z5UA 5LLQA 2HV6A 4KMUX 2XROA 1M2OA 1TR2A 5J47A 5AIPA 1ETYA 3ML6A 2PX9A 2KL4A 2R0QC 2KIMA 4MTGA 3E3VA 5ERIA 5CQGA 1UJ8A 1W1WE 2J9UA 3DTEA 4OINF 2OKUA 3DBLB 2FX0A 4PDKA 3H3ZA 1OKRA 2IEKA 1JJ6C 3O2PE 1OLTA 2J8WA 1W36D 3AOUA 4A3GJ 2WAFA 2KJBA 1VFCA 1HDDC 5KAFC 3L1MA 3ABLC 4I44A 2OZUA 2ZFUA 4LMYA 3J80Z 4DYRA 2H27A 3K4LA 3PSFA 1HE9A 1HLVA 1G2HA 2FBIA 3RKXA 3PQKA 1D1CA 3GEZA 4F91B 2MHRA 1LIHA 2J46A 3Q7GA 4IRIA 1FBSA 4RAYA 3E5QA 4CDVA 1LFPA 1HKQA 4FISA 4MQ9F 3DAFA 4IRGA 1KYWA 3R7CA 2BZTA 4EM0B 3BQYA 3BTLA 1ON1A 2Y69C 2BY3A 4II3A 3C62A 3E6DA 1JUSA 2HVQA 2IGNA 1E17A 5CJ9A 2HSQA 3KKBA 4IARA 3U8VA 3K1NA 4R32A 5D8LB 2R7RA 1DP3A 5F28E 4PSWA 3S3OA 4CO8A 2VJ5A 3OV8A 2PFDA 1MBEA 2JSCA 3MX3A 2L6FA 4CS8A 4A3CJ 2FMLA 3P5JA 1KTMA 3AGUA 2QEXI 2LOOA 4A6DA 2K9QA 4MEXF 1BM9A 1VMAA 4PZJA 5GTIC 4L0YB 2CW8A 2VE9A 5DUKA 3KYLA 3R4KA 1RCPA 1RKEB 2BVMA 1I4ZA 1TNTA 2IS4A 2HZDA 3Q0VA 5HNFA 2A07F 2ZNYA 3H2VA 2UV1A 2XKPA 4S04A 3CO6C 1GVJA 2QENA 1Z7Qc 4CDYA 3US6A 2IM8A 4G9YA 3LNRA 1RKTA 1LI5A 3HOVJ 2V6EA 2EV0A 3M1EA 4GQHA 1R22A 4IXAA 2CUEA 3BG6A 3ZMTA 5ILUA 3A9CA 4U0YA 3F23A 4Q5SF 1V5GA 1CPRA 2O0YA 3S8PA 1AA7A 1RI7A 1ORSC 4YL3A 3VDXA 5L0HA 5H6QA 3LFUA 1D8KA 1T56A 3KZYA 3QP5A 3F72A 4NQWA 2ME0A 3Q9VA 2E2IJ 2M4EA 4AYBN 1DOVA 3C8GD 3K6GA 2F5FA 2HQAA 3QVYA 1WJ5A 2ESNA 3S17J 3BCBA 3T8TA 5E8GA 4HFFB 1QBJA 3BPXA 2LKXA 1WQ2A 2E19A 1YA7O 2CFOA 4CSAA 4KNYA 2R05A 4NCQA 4L9NA 1U0BB 3ZQLA 4KA4A 4BDZA 3A01B 2K4JA 3KX2A 4OD4A 1UHMA 4XRMA 3VODA 2WB1A 4YRVA 4Y4RA 1SVLA 4RAZA 5CVUA 4BBRJ 3V5YA 1ZAOA 1SZIA 5HLIA 2O7OA 2HYGD 3RZOJ 4XPXA 1W4MA 1U9OA 4LLEA 3H3UA 3FAPB 4CS7A 3T8RA 1Z1DA 3K1MA 4DOZA 2R7ZJ 1BR2A 2PEXA 3ZQQA 4MHGA 4ZTJA 5BUOA 2ZJ2A 2RD9A 2YHSA 5H6RA 2V9VA 4BJTA 1EI7A 3HTKC 2H7VC 1VQNI 1VQ4I 3A01A 2H7BA 3PMRA 4HW0A 1ZG1A 4YL0A 1D8JA 5LRRA 5DV5A 1R7JA 2L7ZA 1LJ9A 2Q2EB 5IYCJ 4XEFA 4GRIA 2QUPA 1O3SA 1V55H 4CH7A 1ENHA 4L9VA 4QI2A 2LG4A 2Q9BA 2DA7A 3EGXB 2YL3A 3PFYA 2LREA 2JA2A 2KSFA 4Q48A 3QZCA 3V7OA 4DBRA 3P7NA 2J0XA 2ZSHB 4ZC3A 4CDGA 2YVKA 1Y39A 1IC8A 4D7MA 4RMNA 1P4AA 1TWFJ 4BG0A 4DJAA 2HDDA 5E79C 1TBXA 3K69A 2JK3A 2PJRB 2NPUA 1XPXA 2MLKA 4DYCA 1FFHA 5FLXK 2KDOA 3FMRA 3HB9A 1ETQA 1QNTA 2AQFA 1GDTA 3S27A 4ULVA 1JJ8C 2HPIA 3LL7A 2LIGA 3RKOF 4AX2A 1JHHA 3RQIA 1TWHA 1M57C 3D5LA 4HF1A 3DZAA 5F64A 3L2VA 2HOTA 1E0EA 2KW3C 3BDDA 2DPDA 4YWQA 2DU9A 2DOFA 2AWYA 2KC3A 2VJIA 1EH7A 1EA8A 4IAOA 3T6BA 2HVRA 1JT0A 1QZXA 2HQNA 3VSKA 4CX9A 2FJ1A 2JPCA 2V7FA 1H8AC 5IOZA 2YSRA 4KITB 4WK8F 4ENMA 1J7KA 1JXSA 5ICCA 4Y3OA 3MFKA 1R6RA 2JA7J 3G4ZA 4Y15A 1PVEA 4HE8D 3JTGA 4BXFA 3UR3C 4CYCB 2BXZA 4C9YA 2W4BA 1Z63A 2CUFA 2W25A 2VJJA 1NK2P 1FMWA 3JSPA 2J9BA 5B3IA 3CC2I 3MYIA 5COGA 3KPHA 3Q6NA 3QAHA 2A6EF 3ULQB 3HTUA 3K10A 1WJEA 2XASA 3WTXC 4M3GA 1NFOA 1JR8A 1FTTA 3IH2A 3OSGA 2LSEA 2BY0A 4G94A 3DI5A 2GAUA 3PL8A 2W9YA 2WVOA 3ZIBA 2MC3A 2A5WA 3TJ6A 1B9MA 3BCAA 1S8NA 2NYXA 2AXTC 5HS7A 2WB7A 1E85A 4XN0A 1Q0GA 3RQEA 5FO5A 4EMSA 5FLVA 2G7HA 5FKKA 4PACA 3I5PA 1ZHFA 2R7TA 2XLDA 2OCEA 3WE2A 3WTYC 1W5TA 3JTLO 1FSHA 5CLSA 1A35A 3BY6A 3BG5A 2L3DA 1C02A 1U5TA 1OCTC 2DBBA 4RB1A 2ELKA 5DVWA 4OD5A 2R7XA 3ZMUA 4UY8I 1X1PA 3W2WA 1R1TA 1M56C 2VKHA 4Q4ZF 1R4MB 3HPGA 5F6FA 5EG0A 3C2GA 3MYFA 2QA4I 2KJGA 1X4PA 3CDHA 2Y39A 4N0BA 2L7KA 3F47A 3TP0A 2K86A 3E7LA 3EH2A 4C2TA 3ZVRA 2XM0A 4R79A 1TWAA 3TO7A 2JQ7A 5L0JA 1ZGAA 5IT9Z 1YW7A 3Q9SA 1IUFA 1Z6TA 4XR6A 1QHGA 4LLLA 4RM3A 4BBSJ 1LKXA 1O87A 1XB4A 3PIOF 1AUEA 2ZD9A 3H5NA 1MZBA 3S2WA 3ASOH 1HOMA 2ELJA 2Y48A 4QSHA 1PV3A 2EJRA 3AG2C 3GODA 2YPRA 4JTDB 5FRNA 5D5WB 1IN5A 4WGYA 2WAQN 2W00A 2XF5A 3IWZA 2W4SA 3S1RJ 4GFBA 3FK7A 2IA0A 1O4XA 4XBFA 1R58A 4XORA 3WHCA 4BJ6A 3C63A 5HDNA 1MD0A 2XHKA 4I99C 4AIDA 1ZQ3P 2IGOA 2L9VA 2JRTA 2ZSIB 2IOQA 4N9IA 2VPLA 4EM1A 1O3UA 4M3FA 2JVGA 2ZBKA 1RR7A 4NC6A 2HXOA 4X1EA 5L0IA 1ULYA 1S05A 1YLFA 4RGXA 4G7ZF 2YEVA 1R5GA 1YJGA 4MVUA 3OL3A 4WCGA 2LFBA 5BQTA 3M9AA 3M8EA 1LE8A 2C6YA 3HUGA 1J75A 2UUIA 1KGSA 4B44A 2Q9CA 2FA5A 3QOPA 2KRCA 4BQOA 2OU6A 1SYQA 3VYWA 5FFXA 3HNLA 5DCMB 1G5ZA 4YK5A 4A5MA 1T98A 1Z6RA 3OMYA 4NNJA 3ZQGA 2VOOA 3EH1A 3U5SA 1QGPA 3HNKA 2NOGA 2BE5F 2CQ7A 3CTAA 1TWCJ 5GAEJ 1JI8A 3EJNA 3HNIA 5D5XB 2R92J 4G8XA 2XPVA 3OS2A 2L7AA 3F6VA 3JRBA 1T01A 5TRDA 1H89C 3HM5A 5LHIA 1LS1A 1Z77A 2CH0A 3ECOA 4I1MA 4MS2A 4V2FA 1H9GA 1SFOJ 1UFBA 2J0WA 2C03A 2RNJA 1WWXA 2KFDA 2M8EA 2D1VA 3HEFA 4D5CA 2R7UA 3T4RA 2E60A 4E70A 3OYGA 4IL6C 1QA6A 2NVYJ 2V79A 3FM5A 3DKAA 2RSEB 2LMDA 2ZCWA 5BS6A 1J0RA 3K7AJ 3WE3A 3HL2A 3OYKA 5TISC 1T6SA 4HSTA 3HDDA 3QTHA 1DDNA 2CQNA 4KN4X 5FROA 1K05A 2GBYA 3U2RA 1J2XA 2KMUA 3SDGA 1MH3A 1ZG5A 5JVGF 2UUHA 2GWRA 1IRGA 4NB5A 1R9TJ 3U0CA 2OOCA 2MFZA 4BE2A 2DB4A 3CAXA 1IG7A 5FGMA 2ZKZA 4UV9A 3WAQA 1BOBA 3I4MJ 1B59A 2DFHA 3DXJF 4M3DA 2RNGA 4U0VA 3DM9B 3KH2A 1FP2A 3ABKH 5DYMA 3S3MA 3I55I 1MSEC 2DQRA 2RVCA 3C7JA 1HCRA 3EUKL 2PLYA 3A02A 3DTKA 2XAQA 1I6XA 3NRHA 1IN6A 1OCRC 1RC9A 2W57A 2IS6A 2J5OA 2R7QA 1LDJA 2KQ9A 2P7VA 4PGGA 1XC5A 1OCZH 4F52A 1S6LA 3I58A 1GXQA 2MBFA 1YJ9I 2NS7A 3QVZA 2X6XA 2CV2A 3JRMO 3W8HA 2M1BA 1FOKA 1ZYRF 2L2OA 3CMEI 1E3OC 3OSFA 3AG4C 2HZ8A 1FY7A 2FSWA 4DZPA 1VQMI 3A0HC 2XUBA 4II2A 3U1KA 2KP6A 4EJVA 1A7VA 4PJ0C 1M2VA 1TNSA 2R7FA 3FF5A 4G6QA 4LLGF 1K79A 2M5WA 4Y52J 4M9XA 4A3BJ 2XM4A 1V54H 4IVNA 4EM2A 3T0YA 2K3PA 2FD5A 3RDIA 1JKPC 1AEPA 4WABA 2RN7A 3PCVA 4D0PA 3KEQA 1CPQA 4BHPA 3LSTA 3R61A 3N0TA 4B48A 1CGNA 4LITA 1AKHA 2EPLX 2VLAA 1NK3P 2Q3TA 5IYBJ 1VTMP 3OYEA 3J80K 5DS6A 3SEQA 3BP8A 3LA7A 3NMKA 2DI3A 1D1AA 1UAAA 2CUZA 1YAUO 3OIQA 4NC3A 4RB0A 1S7AA 4F4BA 3D1NI 1ZHYA 1LVAA 2E1CA 4MVMA 1W7PA 2L7FP 2PFBA 2RC4A 3O6XA 2P6SA 2CW0F 3CLQA 1QPIA 4M6YA 2CUJA 4AD9A 4IOAF 3PO3J 3CQZA 3JRHA 1USTA 1I1SA 2EA2A 2TCTA 2G9WA 3TQNA 2W45A 1IXRC 2MG4A 3ZQCA 3GM1A 2F22A 5AIQA 4ZLCA 3R6SA 4I7HA 2DDAA 3BG3A 1P2FA 3UMKA 2NSFA 3K7DA 5FKMA 5EGOA 4GDFA 3S15J 4XLAA 4JURI 3CCEI 2IGMA 5JHUA 2O03A 3LSRA 4A93J 4U0WA 2OTLI 2PX3A 1EH8A 4B3XA 2BOLA 3AG1H 2ISZA 1IN8A 3HC7A 4JBAA 2YS9A 1F5TA 3JREA 3N2ZB 3OA1A 2LBFB 3K33A 1JPJA 3HOUJ 3HSFA 3O55A 1R1VA 2DYSC 1EKYA 3ZGKA 4BNCA 3SYNA 3HOYJ 1EA3A 5L3VA 4IHSA 1RRJA 2E1MB 5GADJ 2EINH 2QBYB 2DTRA 4IQ4A 4UV8A 3LA3A 1VF9A 1V5EA 5K5QA 4BU2A 1YZCA 1H88C 3JRTA 1HY5A 3FOOA 1MNDA 3L0IA 2VT2A 2VQLA 1QQIA 1WOLA 2GWWA 4WJ0A 2OQGA 4MFDA 1F36A 4YIFA 2EIJC 5K5RA 1FT9A 3JSZA 4XNFA 1PD1A 2QSFX 3HBLA 4AVPA 1ETOA 3F8FA 2Z15A 2ME6A 4G7HF 2ZC2A 2DCEA 2ZXIA 3JT1A 3TJ5A 1LNWA 1MMNA 2PN6A 3KLOA 3WG7H 2X0CA 1XCBA 4M6VA 4YELA 3JRGA 2YWAA 3KP6A 1YJWI 3LESA 3CESA 4MVOA 3T6JA 3C3WA 3I5QA 3M4BA 4ZYEA 1ON2A 1OXBA 3SFZA 4A3MJ 3MAJA 3P9CA 2OJQA 1SVMA 2CQXA 2K5CA 5LEJA 2AO9A 2M64A 1JKOC 2ACJA 2QY9A 3PNYA 3FXJA 5L3EA 2Y3GA 1FWZA 1WATA 5D5VB 3F0CA 4YJWA 1NBBA 4CS9A 1KQ8A 5F04A 5IT9K 3FHZA 1J8YF 1B4AA 4CA0A 4PFOA 3ZQVA 3VAYA 1VQ6I 2J7PD 1ORJA 2F4OB 3UKGA 4IOCF 2Z33A 1XGNA 4P6IC 3AG3H 2PMUA 2O61A 1A5JA 1TQMA 2F6CA 3OWTA 2Y2ZA 2A6TA 4EJOA 4WXHA 3HKKA 2WY8Q 2K9NA 2OUMA 1XMKA 3LSPA 4BACA 4EEFG 3S32A 1APCA 5E1ZB 4BXXJ 3W6JB 1NG1A 3ZRGA 3ASNH 1UB9A 5JLIA 4AU7A 2JA5J 1BC8C 2W7NA 3TBIA 2YX4A 1YFHA 2EWNA 2Z1DA 4M73A 3DAGA 3TQOA 3X1OA 2V4JC 3HHHA 3K1IA 1G4US 1Z23A 2N8GA 2R93J 3IL2A 2ELHA 1T33A 3Q0UA 2FNAA 3RYRA 2L9NA 5TJ5E 2OC6A 3B6AA 3S1MJ 3BT9A 2QM3A 4I98B 1EF4A 4E7HA 5F08A 3ZN1A 3BC8A 2OEXA 3BQZA 2I15A 4A2NB 1LPEA 3GVAA 4A3LJ 2OCCC 3P9IA 2DYRH 4DJ9A 5E17F 4I09A 1ODDA 3MKWB 2DN0A 2KIFA 3CCUI 5CI9A 3OOPA 2FNPA 4HF2A 5DCFA 1S9HA 2VKVA 1LUJB 3RTRA 1CQTA 4NDLA 3HRUA 1V54C 1UMQA 2EFQA 2E36A 3FKJA 2XPWA 5CQEA 1WJAA 4D4NA 1ZH5A 3PUBA 3BRJA 4JQFA 2XL8A 4RGUA 4I1OB 2Y0SA 1FMVA 2XAUA 1KU7A 4KT6A 2JT1A 2P4WA 2LKSA 3I4UA 1R1UA 1W36C 2LK4A 1TL8A 1XWJA 1BW6A 2IP2A 3RKYA 4JTCB 2W4MA 4N4OB 2FUG2 1UELB 5F5FA 1W7PB 3RQGA 2GIVA 5DD4A 4UUSA 1HKSA 3VYRB 3OS1A 3GTOJ 1RNLA 4Z9JA 2DA6A 1G3TA 5BPDA 4PJNA 1TT0A 4HPQA 3IHUA 4HEAJ 4XPWA 4GYIA 2K02A 4UB8C 5KYUB 1OFCX 4Z2YA 2G62A 3ASOC 3E6BA 3LS1A 3CCVI 4IPAA 3QU6A 1A7DA 2FQ4A 4CIPA 3RH3A 2MA3A 4HA8A 2YX7A 2CMPA 2DA1A 3H36A 4WXDA 2ZJQF 1IV8A 2HOSA 1JE8A 1N75A 4OIRF 4B8XA 2M0MA 1VB5A 2HTSA 1YYVA 5LFAA 1LB2A 1NU7D 1F1MA 4ETSA 3G71I 2GA0A 3U1DA 1RUNA 2IXNA 3WTSC 2E87A 2XKOA 4ABZA 4MW3A 3MEXA 3A2KA 1V4RA 2DK8A 3CC7I 3TMOA 3PHF2 3GZNB 3W3CA 3ABLH 1MQVA 2XRNA 2VQCA 2HYJA 2VC1A 2AS5F 3HKZN 4BQNA 4EATA 5A6KA 1FOWA 1MMGA 4ESBA 3V7SA 4K0DA 2I10A 3IAS2 2WVQA 4NY3A 3K4JA 1WRJA 3F3XA 4M6XA 4UUTA 4C3HJ 1YI2I 2JMWA 2Z3YA 2P7CB 4PFPA 3CCRI 1AKHB 1G8XA 1OCPA 2A3SA 1PP7U 3RQ4A 4M71A 1JKQC 1WWPA 2DMTA 1X3WB 3WGHA 5FD6A 4PCQA 3QW0A 2JSPA 2XLOA 4GGGA 3IQTA 2EPKX 5JT4A 4HEA2 1WJFA 5J6XA 1OISA 2ADUA 2A0UA 2BBYA 1VQ7I 2JPBA 2KRHA 3TW7A 2L9SA 2EIMC 1PP8F 3SEOA 5K7ZA 2KZGA 2LY9A 3MFNA 3D0SA 3ONQA 4MIMA 3UGOA 2W82A 3HKZA 1TW2A 3H3VK 4RAGA 1OJLA 2HI3A 3DF8A 3ATPA 3L7WA 3GYHX 5EEHA 5EG0B 2WA0A 4JRZA 1Q1HA 3WGIA 1YIOA 1YO5C 3S9OA 2K27A 2Y69H 3S1QJ 2X1CA 3Q6MA 1YRNB 2HQ5A 1DPUA 2O6GE 5K0IA 2A5YB 2M2EA 1P7JA 2RGVA 5LEKA 3REOA 2WB1N 2XC7A 1L3LA 1AHDP 2FE3A 2XVCA 3V7RA 4PJJA 1NZEA 2A68F 2IBFA 2DW4A 3S90A 3CUQA 3RVYA 1K4TA 2EIMH 5D92A 2DFFA 1X19A 3OYBA 4JX5A 2HNHA 4LK0F 2H8RA 1X1CA 2X0LA 4XKVA 5JR3A 1Q0MA 3HNJA 2HSBA 1VZ0A 5DEQA 3RW0A 4IHVA 1BW5A 2EPMX 3L2UA 4KYWA 1T6QA 5CYVA 5A2QZ 3PFIA 4CGZA 1FAPB 1J8MF 2MGQA 2NUTA 3ZG1A 4NC8A 1DU0A 1GGQA 2DODA 2OZ6A 3SZGA 1Z5ZA 2FGYA 5JSLA 1RESA 1B6AA 3KYIA 4JW1A 2H94A 4HF0A 2ZXOA 3JZ0A 3ECHA 1T8IA 2QQ8A 1KQ9A 2QYOA 2FMYA 1K6OA 4O3MA 2IAIA 2XB0X 3GXOA 1NFNA 1TFKB 4B09A 2VN2A 4MO7A 1K83J 4NQWB 5DM6F 3TGNA 2XAHA 5GP9A 2H6CA 3LWFA 3G4SI 2K85A 3ZTMA 4KIGA 4YL1A 1Y6DA 1PD0A 2P0NA 3HUGB 1UG2A 1HW5A 5CVIA 2O9LA 3BJOA 1OCRH 1T39A 2MD0A 1AOYA 1BDJB 2JRMA 2VXZA 4R8HA 5FB2A 2XRHA 3C1DA 3CJTB 1QO0D 1B8IB 1MMAA 1DUXC 3M4OJ 3VWBA 2DJNA 2QUFA 2Z2SB 5CIVA 3KYCB 3FK6A 1VYKA 2EV5A 3W8IA 3OYMA 5BOXA 3NEUA 2VONA 3C18A 2IXOA 2F5VA 2PJPA 2HFHA 1XCVA 1HSJA 5A6BD 2PF4E 4C3BA 3HXLA 5A2QK 3KZZA 1FLIA 1MBHA 1JAFA 2ETHA 5E3OA 1S29A 3NWTA 2VASA 4FTHA 2HV7A 3FMSA 1IXCA 1XZPA 4RGRA 2KZVA 5GAHJ 3EGXA 2L4MA 2NXNB 3CMYA 2VCBA 2Q00A 1SFUA 2WADA 2WZFA 4EIYA 2E35A 2QNLA 4ZDOA 2OF7A 1HW2A 1ZN2A 2BVLA 3OOUA 1LE4A 1DPRA 2ZJPF 3RIPA 4X0RA 5J1YA 3AGTA 5EJCA 2V26A 2LFFA 1TP4A 4B1RA 2DOAA 3CCQI 1BIBA 1H9TA 1K40A 2G3VA 4RA2A 1ZR2A 3K4BA 3CDIA 3AKZA 3F6OA 5IP7J 2XRLA 5LHGA 4XMYA 2WBMA 2STWA 3H0GJ 5J1RA 4MQVA 1QLEC 1R49A 1W7PD 1DGWY 2VCCA 2D5RB 1K7AA 4Q7CA 2GDCA 1MW7A 2FRHA 1YZAA 3ZP5A 2HMZA 4JOMA 3DPUA 1KONA 5TGTA 4A0ZA 3KP5A 1YJNI 4XSXF 4UVCA 4JJFA 3RVZA 1AVOB 1Y1WJ 1XD7A 3SXYA 3GORA 3M1CB 1YIJI 3GTMJ 3K9TA 3ERMA 4UDVA 2G0EA 2DA3A 4IB4A 4S0HB 1GV2A 1R4NB 3TOBA 3LEOA 4JCHA 1M2VB 3DE9A 1ZR4A 2G7UA 3FKIJ 4UUVA 3DKWA 2H09A 1IZ1A 3DM5A 1TWHJ 2LTPA 3FXUA 3RCOA 1W0TA 1OW8A 1G3WA 3E97A 2FFHA 3DWWA 3T5XA 2PQ8A 3B0VC 1ZARA 4BQQA 2M34A 4E6KG 3H0DA 3CC4I 3I71A 2LF7A 2KPMA 3IQ6A 3H9GA 3PIPF 3KP2A 1ZGWA 2EIJH 3JYYA 3H9QA 1HXDA 1YA9A 2OTJI 1A41A 5JRAA 3SXMA 3EPZA 3QODA 2BHYA 2DFEA 4B3AA 1PUEE 4JIOA 4L18B 5COFA 4XLHA 4H0EA 1POGA 2CS3A 2BC5A 5IY5C 4Z9HA 2IJLA 1YW8A 1IN4A 5K1YA 2IT0A 4G7OF 2YQYA 4KMFA 4XQFA 4CHUA 4JX4A 1ZU5A 1V4AA 3H92A 3LSMA 2G3KA 4KIBA 3EPVA 4S05A 2HJMA 2IXPA 1QZEA 3RPUD 2XDVA 3B6CA 3QMKA 2P1AA 4AIKA 1Z7LA 1M1EB 3IUOA 3QU3A 4MGRA 3FX3A 1DGRM 4AVZA 4CCLA 3BZCA 1ACIA 3RZDJ 2XS1A 4JEAA 5DUIA 3U9JA 2H1KA 3ABTA 4CS9C 3IRRA 1HSTA 1UHSA 1EV7A 4IAQA 3QOEA 3OR1C 5CVRA 3LLIA 5DS5A 3WHBA 4B4CA 2ZMEB 4AM3A 4EKWA 1V5FA 4AC0A 1U6GA 2QCOA 4D4XA 4KIFA 1A36A 5GTHC 1UFMA 2I8DA 1HBXG 2V1UA 2EIKC 4ONSA 3K1HA 3NARA 4IJAA 1FZPB 4KICA 5K5OA 2J9WA 4ZDLA 4ENNA 3KP7A 2X6YA 2ECBA 3JSOA 2WV0A 5B66C 4XL9A 3MKYB 3NRVA 3TL4X 3MKZA 3L8IA 5HV9A 4UVAA 1NHAA 1PDNC 1A0BA 1TLHB 2QGUA 4CBEA 3I4NJ 2QBYA 1BL0A 3LS0A 2LF8A 2EK5A 3ZQHA 2P6VA 3GTLJ 1FTZA 2JA8J 4AL1A 4DW6A 1KU2A 3NMJA 3S84A 1Q0KA 2GA2A 3I9V2 2XXAB 2WVNA 1WJDA 5E33A 5E3MA 3BG7A 3LLKA 3JAMK 2RDPA 3S29A 4F93B 3IKTA 2DAOA 2W1OA 2X9DA 5M3MJ 5A6JA 1WI3A 5A6BA 1U8BA 5D4RA 3KZIC 2V1DA 1Y6IA 1FEXA 1G59A 2X6WA 3C8GB 2J45A 1Z9CA 2D2WA 2R7SA 2HEOA 3G1MA 4K7BA 4U5HA 1R5ID 4Y33A 2D4UA 3QP6A 5EZHA 3GZ6A 4FQGA 2OEVA 1FOYA 1T6UA 4XONA 5CVVA 1Z7UA 3FBIB 3OYJA 4KBLA 1HC8A 1OKKA 2HYFA 1CGME 1QHHD 1I39A 1PJRA 3OS0A 1SAXA 4YT4A 5DS4A 3OL4A 1PUFA 2L6GA 3N97A 3KFWX 2E5ZA 2R7DA 2KRFA 4N4NB 2JJ7A 2K3FA 5HDKA 4E7LA 4LDQA 4B47A 2VODA 1MIJA 2YLIA 3IQ5A 3JYHA 1UZCA 3A0BC 4KN7X 4WX9A 2D5VA 2EBIA 1XGSA 4GXOA 3ZQFA 2B7EA 2M4GA 2Y0SN 2VKEA 3CUOA 2DT6A 5E20A 1D3YA 4YT8A 5KYYB 3EUAA 2IRFG 2CFXA 1KU9A 2LFDA 4ON0A 3VOEA 4I0BA 1EQ1A 4Y7NJ 2PBIA 1X2MA 2HR3A 3J7ZI 1GUUA 4CDAA 2GAQA 3JCUC 5IP6A 4IHTA 4XQ1A 5JVEA 1ORKA 3L1PA 2Z9OA 2EZHA 2Q1ZB 2YL0A 4CCNA 4OIQF 2NOJB 4CXFA 1OYYA 2ZNZA 2RV8A 4MTEA 2WV1A 4GYTA 5FD5A 1IZMA 5E3LA 3MBGA 3G2BA 2A0BA 3BWGA 1VNDA 4RLQA 1VQPI 2DLLA 1ZVZA 2E1NA 4XN3A 3K6BA 4E0HA 1X58A 2LY2A 5EHHA 3S1NJ
chains in the Genus database with same CATH topology
1MJ9A 1UCRA 1W5SA 1G4DA 1IN7A 1XGOA 2UZKA 1I5ZA 3B73A 1KYZA 4M9SA 4Y13A 4ESFA 2WWYA 4BQAA 1SFEA 4ZZLA 4EJTA 3WTTC 1SD6A 4XLNF 3ABUA 3GFMA 3ZPLA 1ZRFA 2NS0A 4FX4A 3BPVA 2JTVA 1LEAA 1FBQA 3I4PA 2E7XA 1X3UA 3ISPA 2AXLA 4KUMA 2FOKA 3DP7A 2DQLA 5HS9A 5D8KB 3DPTA 3HYIA 2F5EA 1IXSB 3GFLA 3KLNA 4IRHA 4I2OA 2ISYA 2VBWA 5KVRA 5L3GA 2OBPA 1LEBA 1TW3A 5JFRA 2QQ9A 1L0OC 4U7DA 3RI4A 4P55A 2CQKA 3GUDA 5J8CA 3RYPA 2QZ8A 3RKWA 2MH9A 5HOOA 3SXZA 2XV4S 2M87A 4A0XA 4O6JA 2FU4A 5TJJA 3TDZC 3CO7C 2HDCA 2QQAA 2Y75A 5ED4A 2KJCA 1CF7B 1I1GA 4GYGA 2NNNA 4LFUA 4HYEA 1BI3A 1XSVA 3ZN0A 5D6EA 3WODF 2CGPA 3HRSA 3QPTA 3EQLF 1BC7C 2BYVE 3TOAA 2MLGA 2Z99A 1P4WA 2DPUA 2COMA 5E1WA 1R00A 3I59B 1KQ0A 5E18F 5H20A 2OU2A 2ZXJA 3O6BB 4EVIA 1HQCA 4FHTA 5HVQC 4DQ2A 4JK1X 4R1HA 4HV5A 1SMTA 5DD8A 6PAXA 3EUHA 3SZPA 4A2UA 2DO7A 4UNOA 2H6BA 1EH6A 4EQQA 2HZTA 2P7VB 3B02A 1P4XA 4ASNA 1FYLA 2FEZA 1ZRCA 2P5VA 3I59A 5D5UB 5FFZA 4WXCA 1IRFA 4LB5A 1HKTA 3RIRA 4U88A 2P5KA 2BV6A 2W85A 4AIJA 1C0WA 2LKPA 2KIUA 2HTJA 2J5PA 3CLOA 5ICGA 1FYMA 2IA2A 4UXNA 4UHTA 3MQ0A 3JTHA 5LGUA 2XAGA 5JVTA 1T0FA 2FBKA 4MTDA 4MEYF 5E1XA 1XSXA 4EV0A 1A04A 1O7FA 3I0TA 4KDPA 2DK5A 2P6TA 3E6MA 2Q2EA 3DEUA 3ZMZA 4MNUA 1OYIA 2F5DA 3WG9A 3HRTA 2WTEA 2Q8KA 1WKMA 3CJNA 3RPUA 4XLPF 3WU1B 1QPMA 2XIGA 4LK1F 4RGSA 3E5XA 3DV8A 1R36A 1Z05A 2MD5A 4HDVA 1TQPA 2LDUA 1Y0UA 3EYIA 4ZYDA 4WWCA 2P8TA 3FWEA 2XGXA 4L9JA 2PMHA 3FXRA 2GXGA 1BI1A 3L9FA 1F1ZA 4NHJA 3MWMA 4L5JA 2HS5A 2HKOA 3IKVA 2A6HF 1J5YA 3TDUC 5ILVA 1CGPA 4HZFA 5ICFA 1BN5A 3HSEA 3HSRA 2HQRA 1XDUA 3DFGA 5HLHA 5HLGA 5LRSA 1GXPA 2UWMA 5LBQA 2EFOA 3L2CA 5DDGA 4ZYHA 1J59A 1LDKB 2L4AA 2CG4A 1FX7A 2HGCA 1IW7F 2M45A 3I53A 1SD4A 5E8IA 1MJBA 1QZYA 2DT5A 3PQJA 5IT3A 3LQRA 5ICEA 1RUOA 1YW9A 1RIOH 5L3BA 4G6DA 2O3FA 1YTYA 4F7ZA 1SMYF 3CUQC 3IWFA 3DQVC 3RJPA 3L09A 2OA4A 2R3SA 4EJWA 2TDXA 4AWXB 4HLXA 3P9KA 4A0YA 4CYDA 5L3DA 2QWWA 4A5NA 2Y0MA 2MH2A 3BROA 3G3ZA 1D5VA 4I01A 3ELKA 3HOTA 1TQIA 3M8FA 2OD5A 2VE8A 1XN7A 4CICA 3V4GA 2L01A 5ILSA 3G73A 1AWCA 4UVBA 5J8FA 5CVJA 1ZGJA 1OR7A 2KKOA 1T2KA 3I64A 1HW1A 2XAFA 3VB2A 3BZ6A 1BOAA 5EEGA 3WTVC 2BGCA 2A69F 2FBHA 4EGZA 4HQEA 3L00A 3IC7A 3K2ZA 1OYWA 4RB3C 2YU3A 3F22A 2ZFWA 1O3QA 2HKXA 4Q47A 1I27A 3HIFA 1YS7A 4QWQA 3F8NA 2CWEA 3LAPA 4FX0A 1WI9A 4FT8A 3Q5FA 2CSOA 1Z91A 4YFNF 1G6NA 4OMZA 2VC0A 5LGNA 1REPC 3FMQA 4HLYA 2FQ3A 3DPLC 3RPQA 1USSA 1XMAA 3K0LA 1V3FA 2PI0A 1O3TA 1RZ4A 3HTSB 5JI6A 4YFXF 4BXUA 5DCMA 3GLXA 3GFIA 3V8LA 1MGTA 1K78A 2FXAA 4HX8A 3NQOA 3V8KA 4WF2A 3GFJA 4OMYA 3VFZA 1U3EM 4HQMA 1U5TC 3TO9A 3SXKA 2OQRA 1S7OA 1DP7P 4P5OA 1O7LA 2LSOA 5KK1A 1LQ1A 4KT5C 2JZYA 4P9UA 1BI2A 2VBXA 1XGMA 1BI0A 4L0ZB 1MDMA 3COAC 1YG2A 1FYKA 2VT3A 3BOQA 2ESHA 3LAJA 4ESJA 1S3JA 5L3CA 2EB7A 5LHHA 1U2WA 2V1XA 2IVMA 3JAMZ 1ONVA 2M30A 2D1HA 3AAFA 4M9ZA 2VBZA 3KE2A 3F21A 1FC3A 3QRFF 3K1PA 2O8XA 4Y17A 3MZHA 1H0MA 3KEOA 1BBYA 2QLZA 3V7CA 2BEOA 3EETA 3F8MA 4BHBA 1STZA 3V8JA 3MCZA 2P5LC 2B0LA 4BHCA 3FZVA 3WTUC 3GZ5A 3VEPA 2LNBA 2E7WA 1IF1A 1U5TB 1WSUA 1FNNA 3HOSA 1KA8A 2NRAC 3EYYA 1LDDA 3KCCA 4I02A 3WGGA 4ZH4F 2IPQX 3QPHA 3HRMA 2VOPA 3GW2A 5AONA 4L9TA 2X4HA 1SFXA 2IA1A 2F2EA 3LA2A 4AIHA 1MJAA 3R60A 2DFIA 3IRQA 3W6KB 3JW4A 1G3YA 4P96A 3WTZA 1OPCA 2IW5A 1ZRDA 3EDPA 3SQNA 4CZZA 1YQAA 2WC2A 1B1BA 3I54A 2HWVA 4RS8A 1JHFA 1F9NA 4BYYA 4LGWA 1E2XA 2VBYA 1J9IA 1FBUA 1R5HA 1FPQA 4M72A 4XRFA 4TV7A 1SD5A 3F8BA 4HAMA 1TTYA 2XAJA 3M7GA 4IF4A 2HOEA 2FF4A 3R0AA 4A12A 2GXBA 1P6RA 4EGYA 1U8RA 2GQQA 3ZQ7A 1T38A 4LJZF 4HOBA 4P9FA 3U9GA 2F5CA 1K78B 3GO5A 3WU0A 4PGHA 3KP3A 2D45A 3ERED 4OIOF 3FM3A 2RQPA 2L02A 3J7AO 1ZLJA 2QVOA 4ZZDA 5FLXZ 4EJUA 2CO5A 5BMZA 1FP1D 4LB6B 4HDUA 1BIAA 4ENJA 1R23A 3GF2A 1KU3A 2EA4A 3E5UA 5LGTA 5BPIA 5F1RA 1MDMB 2EV6A 2EFWA 2CYYA 4HBLA 1UHWA 1BJAA 1XDSA 4U7BA 1SD7A 3BJAA 2PG4A 3GWZA 1YS6A 3ZMVA 3I5UA 3MZYA 1GHCA 5HDGA 1ZREA 1JGSA 1IUYA 3CUQB 2L54A 2W84A 1FSEA 5L3FA 1MKMA 2ZO4A 1G3SA 2W24A 4K2EA 3J81Z 3ZMSA 4LG0A 3SHFA 1XSDA 3N4MA 4RB2C 4OU0A 5HS8A 3HHGA 3TKYA 1IAWA 4M74A 2K4BA 3LQQA 2STTA 4A6EA 4YIIA 4LD5A 1CF7A 4KFCA 3TO6A 3WTWC 4GCVA 4YG2F 4HX4A 4OOIA 4DNCA 4LG0B 1QZZA 1ZG3A 2NNYA 1ZLKA 3R0JA 1B9NA 2OAZA 2QQBA 4N9HA 2RKHA 2ZMEA 1F4KA 5D6FA 3KP4A 4BH9A 3J81K 4GO1A 1OMIA 3GX4X 2GZWA 3T1BA 2GA1A 3F8CA 4O5VA 3O3KA 4ENKA 2UXNA 3FXQA 2V6CA 2NAZA 4ZYGA 4YFKF 2YR2A 3E6CC 1U78A 2EFNA 4BAYA 4OIPF 2Q0OA 1O3RA 2K7LA 2A61A 5D4SA 4L5IA 3SZTA 3BJ6A 3KETA 3ZMDA 1VTNC 1P92A 2UXXA 4XSZF 4QLCU 4LLNA 4I0AA 2EFPA 4HV6A 3ROUA 1O57A 4HX7A 3LFKA 2Z5UA 5LLQA 4KMUX 2XROA 5AIPA 3ML6A 2KIMA 3E3VA 5ERIA 4OINF 4PDKA 3H3ZA 1OKRA 3O2PE 2KJBA 2OZUA 3J80Z 4LMYA 2H27A 2FBIA 3RKXA 3PQKA 3GEZA 4IRIA 1FBSA 4RAYA 3E5QA 1HKQA 4MQ9F 4IRGA 1KYWA 4EM0B 1ON1A 3E6DA 1E17A 5CJ9A 3K1NA 5D8LB 4CO8A 3OV8A 2JSCA 2FMLA 4A6DA 4MEXF 1BM9A 4PZJA 4L0YB 2VE9A 5DUKA 3R4KA 1TNTA 2A07F 2ZNYA 3CO6C 2XKPA 4S04A 1GVJA 2QENA 4G9YA 2EV0A 3M1EA 1R22A 4IXAA 3ZMTA 5ILUA 4U0YA 3F23A 4Q5SF 2O0YA 1RI7A 5H6QA 1D8KA 3KZYA 3QP5A 3F72A 4NQWA 3Q9VA 2F5FA 2ESNA 3T8TA 5E8GA 1QBJA 3BPXA 1WQ2A 4KNYA 4L9NA 4KA4A 2K4JA 1UHMA 3VODA 4RAZA 5CVUA 1ZAOA 5HLIA 2HYGD 1W4MA 3H3UA 3T8RA 1Z1DA 3K1MA 2PEXA 4MHGA 2ZJ2A 5H6RA 2V9VA 4HW0A 1ZG1A 1D8JA 5LRRA 5DV5A 1R7JA 1LJ9A 1O3SA 4L9VA 4Q48A 3P7NA 4CDGA 1P4AA 1TBXA 3K69A 2MLKA 5FLXK 3FMRA 1QNTA 1JHHA 3D5LA 4HF1A 5F64A 3BDDA 2DPDA 2DU9A 1EH7A 2HQNA 2JPCA 2YSRA 4WK8F 4ENMA 1J7KA 1JXSA 5ICCA 3MFKA 4Y15A 3JTGA 2W25A 3JSPA 3QAHA 2A6EF 3ULQB 3HTUA 2XASA 3WTXC 4G94A 2GAUA