3SXYA

Metal-free full-length structure of tm0439, a metal-binding fcd family transcriptional regulator
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
201
structure length
201
Chain Sequence
RTKVYNLLKEMILNHELKLGEKLNVRELSEKLGISFTPVRDALLQLATEGLVKVVPRVGFFVTDVDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVEKSAKREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, GntR family
publication title Metal-free full-length structure of Tm0439, a metal-binding FCD family transcriptional regulator
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 83
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3sxyA01
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxyA02
1GXQA 2ELHA 2DI3A 5LRSA 1XD7A 3CUQB 2LF7A 2H27A 3U1DA 3AAFA 5K1YA 5LHGA 4P9FA 2VBZA 2W57A 1HW2A 1RI7A 3K1MA 2COMA 3J81K 3G3ZA 1D3YA 4U88A 1TBXA 5HLGA 2XGXA 5FGMA 3K9TA 5E1ZB 2WTEA 3EDPA 1W7PB 2XAFA 5HDNA 3IKVA 2K86A 1W5TA 4HW0A 2D1HA 4FHTA 1UHMA 2CW0F 3R4KA 5DYMA 4BHCA 2HQRA 5ERIA 4ESFA 3FZVA 4WK8F 2R7DA 2Z9OA 1MGTA 2PLYA 1B9MA 5FD6A 5ILSA 1G3YA 2P7VB 4YIFA 1YG2A 4RB0A 3BPVA 4I98B 3V8KA 3U9GA 3FHZA 3C7JA 1B6AA 3WGHA 2OAZA 3HYIA 3BDDA 2H09A 3F8MA 2XROA 5CJ9A 4LG0A 2CO5A 2FBHA 3R60A 4KN7X 2FNPA 5D6EA 4WXDA 1S29A 2BBYA 3MZHA 2LSOA 1Z6TA 1BIBA 4WXHA 3SHFA 3COAC 4EJTA 4Q48A 1IUYA 3PQJA 1ON1A 1ZREA 3P9KA 1ZGJA 1U2WA 2KIUA 1TQMA 1YW8A 4DNCA 2FEZA 3ML6A 1Z7UA 4RB1A 1ULYA 3GW2A 3OV8A 4MNUA 4LK0F 4I0BA 1ZLKA 1T98A 3N97A 1YS7A 2BYVE 1Z6RA 4G8XA 2KJBA 1FSEA 3JTGA 2B0LA 3MQ0A 3TDUC 4ENNA 3RYRA 3ZMVA 5E8IA 3M8EA 2P8TA 1FBQA 2PMUA 1V4RA 3LAPA 4KNYA 1HSJA 2J5PA 4HLXA 1BJAA 5L3FA 1WSUA 4XBFA 1LEBA 2CWEA 3J7AO 3O2PE 4HA8A 1JHFA 3C1DA 1J9IA 5AIQA 2DTRA 2QVOA 3CTAA 4IVNA 3FMRA 3LA3A 1F1ZA 3KCCA 1BI0A 4Y15A 1CF7A 1O7FA 2F5DA 2EFWA 1O3SA 2DAOA 4UVCA 2LF8A 5DCMA 3K69A 1IRFA 2ISZA 3KFWX 2FXAA 4I7HA 1CF7B 5ICFA 2EV5A 1TW3A 1UFMA 1FSHA 1KA8A 6PAXA 4ZZDA 4Z2YA 3T1BA 2HDCA 2GAUA 4IHTA 5A2QK 2YR2A 4EGYA 2CFXA 5E1XA 4HV5A 2C6YA 5H6RA 3FM3A 1JXSA 2MD5A 4CO8A 1J59A 4JK1X 1D5VA 3D0SA 1T2KA 3KZZA 2GXBA 1RNLA 1R5GA 1ZRDA 5L3BA 4S04A 1L3LA 3V8JA 1QNTA 4HDUA 4A0ZA 3LQQA 1W7PD 4IRGA 4ZZLA 2M30A 4G6DA 4A6EA 4HLYA 4MEYF 3IHUA 3SFZA 4F7ZA 3GFMA 2HTJA 5HDGA 4CGZA 3QP6A 1KQ9A 2RNJA 2XAHA 3QOPA 5JR3A 5HS9A 3KEQA 3I0TA 1H0MA 3R6SA 2XKPA 3F6VA 2KKOA 3BPXA 1XSDA 5FLXK 2PQ8A 5HOOA 3SZPA 5DCFA 1QZYA 2O61A 3LFKA 2FU4A 2Y75A 1P2FA 2KRFA 3EETA 1J0RA 3V7RA 4AIKA 3JSPA 1MDMA 5LLQA 4BXUA 4LB6B 1LVAA 3KLOA 1K6OA 5D8KB 3I64A 1KYZA 2FNAA 1BI1A 3KP6A 4M6XA 3HSFA 5F6FA 3KP7A 2KIMA 2K02A 1Z05A 2A69F 2DFIA 4KT5C 4GGGA 4KICA 1V3FA 3ZPLA 2YSRA 5FFZA 2A3SA 2H6CA 3HHGA 2P7CB 1YIOA 1OYIA 1WQ2A 3L9FA 3MAJA 3FXUA 3E5QA 2ZMEA 1LDKB 2H94A 4U7DA 3F8NA 3ERED 4GCVA 5JHUA 4RB2C 1Z91A 5ILUA 3RYPA 3SXZA 4WX9A 5IT9K 3IWFA 3DF8A 1D8KA 2VOOA 4WXCA 1G3SA 2JRTA 4CICA 4N9IA 2VE8A 5HDKA 2NNYA 1B1BA 1YFHA 1AWCA 5F1RA 2GA1A 3TO7A 3TGNA 2EJRA 3DXJF 4AWXB 1IW7F 2Y0MA 4UVAA 4L9NA 4EQQA 4M73A 3EYIA 4L9TA 1DDNA 3ZN1A 5D5WB 3WGGA 3LSTA 4BHBA 1FYMA 3ZMDA 3ZMZA 3V7SA 4ZH4F 2QQ9A 4KYWA 2YX7A 2W25A 3GZ5A 3DEUA 5FFXA 3P9CA 5CLSA 2V1XA 4U0WA 2RGVA 4G7HF 4A2UA 2EFOA 2IT0A 4CHUA 2RDPA 2OZUA 1YTYA 5KK1A 5HS7A 2DPUA 2HS5A 5D6FA 4IF4A 4KIBA 2XIGA 3PFIA 5D5XB 1RIOH 1T39A 3IC7A 3ISPA 5J6XA 2VBYA 1SFEA 4HZFA 2MA3A 1GXPA 2IPQX 2DBBA 2NS0A 4S05A 3LA7A 4BAYA 5LEJA 2VN2A 2Z5UA 1I6XA 2HYGD 5E1WA 3SZTA 1OKRA 2DT5A 4YFKF 2UZKA 3I5UA 5IT9Z 4XSXF 3GVAA 5F64A 4L0YB 4OIOF 3RI4A 3TOAA 2PI0A 2DO7A 3JW4A 2XASA 3BROA 4LB5A 1XSVA 2PG4A 3F6OA 4MTDA 3GX4X 2RQPA 4U0VA 3P7NA 1S6LA 2L3DA 2FBIA 1IN8A 1SAXA 2QZ8A 3HHHA 2QM3A 4MQ9F 3WTUC 2VBXA 3CO6C 2HR3A 4OMZA 5D4SA 4FX0A 2XVCA 2GIVA 3M8FA 4HV6A 1FYLA 4G94A 4MGRA 3HRSA 1HW5A 2ZNZA 2LKPA 1MJAA 5TJJA 3SXYA 1I27A 4HOBA 3W6JB 3TOBA 2JZYA 5FD5A 5KVRA 2NAZA 1XMKA 1RZ4A 1RUOA 5D4RA 4EVIA 3TQNA 2L02A 1TTYA 4EJVA 2A68F 1SD7A 2J5OA 2VONA 1EH7A 5DDGA 2EA4A 5CVRA 2R3SA 1IN6A 4OOIA 1F9NA 4RGRA 5L3GA 1BIAA 3WODF 3KP2A 3ZMSA 3GO5A 4EM2A 3WGIA 4A5NA 2PMHA 1R1TA 1KU7A 3T5XA 1TLHB 2VT2A 5AIPA 2P5VA 2FRHA 5E20A 3ZP5A 2ZCWA 4IHSA 5FO5A 2QUFA 1S8NA 3F22A 1XGMA 2HTSA 4G7OF 2A5YB 5K5QA 3SXKA 4ASNA 1HKQA 4LG0B 4KDPA 2HGCA 1W4MA 3EQLF 4FT8A 3W6KB 2FF4A 2IW5A 4ZYEA 3QRFF 2XAQA 4EV0A 2WV0A 2OBPA 5H6QA 4H0EA 2EV0A 4A6DA 1SFUA 1VTNC 3F21A 2JPBA 2CQKA 3L09A 3WU1B 3IKTA 4LJZF 3HUGA 4R8HA 1G3TA 1L0OC 4IXAA 5CYVA 1JHHA 5DD8A 2ZBKA 3GZ6A 3I54A 3D5LA 2ETHA 4BH9A 1FY7A 3NQOA 3G73A 3ZMUA 3LA2A 4LLLA 2CSOA 1WKMA 1K7AA 3MEXA 3WE2A 5D8LB 4ENJA 2Q2EA 2Z3YA 1HBXG 4KIGA 4RB3C 4L5IA 2O3FA 2ADUA 2EFPA 3DPTA 1QBJA 1QO0D 1KU3A 3E6MA 1ZARA 3V7CA 5L3CA 2KJCA 1LB2A 1XB4A 2D2WA 2OQGA 1LQ1A 1J75A 2PJPA 1WRJA 3ZMTA 3B73A 3FF5A 1TNTA 4EJUA 2XHKA 2QYOA 2BE5F 2F5FA 2RVCA 2YX4A 1IXCA 4WWCA 5CVVA 3QPTA 2HEOA 3BY6A 3J80Z 2QWWA 4HBLA 5DCMB 1XDUA 1XGOA 5LGUA 3RDIA 1AOYA 3I53A 2M8EA 3KP4A 2EFNA 4M6YA 1MJ9A 4HQMA 4M74A 3E97A 3KP3A 4CXFA 3EYYA 1YYVA 3FXQA 3MFKA 2HZTA 1IN4A 2W24A 2FOKA 3ELKA 2Z33A 2NNNA 4YG2F 3F23A 1XMAA 1YW9A 3F3XA 1CGPA 1UHWA 4HX7A 2FQ3A 4L18B 4GO1A 3E5XA 4HF0A 1MZBA 2ZKZA 1FT9A 3FXRA 3MCZA 3QAHA 5IT3A 4HF2A 2RN7A 4XLNF 3E5UA 5LRRA 1H9TA 5E18F 1U78A 2K7LA 1S3JA 1XGNA 4I0AA 1IXRC 2HKOA 2MBFA 3F8BA 3M7GA 4RAYA 4GYIA 2P4WA 3ROUA 5HVQC 3SXMA 2QENA 3RKYA 3ULQB 1USSA 3K1PA 2RV8A 3WU0A 2F5EA 3I59A 4JBAA 1U5TA 2E7XA 3PQKA 1ZAOA 4YFXF 3H3UA 4K2EA 3K0LA 1BM9A 2V6CA 1IN7A 3NEUA 3I59B 2FE3A 5LEKA 1G4DA 2STTA 4PCQA 2RKHA 3HSRA 5EEHA 2X0LA 2W84A 1R00A 3BOQA 2IRFG 2XV4S 1P4XA 4UNOA 2Y48A 3WTSC 2TDXA 1OR7A 1MDMB 4A0YA 3NRVA 2HOEA 1ODDA 3E6DA 2YPRA 1G3WA 2IVMA 4CYDA 3JTHA 1UB9A 3KLNA 1ZN2A 4RGSA 2P5KA 4HAMA 3JAMZ 2P6SA 4P5OA 1B9NA 3I71A 2VT3A 1MKMA 1R22A 2GWRA 1TQIA 4RGXA 2M45A 4GXOA 3REOA 5LHHA 4N9HA 1DPUA 3GF2A 3GUDA 3K1NA 4LFUA 1REPC 3TDZC 3DV8A 2O6GE 1KU9A 3P9IA 3Q5FA 1BI3A 2ZMEB 1U6GA 3LQRA 4PGGA 2D45A 3C18A 3CO7C 4M9SA 2V1UA 3ABTA 4L5JA 1NHAA 1HKSA 1K78A 1O57A 4O5VA 3E3VA 4UV9A 1FNNA 5LGNA 1KU2A 1R36A 2MC3A 5CVIA 2WWYA 4HX8A 3GWZA 1BC8C 5L3DA 4U7BA 1XN7A 1Z9CA 3RPUA 2MLKA 2ZXJA 3HRTA 4I09A 2PEXA 4EGZA 5DUIA 5AONA 2RC4A 1C0WA 2JT1A 2P6TA 3GXOA 3RPQA 1EV7A 2O03A 1KGSA 1ZLJA 1J2XA 4EJWA 2HYFA 1S7AA 3FMSA 2EK5A 1XCVA 1FOKA 3QPHA 4KMUX 2DK8A 2QBYA 4P9UA 5TRDA 3VODA 3HRUA 4RGUA 4R79A 2L4AA 2VC1A 1U8RA 3IWZA 3IRQA 1ZYRF 2EFQA 3VEPA 1DUXC 3CDHA 3WTVC 4OIQF 2DW4A 2DQLA 3GFLA 3RJPA 2VODA 2LDUA 2V1DA 4ETSA 1IRGA 4ZYGA 3O6BB 4M9XA 3RTRA 3JSOA 3LAJA 3CJNA 5BPDA 3DP7A 1YS6A 1U3EM 1PP7U 1EH6A 5DD4A 1IN5A 2K4BA 1STZA 2JSCA 4AD9A 2VBWA 5ICGA 3N4MA 5CVUA 4IRIA 2E1CA 3LWFA 4G7ZF 1FP2A 1BBYA 2M87A 5LBQA 3R61A 4ESJA 2BV6A 2E7WA 3QU3A 4NQWA 3KZYA 4M72A 4I01A 4HF1A 1FC3A 3CUQA 4B09A 2L4MA 2NRAC 1BN5A 4YFNF 5CVJA 1USTA 3S2WA 1QPMA 3EUHA 1ZRFA 1A04A 2STWA 3L00A 5HLHA 2HFHA 4ENKA 2R7FA 1ZG3A 4I2OA 1ZG1A 1KQ0A 2NYXA 2EB7A 1FBUA 3FWEA 1IAWA 3KEOA 1IXSB 1BC7C 2ZJ2A 3BZ6A 3B02A 4UVBA 5ED4A 3V8LA 2AS5F 2KIFA 1O3QA 1I1GA 3HSEA 2ESNA 3HOTA 1W7PA 2A6HF 3BJOA 1R1UA 2ZNYA 2OD5A 5HS8A 3DQVC 4L9VA 1EH8A 4IPAA 4BHPA 5J8CA 2QLZA 4ON0A 1J5YA 5BOXA 4BYYA 5D5UB 4XSZF 3R0JA 3E6BA 1T38A 2LNBA 3HTUA 4A12A 4LLGF 1OPCA 2EWNA 4PGHA 3VOEA 2PN6A 1PDNC 2G9WA 4ZYDA 1SMTA 2OU2A 3GFJA 2JPCA 1BI2A 5K5RA 3BP8A 4CDGA 2IJLA 5E17F 4KN4X 1TQPA 3J80K 2M5WA 4TV7A 1HXDA 2VXZA 2MH2A 3ECHA 3ECOA 4YIIA 1Z1DA 2EA2A 2ZFWA 1WWXA 1YLFA 4IJAA 4O6JA 2DQRA 3IRRA 4B8XA 3R0AA 1JGSA 4P55A 2VC0A 1T6SA 1R7JA 2P5LC 1F4KA 1FBSA 4KA4A 3U2RA 2IP2A 5E8GA 1I5ZA 3HIFA 3J81Z 1FWZA 1P6RA 2EV6A 1B59A 3L7WA 4LK1F 4AIJA 4LD5A 1U5TC 2PFBA 1SD4A 4OIPF 1K79A 3DKWA 4HDVA 2GQQA 2FMYA 3O3KA 2XAGA 4OINF 3WG9A 3T0YA 4RS8A 2Z99A 2ZO4A 1B4AA 3MZYA 4MQVA 5D5VB 4EM1A 4L9JA 1BOAA 1SD5A 2DU9A 1FZPB 4MTEA 4AVPA 4M71A 1FX7A 2XRNA 1ZG5A 4EM0B 4IRHA 4Y17A 3WTTC 4QWQA 1QGPA 4KUMA 3T8RA 2HKXA 1JE8A 4UHTA 1YO5C 1ZH5A 2VOPA 3Q9SA 4G6QA 4MEXF 4CZZA 2ISYA 2A07F 2OQRA 1O7LA 2V79A 3IL2A 2UXNA 3GLXA 2F5CA 1XDSA 2HWVA 2A61A 1LDDA 2FBKA 3KETA 1FP1D 3WTZA 3FM5A 2IA2A 4HQEA 5L3EA 4BQAA 4OU0A 1GVJA 2F2EA 2WC2A 3M1EA 1J7KA 4DQ2A 1S7OA 3OOPA 3RKXA 5HLIA 2O0YA 2QQBA 1FPQA 1HQCA 3CLOA 1KQ8A 4HX4A 3SQNA 4LMYA 3FX3A 4WF2A 3WTYC 5JVTA 3JAMK 2FMLA 5BQTA 2V9VA 4U0YA 5FB2A 1MJBA 2O8XA 1I1SA 1XGSA 2FA5A 1DP7P 3WTXC 2GXGA 2IA0A 2XKOA 2CG4A 4UXNA 1E2XA 3QU6A 1TNSA 5J8FA 2H6BA 3KP5A 3VB2A 1OYYA 2GZWA 5BPIA 2E1NA 3I58A 3VFZA 2AXLA 3F72A 2BGCA 1GHCA 2A6EF 3HRMA 3BJAA 4Y13A 1D8JA 4PZJA 4QLCU 4EJOA 1FLIA 4ESBA 4Q47A 1SD6A 2FSWA 3GFIA 2K4JA 4XLPF 4BNCA 2DPDA 2DLLA 2W85A 1P4AA 3E6CC 1IZ1A 3M9AA 2XAJA 1U5TB 2MH9A 4M9ZA 4KMFA 2OZ6A 4JQFA 1XSXA 2MLGA 5BS6A 4WCGA 4UUVA 3TO9A 1SFXA 5ICEA 1R1VA 4E70A 4NHJA 4L0ZB 4OMYA 4NB5A 1XCBA 4RAZA 5ILVA 5DEQA 5DV5A 3T8TA 2DK5A 4ENMA 5H20A 3K2ZA 3ZN0A 2IA1A 3H3ZA 5A2QZ 2Q0OA 4UV8A 1R5HA 3F8CA 1ZGAA 5BMZA 1YQAA 3HTSB 3CUQC 1OMIA 5EEGA 1LDJA 2G7UA 3BWGA 1Q1HA 3TKYA 3GEZA 2Q8KA 2XUBA 1LEAA 5LGTA 2GA2A 2YU3A 2ESHA 4LLNA 4MHGA 4A0XA 1P92A 5JFRA 3KE2A 5LHIA 1T0FA 2JTVA 4A5MA 2K27A 3I4PA 1K78B 3GYHX 1LJ9A 1W5SA 1R58A 2VE9A 2CGPA 1ON2A 4O3MA 3F8FA 2M1BA 5JI6A 4FX4A 3CUOA 5ICCA 3H92A 1LNWA 4Q4ZF 2ACJA 2UXXA 1Y0UA 1X3UA 5FLXZ 3MWMA 4KIFA 4G9YA 4OIRF 2L01A 2QQAA 2L54A 3DFGA 1TW2A 3L2CA 1FYKA 3TO6A 1O3RA 1R23A 4D0PA 5K5OA 1PUEE 2QBYB 1IF1A 3WE3A 3V4GA 3ABUA 4R1HA 4I02A 4XRFA 1F5TA 2UWMA 3C3WA 3DPLC 1G6NA 3WTWC 1ONVA 4N0BA 1HSTA 3RKWA 1H9GA 4PDKA 2CYYA 1WI9A 1DPRA 4LGWA 3ZQ7A 3HOSA 1O3TA 3Q9VA 1PP8F 4GYGA 3QP5A 1ZRCA 5DUKA 1HW1A 1QQIA 1HKTA 1P4WA 2HQNA 4HYEA 4Q5SF 1E17A 1RUNA 1SMYF 3FMQA 2X4HA 1YW7A 4ZYHA 4AIHA 1ZHFA 4EMSA 2PBIA 4KFCA 1MD0A 1KYWA 1UCRA 2D1VA 2OA4A 1QZZA 2BEOA 3BJ6A 2G7HA 3RIRA 4P96A 1OYWA
chains in the Genus database with same CATH superfamily
1GXQA 2ELHA 2DI3A 2LCHA 5LRSA 1BL0A 1XD7A 3CUQB 1TKNA 1DU6A 2A1DD 2LF7A 4AYBA 2Y9ZA 2H27A 3U1DA 3AAFA 5K1YA 1YYJA 2YL1A 2ME0A 2R7RA 5LHGA 4OD4A 4P9FA 2VBZA 2DYRH 4YT4A 2W57A 5A6JA 5IY5C 1ZK8A 1HW2A 4D4NA 4AE4A 3VWBA 1RI7A 2Y0SA 1YZAA 4CJOA 3K1MA 4V19K 2COMA 1UJ8A 2LIGA 1HDPA 3RVYA 4MW8A 4QPOA 3PNTA 3EG9A 4N4NB 1OKKA 1VQPI 3D1NI 3J81K 3G3ZA 2HQAA 2QQ8A 1D3YA 3WHNA 4JTAB 3VRCA 4BS9A 4U88A 1YOVB 3M79A 3S90A 4PJJA 3PSFA 4J00A 2L6GA 2WAEA 1TBXA 2UUIA 2ZSHB 1JPNA 2Y31A 5HLGA 2BL2A 3EG9B 2XGXA 4HEAJ 4E7SA 3RIPA 5IP6A 1Y6IA 2QKMB 3BG6A 5FGMA 4QPQA 3K9TA 3DM9B 4GEHA 4FAPB 3L2WA 5E1ZB 2WTEA 5M3FJ 2KC3A 3EDPA 1TWGA 3DJUB 1TWHJ 1I3AA 1W7PB 2XAFA 5HDNA 1JKRC 4BUPA 3IKVA 5DQZA 5JUAA 2XS1A 2LTPA 2K86A 1W5TA 4HW0A 4NC8A 3BR5A 3S1NJ 2D1HA 1RC9A 4FHTA 2QSHX 4IEJA 5KHDA 4PJLA 3GTGJ 1UHMA 5CQGA 1NSGB 2CW0F 2DFFA 4E7IA 3R4KA 5DYMA 2XSDC 2JK3A 2VQLA 4BHCA 4N4WA 2CUJA 2HQRA 5ERIA 2ZXWC 2YLDA 4ESFA 3JRFA 2BY3A 2M8GX 2YVKA 4LDKA 4J7TA 3FZVA 3OYIA 1QLEC 4XKCA 1GUUA 5FLVA 4U5CE 2R7WA 3S93A 5F28E 4WK8F 1P7JA 4P1WA 2R7DA 5M3MJ 2Z9OA 4PSWA 2V26A 1MGTA 2PLYA 3G4XA 4ULVA 4B48A 1Q0GA 5CIVA 1B9MA 3FKJA 5FD6A 5ILSA 1VYIA 4CCMA 1VQ4I 4C3BA 1WJBA 1G3YA 4E7ZA 5E2QA 2P7VB 1OCTC 3GWLA 3B9QA 3OL3A 4YIFA 1YG2A 2LR8A 4RB0A 3K2AA 4BACA 2XL8A 2XGDA 3BPVA 4EEFG 4O6YA 1UG2A 4I98B 3V8KA 1X3WB 3U9GA 3ABKH 1OCRH 3FHZA 1POGA 1OXBA 3AG2C 1FIPA 2V1NA 3C7JA 1H88C 4BJTA 1PD1A 1B6AA 1Q1VA 3WGHA 5F1JA 2OAZA 3HOYJ 4U9DA 4X0GA 4YIRX 1A31A 3HYIA 1ZU5A 1WZ2A 2CCYA 3BDDA 1RRJA 2DOEA 3GTKJ 2H09A 3F8MA 5IOYA 2NUPA 3K66A 3L1MA 2DOFA 4JOMA 4HFKB 2XROA 5A69A 2LYCA 5CJ9A 4LG0A 1O5HA 1MNDA 2CO5A 2DYSH 3LSIA 3SJMA 2FBHA 2Y3BA 3CDIA 1IGNA 4B6IA 3R60A 4KN7X 2FNPA 3NMJA 3EH1A 5D6EA 1SVOA 4WXDA 4W8PA 3PNVA 3AQBA 4CJGA 1S29A 1QVXA 2JSPA 4HNTA 2BBYA 3MZHA 2WVNA 3JYHA 2LSOA 2E2HJ 1LS1A 4LITA 2QNLA 2VLAA 1E3OC 2X1CA 1Z6TA 1BIBA 5IOZA 2K9LA 4WXHA 2EZIA 3X2QH 3SHFA 3DKYA 4XLEA 5JLXA 3COAC 1HC8A 4EJTA 4Q48A 1B72A 5TGTA 3PQJA 1ON1A 1IUYA 1FMWA 2IM8A 1ZREA 3RPUD 3P9KA 3T6JA 1ZGJA 3AG4H 5E3AA 3IUOA 1G4US 4U5DE 4JVSA 1U2WA 2KIUA 1TQMA 1YW8A 4DNCA 2FEZA 3ML6A 1FOWA 3AL0C 1Z7UA 5J4YA 2Y39A 4F91B 1Z63A 3M1CA 3SYTA 2JUCA 3K4KA 5DTDA 4RB1A 2DMPA 4A3EJ 2DA6A 1M2OA 1ULYA 3U8VA 3GW2A 2EZHA 3OV8A 4YN0B 1RKEB 2ZJRF 4MNUA 1T8IA 1BBHA 4LK0F 1JTXA 4I0BA 1ZLKA 2KRCA 4E18A 4E7HA 1T98A 5BQIA 3CZ6A 3N97A 2EPNA 1YS7A 2BYVE 3FHNA 4JCZA 1Z6RA 4G8XA 2WAQN 4CCLA 3BG3A 1MNEA 2KJBA 1FSEA 1N25A 5EG0B 3ZQHA 2AHQA 3V42A 1VFCA 2NG1A 3JTGA 4XEFA 3G6EI 2B0LA 3MQ0A 2JRMA 3TDUC 4XN3A 3RYRA 4ENNA 5FROA 2XRHA 3ZMVA 2O9XA 5E8IA 3HJCA 4Z9JA 4JX4A 2DA7A 3VSLA 3GWNA 3M8EA 3NWTA 2P8TA 1FBQA 2DA3A 2ZXHA 4KJZA 2PMUA 1V4RA 1VQ6I 3K7DA 3LAPA 1UMQA 2ZXOA 4KNYA 2VCBA 5DQTA 3TW7A 2HFIA 1HSJA 2J5PA 4HLXA 4XKVA 3RKQA 2W4BA 4WGYA 1APLC 1BJAA 4HSTA 3TD7A 2CV2A 3U8PA 2B7EA 4GFBA 3CMYA 3LLIA 5L3FA 1WSUA 3CCYA 4XBFA 4JJGA 1LEBA 2E1MC 3I4UA 2E2JJ 1T08B 2CWEA 3EGXA 1R49A 3JYYA 4DVZA 5JP7A 3J7AO 3NAUA 5DM6F 1C17M 2BC5A 3O2PE 3IEEA 4HA8A 1JHFA 2HOSA 3C1DA 1J9IA 1AVOB 5AIQA 4YT5A 3QWLA 2DTRA 3QQAA 2QVOA 4DYQA 1X2NA 3I3LA 2BVMA 3CTAA 5IY5H 4BEHA 3VYSB 3SYNA 2CYDA 3NG1A 4IVNA 3FMRA 3Q3SA 1VLTA 3LA3A 2M7BA 4NBQA 2KFDA 2QE9A 2YL7A 1F1ZA 3JCUQ 3KCCA 2V6EA 3GTOJ 3BCBA 2MWQA 1BI0A 3ATPA 2CNWD 2B9SA 3QW1A 2CU7A 4Y15A 4B3XA 3NKDA 1CF7A 1O7FA 2F5DA 2EFWA 3QPSA 1O3SA 4BBSJ 2DAOA 2P81A 1CGNA 2GAQA 5L0GA 4UVCA 3HLZA 1N78A 2EIJC 1RJ9A 1Z77A 1W2WA 2LF8A 5DCMA 3K69A 1IRFA 1YJ9I 3V5YA 2ISZA 1BR1A 4CSAC 2IXOA 4AUXA 2Q4FA 3KFWX 1HLVA 2FXAA 4I7HA 2Q3TA 1SYQA 2LMDA 1CF7B 1WHUA 2LFDA 5ICFA 1YVIA 2EV5A 2D5RB 1ORKA 2DFHA 2LKSA 4NY3A 2Q1ZB 3CJRB 2F6CA 4GYTA 1TW3A 5GADJ 1UFMA 4C2TA 1FSHA 2XLWA 3OYBA 1B8IA 3FK6A 2E34A 1KA8A 2QEXI 6PAXA 5EK0A 3W6VA 4ZZDA 3Q7LA 2L2OA 4Z2YA 3PIPF 3T1BA 2HDCA 1L3PA 1HA8A 1T0FC 2GAUA 3TMOA 2GXAA 1T6IA 4IHTA 5A2QK 2YR2A 2JD3A 4EGYA 3FOOA 2ZXWH 4CS9A 2WL8A 2CFXA 3KYIA 5E1XA 3O10A 4HV5A 4D7NA 4ZYAA 3DAFA 3IH2A 3EHNA 2C6YA 2BOLA 3E1SA 1WH5A 5B66C 5H6RA 3FM3A 1JXSA 4A3CJ 1ZHWA 2Z15A 2MD5A 4CO8A 3LSMA 4AIDA 1J59A 2NUTA 3MZ8A 3QOEA 3BTCA 3TP0A 5E3MA 1HE1A 1JJ6C 2HU9A 2K3PA 1IJWC 2NOGA 2C03A 4JK1X 4S0HB 1D5VA 3JSZA 3D0SA 1T2KA 2M7AA 3KZZA 3FBNB 5F5HA 2GXBA 1RNLA 4RLFA 3NYJA 1R5GA 3U9MA 3AG2H 3VYTB 4ZJZA 1VQNI 1ZRDA 4BQOA 5L3BA 3SDBA 4S04A 1L3LA 2OTJI 5TISC 3NDBB 2CH0A 3V8JA 1QNTA 3D5SC 4HDUA 1U6HA 4A0ZA 4RD9A 3ABMH 3LQQA 3UKGA 3CCRI 1W7PD 4IRGA 1EA3A 2VKDA 3E7LA 3HBLA 4ZZLA 5COMA 2LBFA 4GRIA 3DMDA 2M30A 3H5NA 4ZTFA 4G6DA 5J3LA 4A6EA 3JRHA 4HLYA 3C8GB 1AKHA 4KC9A 2V4JC 3CF2A 1D1CA 1R5ID 4MEYF 3IHUA 3SFZA 3UNGC 4F7ZA 3GFMA 1JI8A 1FEXA 5L3VA 2MFZA 2HTJA 3EGDB 5HDGA 2OKUA 3SZRA 3EZIA 3FBIB 4CGZA 4KBLA 3QP6A 4RDAA 3A4CA 5COGA 1KQ9A 2F48A 2RNJA 2XLDA 3W2AA 2XAHA 2VKHA 3G50A 3QOPA 5JR3A 5HS9A 1A7VA 3KEQA 3I0TA 1H0MA 4BJ5C 1VQ5I 4LIUA 3OYAA 3CESA 3BTIA 1TWCJ 3R6SA 2XKPA 3F6VA 4CCOA 5IYDJ 2KKOA 1WCMJ 2L7FP 2LLKA 3BPXA 2DDAA 3SEZA 1CGME 5B5EC 1XSDA 3T6BA 3FXHA 5FLXK 1YX3A 3EUAA 4C3HJ 5GTIC 2PQ8A 5HOOA 3SZPA 5DCFA 1QZYA 2O61A 1WJCA 4IQ4A 3LFKA 1PD0A 2FU4A 2Y75A 4XOTA 1MW7A 4EATA 1P2FA 2KRFA 3EETA 1S05A 1J0RA 1SANA 3V7RA 3L0IA 5B3SC 4AIKA 3JSPA 5CQEA 1MDMA 5LLQA 1W1WE 5E3LA 4BXUA 3Q7GA 3BEHA 2R7QA 5E33A 4LB6B 4XR6A 5AGFA 4XQFA 1LVAA 3KLOA 3OYLA 1TL8A 1K6OA 4KI2A 3K6BA 2EIMH 5D8KB 2PF4E 3I64A 1S9HA 1KYZA 2DA2A 2FNAA 1EA8A 3H5AA 3KKBA 3LESA 2E1MB 1HE9A 2YEVA 1BI1A 2LRDA 5IYBJ 3KP6A 1LIHA 2DCEA 4M6XA 2DT7B 1AUEA 5F27A 3HSFA 3VYRB 2XGEA 5L3QA 5F6FA 3DU6A 3KP7A 1V54C 5BNGA 5D92A 2KIMA 2G3KA 1UG0A 3M4OJ 2K02A 1Z05A 2ZB9A 2L6HA 2A69F 2DFIA 3IP4B 4KT5C 3KIOA 3E0JB 1RR7A 2DGJA 3K1IA 4BEJA 4GGGA 4KICA 2ECCA 4JX5A 5EDNA 1V3FA 3ZPLA 2CW8A 2FAPB 3FHDA 4G12A 3RW0A 3IAM2 2V9KA 4CSAA 3HL2A 3S1MJ 2IYLD 2YSRA 5FFZA 2VJJA 3K4NA 1J8MF 2A3SA 5EZGA 2H6CA 1K61A 3VM6A 3HHGA 2P7CB 1YIOA 1OYIA 1WQ2A 1JUSA 1K6YA 4II3A 3L9FA 1KNYA 2ZXIA 2JA5J 3MAJA 1N75A 1X3ZB 4MNDA 2EPFA 3FXUA 2F5VA 1RR8C 3A01A 2EINC 1TWHA 3E5QA 2QY9A 2ZMEA 3K33A 3CJQB 1LDKB 2H94A 4BE0A 4U7DA 1JR8A 3F8NA 3GM2A 2HNHA 2JQ7A 2LREA 3UMHA 1MQVA 4I1MA 3ERED 2EIJH 4GCVA 5KYUA 5JHUA 4RB2C 3VYUB 1NFOA 1P9QC 3EPVA 2R5ZB 3MLGA 1Z91A 5ILUA 3RYPA 3RQIA 2WVQA 4NUBA 1E3HA 2HVSA 1ZW3A 3SXZA 3L8JA 4WX9A 5IT9K 3IWFA 3KL4A 2VC9A 5KYYB 3DF8A 1D8KA 2Y3GA 4D9JA 2VOOA 4WXCA 5HODA 2ASRA 5FKMA 1G3SA 1XX5A 2JRTA 3BR1A 4MVZA 3ZCOA 4CICA 5KCMA 5EGYA 4N9IA 3H2VA 2VE8A 2RREA 4XMYA 1RESA 3ZXSA 5HDKA 1GS9A 3G4ZA 3SP1A 1GVDA 1QHHD 2DA5A 4JTDB 1O4XA 3SZGA 2NNYA 3BR0A 1B1BA 3TOMA 2ECBA 1I3QJ 1YFHA 1T6QA 1AWCA 5F1RA 1Y1WJ 2E71A 2GA1A 2IS1A 2OJED 3TO7A 4E6KG 3JRMO 2V3CC 5KAFC 3TGNA 2EJRA 3ZC4A 1CQTA 2P61A 5KYXA 2J46A 2IXNA 5EJCA 1UG7A 5F04A 3OEOA 1V74B 3DXJF 1J09A 5KYWA 2E35A 1MMAA 3K7AJ 4AWXB 4DOZA 1IW7F 2XSJC 2Y0MA 4UVAA 1Z7Qc 4L9NA 4IHVA 3BLYA 4EQQA 3HOXJ 4M73A 3POVA 3ZQGA 1ETYA 2QSFX 3EYIA 4L9TA 1DDNA 3ZN1A 5D5WB 3WGGA 2ZJPF 3LSTA 4BHBA 1FYMA 3ZMDA 2DDBA 3JRCA 3ZMZA 3V7SA 2J9WA 4DRIB 1RKTA 3KYDB 4ZH4F 1ERDA 2QQ9A 4KYWA 2YX7A 3QODA 3U21A 1ETVA 1WPKA 2W25A 3GZ5A 1SC7A 3NMIA 3DEUA 5FFXA 1Y1VJ 1X1CA 2MD0A 4RMNA 3P9CA 5CLSA 3CCMI 3I4NJ 4M3EA 2IBFA 4BKXA 2V1XA 4U0WA 5COFA 2P1AA 3FXOA 3RF3A 4LIVA 1F36A 2RGVA 4MTGA 4G7HF 4A2UA 2EFOA 2R4GA 2XB5A 1A35A 2IT0A 4MVRA 1E86A 4CHUA 2KL4A 2RDPA 2OZUA 3ASNH 4MVOA 3BZKA 1Z3IX 4CA0A 4A2NB 3CLQA 1YTYA 5KK1A 5HS7A 2DPUA 3S32A 5F0HA 3W8HA 2HS5A 4I99C 5D6FA 2IS4A 1LFBA 4IF4A 3TULA 4KIBA 2XIGA 3PFIA 2VIXA 5GPAA 5D5XB 4A3JJ 2R03A 1RIOH 2YL3A 3S0XA 1T39A 3IC7A 1OW8A 2AVKA 3ISPA 5J6XA 2OUMA 2WV1A 1FFTC 3OYGA 4P9TA 2VBYA 1FOXA 1SFEA 4HZFA 2MA3A 2KPMA 3VPRA 2OG2A 1GXPA 2IPQX 2DBBA 2QLAA 1BOBA 1XWJA 4A4AA 2NS0A 4PSXA 4S05A 4AX2A 3MMYB 3LA7A 4BAYA 5LEJA 4O79A 1AEPA 2M34A 2VN2A 4LACB 3IQCA 3E70C 1I39A 3ZSUA 2WB1N 2Z5UA 1PCXA 1I6XA 2HYGD 3RQFA 3OIPA 4UB8C 4N6HA 3MD2A 2JUGA 5E1WA 1BW5A 3SZTA 2I15A 3RZOJ 1OKRA 2DT5A 1OCCC 3CCUI 3E9VA 2KQRA 3WG7C 2V7FA 4YFKF 4C30A 3K70C 2UZKA 1SEUA 2MHRA 4CYCB 2UV1A 3I5UA 2GM4A 5IT9Z 4XSXF 3GVAA 2CGEA 3GTJJ 3ZWIA 3FXMA 2ME6A 4FTHA 3GEHA 1T5OA 1WATA 2K3FA 5F64A 4L0YB 4OIOF 2Y30A 3RI4A 3TOAA 2PI0A 1OW7A 5B3SH 3DWLE 3H9GA 1NU9C 5A6BD 1VTMP 3CCJI 2DO7A 3JW4A 1TWAJ 1R71A 3DE9A 3C8GD 4PFPA 2XASA 2PX0A 1TZLA 3ZQIA 3BROA 2YKZA 3FAPB 3IPMO 3MX3A 4JKVA 3GBGA 4LB5A 2YHSA 1XSVA 3R2PA 2PG4A 3F6OA 2NXNB 1LKXA 3QZCA 2X9DA 5LD2C 1YARO 5L0JA 4MTDA 3GX4X 4YL1A 1D5YA 2RQPA 1T6UA 4U0VA 2XF7A 3P7NA 5GPGB 1S6LA 3CCSI 4G78A 4DBQA 5K0IA 3GMEA 4PJNA 4NDLA 2L3DA 4W8KA 4A3DJ 2FBIA 2K5CA 1IN8A 4XORA 1SAXA 2QZ8A 2YLGA 1MSFC 3CDLA 3HHHA 2QM3A 5T3WA 4ABZA 4MQ9F 5A6KA 5E79C 3WTUC 3L2QA 3HGGA 4JP0A 2VBXA 3GTLJ 3S27A 3QYEA 4U5FE 3CO6C 4QIWN 2HR3A 1JKPC 4OMZA 5D4SA 1LVKA 4FX0A 3J7AY 4CIPA 4G0HA 2YS9A 4AE4B 1YX5A 4PUSA 4FE4A 4U87A 3GM1A 2WY7Q 2GIVA 2XVCA 3M8FA 2NVUB 5HLTA 1RCPA 1Y6DA 5DVWA 3S14J 4HV6A 1FYLA 3TOLA 4G94A 1FR0A 3OMYA 2YLIA 1VI0A 4MGRA 3HRSA 1NH3A 2L9JA 1HW5A 2ZNZA 2LKPA 4BE1A 1MJAA 2YRFA 4NCQA 5TJJA 2XXAA 1EQ1A 4A3IJ 2EINH 1H89C 3SXYA 1I27A 1HDDC 2CS3A 3RFYA 4HOBA 4QTRA 4UB6C 5EF6A 2LC2A 4XLFA 4FWVA 2R0QC 2K85A 3W6JB 3OIOA 4BXFA 2J8WA 4YL0A 1W0TA 3HKKA 1ZELA 3Q6MA 4DBRA 3HB9A 4M3FA 1HF0A 4E17A 3TOBA 1FIAA 2JZYA 4I6ZA 5C44J 4YT8A 1VQ7I 5FD5A 3JSEO 1Y8QB 2IGMA 2M2EA 3DLAA 2IGKA 3OYFA 5KVRA 2H8AA 3SEOA 1M1EB 2NAZA 4JZAA 3ONQA 3GTQJ 1XMKA 1RZ4A 3FKIJ 4KISA 1J8YF 3S17J 1SF8A 4DRJB 5BUOA 1RUOA 5D4RA 4EVIA 2D5VA 3O39A 3W2WA 3TQNA 2L02A 3OOUA 1TTYA 4EJVA 3HGYA 2A68F 5K7HA 5J1YA 2DXIA 1SD7A 2J5OA 2VONA 1IZMA 1VNDA 3W3CA 1EH7A 4W97A 3DEWA 4XNFA 5DDGA 1K4TA 2EA4A 5BQHA 3DLLF 5CVRA 4E4HA 2R3SA 1IN6A 4OOIA 1F9NA 4RGRA 5L3GA 1JGGA 2HDDA 1BIAA 2Q00A 1IRXA 2XS8A 2CQNA 3SNHA 3WODF 3KP2A 4CIHA 4C7OA 3S2DJ 3ZMSA 1OCOC 3GO5A 2L7MP 5HNHA 2LFFA 4FCYA 4EM2A 3WGIA 2DOAA 3A0HC 1X1AA 2MG4A 5C4JJ 2W82A 4A5NA 1U9OA 2CDQA 1Y0NA 3QW0A 2ZD9A 2PMHA 1R1TA 1R9TJ 4CS9C 5GAHJ 3LSPA 1KU7A 3T5XA 4QI0A 1MMGA 2BW3A 1MH3A 1TLHB 4U5GA 2VT2A 5AIPA 2P5VA 3OYCA 1YZCA 2FRHA 5E20A 3ZP5A 3QVZA 2XF5A 5JLIA 2ZCWA 3Q0UA 2XPVA 5EGOA 3MN2A 1TP4A 1IO2A 1T56A 2MGQA 4IHSA 2DMUA 3BT9A 5FO5A 2QUFA 1S8NA 5DM7F 3F22A 2R7ZJ 2KZGA 3EH2A 3ZGKA 2GWWA 3QTHA 1XGMA 3M8JA 2EBIA 2M3AA 5EGOB 2CRGA 2HTSA 2HSBA 4G7OF 2A5YB 4ZC3A 5K5QA 2NUPB 1I6HJ 3SXKA 4JTCB 4ASNA 2JA2A 1FMVA 1HKQA 2CUZA 4LG0B 3C63A 1QU3A 4KDPA 5GTHC 2HGCA 2HYJA 1W4MA 2LD5A 3EQLF 4WGZA 4FT8A 2A05A 3W6KB 2W4SA 4BDZA 5T1DB 2FF4A 2A0UA 2IW5A 4ZYEA 2N8GA 3GEEA 4Y52J 1TWCA 3QRFF 2OF7A 4F93B 5L0CA 3H1CA 2EILC 2XAQA 2L81A 4EV0A 2WV0A 1ZGWA 2OBPA 3ZQVA 1MNMC 2XLMA 3HPGA 5H6QA 1U0BB 5J4VA 2EV0A 4H0EA 4A6DA 2VASA 1B72B 2YL0A 1G59A 4RLQA 1SFUA 1VTNC 3IQ6A 4O6MA 3AQCA 2Q7RA 3F21A 1L7CA 1OCPA 3V5XA 2JPBA 1V4AA 3KMIA 3TJ5A 2XC7A 5CI9A 2VCAA 1Q0KA 4KT6A 1QA6A 3G2BA 2CQKA 3M1CB 3L09A 1CGOA 3CC2I 3G71I 1M2VA 1Z23A 3WU1B 3IKTA 2M64A 4LJZF 3HUGA 4WJ0A 3WHBA 2Y2ZA 4R8HA 1ETQA 5GAEJ 1APCA 3ABLC 1OISA 1G3TA 2QGUA 2YQYA 5C3EJ 1L0OC 3WG7H 4IXAA 3DM5A 4YELA 2CV1A 1JT6A 1LS4A 1NG6A 1EKYA 5CYVA 1JHHA 5DD8A 2ZBKA 3GZ6A 2HZDA 3NYMA 3I54A 3D5LA 2ETHA 2ID3A 4BH9A 3AGUA 3OYKA 5JSLA 1FY7A 3HJEA 1FTTA 2OQMA 3NQOA 5HV9A 3HUGB 2QA4I 4BY1J 3G73A 3A9CA 3GODA 3ZMUA 3PFYA 3LA2A 3DD7A 2D4UA 2VQCA 4LLLA 1VYKA 5AC5A 3K10A 3BCAA 2CSOA 5KAIC 2W1OA 1WKMA 5IYCJ 4NTBA 3ZG1A 4MLOA 1K7AA 1K83J 2WB1A 1NZEA 3MEXA 2K9SA 3WE2A 1DQUA 1I50J 2CMPA 5D8LB 4ENJA 3KPHA 1VOMA 2Q2EA 2Z3YA 4DJAA 4KIGA 4RB3C 1HBXG 1GT0C 4H4KC 2NS8A 4L5IA 4N4OB 2O3FA 5EEAA 4CBEA 1FOYA 2ADUA 3GTMJ 2W00A 2EFPA 3DPTA 1QBJA 1QO0D 5M5YJ 3F0CA 2GA0A 3H3VK 1KU3A 3E6MA 3EGXB 3N0TA 1ZARA 2J0XA 3QYFA 3V7CA 5L3CA 2KJCA 1LB2A 1XB4A 2I8DA 1PUFA 2D2WA 2OQGA 3BR3A 1LQ1A 3ITFA 3LNRA 2LH9A 3CCLI 1J75A 2PJPA 1WRJA 3ZMTA 1VQKI 2OV7A 3B73A 3BG9A 3FF5A 4BEHB 1TNTA 4UUTA 3S1QJ 4EJUA 2XHKA 3K1IC 3B0UX 2QYOA 2XPWA 3OYNA 2BE5F 2F5FA 3H5RA 2RVCA 1IG7A 2YX4A 4U5EE 1IXCA 1EJ9A 1Q0MA 5F5FA 2BHYA 2K9MA 1YRNA 2WVOA 4HNUA 4WWCA 5CVVA 3LOCA 3QPTA 2O5RA 1E0EA 2EIKC 2EPKX 3GTPJ 2AWCA 2HEOA 2GIZA 2DTZA 3BY6A 1MBEA 3J80Z 2QWWA 2G3VA 2J7PA 3UGPA 4HBLA 1RJ9B 3KH2A 5DCMB 2ZMEC 1XDUA 4E0HA 1XGOA 5LGUA 3OYEA 3RDIA 3J7ZI 1AOYA 3I53A 3TEDA 3ECSA 5JVEA 2M8EA 3KP4A 2R5YA 3DBRB 4MW3A 2EFNA 2AO9A 5GP9A 4I1OB 4M6YA 1MJ9A 2JVGA 2ZFUA 1YDIA 1ZW2A 1ENHA 5DS9A 4Z9IA 2V9PA 4HQMA 5C4XJ 4M74A 1B8IB 5DS6A 3JR9A 3HNLA 3E97A 3KP3A 3FK7A 4CXFA 1S5LC 3EYYA 2CW7A 3MBGA 4BJ6A 2TRTA 3B71A 1YYVA 5F0CA 3FXQA 3HC7A 3MFKA 3AFHA 2CQXA 1IV8A 2HZTA 4X0RA 2VJ4A 5JS5A 1IN4A 2W24A 2G0EA 4DYRA 2GLOA 4G6TB 1MMDA 2FOKA 3HNJA 3ELKA 2HPIA 3U5SA 1OCOH 2RD9A 2Z33A 2NNNA 4YG2F 3F23A 2A5WA 1OLTA 1XMAA 1YW9A 3F3XA 4MO7A 4AC0A 1CGPA 1UHWA 2ETSA 4HX7A 2FQ3A 4L18B 3JRBA 2W4MA 1Y8RB 4GO1A 4C9YA 4PFOA 3E5XA 4RAGA 4HF0A 4M6VA 2GOXB 3RH3A 1OKKD 1MZBA 2ZKZA 1FT9A 3DTEA 2QUPA 4LLCA 2NUTB 3FXRA 3OWTA 1UFBA 3MCZA 1HMOA 3DBHB 3QAHA 5IT3A 4AM3A 3FIWA 4HF2A 2PJRA 2RN7A 2KRHA 3HZJA 4XLNF 4A3LJ 5JVGF 3E5UA 5LRRA 1H9TA 4BQQA 5E18F 1U78A 2K7LA 4EUKB 3X1OA 3JZ0A 3L8IA 1S3JA 3BG5A 2EH3A 3HOVJ 3HEFA 1XGNA 4I0AA 1IXRC 2HKOA 2MBFA 4FETA 3W4YA 3F8BA 3M7GA 3PM1A 4RAYA 1JJ8C 2LY1A 4JW1A 2X6OA 1TFKB 2KW3C 1SFOJ 1T95A 1RETA 2LBFB 4GYIA 2P4WA 3ROUA 5HVQC 5M5XJ 1EKEA 1MIJA 3SXMA 2AP3A 1DGRM 1WWPA 2QENA 1AKHB 3RKYA 3ULQB 1USSA 2L5QA 1GGQA 3A11A 2IXSA 1MMSA 3HKZA 4U5HA 2UUZA 3K1PA 5L0HA 2RV8A 1V5FA 3WU0A 2L9VA 4E7LA 1OQYA 1VQ9I 1ITYA 2EILH 3D5RC 2F5EA 3I59A 4DYCA 3HNIA 3U3FA 2LG4A 3PSIA 4JBAA 1R4NB 2ICWG 4J30B 2HQ5A 2JPUA 1U5TA 2ZC2A 1GV2A 2GDCA 2E7XA 4JJFA 3PQKA 2DA1A 3N24A 1ZAOA 1CPRA 4HPQA 4YFXF 1SZIA 3H3UA 4K2EA 3K0LA 1BM9A 1ZR4A 4P6IC 5DS4A 2V6CA 1IN7A 3G1MA 3I59B 3NEUA 4IWBA 2KMUA 3G4SI 2FE3A 4DJ9A 5LEKA 1G4DA 1GQAA 2STTA 3TBIA 3O8HA 4PCQA 1TWAA 2CUFA 2I10A 2RKHA 1NK3P 3V7OA 4AVZA 3ABLH 3HSRA 5EEHA 3ZRGA 3FXKA 2J9VA 2ZXPA 4HFFB 2X0LA 3LL7A 3S84A 2W84A 1R00A 3BOQA 2KNHA 2IRFG 1UZCA 2LKXA 4AK9A 2XV4S 3QPLA 3AJMA 1P4XA 4DZPA 3JRTA 1U0JA 1D0YA 2Y48A 4UNOA 3WTSC 5CI8A 3U9JA 4CDAA 2TDXA 4IARA 3EHMA 1OR7A 2BVLA 5CPRB 3DKAA 2MW8A 1MDMB 2QF7A 4A0YA 3NRVA 2HOEA 3IAS2 1ZKGA 2R7VA 1ODDA 3AGTA 2HMQA 3E6DA 4DIQA 1ACIA 4D5FA 1VLSA 5KNLA 2L9SA 2YPRA 4F55A 1QZXA 1WJEA 5JT4A 3W2VA 3J7YJ 2KSFA 2OC6A 1JT0A 3KYJA 1G3WA 2IVMA 3ZQQA 2VI6A 1SFKA 1HMDA 3PL8A 3JTHA 4CYDA 4E7KA 1LE4A 2W48A 4NNJA 3H9JA 3TW6A 1UB9A 3RZDJ 2HZ8A 3KLNA 4NC6A 3NWSA 1ZN2A 2LK2A 4RGSA 3GORA 2P5KA 2HOTA 2XLVA 4HAMA 3ZQFA 3PJRA 4KNVA 3JAMZ 3RSNA 3S2HJ 2B0JA 2Q9CA 2P6SA 4P5OA 3PUBA 2HJ3A 1B9NA 3I71A 4HG2A 1EI7A 2CJJA 2LP0A 3K70D 2VT3A 1OXKA 1A5JA 2W9YA 1MKMA 1R22A 2GWRA 1TQIA 4RGXA 2M45A 4GXOA 1LUJB 3BR2A 3REOA 5LHHA 2P6VA 1MBKA 3MKWB 1GM5A 4N9HA 2R25A 1DPUA 3GF2A 3GUDA 3OSFA 3K1NA 4LFUA 1REPC 4ZDLA 2EPOA 3TDZC 4A69C 3DV8A 5K7ZA 2O6GE 3ZTZA 1KU9A 2H7BA 3S29A 4IHYA 3P9IA 3Q5FA 3I9V2 4JE9A 3MYIA 3PUFA 3A01B 2M0CA 3ZQCA 1BI3A 2ZMEB 4DXWA 2VJ5A 1U6GA 4Y7NJ 3LQRA 4PGGA 2D45A 3C18A 3IQTA 3CO7C 1TT5B 1SAUA 256BA 3U2LA 2DMQA 4IAQA 3H35A 4M9SA 2V1UA 5KYUB 4MFDA 1WOLA 3K4JA 1E85A 2K40A 3ABTA 4L5JA 1AHDP 1NHAA 4Y33A 2B0HA 4ZLDA 1HKSA 3DU5A 2X1DA 1K78A 4JC7A 2OU6A 1O57A 4O5VA 3B0PA 3C2HA 3E3VA 4UV9A 2L9NA 1FNNA 5LGNA 3KEYA 1PYVA 1KU2A 1R36A 5EYRA 2AQEA 4IHWA 2M0MA 2MC3A 2A0BA 5CVIA 4BDYA 5EHHA 4YL3A 2WWYA 4HX8A 3GWZA 1YITI 1HY5A 3DE8A 1BC8C 5L3DA 3TL4X 1X1DA 4U7BA 2K9NA 3S3OA 1XN7A 1Z9CA 1I4ZA 3RPUA 1M6TA 4A93J 1I4YA 2MLKA 5KYNA 3WU2C 3IH4A 4XK4A 4CCKA 2E1OA 3FDQA 2LOOA 3BTLA 4OAYA 2ZXJA 3HRTA 4I09A 5E3NA 5FRMA 2Y9YA 1MBFA 3HG9A 5KYXB 4XPXA 2PEXA 4EGZA 1V5EA 3FISA 3KYCB 5DUIA 1Q0DA 2G62A 1DU0A 3O55A 5KYWB 5AONA 3DAGA 3U2MA 2E60A 2RC4A 3JCUC 1C0WA 9ANTA 1O3UA 4GQHA 4LLEA 2AQFA 5B3IA 2KIQA 2JT1A 2P6TA 3GXOA 2UUHA 3RPQA 1F43A 4QI2A 1WJ5A 2NVQJ 2CUEA 1EV7A 2E5NA 2O03A 1FNTc 1KGSA 1ZLJA 2BZTA 1J2XA 1ORJA 2QSGX 1Y4CA 2R9RB 4EJWA 2HYFA 1S7AA 1V55C 2XM4A 3OYHA 1DP3A 3FMSA 2EK5A 4Y3OA 1XCVA 1FOKA 2R7TA 3QPHA 1ZU4A 4JEAA 1YE9A 3US6A 1NFNA 2FX0A 2NVXJ 4KMUX 3BTJA 2DK8A 2QBYA 1RKCA 3AG3C 4EIYA 2GBYA 4P9UA 4MVMA 2H1LA 5TRDA 2W45A 1VB5A 3VODA 3HRUA 4ZTJA 4RGUA 5FKNA 4R79A 1W36C 2L4AA 2DYSC 2VC1A 3SEQA 1Y39A 2WY8Q 1U8RA 2DMTA 3IWZA 4JEBA 1UHSA 3LEVA 3IRQA 1ZYRF 3BRJA 3S9OA 2EFQA 2I5UA 3VEPA 1CPQA 4HSRA 3DI5A 4C3EA 1DUXC 3CDHA 5LFAA 1YA7O 3WTVC 3WHCA 2DW4A 1X1BA 4OIQF 3IQ5A 3H2UA 2DQLA 3GFLA 3ZOBA 1NLXA 1OR2A 3M15A 4B47A 3RJPA 2QKLB 1D0ZA 2R05A 2VODA 2LDUA 2V1DA 4ETSA 1IRGA 4ZYGA 1QZEA 3O6BB 4M9XA 4IGGA 3PNYA 2QTVA 3RTRA 2R92J 3JSOA 3LAJA 3N2ZB 3CJNA 1WH7A 4YK5A 4IX7A 3HDDA 3EPZA 5BPDA 3DP7A 4F92B 1YS6A 1U3EM 4A3MJ 1PP7U 3FVYA 1EH6A 5DD4A 1IN5A 2K4BA 4D5CA 2JN6A 1STZA 1FFHA 1G4WR 2JSCA 4AD9A 4X6AJ 1K05A 3DEEA 2VBWA 5ICGA 2CNWA 2MC4A 4RM3A 3N4MA 5CVUA 4IRIA 2E1CA 3LWFA 4NC3A 4G7ZF 3CC4I 1FP2A 2VQGA 5L0IA 2R7UA 1BBYA 2M87A 5LBQA 4UUSA 4C2MJ 3R61A 1ZHZA 4ESJA 2M4EA 1YJNI 3NKEA 2IGNA 2XL6A 4Z9HA 1SR2A 2KK1A 2BV6A 2E7WA 3GM3A 1U9NA 3ZQLA 4MFEA 3QU3A 4NQWA 3LNQA 3KZYA 4M72A 3ZTMA 1HOMA 2VXDA 1YJWI 3H36A 3LSHA 3IH3A 4U9EA 2BY1A 5FCLA 4I01A 1ZQ3P 4HF1A 2W7NA 2H7VC 3M4BA 2ZSIB 4JX6A 1JKOC 1FC3A 1VQLI 3I56I 2I8BA 1V54H 2BY0A 2ELKA 3CUQA 4B09A 2L4MA 2WZLA 2NRAC 1BN5A 3C62A 3K4MA 1ST6A 1YIJI 4YFNF 4JURI 5CVJA 1USTA 1WN0A 2EPLX 4FASD 3JRGA 3S2WA 2OEVA 4FX5A 2WAFA 1QPMA 1FJLA 2L9RA 3EUHA 1ZRFA 1A04A 2STWA 2XGCA 5FZTA 3L00A 1X1PA 4XRMA 4MIMA 5HLHA 2HFHA 4ENKA 2PMZN 2YU9J 2R7FA 4CCJA 1ZG3A 3CCQI 4I2OA 2ID6A 4XKWA 2EZKA 2KDZA 4DZJA 1ZG1A 3LSKA 1KQ0A 2NYXA 4X1EA 3U3BA 1Z6AA 2LP4A 2EB7A 1ORSC 1IC8A 1FBUA 3FWEA 1IAWA 4MTOA 3KEOA 1E84A 1IXSB 1Q0FA 4YEJA 2J45A 2X6YA 1BC7C 2HVQA 2ZJ2A 3BZ6A 4L6RA 2GOMA 1JMWA 3B02A 2XM0A 4NTAA 4UVBA 3MKYB 4F52A 3S1RJ 1I5NA 2FFHA 3L2RA 2XXAB 5ED4A 3V8LA 2IS2A 2AS5F 2KLOA 2KIFA 1O3QA 1I1GA 4OWRB 4D4XA 3HSEA 3ESWB 2ESNA 3HOTA 1W7PA 4MTFA 2A6HF 3BJOA 4HE8D 3K4LA 1R1UA 2ZNYA 3RQEA 3LFUA 2OD5A 4BGDA 5HS8A 5E3OA 2DFEA 4EBJA 3L2VA 1Z3XA 3PIOF 2VPRA 1TR2A 3MFNA 3BC8A 4CS8A 2PFDA 2DN0A 2LFBA 3DQVC 1A7DA 1XZQA 4V2GA 1ZR2A 4RBOA 1VF9A 4L9VA 1B68A 2RSEB 1EH8A 1NTCA 1X4OA 4IPAA 2JA7J 4FQGA 3ASOC 4IB4A 2F4OB 1WTYA 4M3BA 1LI7A 4BHPA 1E3PA 2HJMA 1BR4A 5J40A 1U89A 1ETWA 5J8CA 2QLZA 3BQYA 4ON0A 3OIQA 1IUFA 1J5YA 1YYXA 2HVRA 3ERMA 5BOXA 2WZFA 1NU7D 3CEXA 1XC5A 3CP2A 4DGWB 2HV7A 1A36A 4ZLCA 1QPIA 4BYYA 5D5UB 4QDLA 4XSZF 3R0JA 3E6BA 3CMEI 4BJ6C 1BW6A 3I5PA 1YHQI 2BHZA 2OCEA 2P7VA 3W8IA 1T38A 2IXPA 2LNBA 4C7OB 1GV5A 3I5QA 3S16J 3QMKA 2FQ4A 3HTUA 4A12A 3HKZN 5J1RA 4HNVA 4LLGF 1OPCA 1SVMA 4V2FA 1KTMA 2H1KA 3B6CA 1ZHYA 2IOQA 4ER9A 3CCVI 2EWNA 4PGHA 4B4CA 1UAAA 3RQ4A 4BU2A 1LI5A 3O8GA 2PN6A 3VOEA 2G9WA 1PDNC 4WABA 3ZR8X 3VYWA 4JRZA 4EHPA 2BW3B 2LY2A 4ZYDA 1SMTA 2OU2A 4AL0A 4EWCA 1PVEA 3GFJA 2M4GA 2JPCA 1V55H 2GFHA 1WJDA 3LNMB 5B1AC 3VAYA 1BI2A 5K5RA 3BP8A 4AU7A 4CDGA 2IJLA 5E17F 4OAZA 4KN4X 1TQPA 3LUTB 4PJ0C 1A6IA 3AG3H 3J80K 3ABMC 4CX9A 2M5WA 3ZQYA 4LDRA 4M3DA 1A7EA 4J01A 3Q0WA 3OSGA 4JYKA 4TV7A 1XG1A 4R32A 1HXDA 1G8XA 2VXZA 1Z67A 1FTSA 2COBA 2MH2A 3H0GJ 1G2HA 3ECHA 3JRIA 1TT0A 1UELB 4CDYA 1WJAA 2P0WA 3ECOA 4YIIA 1YA9A 1Z1DA 2EA2A 4RBNA 2ZFWA 1WWXA 1QSPA 2HXOA 3GEIA 2WA0A 1S72I 1H7IA 4M63A 3U0CA 1YLFA 4IJAA 4O6JA 4XL9A 2DQRA 2VCCA 3IRRA 3MVPA 4B8XA 4FISA 2OOCA 3R0AA 3UMIA 1JGSA 4P55A 2VC0A 2L7KA 2KZVA 3G1LA 1T6SA 1WI3A 3C2BA 2WB7A 5FKOA 1R7JA 4BE2A 4KNWA 4XLAA 2P5LC 4O6NA 2MABA 4IQJA 1F4KA 4IZZA 3LS1A 1FBSA 4ANJA 2HV6A 3OYJA 4KA4A 1RKEA 3U2RA 2IP2A 2X1EA 5E8GA 3FDYA 1I5ZA 1Z7LA 3HIFA 3QVYA 4UDVA 4YWQA 3J81Z 3H65A 1OCCH 1FWZA 1P6RA 2EV6A 5IP9J 4RDUA 2F22A 4K0DA 3OS1A 4OD5A 3J06A 1B59A 1H6GA 2BXYA 3L7WA 4LK1F 1QPUA 4AIJA 1AU7A 4LD5A 1R4TA 1U5TC 2PFBA 5F08A 1SD4A 4OIPF 1M2VB 4ONSA 4XIDA 5EG0A 1K79A 2H8RA 1WFXA 3DKWA 4HDVA 2XF6A 1TQGA 1M57C 3A0BC 2GQQA 2FMYA 2OCCC 3O3KA 4CCNA 4O7GA 2XAGA 3UGOA 1IV6A 1A6QA 4OINF 3WG9A 3FOPA 3T0YA 2HPMA 2L0KA 4RS8A 2EQRA 2JJ7A 2Z99A 2ZO4A 4Y4RA 3EUKL 1B4AA 3MZYA 4MQVA 5D5VB 3A2KA 2DB4A 4EM1A 2E2IJ 2XB0X 1WGXA 2EIMC 3OY9A 4L9JA 1OW6A 1MBJA 2NVYJ 1Y56A 1BOAA 1SD5A 2DU9A 1FZPB 4MTEA 4I3MA 1MH4A 1OR7C 2LVSA 4XN0A 4M71A 1FX7A 4AVPA 1VK5A 2XRNA 1ZG5A 4EM0B 3PHF2 3DTKA 1D0XA 4BXXJ 4IRHA 1ETXA 2X51A 4Y17A 1OCZC 2LD6A 2Q2EB 1N1CA 3RVZA 3WTTC 4A3KJ 1TFOB 3T4RA 2NS7A 2EPMX 1VQ8I 2HI3A 4QWQA 1QGPA 2YWAA 4KUMA 2FD5A 4CZCA 3V5ZA 3CQZJ 3LAYA 3T8RA 5FRNA 4F4BA 2HKXA 1JE8A 4UHTA 1YO5C 1ZH5A 4J7YA 3L1PA 2VOPA 4XKBA 3Q9SA 1DOWA 1LM3B 4C3DA 1W0UA 2F4IA 2A6TA 4G6QA 1PUFB 2DODA 3MYFA 3RQGA 1Z3YA 4MEXF 3ZDLA 1ETKA 4CZZA 3P5JA 4NQFA 2ISYA 2X6WA 1JKQC 3B6AA 2DA4A 5HNFA 2A07F 4IRUA 2OQRA 1O7LA 3LSJA 1N77A 3LMMA 1MBHA 2HMZA 3LLKA 2VUMJ 2V79A 3IL2A 2UXNA 2K9QA 4LOCA 4CDVA 3GLXA 1V5GA 2CQ7A 4EBKA 3B29A 2F5CA 1S7EA 1XDSA 2HWVA 1HCRA 1YRNB 3UR3C 3OS0A 4XLCA 4IHXA 2HUJA 3EFOA 2IS6A 2A61A 1LDDA 2NPUA 5E3CA 3CF5F 2FBKA 4D1QA 1QQ3A 3KETA 2Z2SB 1LE8A 1ZHTA 2KYHA 3HPHA 2H8WA 3DTIA 3EJNA 3WAQA 1FP1D 3BZCA 5M5WJ 1S7ZA 3WTZA 3FM5A 3DWWA 4BY7J 2IGOA 2Z1DA 2IA2A 4HQEA 3PCVA 5L3EA 4DVYP 4BQAA 3EFOB 5K7FA 2PMZA 5JHFA 4XOPA 4OU0A 1ZVZA 4BQNA 1GVJA 2R5YB 2F2EA 2WC2A 2XDVA 3M1EA 1LE8B 1J7KA 2IXMA 1M56C 3VDXA 2RAEA 5H2FC 1LFUP 1OQCA 1E83A 3JT1A 3T9OA 4DQ2A 3ASOH 1KZHA 1S7OA 3OYMA 4BJ1A 1TWGJ 1FTZA 5A6AA 3OOPA 3VF0A 3NRHA 3RKXA 4YRVA 1Z21A 4XLHA 5HLIA 2O0YA 2QQBA 4XM3A 2KISA 1FPQA 2YZSA 4LERA 3DKXA 1HQCA 1IDYA 3CLOA 1KQ8A 3G1OA 2VKEA 4JCHA 2BY2A 4ZDPA 4HX4A 1K4SA 2BXZA 3SQNA 2E5ZA 4LMYA 5T3TA 2WZGA 3FX3A 1PV3A 1QVTA 3SDGA 3H9QA 4WF2A 3WTYC 1QKRA 5JVTA 4BPMA 3JAMK 3L34A 1XTAA 3NYLA 2FMLA 5BQTA 1D1BA 2V9VA 4U0YA 3A02A 5FB2A 1A41A 1MJBA 4CSWA 3S3NA 2PX3A 2JWTA 2O8XA 1I1SA 5D91A 3CC7I 1DGWY 1XGSA 3BQZA 2FA5A 1QRYA 1XMXA 1DP7P 3GANA 1FAPB 4I44A 3WTXC 2GXGA 2IA0A 5FKKA 2XKOA 2CG4A 4UXNA 1E2XA 4Z6YA 3QU6A 4GDFA 1TNSA 2M9HA 5B1AH 2B63J 2PJRB 1JOGA 5J8FA 2KGOA 3F47A 3FAJA 2H6BA 5A6BA 3KP5A 3VB2A 2VB6A 4ZDOA 1OYYA 1JUMA 2GZWA 5BPIA 3C8GA 1TC3C 3ZVRA 1WVRA 1XZPA 2E1NA 3VSKA 1X4PA 4DW6A 2RQQA 2KP6A 3I58A 3VFZA 2AXLA 3F72A 5CKTA 1IDZA 2BGCA 1GHCA 2X6XA 2A6EF 3HRMA 3F46A 2DMNA 3BJAA 4Y13A 1D8JA 3AG1C 3ASNC 4K7BA 4PZJA 3LSGA 3NMKA 4QLCU 3EGDA 1LPEA 4EJOA 3R7CA 2FJ1A 4HRIA 2PBEA 2R7XA 1FLIA 2IAIA 4C3JJ 4BL0B 2KQ9A 2RNGA 4ESBA 2FOWA 4MVUA 1RPWA 4Q47A 2X0CA 1SD6A 2FSWA 3K4BA 3BR6A 3GFIA 3M3YJ 2K4JA 4PACA 4ITVA 4EKWA 1LFPA 5FLMJ 4XLPF 1U8BA 2J0WA 2L7AA 2HOAA 3RCOA 4BNCA 4IOAF 4II2A 1BA5A 5B1BC 2DPDA 4A3GJ 2DLLA 2KT0A 2W85A 1P4AA 1TWFJ 1PJRA 2FUG2 2KHMA 1IZ1A 3E6CC 3AL0B 4XEVA 4B44A 2VQHA 4XPYA 1YAUO 3AOUA 5L0DA 4A3FJ 3M9AA 5DS5A 2XAJA 2ZXRA 4JIOA 1U5TB 2MH9A 1BJZA 2LQGA 4M9ZA 3DCFA 4KMFA 2OZ6A 4JQFA 1XSXA 2MLGA 5BS6A 1XS9A 4WCGA 4UUVA 4UY8I 2Y69C 3TO9A 3RYLA 2J9BA 1DOVA 4AYBN 1YJGA 1C02A 1ZTRA 3OR1C 2XLOA 1X19A 1LE2A 1SFXA 1W36D 5ICEA 1BZ4A 2Q9BA 1R1VA 1GDTA 2Y0SN 3FXJA 5IPAA 2OCCH 4E70A 5DLJA 3HOZJ 1A0BA 4NHJA 2VL8A 3N05A 1OJLA 4L0ZB 4OMYA 4NB5A 2JA6J 2XSEA 5BQGA 1QHGA 4RA2A 1XCBA 4RAZA 3SFIA 5ILVA 4IO9F 2XLEA 4M3GA 3C2GA 1YI2I 3FXLA 4L5EA 5DEQA 5DV5A 2IEKA 1BDJB 2E36A 2DK5A 4QSHA 3T8TA 2C04A 4ENMA 1OFCX 5H20A 4IAOA 4EBBA 2M4KA 2L7ZA 3K2ZA 1MMNA 3ZN0A 3RKOF 3TP3A 3L2UA 4LDQA 2IA1A 4FESA 3H3ZA 5A2QZ 2XL4A 2Q0OA 2VPLA 4UV8A 2FGYA 3ZIBA 4E7JA 4XICA 1R5HA 3F8CA 3NARA 4XPWA 2Y3DA 1ZGAA 1JPJA 5BMZA 2DYRC 1OCZH 3I4MJ 1YQAA 2IBDA 3HTSB 2AU5A 2KJGA 1NG1A 3U1KA 3CUQC 2NOJB 1T01A 3PO3J 1OMIA 2WAQA 5EEGA 1LDJA 1YLMA 4K1OA 5F0FA 2PP4A 2G7UA 3BG7A 3S28A 2E87A 3EUHC 2PNOA 2PX9A 3BWGA 3JTLO 1Q1HA 3EZHA 2TMVP 3TKYA 3GEZA 2Q8KA 4Q7CA 2XUBA 3LSRA 1LEAA 3C8ZA 1BR2A 1MSEC 1X2MA 1WGWA 2EIKH 5LGTA 3MKZA 2GA2A 1T33A 2R5ZA 2YU3A 2ESHA 2O8KA 3K4CA 5FKLA 2O9LA 4LLNA 4MHGA 3A1YA 4I76A 4A0XA 5JLWA 3HOUJ 1P92A 4CH7A 1MBGA 4BG0A 5KYYA 3MKLA 4IOCF 2ZJQF 5JFRA 4KITB 1IRZA 1W5CC 3KE2A 4RM2A 4LG3A 4B43A 5LHIA 1JRAA 2DT6A 3AKZA 1T0FA 2NVTJ 1X58A 2LSEA 4RAFA 2JTVA 4A5MA 2K27A 3OS2A 3HTKC 4XWJA 1XPXA 2R93J 2LK4A 5GAGJ 1R4MB 1SVLA 1T9KA 3I4PA 4IJJA 4HEA2 2XPUA 1K78B 4DRHB 3K6GA 3GYHX 5J47A 4H54A 3UMKA 1LJ9A 1F1MA 2R02A 1W5SA 3CCEI 1R58A 3DBLB 1WJFA 2VE9A 2CGPA 1ON2A 5TJ5E 2MSYA 4O3MA 4CS8C 4BEMJ 2EZLA 2J9UA 3F8FA 4XEKA 3TQOA 1K04A 3PO2J 2ZPAA 2VKVA 2JVHA 2X48A 2M1BA 5L0FA 5JI6A 4FX4A 3CUOA 5ICCA 1NK2P 1VQOI 3OA1A 3H92A 3DZAA 1LNWA 1EF4A 3TK0A 4C3IJ 3KZIC 4YT2A 4BBRJ 1D1AA 4Q4ZF 2ACJA 3GCMA 4NC7A 2UXXA 3CJTB 5FJ8J 4NTFA 1Y0UA 1X3UA 3CMAI 1NBBA 4MVSA 2Q9AA 3LJBA 4YJWA 1RXQA 3OR2C 5FLXZ 1QVUA 3KX2A 3MWMA 4D7MA 1WASA 3ABKC 3M4CA 4AL1A 1OCRC 4KIFA 4G9YA 2VJIA 4OIRF 2L01A 3S15J 3LS0A 3O6XA 2CFOA 3Q0VA 1NG7A 2L54A 2QQAA 4B1RA 3DFGA 3IV5A 2R7OA 1TW2A 3L2CA 1FYKA 3TO6A 5HSWA 4IKFA 5EZHA 4J19A 4B3AA 2CV0A 4W1UA 1RKWA 1O3RA 1R23A 3HOWJ 2NSGA 2J7PD 4IL6C 3DJNB 2OJQA 4D0PA 5K5OA 1PUEE 2QBYB 1ZZPA 4XTKA 1LPQA 1IF1A 1JAFA 1OR3A 4J32B 2AXTC 1H8AC 3HXLA 3WE3A 4XRSA 2HSQA 2P0NA 1VMAA 3TJ6A 2X85A 3V4GA 3ABUA 4R1HA 5J1UA 1ORYA 2F4MB 4PK4A 3DPUA 3I55I 1ETOA 3JREA 1P7IA 4F3QA 4I02A 3CAXA 3AG1H 2HXIA 2KDOA 4CS7A 4XRFA 3X2QC 1C03A 4XONA 3CSKA 1F5TA 3GLLA 2H7OA 3PMRA 2UWMA 2Y3HA 3C3WA 4CUGA 2OEXA 4BJ5A 5AC4A 4XRSG 1JUPA 3OL4A 3DPLC 3OYDA 3T6GB 3JRDA 1G6NA 1Z5ZA 2XAUA 3WTWC 3AG4C 1ONVA 4N0BA 1HSTA 3RKWA 1H9GA 1RMVA 3CP8A 2CYYA 4PDKA 2L6FA 2O7OA 1WI9A 1DPRA 4LGWA 5IP7J 4FE7A 1G5ZA 4PJMA 5B1BH 3ZQ7A 3HOSA 1O3TA 4A3BJ 2WADA 1O87A 2XLHA 3Q9VA 1PP8F 4PR9A 1GLNA 2JMWA 3A03A 4E0IA 4GYGA 1ZHXA 2DJIA 3QP5A 2JX0A 3LEOA 1ZRCA 5DUKA 4ULWA 4C2UA 3HM5A 2ELJA 3K1HA 2QCOA 1HW1A 1QQIA 2HDWA 2WBMA 1HKTA 2HKVA 5GPCA 4CYCA 1P4WA 2VH3A 4N06A 1AA7A 3JRAA 1VQMI 2LY9A 2HQNA 4HYEA 4Q5SF 1E17A 1K40A 5JRAA 3KYLA 3PDMP 2Y69H 1RUNA 4MS2A 1SMYF 3FMQA 2X4HA 1YW7A 4ZYHA 4AIHA 1ZHFA 4EMSA 3CMMA 2PBIA 2Z16A 4UUSB 4KFCA 3M07A 4N6CA 1MD0A 1KYWA 4U5BE 3QYBA 1KONA 1JTYA 4XQ1A 1UCRA 2D1VA 2R7SA 2CQQA 2TCTA 2OA4A 1VZ0A 4NQWB 1QZZA 3S8PA 2BEOA 3BJ6A 2JA8J 3H0DA 3B0VC 3GZNB 2OPTA 2OTLI 3HNKA 2XRLA 2DJNA 2G7HA 3Q6NA 1Z0XA 3S3MA 3CQZA 1R6RA 4MVQA 3RIRA 2AWYA 2NSFA 4P96A 2E19A 1OYWA 3CD6I 2YUSA 3F9KA 2MYSA
chains in the Genus database with same CATH topology
1GXQA 2ELHA 2DI3A 5LRSA 1XD7A 3CUQB 2LF7A 2H27A 3U1DA 3AAFA 5K1YA 5LHGA 4P9FA 2VBZA 2W57A 1HW2A 1RI7A 3K1MA 2COMA 3J81K 3G3ZA 1D3YA 4U88A 1TBXA 5HLGA 2XGXA 5FGMA 3K9TA 5E1ZB 2WTEA 3EDPA 1W7PB 2XAFA 5HDNA 3IKVA 2K86A 1W5TA 4HW0A 2D1HA 4FHTA 1UHMA 2CW0F 3R4KA 5DYMA 4BHCA 2HQRA 5ERIA 4ESFA 3FZVA 4WK8F 2R7DA 2Z9OA 1MGTA 2PLYA 1B9MA 5FD6A 5ILSA 1G3YA 2P7VB 4YIFA 1YG2A 4RB0A 3BPVA 4I98B 3V8KA 3U9GA 3FHZA 3C7JA 1B6AA 3WGHA 2OAZA 3HYIA 3BDDA 2H09A 3F8MA 2XROA 5CJ9A 4LG0A 2CO5A 2FBHA 3R60A 4KN7X 2FNPA 5D6EA 4WXDA 1S29A 2BBYA 3MZHA 2LSOA 1Z6TA 1BIBA 4WXHA 3SHFA 3COAC 4EJTA 4Q48A 1IUYA 3PQJA 1ON1A 1ZREA 3P9KA 1ZGJA 1U2WA 2KIUA 1TQMA 1YW8A 4DNCA 2FEZA 3ML6A 1Z7UA 4RB1A 1ULYA 3GW2A 3OV8A 4MNUA 4LK0F 4I0BA 1ZLKA 1T98A 3N97A 1YS7A 2BYVE 1Z6RA 4G8XA 2KJBA 1FSEA 3JTGA 2B0LA 3MQ0A 3TDUC 4ENNA 3RYRA 3ZMVA 5E8IA 3M8EA 2P8TA 1FBQA 2PMUA 1V4RA 3LAPA 4KNYA 1HSJA 2J5PA 4HLXA 1BJAA 5L3FA 1WSUA 4XBFA 1LEBA 2CWEA 3J7AO 3O2PE 4HA8A 1JHFA 3C1DA 1J9IA 5AIQA 2DTRA 2QVOA 3CTAA 4IVNA 3FMRA 3LA3A 1F1ZA 3KCCA 1BI0A 4Y15A 1CF7A 1O7FA 2F5DA 2EFWA 1O3SA 2DAOA 4UVCA 2LF8A 5DCMA 3K69A 1IRFA 2ISZA 3KFWX 2FXAA 4I7HA 1CF7B 5ICFA 2EV5A 1TW3A 1UFMA 1FSHA 1KA8A 6PAXA 4ZZDA 4Z2YA 3T1BA 2HDCA 2GAUA 4IHTA 5A2QK 2YR2A 4EGYA 2CFXA 5E1XA 4HV5A 2C6YA 5H6RA 3FM3A 1JXSA 2MD5A 4CO8A 1J59A 4JK1X 1D5VA 3D0SA 1T2KA 3KZZA 2GXBA 1RNLA 1R5GA 1ZRDA 5L3BA 4S04A 1L3LA 3V8JA 1QNTA 4HDUA 4A0ZA 3LQQA 1W7PD 4IRGA 4ZZLA 2M30A 4G6DA 4A6EA 4HLYA 4MEYF 3IHUA 3SFZA 4F7ZA 3GFMA 2HTJA 5HDGA 4CGZA 3QP6A 1KQ9A 2RNJA 2XAHA 3QOPA 5JR3A 5HS9A 3KEQA 3I0TA 1H0MA 3R6SA 2XKPA 3F6VA 2KKOA 3BPXA 1XSDA 5FLXK 2PQ8A 5HOOA 3SZPA 5DCFA 1QZYA 2O61A 3LFKA 2FU4A 2Y75A 1P2FA 2KRFA 3EETA 1J0RA 3V7RA 4AIKA 3JSPA 1MDMA 5LLQA 4BXUA 4LB6B 1LVAA 3KLOA 1K6OA 5D8KB 3I64A 1KYZA 2FNAA 1BI1A 3KP6A 4M6XA 3HSFA 5F6FA 3KP7A 2KIMA 2K02A 1Z05A 2A69F 2DFIA 4KT5C 4GGGA 4KICA 1V3FA 3ZPLA 2YSRA 5FFZA 2A3SA 2H6CA 3HHGA 2P7CB 1YIOA 1OYIA 1WQ2A 3L9FA 3MAJA 3FXUA 3E5QA 2ZMEA 1LDKB 2H94A 4U7DA 3F8NA 3ERED 4GCVA 5JHUA 4RB2C 1Z91A 5ILUA 3RYPA 3SXZA 4WX9A 5IT9K 3IWFA 3DF8A 1D8KA 2VOOA 4WXCA 1G3SA 2JRTA 4CICA 4N9IA 2VE8A 5HDKA 2NNYA 1B1BA 1YFHA 1AWCA 5F1RA 2GA1A 3TO7A 3TGNA 2EJRA 3DXJF 4AWXB 1IW7F 2Y0MA 4UVAA 4L9NA 4EQQA 4M73A 3EYIA 4L9TA 1DDNA 3ZN1A 5D5WB 3WGGA 3LSTA 4BHBA 1FYMA 3ZMDA 3ZMZA 3V7SA 4ZH4F 2QQ9A 4KYWA 2YX7A 2W25A 3GZ5A 3DEUA 5FFXA 3P9CA 5CLSA 2V1XA 4U0WA 2RGVA 4G7HF 4A2UA 2EFOA 2IT0A 4CHUA 2RDPA 2OZUA 1YTYA 5KK1A 5HS7A 2DPUA 2HS5A 5D6FA 4IF4A 4KIBA 2XIGA 3PFIA 5D5XB 1RIOH 1T39A 3IC7A 3ISPA 5J6XA 2VBYA 1SFEA 4HZFA 2MA3A 1GXPA 2IPQX 2DBBA 2NS0A 4S05A 3LA7A 4BAYA 5LEJA 2VN2A 2Z5UA 1I6XA 2HYGD 5E1WA 3SZTA 1OKRA 2DT5A 4YFKF 2UZKA 3I5UA 5IT9Z 4XSXF 3GVAA 5F64A 4L0YB 4OIOF 3RI4A 3TOAA 2PI0A 2DO7A 3JW4A 2XASA 3BROA 4LB5A 1XSVA 2PG4A 3F6OA 4MTDA 3GX4X 2RQPA 4U0VA 3P7NA 1S6LA 2L3DA 2FBIA 1IN8A 1SAXA 2QZ8A 3HHHA 2QM3A 4MQ9F 3WTUC 2VBXA 3CO6C 2HR3A 4OMZA 5D4SA 4FX0A 2XVCA 2GIVA 3M8FA 4HV6A 1FYLA 4G94A 4MGRA 3HRSA 1HW5A 2ZNZA 2LKPA 1MJAA 5TJJA 3SXYA 1I27A 4HOBA 3W6JB 3TOBA 2JZYA 5FD5A 5KVRA 2NAZA 1XMKA 1RZ4A 1RUOA 5D4RA 4EVIA 3TQNA 2L02A 1TTYA 4EJVA 2A68F 1SD7A 2J5OA 2VONA 1EH7A 5DDGA 2EA4A 5CVRA 2R3SA 1IN6A 4OOIA 1F9NA 4RGRA 5L3GA 1BIAA 3WODF 3KP2A 3ZMSA 3GO5A 4EM2A 3WGIA 4A5NA 2PMHA 1R1TA 1KU7A 3T5XA 1TLHB 2VT2A 5AIPA 2P5VA 2FRHA 5E20A 3ZP5A 2ZCWA 4IHSA 5FO5A 2QUFA 1S8NA 3F22A 1XGMA 2HTSA 4G7OF 2A5YB 5K5QA 3SXKA 4ASNA 1HKQA 4LG0B 4KDPA 2HGCA 1W4MA 3EQLF 4FT8A 3W6KB 2FF4A 2IW5A 4ZYEA 3QRFF 2XAQA 4EV0A 2WV0A 2OBPA 5H6QA 4H0EA 2EV0A 4A6DA 1SFUA 1VTNC 3F21A 2JPBA 2CQKA 3L09A 3WU1B 3IKTA 4LJZF 3HUGA 4R8HA 1G3TA 1L0OC 4IXAA 5CYVA 1JHHA 5DD8A 2ZBKA 3GZ6A 3I54A 3D5LA 2ETHA 4BH9A 1FY7A 3NQOA 3G73A 3ZMUA 3LA2A 4LLLA 2CSOA 1WKMA 1K7AA 3MEXA 3WE2A 5D8LB 4ENJA 2Q2EA 2Z3YA 1HBXG 4KIGA 4RB3C 4L5IA 2O3FA 2ADUA 2EFPA 3DPTA 1QBJA 1QO0D 1KU3A 3E6MA 1ZARA 3V7CA 5L3CA 2KJCA 1LB2A 1XB4A 2D2WA 2OQGA 1LQ1A 1J75A 2PJPA 1WRJA 3ZMTA 3B73A 3FF5A 1TNTA 4EJUA 2XHKA 2QYOA 2BE5F 2F5FA 2RVCA 2YX4A 1IXCA 4WWCA 5CVVA 3QPTA 2HEOA 3BY6A 3J80Z 2QWWA 4HBLA 5DCMB 1XDUA 1XGOA 5LGUA 3RDIA 1AOYA 3I53A 2M8EA 3KP4A 2EFNA 4M6YA 1MJ9A 4HQMA 4M74A 3E97A 3KP3A 4CXFA 3EYYA 1YYVA 3FXQA 3MFKA 2HZTA 1IN4A 2W24A 2FOKA 3ELKA 2Z33A 2NNNA 4YG2F 3F23A 1XMAA 1YW9A 3F3XA 1CGPA 1UHWA 4HX7A 2FQ3A 4L18B 4GO1A 3E5XA 4HF0A 1MZBA 2ZKZA 1FT9A 3FXRA 3MCZA 3QAHA 5IT3A 4HF2A 2RN7A 4XLNF 3E5UA 5LRRA 1H9TA 5E18F 1U78A 2K7LA 1S3JA 1XGNA 4I0AA 1IXRC 2HKOA 2MBFA 3F8BA 3M7GA 4RAYA 4GYIA 2P4WA 3ROUA 5HVQC 3SXMA 2QENA 3RKYA 3ULQB 1USSA 3K1PA 2RV8A 3WU0A 2F5EA 3I59A 4JBAA 1U5TA 2E7XA 3PQKA 1ZAOA 4YFXF 3H3UA 4K2EA 3K0LA 1BM9A 2V6CA 1IN7A 3NEUA 3I59B 2FE3A 5LEKA 1G4DA 2STTA 4PCQA 2RKHA 3HSRA 5EEHA 2X0LA 2W84A 1R00A 3BOQA 2IRFG 2XV4S 1P4XA 4UNOA 2Y48A 3WTSC 2TDXA 1OR7A 1MDMB 4A0YA 3NRVA 2HOEA 1ODDA 3E6DA 2YPRA 1G3WA 2IVMA 4CYDA 3JTHA 1UB9A 3KLNA 1ZN2A 4RGSA 2P5KA 4HAMA 3JAMZ 2P6SA 4P5OA 1B9NA 3I71A 2VT3A 1MKMA 1R22A 2GWRA 1TQIA 4RGXA 2M45A 4GXOA 3REOA 5LHHA 4N9HA 1DPUA 3GF2A 3GUDA 3K1NA 4LFUA 1REPC 3TDZC 3DV8A 2O6GE 1KU9A 3P9IA 3Q5FA 1BI3A 2ZMEB 1U6GA 3LQRA 4PGGA 2D45A 3C18A 3CO7C 4M9SA 2V1UA 3ABTA 4L5JA 1NHAA 1HKSA 1K78A 1O57A 4O5VA 3E3VA 4UV9A 1FNNA 5LGNA 1KU2A 1R36A 2MC3A 5CVIA 2WWYA 4HX8A 3GWZA 1BC8C 5L3DA 4U7BA 1XN7A 1Z9CA 3RPUA 2MLKA 2ZXJA 3HRTA 4I09A 2PEXA 4EGZA 5DUIA 5AONA 2RC4A 1C0WA 2JT1A 2P6TA 3GXOA 3RPQA 1EV7A 2O03A 1KGSA 1ZLJA 1J2XA 4EJWA 2HYFA 1S7AA 3FMSA 2EK5A 1XCVA 1FOKA