3SXZA

Metal-free fcd domain of tm0439 a putative transcriptional regulator
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
140
structure length
139
Chain Sequence
b'GAMDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVEKSAREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, GntR family
molecule tags Transcription regulator
source organism Thermotoga maritima
publication title Metal-free FCD domain of TM0439 a putative transcriptional regulator
rcsb
total genus 64
structure length 139
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxzA00
3IHUA 4P9FA 3SXKA 3SXZA 2DI3A 3SXMA 3SXYA 1E2XA 1HW1A 3FMSA 1HW2A 2HS5A 1H9TA 3C7JA 1H9GA
chains in the Genus database with same CATH superfamily
2ZXWC 5E33A 2ZXPA 2G3VA 4CS8C 2HJMA 4XLPF 3BRJA 3MYIA 3G50A 4EKWA 3M15A 4H54A 3U2MA 1A7EA 3ZSUA 2B0JA 1VTMP 1Q0MA 2IOQA 4ULVA 1YVIA 1CGOA 2PP4A 1L3PA 1M2VB 3B9QA 3QVYA 1IW7F 3RF3A 1FFHA 3KMIA 4J7TA 2H7VC 4FAPB 1QSPA 4CIPA 4JJGA 5A6BD 5KYNA 2GFHA 1O87A 1JMWA 1NBBA 5FZTA 3IQTA 3U5SA 2D5RB 2HSBA 3E70C 3TJ5A 2KC3A 3EGXA 4JTDB 1OQCA 3GM1A 3K1IC 3RQFA 3TOMA 2IYLD 3IQ5A 2KW3C 2P61A 1T01A 5T1DB 3AG1C 1B68A 1BR4A 3I5QA 3M4BA 2CNWD 3VM6A 3R7CA 4E7SA 2R7SA 2R7VA 1YYXA 3EGDA 5L0DA 4CIHA 5L0IA 4XWJA 1BR2A 4OIPF 3DMDA 2OG2A 2QY9A 5JRAA 1RKEB 1UG7A 2VH3A 2A6HF 2H7OA 2I15A 5L3QA 2IXMA 4Q5SF 3W8HA 4YT4A 2W4BA 2A69F 3FOOA 1OCCC 1LS1A 3L8IA 5KYUB 1RKEA 2WZFA 3OWTA 3SXMA 2C03A 1D1BA 2HFIA 3VRCA 4XLNF 3V7OA 3A11A 3WAQA 4ZLCA 2DGJA 2R02A 3JRMO 4O6NA 1TQGA 2VASA 3UR3C 3IHUA 3TJ6A 1K05A 2MYSA 2LFDA 4YJWA 1E86A 1ZHXA 3QVZA 1XWJA 3EZIA 2R7XA 3LESA 5JT4A 3NYMA 1YZAA 4OINF 1LS4A 4DRIB 1EKYA 5T3TA 1ORYA 1A7DA 3AG2C 2Y3GA 3RKOF 1ORJA 1E85A 3DAGA 2DYSC 3DKAA 1S05A 1C03A 2YWAA 5DS6A 4I1MA 2P1AA 1FTSA 4JEBA 1JR8A 2YLIA 1YA9A 3LS0A 4AK9A 4EBJA 1TWGA 3W4YA 2LP4A 3AQBA 1BR1A 4D4NA 2KSFA 4G78A 2J7PA 2AP3A 1U6HA 4N06A 4JTCB 1OCZC 4UDVA 4IJJA 3RQEA 1KU2A 1QKRA 1NSGB 5KYWA 3M1CB 2LSEA 1NLXA 2PX3A 2G3KA 2C04A 3ABMC 3JSZA 1SMYF 1TWHA 4NTBA 1VLTA 2HSQA 2NSGA 4JKVA 4DBQA 2L6FA 2TMVP 1K04A 4YT5A 5B3IA 2PX0A 4EHPA 4KNWA 2J46A 1Z63A 2YVKA 2LQGA 3F47A 1JPJA 3JRTA 4RBNA 3GWLA 3PCVA 3EJNA 3F46A 4LACB 3ZWIA 1NU7D 1VLSA 3NMJA 3FXHA 1S7ZA 1HMOA 3CQZA 4XEVA 1FFTC 2Y3DA 2IM8A 2Q9AA 3KYIA 4U9DA 5T3WA 3FDQA 2VC9A 4RDAA 5BQIA 4QI2A 3UMKA 3SYNA 3W2VA 2OOCA 1H6GA 2XLVA 3M4CA 3SNHA 1ZHZA 4DOZA 4I44A 4AL0A 3DM9B 3X2QC 3JSEO 3T4RA 3B0PA 1GGQA 3U0CA 4NY3A 4NTFA 1HW1A 2PNOA 2Z15A 2IBFA 2CCYA 3EGDB 4YL1A 1TR2A 2GWWA 3GEIA 1APCA 4FWVA 2W9YA 1OKKD 2WZLA 3S28A 3TULA 4KBLA 4MTGA 5E3CA 1MMGA 4O79A 5DVWA 1CGME 3NDBB 3Q7LA 3UMIA 2XL8A 4LLEA 4IARA 1ZU4A 1RJ9B 3L0IA 1MMAA 5DS5A 1U0BB 3TK0A 1NG1A 5FCLA 1YARO 2Q3TA 2X51A 2Y3BA 2XLMA 5JS5A 1D0XA 3RFYA 5COFA 3HLZA 3C7JA 4PFPA 1R4TA 3PHF2 3S84A 4WJ0A 4QI0A 3MLGA 1GM5A 3US6A 1K40A 1EA8A 5JUAA 2L81A 2P7VA 1M57C 1M2VA 1YYJA 4JEAA 5DS4A 1XZPA 4J30B 2Q4FA 3HNJA 4K7BA 4U5DE 1Y6DA 2EINC 2HKVA 2CW0F 3C8ZA 4MW3A 1V54C 1C02A 3W2WA 4BJ6A 4U5EE 3GEEA 3TQOA 3T6JA 1FNTc 3DE9A 1HE9A 1BBHA 1Z6AA 4JCZA 4KI2A 1I5NA 2NUPA 2XS8A 1OW8A 2R25A 1ZHYA 4XPYA 3ITFA 1O3UA 3EQLF 4HEAJ 3FVYA 4JZAA 2ZXRA 5L0HA 5EGYA 1HW2A 1V4AA 2Y3HA 1FMVA 2CNWA 1U89A 3HNKA 1LI5A 4GEHA 4EIYA 5A6KA 4PJMA 3EG9B 1QPUA 2DB4A 2J0WA 3G4ZA 2F22A 4DXWA 1RCPA 3SEOA 3IQ6A 5BQGA 5K0IA 4IB4A 1OR2A 3JZ0A 2HMQA 5B1AC 3T9OA 2YEVA 3V5YA 1MNEA 2Q9BA 1A7VA 2FFHA 4Q4ZF 4OIQF 3O10A 2KNHA 3JTLO 2J0XA 3FAPB 3QW1A 2XM4A 1HE1A 1HMDA 1RKCA 2CYDA 2J9BA 4PK4A 3GM3A 4BJ5A 2J8WA 3GM2A 4YN0B 2QTVA 3JCUQ 3SZRA 3QTHA 4XTKA 5IY5C 3EH1A 4CS9C 4ULWA 4NTAA 2GAQA 4O7GA 4QDLA 4NQFA 4YL0A 4FESA 2J9VA 3ABLC 4AL1A 2M4EA 2AWYA 2WVNA 3H2UA 4I3MA 3EPVA 3C18A 2QE9A 3Q6NA 4A2NB 3RVYA 1C17M 2A0UA 2IXNA 2VCBA 3DJNB 2EPKX 2UUHA 4CS9A 3B71A 2V26A 3RIPA 2QUPA 4IAQA 5L3VA 2L6GA 4YT8A 2R7OA 4G0HA 4C3BA 1T6IA 1CGNA 2IXPA 2HZ8A 3UNGC 2PF4E 1OKKA 1PV3A 2OCCC 3ZTMA 3LLKA 4LDQA 3BEHA 2A6EF 2GA0A 5B1BC 3S0XA 1VK5A 3K66A 4MW8A 3DAFA 5DQTA 3ASNC 2EPMX 1LVKA 2YL0A 3KKBA 3OA1A 2OEVA 4IRUA 1QVXA 1T6QA 4G7ZF 1D1CA 2HV7A 4MVMA 3JYYA 5KYWB 3FAJA 1OW7A 2B0HA 2A1DD 2JPUA 2ETSA 2NUTB 4MVRA 3WG7C 3PDMP 5A6JA 1V74B 2L9JA 5GPGB 3OEOA 4CDAA 2YL7A 1SR2A 2MWQA 3K7DA 4BEMJ 5CIVA 4C7OA 3JYHA 2ZD9A 1LE2A 2WZGA 5JVEA 2R7TA 1VB5A 3LEVA 1CPRA 3ASOC 2EPOA 3ZQVA 4E17A 5L0GA 3LNMB 2J9WA 3RQGA 1V55C 1O5HA 4Z9IA 1PD1A 2M64A 1D0ZA 3AQCA 4MNDA 4E18A 1E2XA 3EHMA 3U9JA 4EBKA 2GDCA 5EHHA 2YL3A 3NG1A 1RJ9A 2XRHA 3NYLA 1R5ID 3MX3A 4E0HA 4W8PA 5D92A 3LS1A 4H4KC 1OW6A 1YZCA 2VCCA 3EFOA 3U3FA 4AE4A 1ZW2A 1JAFA 3LAYA 3MFNA 5KYXA 1H9GA 4KC9A 2NUPB 3IQCA 4OD4A 2NUTA 4NCQA 5A69A 4CDVA 3IEEA 3RH3A 2W45A 3TD7A 2D4UA 3ZTZA 3FMSA 3NRHA 2LD6A 2JX0A 5HV9A 2XLOA 2XM0A 1TWAA 2R7UA 3TOLA 5L0CA 1G4US 1SF8A 1DOVA 3CEXA 4U5FE 3DD7A 3S27A 2V3CC 4CSAC 4BJ5C 5DQZA 3O39A 4LDKA 1VMAA 1YA7O 4R32A 4PJNA 2DI3A 2X0CA 2BL2A 1IZMA 1YLMA 3K1IA 4GQHA 3V5XA 2NG1A 2HMZA 2PBEA 3FOPA 1NFNA 1WTYA 2WL8A 4BEJA 3KYJA 4YWQA 1JPNA 4ONSA 2YLDA 4U9EA 3C62A 1OCRC 3NMKA 1WASA 5JP7A 3UMHA 2IXOA 4U5HA 2KK1A 5A6BA 3J06A 3UGOA 3E9VA 1FAPB 4JW1A 4KNVA 1Y4CA 1NFOA 1ZYRF 4OD5A 1LE4A 4IGGA 5D91A 3VAYA 4DBRA 4U5BE 3ZVRA 5JSLA 1I4YA 2ICWG 2P0NA 2KYHA 2YL1A 3DWWA 4N6HA 4Z9JA 3ZIBA 1QQ3A 1TFOB 3C8GA 4MVSA 4OIRF 4CS8A 1H9TA 1AEPA 4M63A 1I4ZA 1LI7A 1ZHWA 3R2PA 1M2OA 4MVQA 4MTFA 4O6MA 3ABKC 2KQ9A 4C3DA 1G5ZA 2R05A 4NC3A 5COGA 3CSKA 3SXYA 1J8MF 5AC4A 2Y69C 4B6IA 3K33A 1JRAA 1SZIA 2NSFA 3U2LA 5A6AA 2A0BA 5COMA 4BG0A 1LPEA 3QMKA 1AUEA 1Q0KA 4CJOA 3LUTB 1M56C 2G62A 3EH2A 3Q6MA 5BQHA 4DVYP 3LEOA 4JC7A 2XLDA 1ZU5A 3C8GD 4K0DA 1WOLA 3RW0A 3ZDLA 2OJED 1T9KA 2I8BA 3IPMO 1FMWA 1HY5A 1ORSC 2R7QA 2XLEA 3A9CA 3JT1A 4MTOA 1TKNA 1UFBA 2PFDA 2R9RB 3C8GB 3B29A 5F28E 4YT2A 1LM3B 3T6BA 4GYTA 4E0IA 3O6XA 5F5FA 4CX9A 1KNYA 1TFKB 2XL6A 3AGTA 2J45A 3K6BA 3WODF 1Z5ZA 1OXKA 1F1MA 2BE5F 3AG4C 4CS7A 3AG3C 4MQ9F 5EK0A 4BJTA 1GQAA 2MHRA 3W8IA 4RD9A 4DRHB 1A41A 3U3BA 2LCHA 1LIHA 4MS2A 4J32B 3N24A 1G8XA 3ATPA 3EHNA 3NMIA 3AGUA 1QZXA 2XXAA 4MVOA 3U8PA 2ZPAA 3L8JA 1T6UA 4K1OA 4C3EA 2Q00A 5L0JA 1CPQA 1VYKA 4HFFB 4E7ZA 3S90A 2YQYA 4XEKA 3SP1A 1E84A 3DM5A 3GORA 3PMRA 2AWCA 1ZZPA 2E87A 3B0UX 3HJCA 2LIGA 3NKEA 3GANA 1J8YF 4Z9HA 1GS9A 3DI5A 4ZLDA 2EIJC 2EILC 2Q9CA 3KPHA 3RYLA 3WHNA 4L6RA 3ZQYA 4W8KA 1OXBA 1VOMA 2CGEA 2H7BA 3AJMA 1ZVZA 2J9UA 4WABA 5E3AA 2HUJA 5BUOA 2P6VA 5TJ5E 4G7HF 4OIOF 2RD9A 1JOGA 2Y39A 1TWCA 4IAOA 4WGYA 5F5HA 1RMVA 4AE4B 5HSWA 2ASRA 1VYIA 2J7PD 3QW0A 4DRJB 3HNLA 4EWCA 1N1CA 2A68F 4XQ1A 2EIKC 3NYJA 1M6TA 5CI8A 1YDIA 2EPNA 3NKDA 2YLGA 3L1MA 1KTMA 4JURI 5AGFA 3UGPA 3G4XA 4MVUA 2EPLX 2ZXOA 3C63A 2OJQA 2FAPB 4P9TA 3RVZA 4DJ9A 2Q7RA 2BC5A 3DJUB 5CI9A 2VCAA 4BJ1A 2OU6A 2XLHA 2XSEA 3KH2A 3VF0A 1NZEA 5DLJA 3KL4A 4U5GA 4XPXA 1FR0A 3SXZA 3EG9A 1BZ4A 3FHDA 4J7YA 3T6GB 4X0RA 1NU9C 2OKUA 4JTAB 3VYWA 5AC5A 2YZSA 4N6CA 2YHSA 1Z3IX 2XL4A 2XLWA 2YKZA 4JCHA 2XS1A 4I1OB 5B3SC 1WATA 3O55A 2HV6A 3LJBA 3HNIA 2DYRC 2FGYA 1L7CA 2KJGA 1WN0A 1T5OA 2NPUA 3LNRA 4JVSA 1Q0GA 2XXAB 3U9MA 1ST6A 2R7WA 4LERA 4PR9A 3POVA 1XZQA 1OR3A 3N2ZB 1G4WR 4BJ6C 1W2WA 1BDJB 2HJ3A 3EFOB 3GODA 4CBEA 1Z23A 3ZG1A 4ER9A 4CJGA 1Q0FA 3EGXB 1PCXA 3X1OA 2QLAA 3GWNA 4JRZA 2R7RA 4P6IC 3ECSA 4FX5A 3HKKA 4XPWA 4IWBA 3L34A 4D4XA 5KYYB 3V5ZA 1YAUO 2JD3A 3SXKA 1E83A 2OEXA 4JE9A 2AVKA 1Z7Qc 1D0YA 1MNDA 3K1HA 4U5CE 3CZ6A 4DVZA 1MMNA 2LK4A 4PJJA 1PD0A 3AOUA 2L7AA 4LDRA 4Q7CA 3M79A 1MMDA 4JJFA 4MVZA 4PFOA 4YL3A 4HFKB 4C7OB 2HS5A 2KGOA 3I5PA 1H7IA 1MQVA 3DE8A 4PJLA 2EIMC 3ZC4A 4PACA 2W4MA 2LFFA 2WVOA 1D1AA 1LKXA 1AVOB 3EZHA 3S29A 2QNLA 3Q7GA 4EBBA 3I4UA 4N4WA 3QZCA 2L6HA 4CDYA 3HTKC 3U8VA 3GEHA 2RSEB 2VB6A 3N0TA 1Q0DA 2CDQA 3MYFA 4LLCA 3DZAA 3CAXA 4WGZA 1DOWA 4XEFA 1RXQA 256BA 3H2VA 3B0VC 1ZHTA 2AU5A 4YK5A 5E2QA 1YJGA 4EUKB 4G7OF 5JLIA 3LLIA 1EI7A 4JIOA 1SYQA 1EQ1A 3DXJF 2O9XA 1WGWA 2YRFA 4HE8D 4ANJA 4F4BA 1OCOC 5KYYA 2WB7A 4BPMA 1WWPA 1A0BA 2OQMA 4AX2A 1QLEC 2R03A 2WVQA 4A4AA 5L0FA 1ZW3A 2H8AA 4P9FA 3H65A 2UUIA 5KYUA 3S9OA 3MBGA 4O6YA 4CSAA 5KYXB
chains in the Genus database with same CATH topology
3IHUA 4P9FA 3SXKA 3SXZA 2DI3A 3SXMA 3SXYA 1E2XA 1HW1A 3FMSA 1HW2A 2HS5A 1H9TA 3C7JA 1H9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHU A;  4P9F A;  3SXK A;  3SXZ A;  2DI3 A;  3SXM A;  3SXY A;  1E2X A;  1HW1 A;  3FMS A;  1HW2 A;  2HS5 A;  1H9T A;  3C7J A;  1H9G A; 
#chains in the Genus database with same CATH topology
 2ZXW C;  5E33 A;  2ZXP A;  2G3V A;  4CS8 C;  2HJM A;  4XLP F;  3BRJ A;  3MYI A;  3G50 A;  4EKW A;  3M15 A;  4H54 A;  3U2M A;  1A7E A;  3ZSU A;  2B0J A;  1VTM P;  1Q0M A;  2IOQ A;  4ULV A;  1YVI A;  1CGO A;  2PP4 A;  1L3P A;  1M2V B;  3B9Q A;  3QVY A;  1IW7 F;  3RF3 A;  1FFH A;  3KMI A;  4J7T A;  2H7V C;  4FAP B;  1QSP A;  4CIP A;  4JJG A;  5A6B D;  5KYN A;  2GFH A;  1O87 A;  1JMW A;  1NBB A;  5FZT A;  3IQT A;  3U5S A;  2D5R B;  2HSB A;  3E70 C;  3TJ5 A;  2KC3 A;  3EGX A;  4JTD B;  1OQC A;  3GM1 A;  3K1I C;  3RQF A;  3TOM A;  2IYL D;  3IQ5 A;  2KW3 C;  2P61 A;  1T01 A;  5T1D B;  3AG1 C;  1B68 A;  1BR4 A;  3I5Q A;  3M4B A;  2CNW D;  3VM6 A;  3R7C A;  4E7S A;  2R7S A;  2R7V A;  1YYX A;  3EGD A;  5L0D A;  4CIH A;  5L0I A;  4XWJ A;  1BR2 A;  4OIP F;  3DMD A;  2OG2 A;  2QY9 A;  5JRA A;  1RKE B;  1UG7 A;  2VH3 A;  2A6H F;  2H7O A;  2I15 A;  5L3Q A;  2IXM A;  4Q5S F;  3W8H A;  4YT4 A;  2W4B A;  2A69 F;  3FOO A;  1OCC C;  1LS1 A;  3L8I A;  5KYU B;  1RKE A;  2WZF A;  3OWT A;  3SXM A;  2C03 A;  1D1B A;  2HFI A;  3VRC A;  4XLN F;  3V7O A;  3A11 A;  3WAQ A;  4ZLC A;  2DGJ A;  2R02 A;  3JRM O;  4O6N A;  1TQG A;  2VAS A;  3UR3 C;  3IHU A;  3TJ6 A;  1K05 A;  2MYS A;  2LFD A;  4YJW A;  1E86 A;  1ZHX A;  3QVZ A;  1XWJ A;  3EZI A;  2R7X A;  3LES A;  5JT4 A;  3NYM A;  1YZA A;  4OIN F;  1LS4 A;  4DRI B;  1EKY A;  5T3T A;  1ORY A;  1A7D A;  3AG2 C;  2Y3G A;  3RKO F;  1ORJ A;  1E85 A;  3DAG A;  2DYS C;  3DKA A;  1S05 A;  1C03 A;  2YWA A;  5DS6 A;  4I1M A;  2P1A A;  1FTS A;  4JEB A;  1JR8 A;  2YLI A;  1YA9 A;  3LS0 A;  4AK9 A;  4EBJ A;  1TWG A;  3W4Y A;  2LP4 A;  3AQB A;  1BR1 A;  4D4N A;  2KSF A;  4G78 A;  2J7P A;  2AP3 A;  1U6H A;  4N06 A;  4JTC B;  1OCZ C;  4UDV A;  4IJJ A;  3RQE A;  1KU2 A;  1QKR A;  1NSG B;  5KYW A;  3M1C B;  2LSE A;  1NLX A;  2PX3 A;  2G3K A;  2C04 A;  3ABM C;  3JSZ A;  1SMY F;  1TWH A;  4NTB A;  1VLT A;  2HSQ A;  2NSG A;  4JKV A;  4DBQ A;  2L6F A;  2TMV P;  1K04 A;  4YT5 A;  5B3I A;  2PX0 A;  4EHP A;  4KNW A;  2J46 A;  1Z63 A;  2YVK A;  2LQG A;  3F47 A;  1JPJ A;  3JRT A;  4RBN A;  3GWL A;  3PCV A;  3EJN A;  3F46 A;  4LAC B;  3ZWI A;  1NU7 D;  1VLS A;  3NMJ A;  3FXH A;  1S7Z A;  1HMO A;  3CQZ A;  4XEV A;  1FFT C;  2Y3D A;  2IM8 A;  2Q9A A;  3KYI A;  4U9D A;  5T3W A;  3FDQ A;  2VC9 A;  4RDA A;  5BQI A;  4QI2 A;  3UMK A;  3SYN A;  3W2V A;  2OOC A;  1H6G A;  2XLV A;  3M4C A;  3SNH A;  1ZHZ A;  4DOZ A;  4I44 A;  4AL0 A;  3DM9 B;  3X2Q C;  3JSE O;  3T4R A;  3B0P A;  1GGQ A;  3U0C A;  4NY3 A;  4NTF A;  1HW1 A;  2PNO A;  2Z15 A;  2IBF A;  2CCY A;  3EGD B;  4YL1 A;  1TR2 A;  2GWW A;  3GEI A;  1APC A;  4FWV A;  2W9Y A;  1OKK D;  2WZL A;  3S28 A;  3TUL A;  4KBL A;  4MTG A;  5E3C A;  1MMG A;  4O79 A;  5DVW A;  1CGM E;  3NDB B;  3Q7L A;  3UMI A;  2XL8 A;  4LLE A;  4IAR A;  1ZU4 A;  1RJ9 B;  3L0I A;  1MMA A;  5DS5 A;  1U0B B;  3TK0 A;  1NG1 A;  5FCL A;  1YAR O;  2Q3T A;  2X51 A;  2Y3B A;  2XLM A;  5JS5 A;  1D0X A;  3RFY A;  5COF A;  3HLZ A;  3C7J A;  4PFP A;  1R4T A;  3PHF 2;  3S84 A;  4WJ0 A;  4QI0 A;  3MLG A;  1GM5 A;  3US6 A;  1K40 A;  1EA8 A;  5JUA A;  2L81 A;  2P7V A;  1M57 C;  1M2V A;  1YYJ A;  4JEA A;  5DS4 A;  1XZP A;  4J30 B;  2Q4F A;  3HNJ A;  4K7B A;  4U5D E;  1Y6D A;  2EIN C;  2HKV A;  2CW0 F;  3C8Z A;  4MW3 A;  1V54 C;  1C02 A;  3W2W A;  4BJ6 A;  4U5E E;  3GEE A;  3TQO A;  3T6J A;  1FNT c;  3DE9 A;  1HE9 A;  1BBH A;  1Z6A A;  4JCZ A;  4KI2 A;  1I5N A;  2NUP A;  2XS8 A;  1OW8 A;  2R25 A;  1ZHY A;  4XPY A;  3ITF A;  1O3U A;  3EQL F;  4HEA J;  3FVY A;  4JZA A;  2ZXR A;  5L0H A;  5EGY A;  1HW2 A;  1V4A A;  2Y3H A;  1FMV A;  2CNW A;  1U89 A;  3HNK A;  1LI5 A;  4GEH A;  4EIY A;  5A6K A;  4PJM A;  3EG9 B;  1QPU A;  2DB4 A;  2J0W A;  3G4Z A;  2F22 A;  4DXW A;  1RCP A;  3SEO A;  3IQ6 A;  5BQG A;  5K0I A;  4IB4 A;  1OR2 A;  3JZ0 A;  2HMQ A;  5B1A C;  3T9O A;  2YEV A;  3V5Y A;  1MNE A;  2Q9B A;  1A7V A;  2FFH A;  4Q4Z F;  4OIQ F;  3O10 A;  2KNH A;  3JTL O;  2J0X A;  3FAP B;  3QW1 A;  2XM4 A;  1HE1 A;  1HMD A;  1RKC A;  2CYD A;  2J9B A;  4PK4 A;  3GM3 A;  4BJ5 A;  2J8W A;  3GM2 A;  4YN0 B;  2QTV A;  3JCU Q;  3SZR A;  3QTH A;  4XTK A;  5IY5 C;  3EH1 A;  4CS9 C;  4ULW A;  4NTA A;  2GAQ A;  4O7G A;  4QDL A;  4NQF A;  4YL0 A;  4FES A;  2J9V A;  3ABL C;  4AL1 A;  2M4E A;  2AWY A;  2WVN A;  3H2U A;  4I3M A;  3EPV A;  3C18 A;  2QE9 A;  3Q6N A;  4A2N B;  3RVY A;  1C17 M;  2A0U A;  2IXN A;  2VCB A;  3DJN B;  2EPK X;  2UUH A;  4CS9 A;  3B71 A;  2V26 A;  3RIP A;  2QUP A;  4IAQ A;  5L3V A;  2L6G A;  4YT8 A;  2R7O A;  4G0H A;  4C3B A;  1T6I A;  1CGN A;  2IXP A;  2HZ8 A;  3UNG C;  2PF4 E;  1OKK A;  1PV3 A;  2OCC C;  3ZTM A;  3LLK A;  4LDQ A;  3BEH A;  2A6E F;  2GA0 A;  5B1B C;  3S0X A;  1VK5 A;  3K66 A;  4MW8 A;  3DAF A;  5DQT A;  3ASN C;  2EPM X;  1LVK A;  2YL0 A;  3KKB A;  3OA1 A;  2OEV A;  4IRU A;  1QVX A;  1T6Q A;  4G7Z F;  1D1C A;  2HV7 A;  4MVM A;  3JYY A;  5KYW B;  3FAJ A;  1OW7 A;  2B0H A;  2A1D D;  2JPU A;  2ETS A;  2NUT B;  4MVR A;  3WG7 C;  3PDM P;  5A6J A;  1V74 B;  2L9J A;  5GPG B;  3OEO A;  4CDA A;  2YL7 A;  1SR2 A;  2MWQ A;  3K7D A;  4BEM J;  5CIV A;  4C7O A;  3JYH A;  2ZD9 A;  1LE2 A;  2WZG A;  5JVE A;  2R7T A;  1VB5 A;  3LEV A;  1CPR A;  3ASO C;  2EPO A;  3ZQV A;  4E17 A;  5L0G A;  3LNM B;  2J9W A;  3RQG A;  1V55 C;  1O5H A;  4Z9I A;  1PD1 A;  2M64 A;  1D0Z A;  3AQC A;  4MND A;  4E18 A;  1E2X A;  3EHM A;  3U9J A;  4EBK A;  2GDC A;  5EHH A;  2YL3 A;  3NG1 A;  1RJ9 A;  2XRH A;  3NYL A;  1R5I D;  3MX3 A;  4E0H A;  4W8P A;  5D92 A;  3LS1 A;  4H4K C;  1OW6 A;  1YZC A;  2VCC A;  3EFO A;  3U3F A;  4AE4 A;  1ZW2 A;  1JAF A;  3LAY A;  3MFN A;  5KYX A;  1H9G A;  4KC9 A;  2NUP B;  3IQC A;  4OD4 A;  2NUT A;  4NCQ A;  5A69 A;  4CDV A;  3IEE A;  3RH3 A;  2W45 A;  3TD7 A;  2D4U A;  3ZTZ A;  3FMS A;  3NRH A;  2LD6 A;  2JX0 A;  5HV9 A;  2XLO A;  2XM0 A;  1TWA A;  2R7U A;  3TOL A;  5L0C A;  1G4U S;  1SF8 A;  1DOV A;  3CEX A;  4U5F E;  3DD7 A;  3S27 A;  2V3C C;  4CSA C;  4BJ5 C;  5DQZ A;  3O39 A;  4LDK A;  1VMA A;  1YA7 O;  4R32 A;  4PJN A;  2DI3 A;  2X0C A;  2BL2 A;  1IZM A;  1YLM A;  3K1I A;  4GQH A;  3V5X A;  2NG1 A;  2HMZ A;  2PBE A;  3FOP A;  1NFN A;  1WTY A;  2WL8 A;  4BEJ A;  3KYJ A;  4YWQ A;  1JPN A;  4ONS A;  2YLD A;  4U9E A;  3C62 A;  1OCR C;  3NMK A;  1WAS A;  5JP7 A;  3UMH A;  2IXO A;  4U5H A;  2KK1 A;  5A6B A;  3J06 A;  3UGO A;  3E9V A;  1FAP B;  4JW1 A;  4KNV A;  1Y4C A;  1NFO A;  1ZYR F;  4OD5 A;  1LE4 A;  4IGG A;  5D91 A;  3VAY A;  4DBR A;  4U5B E;  3ZVR A;  5JSL A;  1I4Y A;  2ICW G;  2P0N A;  2KYH A;  2YL1 A;  3DWW A;  4N6H A;  4Z9J A;  3ZIB A;  1QQ3 A;  1TFO B;  3C8G A;  4MVS A;  4OIR F;  4CS8 A;  1H9T A;  1AEP A;  4M63 A;  1I4Z A;  1LI7 A;  1ZHW A;  3R2P A;  1M2O A;  4MVQ A;  4MTF A;  4O6M A;  3ABK C;  2KQ9 A;  4C3D A;  1G5Z A;  2R05 A;  4NC3 A;  5COG A;  3CSK A;  3SXY A;  1J8M F;  5AC4 A;  2Y69 C;  4B6I A;  3K33 A;  1JRA A;  1SZI A;  2NSF A;  3U2L A;  5A6A A;  2A0B A;  5COM A;  4BG0 A;  1LPE A;  3QMK A;  1AUE A;  1Q0K A;  4CJO A;  3LUT B;  1M56 C;  2G62 A;  3EH2 A;  3Q6M A;  5BQH A;  4DVY P;  3LEO A;  4JC7 A;  2XLD A;  1ZU5 A;  3C8G D;  4K0D A;  1WOL A;  3RW0 A;  3ZDL A;  2OJE D;  1T9K A;  2I8B A;  3IPM O;  1FMW A;  1HY5 A;  1ORS C;  2R7Q A;  2XLE A;  3A9C A;  3JT1 A;  4MTO A;  1TKN A;  1UFB A;  2PFD A;  2R9R B;  3C8G B;  3B29 A;  5F28 E;  4YT2 A;  1LM3 B;  3T6B A;  4GYT A;  4E0I A;  3O6X A;  5F5F A;  4CX9 A;  1KNY A;  1TFK B;  2XL6 A;  3AGT A;  2J45 A;  3K6B A;  3WOD F;  1Z5Z A;  1OXK A;  1F1M A;  2BE5 F;  3AG4 C;  4CS7 A;  3AG3 C;  4MQ9 F;  5EK0 A;  4BJT A;  1GQA A;  2MHR A;  3W8I A;  4RD9 A;  4DRH B;  1A41 A;  3U3B A;  2LCH A;  1LIH A;  4MS2 A;  4J32 B;  3N24 A;  1G8X A;  3ATP A;  3EHN A;  3NMI A;  3AGU A;  1QZX A;  2XXA A;  4MVO A;  3U8P A;  2ZPA A;  3L8J A;  1T6U A;  4K1O A;  4C3E A;  2Q00 A;  5L0J A;  1CPQ A;  1VYK A;  4HFF B;  4E7Z A;  3S90 A;  2YQY A;  4XEK A;  3SP1 A;  1E84 A;  3DM5 A;  3GOR A;  3PMR A;  2AWC A;  1ZZP A;  2E87 A;  3B0U X;  3HJC A;  2LIG A;  3NKE A;  3GAN A;  1J8Y F;  4Z9H A;  1GS9 A;  3DI5 A;  4ZLD A;  2EIJ C;  2EIL C;  2Q9C A;  3KPH A;  3RYL A;  3WHN A;  4L6R A;  3ZQY A;  4W8K A;  1OXB A;  1VOM A;  2CGE A;  2H7B A;  3AJM A;  1ZVZ A;  2J9U A;  4WAB A;  5E3A A;  2HUJ A;  5BUO A;  2P6V A;  5TJ5 E;  4G7H F;  4OIO F;  2RD9 A;  1JOG A;  2Y39 A;  1TWC A;  4IAO A;  4WGY A;  5F5H A;  1RMV A;  4AE4 B;  5HSW A;  2ASR A;  1VYI A;  2J7P D;  3QW0 A;  4DRJ B;  3HNL A;  4EWC A;  1N1C A;  2A68 F;  4XQ1 A;  2EIK C;  3NYJ A;  1M6T A;  5CI8 A;  1YDI A;  2EPN A;  3NKD A;  2YLG A;  3L1M A;  1KTM A;  4JUR I;  5AGF A;  3UGP A;  3G4X A;  4MVU A;  2EPL X;  2ZXO A;  3C63 A;  2OJQ A;  2FAP B;  4P9T A;  3RVZ A;  4DJ9 A;  2Q7R A;  2BC5 A;  3DJU B;  5CI9 A;  2VCA A;  4BJ1 A;  2OU6 A;  2XLH A;  2XSE A;  3KH2 A;  3VF0 A;  1NZE A;  5DLJ A;  3KL4 A;  4U5G A;  4XPX A;  1FR0 A;  3SXZ A;  3EG9 A;  1BZ4 A;  3FHD A;  4J7Y A;  3T6G B;  4X0R A;  1NU9 C;  2OKU A;  4JTA B;  3VYW A;  5AC5 A;  2YZS A;  4N6C A;  2YHS A;  1Z3I X;  2XL4 A;  2XLW A;  2YKZ A;  4JCH A;  2XS1 A;  4I1O B;  5B3S C;  1WAT A;  3O55 A;  2HV6 A;  3LJB A;  3HNI A;  2DYR C;  2FGY A;  1L7C A;  2KJG A;  1WN0 A;  1T5O A;  2NPU A;  3LNR A;  4JVS A;  1Q0G A;  2XXA B;  3U9M A;  1ST6 A;  2R7W A;  4LER A;  4PR9 A;  3POV A;  1XZQ A;  1OR3 A;  3N2Z B;  1G4W R;  4BJ6 C;  1W2W A;  1BDJ B;  2HJ3 A;  3EFO B;  3GOD A;  4CBE A;  1Z23 A;  3ZG1 A;  4ER9 A;  4CJG A;  1Q0F A;  3EGX B;  1PCX A;  3X1O A;  2QLA A;  3GWN A;  4JRZ A;  2R7R A;  4P6I C;  3ECS A;  4FX5 A;  3HKK A;  4XPW A;  4IWB A;  3L34 A;  4D4X A;  5KYY B;  3V5Z A;  1YAU O;  2JD3 A;  3SXK A;  1E83 A;  2OEX A;  4JE9 A;  2AVK A;  1Z7Q c;  1D0Y A;  1MND A;  3K1H A;  4U5C E;  3CZ6 A;  4DVZ A;  1MMN A;  2LK4 A;  4PJJ A;  1PD0 A;  3AOU A;  2L7A A;  4LDR A;  4Q7C A;  3M79 A;  1MMD A;  4JJF A;  4MVZ A;  4PFO A;  4YL3 A;  4HFK B;  4C7O B;  2HS5 A;  2KGO A;  3I5P A;  1H7I A;  1MQV A;  3DE8 A;  4PJL A;  2EIM C;  3ZC4 A;  4PAC A;  2W4M A;  2LFF A;  2WVO A;  1D1A A;  1LKX A;  1AVO B;  3EZH A;  3S29 A;  2QNL A;  3Q7G A;  4EBB A;  3I4U A;  4N4W A;  3QZC A;  2L6H A;  4CDY A;  3HTK C;  3U8V A;  3GEH A;  2RSE B;  2VB6 A;  3N0T A;  1Q0D A;  2CDQ A;  3MYF A;  4LLC A;  3DZA A;  3CAX A;  4WGZ A;  1DOW A;  4XEF A;  1RXQ A;  256B A;  3H2V A;  3B0V C;  1ZHT A;  2AU5 A;  4YK5 A;  5E2Q A;  1YJG A;  4EUK B;  4G7O F;  5JLI A;  3LLI A;  1EI7 A;  4JIO A;  1SYQ A;  1EQ1 A;  3DXJ F;  2O9X A;  1WGW A;  2YRF A;  4HE8 D;  4ANJ A;  4F4B A;  1OCO C;  5KYY A;  2WB7 A;  4BPM A;  1WWP A;  1A0B A;  2OQM A;  4AX2 A;  1QLE C;  2R03 A;  2WVQ A;  4A4A A;  5L0F A;  1ZW3 A;  2H8A A;  4P9F A;  3H65 A;  2UUI A;  5KYU A;  3S9O A;  3MBG A;  4O6Y A;  4CSA A;  5KYX B; 
#chains in the Genus database with same CATH homology
 3IHU A;  4P9F A;  3SXK A;  3SXZ A;  2DI3 A;  3SXM A;  3SXY A;  1E2X A;  1HW1 A;  3FMS A;  1HW2 A;  2HS5 A;  1H9T A;  3C7J A;  1H9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...