3SXZA

Metal-free fcd domain of tm0439 a putative transcriptional regulator
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
140
structure length
139
Chain Sequence
GAMDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVEKSAREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, GntR family
publication title Metal-free FCD domain of TM0439 a putative transcriptional regulator
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 64
structure length 139
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxzA00
1H9GA 4P9FA 3SXKA 3SXMA 2HS5A 2DI3A 3IHUA 1HW2A 1H9TA 1HW1A 3C7JA 3SXYA 1E2XA 3SXZA 3FMSA
chains in the Genus database with same CATH superfamily
2XLMA 1FAPB 1H7IA 1ZU5A 2ASRA 4YN0B 4LACB 1R5ID 3IQCA 4L6RA 4BEMJ 1RXQA 5KYYA 3KL4A 3TK0A 1LIHA 4JCHA 1YA9A 2JPUA 5BQIA 1LVKA 4XLNF 1M2VB 2QE9A 1PD1A 2PFDA 3VF0A 2H7BA 4K1OA 2AWYA 1KTMA 4U5DE 2AWCA 2WVNA 4YL3A 3U2MA 1A7VA 3HNKA 2A68F 3X2QC 5IY5C 3V5XA 1ZHWA 5KYUB 3GEEA 3G4ZA 4PJLA 4O6YA 1Q0FA 4IARA 4DRJB 3DM9B 5KYNA 4E17A 3IHUA 4O6MA 2OU6A 5TJ5E 4CIHA 2KYHA 3GM2A 4MVZA 5JSLA 2HV7A 3FAJA 4MVUA 3X1OA 1H9GA 4MTOA 3H2UA 4XPXA 1ORSC 2D5RB 3RQGA 3NDBB 3ABKC 4E7SA 5KYXB 3AOUA 4AK9A 1ZZPA 2QNLA 3FVYA 4JE9A 3TULA 2P61A 1H9TA 4YWQA 3DJNB 4CDVA 2WL8A 3R7CA 2OCCC 4G7OF 2EPOA 1WTYA 1FMWA 1AEPA 1XWJA 2OEVA 3MFNA 1YAUO 3AG2C 1JPJA 2XS1A 3ATPA 3C7JA 4I44A 4N6CA 3OEOA 1OW8A 1WOLA 4AE4A 4DVYP 1H6GA 3N24A 1OKKA 2BC5A 2HS5A 3O6XA 2PX3A 5D92A 4ZLCA 4CS8C 4DRHB 3G4XA 1EA8A 1TQGA 1YLMA 2QTVA 3Q7GA 4MW3A 3QW0A 4MS2A 4ULVA 3U5SA 1Q0MA 2Y3GA 3ZTMA 3T9OA 3JZ0A 1WN0A 2XLDA 4MQ9F 5EK0A 2WVQA 3TOLA 1C03A 3HLZA 3LEOA 4BJTA 2KJGA 1T6UA 3ECSA 3SXMA 4AX2A 2MYSA 1T6IA 2GFHA 4YK5A 3L8JA 2A0UA 1OW6A 4KBLA 4BPMA 1FNTc 3T6JA 5DS5A 3DZAA 2BL2A 1T01A 2XL4A 2Y39A 3U3FA 1M56C 3TJ5A 4NC3A 2HKVA 3S28A 2IYLD 2E87A 2ZXPA 3NYLA 3EG9B 2YRFA 2LIGA 4QI2A 1RKCA 1MNDA 2CW0F 3M79A 3S9OA 3U2LA 2B0JA 4XWJA 3HNLA 2UUHA 4J32B 5E33A 1XZQA 3HNJA 2IM8A 3AJMA 1HW1A 2VB6A 3Q7LA 4YT8A 3Q6MA 2EIMC 5L0HA 3U3BA 4BEJA 1K40A 4WGZA 1XZPA 2KNHA 2OQMA 4U5HA 5HSWA 4JTDB 2AVKA 2UUIA 2Q9CA 2CNWA 3NMIA 4NCQA 1SF8A 4E18A 3LUTB 1TWAA 3NRHA 4IGGA 2YVKA 1G4US 2IOQA 2RSEB 3LEVA 3LS1A 4IB4A 5DS4A 3R2PA 3PHF2 4I1MA 1O5HA 1Z23A 3DD7A 1Q0GA 5JT4A 1CPRA 1FFTC 3ZVRA 4QI0A 3WODF 3RVYA 2JX0A 3PDMP 2HJMA 1S05A 2EPKX 4NTAA 3I5QA 1PCXA 4LLEA 4U9DA 1J8YF 3C8ZA 3ZWIA 2VH3A 3KH2A 2A6EF 1ZHTA 4EBKA 5L0IA 2R7SA 1SZIA 2HJ3A 2KGOA 1YJGA 2XLHA 4JJGA 3ITFA 1Y4CA 4DRIB 1OR2A 4N6HA 3RKOF 1IZMA 4XEKA 4J30B 1V4AA 3CZ6A 3B29A 3EH2A 3NYJA 3QZCA 4MVRA 4O6NA 5A6BD 5JVEA 2WZGA 1EKYA 4P6IC 3E9VA 4PK4A 2ZD9A 3JT1A 3NYMA 1JAFA 1LPEA 2OJED 2B0HA 3M15A 4JCZA 4CJGA 1VK5A 2AU5A 1CPQA 2R05A 4Z9HA 4HEAJ 2G62A 2W45A 1QLEC 1VLTA 1YVIA 2DYSC 4EKWA 1LE4A 4C7OB 3FOOA 3EFOB 3GM1A 3EHMA 5DS6A 2ZPAA 2DI3A 4MTGA 1OQCA 3UMHA 1APCA 2DYRC 3LS0A 2EILC 1E2XA 2XLOA 1JPNA 3GODA 4RDAA 4U9EA 4Z9IA 1YYJA 1MMNA 1OCRC 1Z5ZA 2C04A 2VCAA 2G3VA 3EGXB 4CJOA 1FFHA 2KC3A 2XSEA 5B3IA 3JTLO 1LS4A 3FHDA 1PV3A 4C3BA 2XXAB 1MMGA 3ZIBA 3RQFA 5L0JA 3DM5A 4DBRA 4M63A 3UNGC 4LDQA 5COFA 1QVXA 1M2VA 4N4WA 1FR0A 3MYFA 3JRMO 4CDAA 4CBEA 4JJFA 2A0BA 2WB7A 5HV9A 3S84A 3QTHA 2M4EA 1MMDA 4BJ5A 3W2VA 2VCBA 5KYUA 2Q00A 3RF3A 1OKKD 3LAYA 5B1BC 2R7XA 1J8MF 2ZXWC 2F22A 4GYTA 2C03A 4I1OB 3ZDLA 2EPNA 3HTKC 3SXKA 4F4BA 1Q0KA 5L0GA 1ZHZA 3K33A 5CI9A 4BJ6A 2PX0A 1V74B 3SNHA 5CIVA 3UGOA 2ICWG 4JC7A 3H65A 3TOMA 1I4ZA 3JSEO 2RD9A 4XPWA 5KYXA 2FGYA 1EI7A 4DOZA 2J45A 4YL0A 2MWQA 2W4MA 3B0PA 3UMKA 4DVZA 1D1AA 3FMSA 4NTFA 1Z63A 1C17M 1CGOA 3K7DA 4NY3A 4OD5A 1YA7O 2XS8A 2P7VA 3K66A 1BR2A 3C8GD 4W8KA 4JVSA 1F1MA 5E2QA 3A9CA 4OIRF 4LDKA 1Y6DA 1G8XA 4Q7CA 2IXPA 3LESA 5KYWB 3B0UX 4AL1A 3DWWA 4J7YA 3S29A 4EWCA 4Q4ZF 1ORYA 1ZYRF 2Y69C 2HV6A 1L7CA 2MHRA 3LLKA 4CS9A 1A41A 3TQOA 3NG1A 3EZHA 2YLIA 4G7ZF 1A7EA 3L0IA 4PJJA 1BZ4A 3GM3A 2EPLX 4LDRA 4C3EA 2R7UA 3I5PA 2J7PA 3OWTA 1HE9A 2L6FA 2J9WA 3W4YA 4KI2A 2OJQA 3EG9A 3ZC4A 3KYJA 5BQGA 4K0DA 2EIJC 1LI5A 4GQHA 2R7WA 1T5OA 1VLSA 1SMYF 2XL6A 1MMAA 2ETSA 3DKAA 2A1DD 2CCYA 4JTCB 4K7BA 5F28E 2WVOA 3W8IA 5A6KA 1M2OA 4IWBA 4G7HF 1E83A 1IW7F 2X51A 4BJ5C 3MLGA 4NQFA 3JYYA 2V26A 3NKEA 4MVSA 2Q7RA 5AGFA 3SZRA 1G4WR 5JUAA 4HE8D 2L6HA 2YL3A 1TKNA 2H8AA 3M1CB 4JZAA 2QUPA 4EBBA 3A11A 4U5CE 3L8IA 4PFOA 4JTAB 2IBFA 2HZ8A 4PJMA 5FZTA 1BBHA 4IJJA 4BJ6C 4XTKA 1VMAA 2Q3TA 3NMKA 2XM0A 5A69A 3DXJF 5A6AA 1VYKA 2NUTB 4ULWA 2J46A 2KSFA 5L0FA 3C8GB 4YJWA 1KU2A 3FDQA 3VAYA 3V5YA 2VCCA 5AC4A 3T4RA 3L1MA 2J9VA 2L9JA 3BRJA 2R25A 3DI5A 4FESA 4R32A 5L3QA 3UMIA 1HE1A 1JRAA 1QQ3A 3LNRA 3K6BA 3NKDA 1WGWA 1JOGA 3QVYA 4FX5A 3ZSUA 5DQTA 3POVA 2M64A 3CAXA 1YYXA 2DGJA 3ABLC 4E7ZA 4B6IA 4ZLDA 2EPMX 2NUPB 4G78A 2IXOA 4IRUA 2YWAA 3AG3C 3M4CA 5DVWA 2EIKC 3T6BA 2VC9A 1ZW3A 3DE9A 1CGNA 2NSGA 3JYHA 3HNIA 2ZXOA 3AQBA 4JEBA 3MYIA 3RYLA 4OIOF 2YKZA 2XL8A 1I5NA 2R7OA 3EGDB 1JMWA 3PCVA 1VB5A 4FWVA 3U8PA 1FTSA 2OEXA 2NG1A 2OOCA 4IAOA 4QDLA 4CS9C 4JKVA 4EUKB 1RMVA 1L3PA 2J9BA 2WZFA 4KNVA 1NFNA 1VYIA 1ST6A 1T9KA 2NSFA 1RJ9B 2NPUA 3EFOA 4XPYA 3WAQA 2EINC 2V3CC 3GEHA 4KNWA 1NU9C 2YLDA 1LE2A 4U5GA 5JRAA 3E70C 3AG1C 4WGYA 2Q4FA 4O79A 1RKEB 2P0NA 1BDJB 1HY5A 5F5HA 1QSPA 2IXMA 4DXWA 1OXBA 3KMIA 3B0VC 3DAGA 2FFHA 1I4YA 2J8WA 1UG7A 2YZSA 2LD6A 1E85A 1OCZC 3IQ5A 3V7OA 4Q5SF 1A0BA 1D1CA 2CGEA 3VM6A 2A69F 2HSBA 4U5EE 3GORA 4CS8A 1HW2A 1C02A 3RW0A 2QLAA 3FAPB 3F47A 1SYQA 2FAPB 5T3WA 3RIPA 3IQTA 3CSKA 4EHPA 3L34A 4CS7A 4YT4A 1OW7A 1NFOA 3J06A 4PACA 3Q6NA 2CYDA 3EJNA 3EHNA 2D4UA 3JSZA 2GAQA 3QVZA 4O7GA 5EHHA 1CGME 4P9FA 2LFFA 4DBQA 4OD4A 1B68A 2GA0A 3IEEA 4OINF 1R4TA 4MVQA 4U5FE 4I3MA 3OA1A 5A6BA 5KYYB 1ZVZA 5EGYA 3KYIA 3O55A 1V54C 4XEVA 3I4UA 3O39A 2J0XA 3PMRA 2YQYA 2R7QA 2R02A 3LNMB 1T6QA 3AG4C 3U9MA 4ANJA 2J9UA 1D0ZA 1PD0A 2LFDA 2Q9BA 3C18A 4CDYA 4XLPF 2H7VC 2J7PD 3N0TA 4CSAA 1M6TA 3SEOA 1DOWA 1TFOB 2YL7A 4MW8A 1RCPA 3H2VA 1WASA 3M4BA 1D1BA 1LKXA 3WHNA 3HJCA 4A4AA 3B71A 1AVOB 3C62A 5L3VA 2W4BA 3BEHA 3U0CA 3K1IA 2X0CA 2OKUA 1NZEA 4C3DA 5KYWA 2YLGA 3GEIA 3LJBA 5T3TA 4U5BE 3N2ZB 4AL0A 1SR2A 3RH3A 4XQ1A 2BE5F 4YT5A 3TJ6A 1NU7D 4JEAA 2PP4A 5DQZA 1NBBA 2CNWD 4W8PA 5GPGB 4BJ1A 5K0IA 1LS1A 1MQVA 1TFKB 4OIPF 4RBNA 3RVZA 4JRZA 1AUEA 2L7AA 2R9RB 4PJNA 2XLWA 4DJ9A 2HSQA 1Q0DA 5A6JA 3S0XA 3W2WA 3S90A 1U0BB 1OCOC 4HFKB 4J7TA 4X0RA 3U9JA 4A2NB 5DLJA 4AE4B 4YT2A 4E0HA 4OIQF 2HUJA 2XM4A 5COMA 2XLEA 2YL0A 1N1CA 3G50A 3VYWA 4PFPA 1S7ZA 2I8BA 3VRCA 4ER9A 2OG2A 4RD9A 4D4NA 5L0CA 4JURI 2I15A 2J0WA 1VOMA 1MNEA 2KK1A 2QY9A 5E3CA 1GM5A 3NMJA 2Y3DA 1Z3IX 2KW3C 5B3SC 2R7VA 4MVMA 3LLIA 3MX3A 4MVOA 1UFBA 3EPVA 4NTBA 2W9YA 3SYNA 1NSGB 2YL1A 1ZHYA 2Z15A 1D0XA 3TD7A 3JCUQ 1OXKA 3US6A 1OCCC 1HMDA 3SXZA 1W2WA 2VASA 4GEHA 3T6GB 2LP4A 5BUOA 1YZCA 2H7OA 3O10A 4G0HA 2G3KA 2HMZA 2NUTA 3IQ6A 5FCLA 1M57C 256BA 2Y3HA 3C8GA 1ORJA 5COGA 1OR3A 2LCHA 4H4KC 1VTMP 2AP3A 2HFIA 4CSAC 3FXHA 1WWPA 1E84A 3AGUA 1FMVA 2KQ9A 5JP7A 1E86A 3UGPA 2PNOA 1YZAA 1LI7A 2GWWA 3ZG1A 4E0IA 3AQCA 3EZIA 5F5FA 1TWCA 3K1HA 4BG0A 1D0YA 3ZTZA 5AC5A 2IXNA 1TWGA 3U8VA 2CDQA 3K1IC 5BQHA 2NUPA 1U6HA 4PR9A 1TWHA 3RFYA 2O9XA 2GDCA 4UDVA 1HMOA 3IPMO 2L81A 1GGQA 5D91A 3W8HA 3DMDA 4ONSA 2R03A 1O87A 1ZHXA 1LM3B 3EGDA 2ZXRA 4XEFA 2HMQA 3ASOC 3MBGA 3CEXA 5E3AA 5T1DB 3ZQYA 1DOVA 2YEVA 4HFFB 1WATA 3ZQVA 1NLXA 3KPHA 1G5ZA 2YHSA 4Z9JA 4CIPA 1JR8A 1Z7Qc 3RQEA 1K05A 3ABMC 4EIYA 1RJ9A 4WABA 1YDIA 4D4XA 4C7OA 2R7RA 1GS9A 3QMKA 3WG7C 1ZW2A 4P9TA 1KNYA 3GANA 1U89A 2DB4A 3SP1A 3GWNA 3F46A 1QZXA 1O3UA 2WZLA 1BR4A 2JD3A 2Q9AA 4EBJA 1K04A 3UR3C 3DAFA 1RKEA 1A7DA 1V55C 3EGXA 3AGTA 4JIOA 3QW1A 4CX9A 3KKBA 3EQLF 3HKKA 2LK4A 3V5ZA 5B1AC 2XXAA 1QPUA 1GQAA 2P1AA 2L6GA 2R7TA 4MTFA 3CQZA 4LERA 3DJUB 1BR1A 1Z6AA 2A6HF 2PF4E 3DE8A 3JRTA 4H54A 4LLCA 3S27A 2XRHA 4N06A 3B9QA 2LSEA 3SXYA 1YARO 4KC9A 3C63A 5L0DA 2XLVA 2PBEA 2Y3BA 3GWLA 3EH1A 2LQGA 4MNDA 5JLIA 1NG1A 2TMVP 4FAPB 4WJ0A 3ASNC 4JW1A 5JS5A 1EQ1A 5CI8A 1QKRA 3FOPA 4YL1A 2P6VA 1TR2A 1ZU4A 4IAQA
chains in the Genus database with same CATH topology
1H9GA 4P9FA 3SXKA 3SXMA 2HS5A 2DI3A 3IHUA 1HW2A 1H9TA 1HW1A 3C7JA 3SXYA 1E2XA 3SXZA 3FMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9G A;  4P9F A;  3SXK A;  3SXM A;  2HS5 A;  2DI3 A;  3IHU A;  1HW2 A;  1H9T A;  1HW1 A;  3C7J A;  3SXY A;  1E2X A;  3SXZ A;  3FMS A; 
#chains in the Genus database with same CATH topology
 2XLM A;  1FAP B;  1H7I A;  1ZU5 A;  2ASR A;  4YN0 B;  4LAC B;  1R5I D;  3IQC A;  4L6R A;  4BEM J;  1RXQ A;  5KYY A;  3KL4 A;  3TK0 A;  1LIH A;  4JCH A;  1YA9 A;  2JPU A;  5BQI A;  1LVK A;  4XLN F;  1M2V B;  2QE9 A;  1PD1 A;  2PFD A;  3VF0 A;  2H7B A;  4K1O A;  2AWY A;  1KTM A;  4U5D E;  2AWC A;  2WVN A;  4YL3 A;  3U2M A;  1A7V A;  3HNK A;  2A68 F;  3X2Q C;  5IY5 C;  3V5X A;  1ZHW A;  5KYU B;  3GEE A;  3G4Z A;  4PJL A;  4O6Y A;  1Q0F A;  4IAR A;  4DRJ B;  3DM9 B;  5KYN A;  4E17 A;  3IHU A;  4O6M A;  2OU6 A;  5TJ5 E;  4CIH A;  2KYH A;  3GM2 A;  4MVZ A;  5JSL A;  2HV7 A;  3FAJ A;  4MVU A;  3X1O A;  1H9G A;  4MTO A;  3H2U A;  4XPX A;  1ORS C;  2D5R B;  3RQG A;  3NDB B;  3ABK C;  4E7S A;  5KYX B;  3AOU A;  4AK9 A;  1ZZP A;  2QNL A;  3FVY A;  4JE9 A;  3TUL A;  2P61 A;  1H9T A;  4YWQ A;  3DJN B;  4CDV A;  2WL8 A;  3R7C A;  2OCC C;  4G7O F;  2EPO A;  1WTY A;  1FMW A;  1AEP A;  1XWJ A;  2OEV A;  3MFN A;  1YAU O;  3AG2 C;  1JPJ A;  2XS1 A;  3ATP A;  3C7J A;  4I44 A;  4N6C A;  3OEO A;  1OW8 A;  1WOL A;  4AE4 A;  4DVY P;  1H6G A;  3N24 A;  1OKK A;  2BC5 A;  2HS5 A;  3O6X A;  2PX3 A;  5D92 A;  4ZLC A;  4CS8 C;  4DRH B;  3G4X A;  1EA8 A;  1TQG A;  1YLM A;  2QTV A;  3Q7G A;  4MW3 A;  3QW0 A;  4MS2 A;  4ULV A;  3U5S A;  1Q0M A;  2Y3G A;  3ZTM A;  3T9O A;  3JZ0 A;  1WN0 A;  2XLD A;  4MQ9 F;  5EK0 A;  2WVQ A;  3TOL A;  1C03 A;  3HLZ A;  3LEO A;  4BJT A;  2KJG A;  1T6U A;  3ECS A;  3SXM A;  4AX2 A;  2MYS A;  1T6I A;  2GFH A;  4YK5 A;  3L8J A;  2A0U A;  1OW6 A;  4KBL A;  4BPM A;  1FNT c;  3T6J A;  5DS5 A;  3DZA A;  2BL2 A;  1T01 A;  2XL4 A;  2Y39 A;  3U3F A;  1M56 C;  3TJ5 A;  4NC3 A;  2HKV A;  3S28 A;  2IYL D;  2E87 A;  2ZXP A;  3NYL A;  3EG9 B;  2YRF A;  2LIG A;  4QI2 A;  1RKC A;  1MND A;  2CW0 F;  3M79 A;  3S9O A;  3U2L A;  2B0J A;  4XWJ A;  3HNL A;  2UUH A;  4J32 B;  5E33 A;  1XZQ A;  3HNJ A;  2IM8 A;  3AJM A;  1HW1 A;  2VB6 A;  3Q7L A;  4YT8 A;  3Q6M A;  2EIM C;  5L0H A;  3U3B A;  4BEJ A;  1K40 A;  4WGZ A;  1XZP A;  2KNH A;  2OQM A;  4U5H A;  5HSW A;  4JTD B;  2AVK A;  2UUI A;  2Q9C A;  2CNW A;  3NMI A;  4NCQ A;  1SF8 A;  4E18 A;  3LUT B;  1TWA A;  3NRH A;  4IGG A;  2YVK A;  1G4U S;  2IOQ A;  2RSE B;  3LEV A;  3LS1 A;  4IB4 A;  5DS4 A;  3R2P A;  3PHF 2;  4I1M A;  1O5H A;  1Z23 A;  3DD7 A;  1Q0G A;  5JT4 A;  1CPR A;  1FFT C;  3ZVR A;  4QI0 A;  3WOD F;  3RVY A;  2JX0 A;  3PDM P;  2HJM A;  1S05 A;  2EPK X;  4NTA A;  3I5Q A;  1PCX A;  4LLE A;  4U9D A;  1J8Y F;  3C8Z A;  3ZWI A;  2VH3 A;  3KH2 A;  2A6E F;  1ZHT A;  4EBK A;  5L0I A;  2R7S A;  1SZI A;  2HJ3 A;  2KGO A;  1YJG A;  2XLH A;  4JJG A;  3ITF A;  1Y4C A;  4DRI B;  1OR2 A;  4N6H A;  3RKO F;  1IZM A;  4XEK A;  4J30 B;  1V4A A;  3CZ6 A;  3B29 A;  3EH2 A;  3NYJ A;  3QZC A;  4MVR A;  4O6N A;  5A6B D;  5JVE A;  2WZG A;  1EKY A;  4P6I C;  3E9V A;  4PK4 A;  2ZD9 A;  3JT1 A;  3NYM A;  1JAF A;  1LPE A;  2OJE D;  2B0H A;  3M15 A;  4JCZ A;  4CJG A;  1VK5 A;  2AU5 A;  1CPQ A;  2R05 A;  4Z9H A;  4HEA J;  2G62 A;  2W45 A;  1QLE C;  1VLT A;  1YVI A;  2DYS C;  4EKW A;  1LE4 A;  4C7O B;  3FOO A;  3EFO B;  3GM1 A;  3EHM A;  5DS6 A;  2ZPA A;  2DI3 A;  4MTG A;  1OQC A;  3UMH A;  1APC A;  2DYR C;  3LS0 A;  2EIL C;  1E2X A;  2XLO A;  1JPN A;  3GOD A;  4RDA A;  4U9E A;  4Z9I A;  1YYJ A;  1MMN A;  1OCR C;  1Z5Z A;  2C04 A;  2VCA A;  2G3V A;  3EGX B;  4CJO A;  1FFH A;  2KC3 A;  2XSE A;  5B3I A;  3JTL O;  1LS4 A;  3FHD A;  1PV3 A;  4C3B A;  2XXA B;  1MMG A;  3ZIB A;  3RQF A;  5L0J A;  3DM5 A;  4DBR A;  4M63 A;  3UNG C;  4LDQ A;  5COF A;  1QVX A;  1M2V A;  4N4W A;  1FR0 A;  3MYF A;  3JRM O;  4CDA A;  4CBE A;  4JJF A;  2A0B A;  2WB7 A;  5HV9 A;  3S84 A;  3QTH A;  2M4E A;  1MMD A;  4BJ5 A;  3W2V A;  2VCB A;  5KYU A;  2Q00 A;  3RF3 A;  1OKK D;  3LAY A;  5B1B C;  2R7X A;  1J8M F;  2ZXW C;  2F22 A;  4GYT A;  2C03 A;  4I1O B;  3ZDL A;  2EPN A;  3HTK C;  3SXK A;  4F4B A;  1Q0K A;  5L0G A;  1ZHZ A;  3K33 A;  5CI9 A;  4BJ6 A;  2PX0 A;  1V74 B;  3SNH A;  5CIV A;  3UGO A;  2ICW G;  4JC7 A;  3H65 A;  3TOM A;  1I4Z A;  3JSE O;  2RD9 A;  4XPW A;  5KYX A;  2FGY A;  1EI7 A;  4DOZ A;  2J45 A;  4YL0 A;  2MWQ A;  2W4M A;  3B0P A;  3UMK A;  4DVZ A;  1D1A A;  3FMS A;  4NTF A;  1Z63 A;  1C17 M;  1CGO A;  3K7D A;  4NY3 A;  4OD5 A;  1YA7 O;  2XS8 A;  2P7V A;  3K66 A;  1BR2 A;  3C8G D;  4W8K A;  4JVS A;  1F1M A;  5E2Q A;  3A9C A;  4OIR F;  4LDK A;  1Y6D A;  1G8X A;  4Q7C A;  2IXP A;  3LES A;  5KYW B;  3B0U X;  4AL1 A;  3DWW A;  4J7Y A;  3S29 A;  4EWC A;  4Q4Z F;  1ORY A;  1ZYR F;  2Y69 C;  2HV6 A;  1L7C A;  2MHR A;  3LLK A;  4CS9 A;  1A41 A;  3TQO A;  3NG1 A;  3EZH A;  2YLI A;  4G7Z F;  1A7E A;  3L0I A;  4PJJ A;  1BZ4 A;  3GM3 A;  2EPL X;  4LDR A;  4C3E A;  2R7U A;  3I5P A;  2J7P A;  3OWT A;  1HE9 A;  2L6F A;  2J9W A;  3W4Y A;  4KI2 A;  2OJQ A;  3EG9 A;  3ZC4 A;  3KYJ A;  5BQG A;  4K0D A;  2EIJ C;  1LI5 A;  4GQH A;  2R7W A;  1T5O A;  1VLS A;  1SMY F;  2XL6 A;  1MMA A;  2ETS A;  3DKA A;  2A1D D;  2CCY A;  4JTC B;  4K7B A;  5F28 E;  2WVO A;  3W8I A;  5A6K A;  1M2O A;  4IWB A;  4G7H F;  1E83 A;  1IW7 F;  2X51 A;  4BJ5 C;  3MLG A;  4NQF A;  3JYY A;  2V26 A;  3NKE A;  4MVS A;  2Q7R A;  5AGF A;  3SZR A;  1G4W R;  5JUA A;  4HE8 D;  2L6H A;  2YL3 A;  1TKN A;  2H8A A;  3M1C B;  4JZA A;  2QUP A;  4EBB A;  3A11 A;  4U5C E;  3L8I A;  4PFO A;  4JTA B;  2IBF A;  2HZ8 A;  4PJM A;  5FZT A;  1BBH A;  4IJJ A;  4BJ6 C;  4XTK A;  1VMA A;  2Q3T A;  3NMK A;  2XM0 A;  5A69 A;  3DXJ F;  5A6A A;  1VYK A;  2NUT B;  4ULW A;  2J46 A;  2KSF A;  5L0F A;  3C8G B;  4YJW A;  1KU2 A;  3FDQ A;  3VAY A;  3V5Y A;  2VCC A;  5AC4 A;  3T4R A;  3L1M A;  2J9V A;  2L9J A;  3BRJ A;  2R25 A;  3DI5 A;  4FES A;  4R32 A;  5L3Q A;  3UMI A;  1HE1 A;  1JRA A;  1QQ3 A;  3LNR A;  3K6B A;  3NKD A;  1WGW A;  1JOG A;  3QVY A;  4FX5 A;  3ZSU A;  5DQT A;  3POV A;  2M64 A;  3CAX A;  1YYX A;  2DGJ A;  3ABL C;  4E7Z A;  4B6I A;  4ZLD A;  2EPM X;  2NUP B;  4G78 A;  2IXO A;  4IRU A;  2YWA A;  3AG3 C;  3M4C A;  5DVW A;  2EIK C;  3T6B A;  2VC9 A;  1ZW3 A;  3DE9 A;  1CGN A;  2NSG A;  3JYH A;  3HNI A;  2ZXO A;  3AQB A;  4JEB A;  3MYI A;  3RYL A;  4OIO F;  2YKZ A;  2XL8 A;  1I5N A;  2R7O A;  3EGD B;  1JMW A;  3PCV A;  1VB5 A;  4FWV A;  3U8P A;  1FTS A;  2OEX A;  2NG1 A;  2OOC A;  4IAO A;  4QDL A;  4CS9 C;  4JKV A;  4EUK B;  1RMV A;  1L3P A;  2J9B A;  2WZF A;  4KNV A;  1NFN A;  1VYI A;  1ST6 A;  1T9K A;  2NSF A;  1RJ9 B;  2NPU A;  3EFO A;  4XPY A;  3WAQ A;  2EIN C;  2V3C C;  3GEH A;  4KNW A;  1NU9 C;  2YLD A;  1LE2 A;  4U5G A;  5JRA A;  3E70 C;  3AG1 C;  4WGY A;  2Q4F A;  4O79 A;  1RKE B;  2P0N A;  1BDJ B;  1HY5 A;  5F5H A;  1QSP A;  2IXM A;  4DXW A;  1OXB A;  3KMI A;  3B0V C;  3DAG A;  2FFH A;  1I4Y A;  2J8W A;  1UG7 A;  2YZS A;  2LD6 A;  1E85 A;  1OCZ C;  3IQ5 A;  3V7O A;  4Q5S F;  1A0B A;  1D1C A;  2CGE A;  3VM6 A;  2A69 F;  2HSB A;  4U5E E;  3GOR A;  4CS8 A;  1HW2 A;  1C02 A;  3RW0 A;  2QLA A;  3FAP B;  3F47 A;  1SYQ A;  2FAP B;  5T3W A;  3RIP A;  3IQT A;  3CSK A;  4EHP A;  3L34 A;  4CS7 A;  4YT4 A;  1OW7 A;  1NFO A;  3J06 A;  4PAC A;  3Q6N A;  2CYD A;  3EJN A;  3EHN A;  2D4U A;  3JSZ A;  2GAQ A;  3QVZ A;  4O7G A;  5EHH A;  1CGM E;  4P9F A;  2LFF A;  4DBQ A;  4OD4 A;  1B68 A;  2GA0 A;  3IEE A;  4OIN F;  1R4T A;  4MVQ A;  4U5F E;  4I3M A;  3OA1 A;  5A6B A;  5KYY B;  1ZVZ A;  5EGY A;  3KYI A;  3O55 A;  1V54 C;  4XEV A;  3I4U A;  3O39 A;  2J0X A;  3PMR A;  2YQY A;  2R7Q A;  2R02 A;  3LNM B;  1T6Q A;  3AG4 C;  3U9M A;  4ANJ A;  2J9U A;  1D0Z A;  1PD0 A;  2LFD A;  2Q9B A;  3C18 A;  4CDY A;  4XLP F;  2H7V C;  2J7P D;  3N0T A;  4CSA A;  1M6T A;  3SEO A;  1DOW A;  1TFO B;  2YL7 A;  4MW8 A;  1RCP A;  3H2V A;  1WAS A;  3M4B A;  1D1B A;  1LKX A;  3WHN A;  3HJC A;  4A4A A;  3B71 A;  1AVO B;  3C62 A;  5L3V A;  2W4B A;  3BEH A;  3U0C A;  3K1I A;  2X0C A;  2OKU A;  1NZE A;  4C3D A;  5KYW A;  2YLG A;  3GEI A;  3LJB A;  5T3T A;  4U5B E;  3N2Z B;  4AL0 A;  1SR2 A;  3RH3 A;  4XQ1 A;  2BE5 F;  4YT5 A;  3TJ6 A;  1NU7 D;  4JEA A;  2PP4 A;  5DQZ A;  1NBB A;  2CNW D;  4W8P A;  5GPG B;  4BJ1 A;  5K0I A;  1LS1 A;  1MQV A;  1TFK B;  4OIP F;  4RBN A;  3RVZ A;  4JRZ A;  1AUE A;  2L7A A;  2R9R B;  4PJN A;  2XLW A;  4DJ9 A;  2HSQ A;  1Q0D A;  5A6J A;  3S0X A;  3W2W A;  3S90 A;  1U0B B;  1OCO C;  4HFK B;  4J7T A;  4X0R A;  3U9J A;  4A2N B;  5DLJ A;  4AE4 B;  4YT2 A;  4E0H A;  4OIQ F;  2HUJ A;  2XM4 A;  5COM A;  2XLE A;  2YL0 A;  1N1C A;  3G50 A;  3VYW A;  4PFP A;  1S7Z A;  2I8B A;  3VRC A;  4ER9 A;  2OG2 A;  4RD9 A;  4D4N A;  5L0C A;  4JUR I;  2I15 A;  2J0W A;  1VOM A;  1MNE A;  2KK1 A;  2QY9 A;  5E3C A;  1GM5 A;  3NMJ A;  2Y3D A;  1Z3I X;  2KW3 C;  5B3S C;  2R7V A;  4MVM A;  3LLI A;  3MX3 A;  4MVO A;  1UFB A;  3EPV A;  4NTB A;  2W9Y A;  3SYN A;  1NSG B;  2YL1 A;  1ZHY A;  2Z15 A;  1D0X A;  3TD7 A;  3JCU Q;  1OXK A;  3US6 A;  1OCC C;  1HMD A;  3SXZ A;  1W2W A;  2VAS A;  4GEH A;  3T6G B;  2LP4 A;  5BUO A;  1YZC A;  2H7O A;  3O10 A;  4G0H A;  2G3K A;  2HMZ A;  2NUT A;  3IQ6 A;  5FCL A;  1M57 C;  256B A;  2Y3H A;  3C8G A;  1ORJ A;  5COG A;  1OR3 A;  2LCH A;  4H4K C;  1VTM P;  2AP3 A;  2HFI A;  4CSA C;  3FXH A;  1WWP A;  1E84 A;  3AGU A;  1FMV A;  2KQ9 A;  5JP7 A;  1E86 A;  3UGP A;  2PNO A;  1YZA A;  1LI7 A;  2GWW A;  3ZG1 A;  4E0I A;  3AQC A;  3EZI A;  5F5F A;  1TWC A;  3K1H A;  4BG0 A;  1D0Y A;  3ZTZ A;  5AC5 A;  2IXN A;  1TWG A;  3U8V A;  2CDQ A;  3K1I C;  5BQH A;  2NUP A;  1U6H A;  4PR9 A;  1TWH A;  3RFY A;  2O9X A;  2GDC A;  4UDV A;  1HMO A;  3IPM O;  2L81 A;  1GGQ A;  5D91 A;  3W8H A;  3DMD A;  4ONS A;  2R03 A;  1O87 A;  1ZHX A;  1LM3 B;  3EGD A;  2ZXR A;  4XEF A;  2HMQ A;  3ASO C;  3MBG A;  3CEX A;  5E3A A;  5T1D B;  3ZQY A;  1DOV A;  2YEV A;  4HFF B;  1WAT A;  3ZQV A;  1NLX A;  3KPH A;  1G5Z A;  2YHS A;  4Z9J A;  4CIP A;  1JR8 A;  1Z7Q c;  3RQE A;  1K05 A;  3ABM C;  4EIY A;  1RJ9 A;  4WAB A;  1YDI A;  4D4X A;  4C7O A;  2R7R A;  1GS9 A;  3QMK A;  3WG7 C;  1ZW2 A;  4P9T A;  1KNY A;  3GAN A;  1U89 A;  2DB4 A;  3SP1 A;  3GWN A;  3F46 A;  1QZX A;  1O3U A;  2WZL A;  1BR4 A;  2JD3 A;  2Q9A A;  4EBJ A;  1K04 A;  3UR3 C;  3DAF A;  1RKE A;  1A7D A;  1V55 C;  3EGX A;  3AGT A;  4JIO A;  3QW1 A;  4CX9 A;  3KKB A;  3EQL F;  3HKK A;  2LK4 A;  3V5Z A;  5B1A C;  2XXA A;  1QPU A;  1GQA A;  2P1A A;  2L6G A;  2R7T A;  4MTF A;  3CQZ A;  4LER A;  3DJU B;  1BR1 A;  1Z6A A;  2A6H F;  2PF4 E;  3DE8 A;  3JRT A;  4H54 A;  4LLC A;  3S27 A;  2XRH A;  4N06 A;  3B9Q A;  2LSE A;  3SXY A;  1YAR O;  4KC9 A;  3C63 A;  5L0D A;  2XLV A;  2PBE A;  2Y3B A;  3GWL A;  3EH1 A;  2LQG A;  4MND A;  5JLI A;  1NG1 A;  2TMV P;  4FAP B;  4WJ0 A;  3ASN C;  4JW1 A;  5JS5 A;  1EQ1 A;  5CI8 A;  1QKR A;  3FOP A;  4YL1 A;  2P6V A;  1TR2 A;  1ZU4 A;  4IAQ A; 
#chains in the Genus database with same CATH homology
 1H9G A;  4P9F A;  3SXK A;  3SXM A;  2HS5 A;  2DI3 A;  3IHU A;  1HW2 A;  1H9T A;  1HW1 A;  3C7J A;  3SXY A;  1E2X A;  3SXZ A;  3FMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...