3SXZA

Metal-free fcd domain of tm0439 a putative transcriptional regulator
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
140
structure length
139
Chain Sequence
GAMDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVEKSAREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-free FCD domain of TM0439 a putative transcriptional regulator
rcsb
molecule keywords Transcriptional regulator, GntR family
molecule tags Transcription regulator
source organism Thermotoga maritima
total genus 64
structure length 139
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxzA00
1HW1A 2DI3A 1E2XA 3IHUA 4P9FA 3SXMA 3C7JA 1H9TA 3SXKA 1HW2A 3SXZA 3FMSA 3SXYA 1H9GA 2HS5A
chains in the Genus database with same CATH superfamily
3JT1A 3LAYA 2XSEA 1FFTC 2PP4A 1T9KA 2XL8A 2A68F 3L0IA 1A7DA 3L8IA 2YVKA 4IWBA 3LNRA 3G4ZA 4DVYP 3DMDA 4K0DA 5TJ5E 3FMSA 4HFFB 1Q0DA 4L6RA 4LERA 4OD4A 2ZXOA 1SZIA 3LEOA 3NYLA 2HSQA 3C18A 3QW1A 4H54A 3RFYA 2XLMA 4JEBA 4MVSA 4UDVA 1HW2A 2H7VC 3Q6MA 2P6VA 5JP7A 1LS1A 4U5EE 4Q4ZF 1LKXA 2R7WA 2XL4A 3ZC4A 1YZCA 1BDJB 3DAGA 1MQVA 3RW0A 2E87A 1R5ID 4MQ9F 3SYNA 2M4EA 1O5HA 3M15A 4WJ0A 4YK5A 5JLIA 2O9XA 1OKKD 1AUEA 4PR9A 4G7ZF 3LLKA 3ATPA 2Q9AA 2VASA 1C03A 5HSWA 1BR2A 4NQFA 3ZQYA 3HJCA 3EGXB 1SYQA 4E0IA 4NCQA 3TULA 3B0VC 3V5XA 3LS1A 2HJ3A 1O3UA 2CDQA 4E17A 4JURI 1ZHWA 3LS0A 2PX0A 4NTBA 3VAYA 5BQHA 4EKWA 3EGDB 1IW7F 2XM4A 1NU9C 4OIOF 4BG0A 4EBKA 4PJNA 2BE5F 1KTMA 4FWVA 5KYWA 1QQ3A 4XLNF 2OU6A 1EKYA 1FR0A 2YQYA 2MYSA 4XEKA 2QTVA 4E7SA 3M79A 5A6KA 1D0XA 5DLJA 4YL3A 3ZSUA 5A6BA 2Q9CA 2JD3A 4J30B 4I1OB 1WASA 3IPMO 4MVUA 2IYLD 5B3IA 1YDIA 5DVWA 4W8PA 4EBJA 1H9TA 4CIHA 3NKDA 3K1IC 2LCHA 2PFDA 1LE4A 3M4BA 1OXBA 4IB4A 2JPUA 4FESA 1G4US 2XLHA 1UFBA 2P61A 5DS6A 2A6HF 1APCA 1OQCA 3Q7LA 2P1AA 5F5HA 3WODF 3U2LA 1FAPB 4KNWA 3BRJA 2R7OA 3F47A 2LFDA 1JAFA 1BR1A 2F22A 4O6MA 4U5BE 3EH2A 1A7EA 3QVYA 3NKEA 5JSLA 5IY5C 2BL2A 4B6IA 3PDMP 2VCCA 4FX5A 1VMAA 1TFOB 3C8GA 3JRMO 3LJBA 4DJ9A 1E2XA 3NMJA 2XRHA 1C02A 2XXAB 5L0CA 2M64A 3K66A 3I4UA 4I1MA 3NRHA 1Z7Qc 2L6FA 3H2UA 3SXZA 4YN0B 3U3BA 3HNLA 5KYXB 2EPKX 1ZW3A 1F1MA 4YT4A 2HSBA 1DOWA 3AGTA 4N4WA 2EPLX 2WZGA 1CPQA 2OEVA 2D5RB 2YL3A 4AE4A 3UR3C 2HMZA 3G4XA 2RSEB 3ECSA 4JTCB 4F4BA 1HMOA 5FZTA 4U5GA 1TWHA 1Q0GA 2J46A 3JCUQ 4MTGA 5E3AA 2A0UA 3EQLF 1NFNA 2XLWA 4M63A 1C17M 1Z3IX 2AWCA 3NDBB 3JYYA 2ASRA 2R9RB 5BQIA 4Q5SF 3EG9B 2LIGA 2HV7A 2J9VA 2AVKA 1YA9A 2AU5A 4JTAB 1U0BB 2HZ8A 2OEXA 4LLEA 1U6HA 2L6HA 2L81A 3B29A 2R7RA 2FFHA 2FGYA 1D1CA 3ASNC 1RXQA 1PV3A 5DQTA 1RKEB 1K40A 2ETSA 3RYLA 3OEOA 3HNKA 2WL8A 2QUPA 1M57C 4U9DA 5L0FA 1UG7A 4E0HA 3Q7GA 1BBHA 3C7JA 3HNJA 3UMIA 2LFFA 1A7VA 3ITFA 4XPWA 2ICWG 2HFIA 1RKCA 1VYKA 3ZG1A 1D1BA 4J32B 4NC3A 3GM2A 4BPMA 4C3EA 4YL1A 3AOUA 1GGQA 4ONSA 1CGOA 1ORSC 2P0NA 2G3KA 2B0JA 1LS4A 2DYRC 3W2VA 5KYWB 2TMVP 2B0HA 1FTSA 1XZQA 2W45A 4Z9JA 3SEOA 4IARA 1YZAA 4ULWA 2QY9A 1JR8A 1YARO 4C3DA 4JIOA 3GORA 2OOCA 1NSGB 2LD6A 4Q7CA 1HE1A 1ZU5A 4P9TA 5DQZA 1OW6A 2GDCA 2WVNA 3U0CA 1JPNA 1M6TA 2OJQA 2WZLA 2MHRA 3SXMA 1GS9A 3MBGA 1T6QA 2A69F 4A2NB 4AL1A 3TQOA 2W9YA 1G8XA 256BA 2BC5A 4WABA 3B71A 5CI8A 2Y3DA 4AE4B 1CGME 4MW8A 2DYSC 1V55C 2KQ9A 3GEEA 3ABKC 2PF4E 1VK5A 3ASOC 4AX2A 5L0JA 1TWAA 5COGA 3UMHA 2XXAA 2YL7A 1V4AA 3FXHA 1D1AA 5F5FA 3MLGA 3TOMA 1NG1A 4R32A 5E33A 3N24A 3DZAA 4IGGA 5E3CA 5KYXA 3K1IA 3KMIA 2I8BA 2PBEA 3NMKA 1N1CA 4NTFA 4GQHA 3DI5A 3GM3A 2VCBA 3K6BA 5EK0A 1G5ZA 4G78A 4K1OA 1ZHXA 3JTLO 3E9VA 3VF0A 3LEVA 3JSEO 2H7OA 2CYDA 2NUTB 1H7IA 3CSKA 4YWQA 3X2QC 4YJWA 1DOVA 3MFNA 3U8VA 1TWGA 3WHNA 3RQFA 3IQCA 1SR2A 2Q4FA 3C8GD 3MX3A 4XLPF 1AEPA 2J9BA 2CCYA 3EG9A 2J8WA 2R03A 4MVZA 2R7VA 5L0DA 4O79A 1TFKB 1ZHZA 4JC7A 4KI2A 2LQGA 1OW7A 1K04A 4I44A 4NTAA 5CI9A 1OW8A 3DM5A 1LE2A 1GM5A 2HV6A 1RKEA 1ZZPA 4PFPA 1E83A 3V5ZA 4CX9A 1Z6AA 2YHSA 1KNYA 3JSZA 1QLEC 4JCHA 3RVYA 3S9OA 4CS7A 5L0GA 5DS5A 3EHMA 1LI5A 1ZW2A 2YKZA 2R7SA 4G7HF 4ANJA 4D4XA 2J9UA 3EPVA 4IRUA 4JKVA 2IBFA 3V7OA 4EBBA 3DM9B 2J0WA 4YT8A 2YLIA 4LLCA 3UGPA 2Y39A 4BJ5C 3FOPA 4J7YA 2DB4A 3RQEA 3RVZA 4DRIB 5BUOA 5KYUB 1JPJA 2HMQA 4N6HA 2YWAA 4BJTA 3CAXA 3CZ6A 2G62A 1BZ4A 2GFHA 2LK4A 2OKUA 2MWQA 1QKRA 1M56C 2XS8A 3FAJA 3NMIA 1K05A 4JW1A 4XTKA 3W8HA 5DS4A 3ABMC 2Q7RA 2XLEA 4ER9A 2UUHA 3LNMB 1T5OA 1GQAA 3C62A 4OD5A 3RIPA 4EIYA 3M4CA 4JZAA 3KL4A 1D0YA 3MYIA 3X1OA 4CDYA 5JRAA 1FFHA 2NPUA 2X51A 3UNGC 2PX3A 3DXJF 1EQ1A 5JUAA 4BEJA 3FVYA 3I5PA 1VOMA 1L7CA 4JVSA 4RDAA 4EWCA 5A6JA 3AG2C 1Q0MA 1QPUA 1CPRA 2L9JA 2YLGA 2OQMA 3NYJA 1YVIA 1HY5A 2IXNA 2PNOA 1OCRC 2Y3BA 1J8YF 4XEVA 1ZYRF 3QTHA 2FAPB 1Q0FA 2Z15A 3BEHA 3K33A 4PJLA 1OCOC 3MYFA 5A69A 3AJMA 4QDLA 3UGOA 3L1MA 5COMA 2CNWA 3NYMA 3FDQA 5BQGA 2ZD9A 2YLDA 4D4NA 2EIJC 1CGNA 4DOZA 3QVZA 4XQ1A 1ZHYA 1ZVZA 3O39A 2KW3C 1T01A 4CBEA 3DAFA 1PCXA 5JT4A 4U5CE 2HUJA 4JJFA 3AGUA 3DJNB 1I5NA 4MVRA 3IEEA 3KH2A 2NUTA 3AG3C 4PACA 4JTDB 1ORYA 1ST6A 3QZCA 1QVXA 1ZU4A 3AQCA 1PD0A 1NZEA 2QNLA 2ZPAA 1M2OA 3IQTA 4J7TA 3K7DA 4KNVA 3RKOF 4O6YA 3Q6NA 3SP1A 2WVOA 3ZVRA 2C03A 2Q3TA 3JYHA 4C7OB 2EPNA 1OR2A 2IOQA 4KC9A 2VC9A 4LDKA 4PK4A 2L6GA 4CDVA 1VYIA 4IJJA 1EI7A 3B0UX 2ZXWC 3HLZA 1KU2A 5JVEA 1RCPA 2YZSA 4XPXA 3RH3A 1J8MF 3TOLA 3QMKA 5B3SC 4HEAJ 4MTOA 4MVMA 1OCCC 1OCZC 1NLXA 3PCVA 2R02A 5L0HA 1Z5ZA 3DKAA 4JEAA 3WAQA 4EHPA 4A4AA 2XLDA 1D0ZA 4MW3A 5HV9A 3FOOA 3W4YA 3E70C 2IXPA 4N06A 3OA1A 4O7GA 3IHUA 1WN0A 3KYJA 4Z9IA 2NG1A 3W2WA 4JCZA 2W4MA 3GEIA 4XEFA 5KYUA 2Y3GA 2EIMC 1MNEA 3M1CB 3ZDLA 1S7ZA 4CS8A 4CS9A 4E7ZA 4P6IC 3H2VA 1E84A 3TJ5A 2R7TA 1Q0KA 2QLAA 3B9QA 2XLVA 4LDQA 4MVQA 5A6AA 3KKBA 1IZMA 3LUTB 3POVA 1MMDA 4CDAA 5KYYB 1I4ZA 2J0XA 5A6BD 4FAPB 3LESA 2R25A 1VB5A 1YAUO 3RF3A 4DBQA 2JX0A 1W2WA 2IXOA 3T6GB 2J9WA 5K0IA 1Z63A 2Y3HA 4I3MA 4WGZA 2HKVA 2J45A 4BJ5A 2R7UA 2NSFA 2LP4A 4OINF 5T3WA 1VTMP 3GWNA 3U9JA 3U2MA 2J7PA 3K1HA 1TWCA 3VM6A 3ZTMA 4CJGA 1U89A 1WGWA 4PJJA 3KYIA 1YA7O 4EUKB 2GAQA 2R05A 3KPHA 1YJGA 1YYXA 4PJMA 2AP3A 3C8ZA 4X0RA 4DBRA 1S05A 2A0BA 3HNIA 2A1DD 1I4YA 1RMVA 4K7BA 3U9MA 3VRCA 1V54C 4HE8D 1RJ9B 4GEHA 3ZWIA 4LDRA 4G0HA 1T6UA 4CS9C 1TQGA 2XLOA 3TK0A 1YYJA 1Y6DA 2G3VA 2GA0A 3UMKA 2NUPA 2ZXRA 4O6NA 5D92A 1OXKA 2DI3A 3S90A 4U5HA 1SMYF 5T3TA 2R7QA 1JRAA 2YL0A 3N0TA 4ULVA 1LM3B 2OCCC 1XZPA 2HS5A 4DRHB 3U3FA 5JS5A 2NSGA 4H4KC 2GWWA 4BJ6A 3S29A 3IQ5A 4C7OA 3EFOB 3C63A 1E85A 3EHNA 4RD9A 4CS8C 3DJUB 3GWLA 4P9FA 2KYHA 5L3VA 1HMDA 3T9OA 1B68A 5COFA 5D91A 2CNWD 2V3CC 1WATA 2D4UA 3GM1A 3DD7A 4OIQF 3FHDA 2L7AA 5EHHA 2AWYA 2CGEA 3S27A 2WVQA 4U5FE 1AVOB 1V74B 1WWPA 1M2VB 4U5DE 2CW0F 2KK1A 1Y4CA 3O10A 2EPMX 2EPOA 4XWJA 4YT2A 5L3QA 4CIPA 1EA8A 1NBBA 4IAOA 3OWTA 3SNHA 3CQZA 1OKKA 4G7OF 1VLSA 1MMNA 2VCAA 1HW1A 1A0BA 2HJMA 3F46A 3H65A 4PFOA 3G50A 4BEMJ 3DWWA 4MS2A 4QI2A 4DXWA 4Z9HA 1WOLA 3A9CA 3T6BA 3S84A 2R7XA 3GANA 1T6IA 4ZLDA 4YT5A 1BR4A 2C04A 1TR2A 2WB7A 3J06A 4BJ6C 3PHF2 3SZRA 1FNTc 3AG4C 3V5YA 5CIVA 1OR3A 3GEHA 1FMVA 3EZHA 2RD9A 3TJ6A 2WZFA 4JE9A 2X0CA 3VYWA 4AK9A 3O55A 3US6A 5B1AC 2IM8A 3T6JA 3U8PA 5KYYA 3I5QA 1LVKA 3JRTA 1NU7D 3TD7A 2DGJA 1E86A 4CSAA 4OIRF 2NUPB 3DE9A 5AGFA 2VH3A 2V26A 4MNDA 3RQGA 3ABLC 1NFOA 1MNDA 3PMRA 4BJ1A 1LIHA 2KGOA 2ZXPA 3U5SA 5EGYA 3L34A 3R2PA 2EIKC 1R4TA 3S28A 3SXYA 1H6GA 3ZIBA 2Q00A 3N2ZB 4AL0A 5FCLA 1A41A 5KYNA 1YLMA 2KC3A 3HKKA 4QI0A 5E2QA 1LI7A 3B0PA 4E18A 4MTFA 1HE9A 2W4BA 4HFKB 1ORJA 2UUIA 3AQBA 4IAQA 4U9EA 4W8KA 4ZLCA 3A11A 1RJ9A 4XPYA 4KBLA 2KJGA 3O6XA 1MMGA 2H7BA 3ZTZA 4RBNA 2A6EF 2P7VA 2QE9A 2VB6A 3FAPB 4WGYA 4LACB 2YL1A 3EJNA 3ZQVA 2EINC 4MVOA 4DVZA 1H9GA 3CEXA 5AC5A 1XWJA 3AG1C 3HTKC 3EH1A 4JRZA 3EGXA 1ZHTA 1JMWA 3SXKA 5L0IA 2LSEA 1WTYA 2IXMA 1JOGA 1VLTA 4JJGA 2J7PD 4CSAC 1G4WR 2H8AA 1LPEA 2KNHA 3EZIA 4NY3A 4OIPF 3DE8A 2XM0A 2I15A 3EFOA 3T4RA 1Z23A 3EGDA 4YL0A 3R7CA 2Q9BA 3LLIA 3L8JA 1PD1A 1L3PA 4DRJB 2KSFA 4N6CA 5F28E 5T1DB 1QZXA 3IQ6A 4CJOA 1MMAA 3WG7C 3C8GB 3NG1A 3QW0A 4GYTA 3S0XA 1M2VA 1O87A 4C3BA 2EILC 2XL6A 5B1BC 2YRFA 1TKNA 5GPGB 3GODA 5AC4A 1SF8A 3W8IA 2OJED 1FMWA 1QSPA 2YEVA 3JZ0A 2XS1A 2Y69C 2OG2A
chains in the Genus database with same CATH topology
1HW1A 2DI3A 1E2XA 3IHUA 4P9FA 3SXMA 3C7JA 1H9TA 3SXKA 1HW2A 3SXZA 3FMSA 3SXYA 1H9GA 2HS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HW1 A;  2DI3 A;  1E2X A;  3IHU A;  4P9F A;  3SXM A;  3C7J A;  1H9T A;  3SXK A;  1HW2 A;  3SXZ A;  3FMS A;  3SXY A;  1H9G A;  2HS5 A; 
#chains in the Genus database with same CATH topology
 3JT1 A;  3LAY A;  2XSE A;  1FFT C;  2PP4 A;  1T9K A;  2XL8 A;  2A68 F;  3L0I A;  1A7D A;  3L8I A;  2YVK A;  4IWB A;  3LNR A;  3G4Z A;  4DVY P;  3DMD A;  4K0D A;  5TJ5 E;  3FMS A;  4HFF B;  1Q0D A;  4L6R A;  4LER A;  4OD4 A;  2ZXO A;  1SZI A;  3LEO A;  3NYL A;  2HSQ A;  3C18 A;  3QW1 A;  4H54 A;  3RFY A;  2XLM A;  4JEB A;  4MVS A;  4UDV A;  1HW2 A;  2H7V C;  3Q6M A;  2P6V A;  5JP7 A;  1LS1 A;  4U5E E;  4Q4Z F;  1LKX A;  2R7W A;  2XL4 A;  3ZC4 A;  1YZC A;  1BDJ B;  3DAG A;  1MQV A;  3RW0 A;  2E87 A;  1R5I D;  4MQ9 F;  3SYN A;  2M4E A;  1O5H A;  3M15 A;  4WJ0 A;  4YK5 A;  5JLI A;  2O9X A;  1OKK D;  1AUE A;  4PR9 A;  4G7Z F;  3LLK A;  3ATP A;  2Q9A A;  2VAS A;  1C03 A;  5HSW A;  1BR2 A;  4NQF A;  3ZQY A;  3HJC A;  3EGX B;  1SYQ A;  4E0I A;  4NCQ A;  3TUL A;  3B0V C;  3V5X A;  3LS1 A;  2HJ3 A;  1O3U A;  2CDQ A;  4E17 A;  4JUR I;  1ZHW A;  3LS0 A;  2PX0 A;  4NTB A;  3VAY A;  5BQH A;  4EKW A;  3EGD B;  1IW7 F;  2XM4 A;  1NU9 C;  4OIO F;  4BG0 A;  4EBK A;  4PJN A;  2BE5 F;  1KTM A;  4FWV A;  5KYW A;  1QQ3 A;  4XLN F;  2OU6 A;  1EKY A;  1FR0 A;  2YQY A;  2MYS A;  4XEK A;  2QTV A;  4E7S A;  3M79 A;  5A6K A;  1D0X A;  5DLJ A;  4YL3 A;  3ZSU A;  5A6B A;  2Q9C A;  2JD3 A;  4J30 B;  4I1O B;  1WAS A;  3IPM O;  4MVU A;  2IYL D;  5B3I A;  1YDI A;  5DVW A;  4W8P A;  4EBJ A;  1H9T A;  4CIH A;  3NKD A;  3K1I C;  2LCH A;  2PFD A;  1LE4 A;  3M4B A;  1OXB A;  4IB4 A;  2JPU A;  4FES A;  1G4U S;  2XLH A;  1UFB A;  2P61 A;  5DS6 A;  2A6H F;  1APC A;  1OQC A;  3Q7L A;  2P1A A;  5F5H A;  3WOD F;  3U2L A;  1FAP B;  4KNW A;  3BRJ A;  2R7O A;  3F47 A;  2LFD A;  1JAF A;  1BR1 A;  2F22 A;  4O6M A;  4U5B E;  3EH2 A;  1A7E A;  3QVY A;  3NKE A;  5JSL A;  5IY5 C;  2BL2 A;  4B6I A;  3PDM P;  2VCC A;  4FX5 A;  1VMA A;  1TFO B;  3C8G A;  3JRM O;  3LJB A;  4DJ9 A;  1E2X A;  3NMJ A;  2XRH A;  1C02 A;  2XXA B;  5L0C A;  2M64 A;  3K66 A;  3I4U A;  4I1M A;  3NRH A;  1Z7Q c;  2L6F A;  3H2U A;  3SXZ A;  4YN0 B;  3U3B A;  3HNL A;  5KYX B;  2EPK X;  1ZW3 A;  1F1M A;  4YT4 A;  2HSB A;  1DOW A;  3AGT A;  4N4W A;  2EPL X;  2WZG A;  1CPQ A;  2OEV A;  2D5R B;  2YL3 A;  4AE4 A;  3UR3 C;  2HMZ A;  3G4X A;  2RSE B;  3ECS A;  4JTC B;  4F4B A;  1HMO A;  5FZT A;  4U5G A;  1TWH A;  1Q0G A;  2J46 A;  3JCU Q;  4MTG A;  5E3A A;  2A0U A;  3EQL F;  1NFN A;  2XLW A;  4M63 A;  1C17 M;  1Z3I X;  2AWC A;  3NDB B;  3JYY A;  2ASR A;  2R9R B;  5BQI A;  4Q5S F;  3EG9 B;  2LIG A;  2HV7 A;  2J9V A;  2AVK A;  1YA9 A;  2AU5 A;  4JTA B;  1U0B B;  2HZ8 A;  2OEX A;  4LLE A;  1U6H A;  2L6H A;  2L81 A;  3B29 A;  2R7R A;  2FFH A;  2FGY A;  1D1C A;  3ASN C;  1RXQ A;  1PV3 A;  5DQT A;  1RKE B;  1K40 A;  2ETS A;  3RYL A;  3OEO A;  3HNK A;  2WL8 A;  2QUP A;  1M57 C;  4U9D A;  5L0F A;  1UG7 A;  4E0H A;  3Q7G A;  1BBH A;  3C7J A;  3HNJ A;  3UMI A;  2LFF A;  1A7V A;  3ITF A;  4XPW A;  2ICW G;  2HFI A;  1RKC A;  1VYK A;  3ZG1 A;  1D1B A;  4J32 B;  4NC3 A;  3GM2 A;  4BPM A;  4C3E A;  4YL1 A;  3AOU A;  1GGQ A;  4ONS A;  1CGO A;  1ORS C;  2P0N A;  2G3K A;  2B0J A;  1LS4 A;  2DYR C;  3W2V A;  5KYW B;  2TMV P;  2B0H A;  1FTS A;  1XZQ A;  2W45 A;  4Z9J A;  3SEO A;  4IAR A;  1YZA A;  4ULW A;  2QY9 A;  1JR8 A;  1YAR O;  4C3D A;  4JIO A;  3GOR A;  2OOC A;  1NSG B;  2LD6 A;  4Q7C A;  1HE1 A;  1ZU5 A;  4P9T A;  5DQZ A;  1OW6 A;  2GDC A;  2WVN A;  3U0C A;  1JPN A;  1M6T A;  2OJQ A;  2WZL A;  2MHR A;  3SXM A;  1GS9 A;  3MBG A;  1T6Q A;  2A69 F;  4A2N B;  4AL1 A;  3TQO A;  2W9Y A;  1G8X A;  256B A;  2BC5 A;  4WAB A;  3B71 A;  5CI8 A;  2Y3D A;  4AE4 B;  1CGM E;  4MW8 A;  2DYS C;  1V55 C;  2KQ9 A;  3GEE A;  3ABK C;  2PF4 E;  1VK5 A;  3ASO C;  4AX2 A;  5L0J A;  1TWA A;  5COG A;  3UMH A;  2XXA A;  2YL7 A;  1V4A A;  3FXH A;  1D1A A;  5F5F A;  3MLG A;  3TOM A;  1NG1 A;  4R32 A;  5E33 A;  3N24 A;  3DZA A;  4IGG A;  5E3C A;  5KYX A;  3K1I A;  3KMI A;  2I8B A;  2PBE A;  3NMK A;  1N1C A;  4NTF A;  4GQH A;  3DI5 A;  3GM3 A;  2VCB A;  3K6B A;  5EK0 A;  1G5Z A;  4G78 A;  4K1O A;  1ZHX A;  3JTL O;  3E9V A;  3VF0 A;  3LEV A;  3JSE O;  2H7O A;  2CYD A;  2NUT B;  1H7I A;  3CSK A;  4YWQ A;  3X2Q C;  4YJW A;  1DOV A;  3MFN A;  3U8V A;  1TWG A;  3WHN A;  3RQF A;  3IQC A;  1SR2 A;  2Q4F A;  3C8G D;  3MX3 A;  4XLP F;  1AEP A;  2J9B A;  2CCY A;  3EG9 A;  2J8W A;  2R03 A;  4MVZ A;  2R7V A;  5L0D A;  4O79 A;  1TFK B;  1ZHZ A;  4JC7 A;  4KI2 A;  2LQG A;  1OW7 A;  1K04 A;  4I44 A;  4NTA A;  5CI9 A;  1OW8 A;  3DM5 A;  1LE2 A;  1GM5 A;  2HV6 A;  1RKE A;  1ZZP A;  4PFP A;  1E83 A;  3V5Z A;  4CX9 A;  1Z6A A;  2YHS A;  1KNY A;  3JSZ A;  1QLE C;  4JCH A;  3RVY A;  3S9O A;  4CS7 A;  5L0G A;  5DS5 A;  3EHM A;  1LI5 A;  1ZW2 A;  2YKZ A;  2R7S A;  4G7H F;  4ANJ A;  4D4X A;  2J9U A;  3EPV A;  4IRU A;  4JKV A;  2IBF A;  3V7O A;  4EBB A;  3DM9 B;  2J0W A;  4YT8 A;  2YLI A;  4LLC A;  3UGP A;  2Y39 A;  4BJ5 C;  3FOP A;  4J7Y A;  2DB4 A;  3RQE A;  3RVZ A;  4DRI B;  5BUO A;  5KYU B;  1JPJ A;  2HMQ A;  4N6H A;  2YWA A;  4BJT A;  3CAX A;  3CZ6 A;  2G62 A;  1BZ4 A;  2GFH A;  2LK4 A;  2OKU A;  2MWQ A;  1QKR A;  1M56 C;  2XS8 A;  3FAJ A;  3NMI A;  1K05 A;  4JW1 A;  4XTK A;  3W8H A;  5DS4 A;  3ABM C;  2Q7R A;  2XLE A;  4ER9 A;  2UUH A;  3LNM B;  1T5O A;  1GQA A;  3C62 A;  4OD5 A;  3RIP A;  4EIY A;  3M4C A;  4JZA A;  3KL4 A;  1D0Y A;  3MYI A;  3X1O A;  4CDY A;  5JRA A;  1FFH A;  2NPU A;  2X51 A;  3UNG C;  2PX3 A;  3DXJ F;  1EQ1 A;  5JUA A;  4BEJ A;  3FVY A;  3I5P A;  1VOM A;  1L7C A;  4JVS A;  4RDA A;  4EWC A;  5A6J A;  3AG2 C;  1Q0M A;  1QPU A;  1CPR A;  2L9J A;  2YLG A;  2OQM A;  3NYJ A;  1YVI A;  1HY5 A;  2IXN A;  2PNO A;  1OCR C;  2Y3B A;  1J8Y F;  4XEV A;  1ZYR F;  3QTH A;  2FAP B;  1Q0F A;  2Z15 A;  3BEH A;  3K33 A;  4PJL A;  1OCO C;  3MYF A;  5A69 A;  3AJM A;  4QDL A;  3UGO A;  3L1M A;  5COM A;  2CNW A;  3NYM A;  3FDQ A;  5BQG A;  2ZD9 A;  2YLD A;  4D4N A;  2EIJ C;  1CGN A;  4DOZ A;  3QVZ A;  4XQ1 A;  1ZHY A;  1ZVZ A;  3O39 A;  2KW3 C;  1T01 A;  4CBE A;  3DAF A;  1PCX A;  5JT4 A;  4U5C E;  2HUJ A;  4JJF A;  3AGU A;  3DJN B;  1I5N A;  4MVR A;  3IEE A;  3KH2 A;  2NUT A;  3AG3 C;  4PAC A;  4JTD B;  1ORY A;  1ST6 A;  3QZC A;  1QVX A;  1ZU4 A;  3AQC A;  1PD0 A;  1NZE A;  2QNL A;  2ZPA A;  1M2O A;  3IQT A;  4J7T A;  3K7D A;  4KNV A;  3RKO F;  4O6Y A;  3Q6N A;  3SP1 A;  2WVO A;  3ZVR A;  2C03 A;  2Q3T A;  3JYH A;  4C7O B;  2EPN A;  1OR2 A;  2IOQ A;  4KC9 A;  2VC9 A;  4LDK A;  4PK4 A;  2L6G A;  4CDV A;  1VYI A;  4IJJ A;  1EI7 A;  3B0U X;  2ZXW C;  3HLZ A;  1KU2 A;  5JVE A;  1RCP A;  2YZS A;  4XPX A;  3RH3 A;  1J8M F;  3TOL A;  3QMK A;  5B3S C;  4HEA J;  4MTO A;  4MVM A;  1OCC C;  1OCZ C;  1NLX A;  3PCV A;  2R02 A;  5L0H A;  1Z5Z A;  3DKA A;  4JEA A;  3WAQ A;  4EHP A;  4A4A A;  2XLD A;  1D0Z A;  4MW3 A;  5HV9 A;  3FOO A;  3W4Y A;  3E70 C;  2IXP A;  4N06 A;  3OA1 A;  4O7G A;  3IHU A;  1WN0 A;  3KYJ A;  4Z9I A;  2NG1 A;  3W2W A;  4JCZ A;  2W4M A;  3GEI A;  4XEF A;  5KYU A;  2Y3G A;  2EIM C;  1MNE A;  3M1C B;  3ZDL A;  1S7Z A;  4CS8 A;  4CS9 A;  4E7Z A;  4P6I C;  3H2V A;  1E84 A;  3TJ5 A;  2R7T A;  1Q0K A;  2QLA A;  3B9Q A;  2XLV A;  4LDQ A;  4MVQ A;  5A6A A;  3KKB A;  1IZM A;  3LUT B;  3POV A;  1MMD A;  4CDA A;  5KYY B;  1I4Z A;  2J0X A;  5A6B D;  4FAP B;  3LES A;  2R25 A;  1VB5 A;  1YAU O;  3RF3 A;  4DBQ A;  2JX0 A;  1W2W A;  2IXO A;  3T6G B;  2J9W A;  5K0I A;  1Z63 A;  2Y3H A;  4I3M A;  4WGZ A;  2HKV A;  2J45 A;  4BJ5 A;  2R7U A;  2NSF A;  2LP4 A;  4OIN F;  5T3W A;  1VTM P;  3GWN A;  3U9J A;  3U2M A;  2J7P A;  3K1H A;  1TWC A;  3VM6 A;  3ZTM A;  4CJG A;  1U89 A;  1WGW A;  4PJJ A;  3KYI A;  1YA7 O;  4EUK B;  2GAQ A;  2R05 A;  3KPH A;  1YJG A;  1YYX A;  4PJM A;  2AP3 A;  3C8Z A;  4X0R A;  4DBR A;  1S05 A;  2A0B A;  3HNI A;  2A1D D;  1I4Y A;  1RMV A;  4K7B A;  3U9M A;  3VRC A;  1V54 C;  4HE8 D;  1RJ9 B;  4GEH A;  3ZWI A;  4LDR A;  4G0H A;  1T6U A;  4CS9 C;  1TQG A;  2XLO A;  3TK0 A;  1YYJ A;  1Y6D A;  2G3V A;  2GA0 A;  3UMK A;  2NUP A;  2ZXR A;  4O6N A;  5D92 A;  1OXK A;  2DI3 A;  3S90 A;  4U5H A;  1SMY F;  5T3T A;  2R7Q A;  1JRA A;  2YL0 A;  3N0T A;  4ULV A;  1LM3 B;  2OCC C;  1XZP A;  2HS5 A;  4DRH B;  3U3F A;  5JS5 A;  2NSG A;  4H4K C;  2GWW A;  4BJ6 A;  3S29 A;  3IQ5 A;  4C7O A;  3EFO B;  3C63 A;  1E85 A;  3EHN A;  4RD9 A;  4CS8 C;  3DJU B;  3GWL A;  4P9F A;  2KYH A;  5L3V A;  1HMD A;  3T9O A;  1B68 A;  5COF A;  5D91 A;  2CNW D;  2V3C C;  1WAT A;  2D4U A;  3GM1 A;  3DD7 A;  4OIQ F;  3FHD A;  2L7A A;  5EHH A;  2AWY A;  2CGE A;  3S27 A;  2WVQ A;  4U5F E;  1AVO B;  1V74 B;  1WWP A;  1M2V B;  4U5D E;  2CW0 F;  2KK1 A;  1Y4C A;  3O10 A;  2EPM X;  2EPO A;  4XWJ A;  4YT2 A;  5L3Q A;  4CIP A;  1EA8 A;  1NBB A;  4IAO A;  3OWT A;  3SNH A;  3CQZ A;  1OKK A;  4G7O F;  1VLS A;  1MMN A;  2VCA A;  1HW1 A;  1A0B A;  2HJM A;  3F46 A;  3H65 A;  4PFO A;  3G50 A;  4BEM J;  3DWW A;  4MS2 A;  4QI2 A;  4DXW A;  4Z9H A;  1WOL A;  3A9C A;  3T6B A;  3S84 A;  2R7X A;  3GAN A;  1T6I A;  4ZLD A;  4YT5 A;  1BR4 A;  2C04 A;  1TR2 A;  2WB7 A;  3J06 A;  4BJ6 C;  3PHF 2;  3SZR A;  1FNT c;  3AG4 C;  3V5Y A;  5CIV A;  1OR3 A;  3GEH A;  1FMV A;  3EZH A;  2RD9 A;  3TJ6 A;  2WZF A;  4JE9 A;  2X0C A;  3VYW A;  4AK9 A;  3O55 A;  3US6 A;  5B1A C;  2IM8 A;  3T6J A;  3U8P A;  5KYY A;  3I5Q A;  1LVK A;  3JRT A;  1NU7 D;  3TD7 A;  2DGJ A;  1E86 A;  4CSA A;  4OIR F;  2NUP B;  3DE9 A;  5AGF A;  2VH3 A;  2V26 A;  4MND A;  3RQG A;  3ABL C;  1NFO A;  1MND A;  3PMR A;  4BJ1 A;  1LIH A;  2KGO A;  2ZXP A;  3U5S A;  5EGY A;  3L34 A;  3R2P A;  2EIK C;  1R4T A;  3S28 A;  3SXY A;  1H6G A;  3ZIB A;  2Q00 A;  3N2Z B;  4AL0 A;  5FCL A;  1A41 A;  5KYN A;  1YLM A;  2KC3 A;  3HKK A;  4QI0 A;  5E2Q A;  1LI7 A;  3B0P A;  4E18 A;  4MTF A;  1HE9 A;  2W4B A;  4HFK B;  1ORJ A;  2UUI A;  3AQB A;  4IAQ A;  4U9E A;  4W8K A;  4ZLC A;  3A11 A;  1RJ9 A;  4XPY A;  4KBL A;  2KJG A;  3O6X A;  1MMG A;  2H7B A;  3ZTZ A;  4RBN A;  2A6E F;  2P7V A;  2QE9 A;  2VB6 A;  3FAP B;  4WGY A;  4LAC B;  2YL1 A;  3EJN A;  3ZQV A;  2EIN C;  4MVO A;  4DVZ A;  1H9G A;  3CEX A;  5AC5 A;  1XWJ A;  3AG1 C;  3HTK C;  3EH1 A;  4JRZ A;  3EGX A;  1ZHT A;  1JMW A;  3SXK A;  5L0I A;  2LSE A;  1WTY A;  2IXM A;  1JOG A;  1VLT A;  4JJG A;  2J7P D;  4CSA C;  1G4W R;  2H8A A;  1LPE A;  2KNH A;  3EZI A;  4NY3 A;  4OIP F;  3DE8 A;  2XM0 A;  2I15 A;  3EFO A;  3T4R A;  1Z23 A;  3EGD A;  4YL0 A;  3R7C A;  2Q9B A;  3LLI A;  3L8J A;  1PD1 A;  1L3P A;  4DRJ B;  2KSF A;  4N6C A;  5F28 E;  5T1D B;  1QZX A;  3IQ6 A;  4CJO A;  1MMA A;  3WG7 C;  3C8G B;  3NG1 A;  3QW0 A;  4GYT A;  3S0X A;  1M2V A;  1O87 A;  4C3B A;  2EIL C;  2XL6 A;  5B1B C;  2YRF A;  1TKN A;  5GPG B;  3GOD A;  5AC4 A;  1SF8 A;  3W8I A;  2OJE D;  1FMW A;  1QSP A;  2YEV A;  3JZ0 A;  2XS1 A;  2Y69 C;  2OG2 A; 
#chains in the Genus database with same CATH homology
 1HW1 A;  2DI3 A;  1E2X A;  3IHU A;  4P9F A;  3SXM A;  3C7J A;  1H9T A;  3SXK A;  1HW2 A;  3SXZ A;  3FMS A;  3SXY A;  1H9G A;  2HS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...