3SXZA

Metal-free fcd domain of tm0439 a putative transcriptional regulator
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
140
structure length
139
Chain Sequence
b'GAMDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVEKSAREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, GntR family
publication title Metal-free FCD domain of TM0439 a putative transcriptional regulator
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 64
structure length 139
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxzA00
1HW2A 3C7JA 3SXKA 3SXYA 1E2XA 1H9GA 3SXMA 3SXZA 1HW1A 1H9TA 3IHUA 3FMSA 4P9FA 2DI3A 2HS5A
chains in the Genus database with same CATH superfamily
2VB6A 4JKVA 1VTMP 4MVRA 1FFTC 2JD3A 3F46A 2PBEA 4P9TA 4G7ZF 1G4WR 2G3KA 3ABMC 2L6GA 4KNWA 1TFKB 4JEAA 3MFNA 4Q7CA 2KC3A 5KYYA 4JW1A 1PCXA 3B9QA 2Y3BA 3T6GB 2AWCA 3TOMA 1HMOA 2NUTA 3O55A 5BQHA 3ABLC 5DS5A 2XXAA 1WGWA 2ZXRA 1QVXA 1RKEA 1EKYA 2Y3GA 3MBGA 3F47A 2BE5F 2B0HA 4OIQF 3M79A 5A6JA 1LI7A 1RCPA 1WTYA 3O39A 4OIPF 3SYNA 3L0IA 5A6KA 3GORA 3GM2A 2YWAA 2Q7RA 2A6HF 3I4UA 2CNWA 1QLEC 2CCYA 5BQGA 5KYUA 2R9RB 3SXMA 2M4EA 3EJNA 1Q0MA 3S29A 3TK0A 4MNDA 5L3VA 2R7XA 3V5YA 2OCCC 1MMDA 4U5BE 1JPJA 4I44A 2QE9A 1KTMA 2LCHA 2P7VA 1ZZPA 2DGJA 4XLNF 1EA8A 1JMWA 4IARA 4MQ9F 4RD9A 3QVZA 5L0GA 1YJGA 5JRAA 4CDVA 5AC4A 1O5HA 2KQ9A 3PCVA 3EGDB 1NFOA 4YL3A 2HUJA 3C8GA 4BJTA 4Z9JA 3T6BA 2EIJC 3A9CA 4YT8A 4WGZA 1HW2A 4CSAC 1R4TA 3LEOA 1OCOC 4YK5A 4EKWA 5A6BD 5DQZA 3J06A 1Q0GA 1CGNA 1Z6AA 4CDYA 4DBRA 5A6AA 2J8WA 3UMIA 1T6QA 4XEKA 2M64A 3T4RA 2HKVA 3K6BA 2NSGA 1ZHWA 2Q9CA 4IWBA 4MTOA 3U3BA 3EG9A 3W2VA 2KYHA 5DVWA 1CGOA 2DYSC 2OKUA 3ASOC 3BRJA 3RW0A 5KYXA 1CGME 2I15A 2IXOA 4C7OA 2CDQA 5F5FA 5L0IA 1O87A 2HMQA 1VOMA 3FOOA 1YARO 5JUAA 2Q4FA 1FR0A 1TWAA 2OOCA 2QY9A 1A7VA 1ZU5A 2XS8A 2I8BA 4MVQA 3AG2C 2YVKA 3FMSA 3VRCA 3KKBA 1I4YA 2R02A 3ZQYA 1YLMA 4DOZA 2XLHA 3OA1A 1NLXA 1TR2A 1KNYA 3HJCA 3Q6NA 4YL0A 4WABA 3UR3C 5B3IA 3GODA 1CPRA 4PJNA 3W8HA 3K7DA 5FCLA 1T6IA 4PFOA 4O79A 2GA0A 4MTGA 3ZTMA 3NKDA 4DJ9A 1YYJA 1D0XA 1PV3A 3OEOA 2E87A 2IBFA 1OCZC 2VC9A 1NU7D 3FOPA 3PMRA 2J9BA 4I1MA 4J32B 5E3AA 2R7WA 3SXKA 3C8GB 1I4ZA 3AG3C 2BC5A 2WVOA 3UMKA 2GFHA 3W8IA 1OW8A 3RQFA 3RH3A 4BG0A 1OCRC 3U0CA 1K40A 2L7AA 3SEOA 3ITFA 3LLKA 1TWHA 2XS1A 4PK4A 3R7CA 2EPKX 2EPOA 4JJGA 4CS7A 3QW0A 1Z5ZA 3IQTA 1QZXA 4M63A 3SXZA 5L0HA 1ZHXA 3AJMA 2KGOA 2XLVA 2V3CC 4XTKA 1C03A 3ATPA 3PHF2 2IYLD 2GDCA 2VASA 4HFFB 3V7OA 1OXKA 3C62A 2A1DD 2JPUA 2J9VA 2LFDA 2ASRA 1YA9A 2L81A 2YL7A 4N6CA 1WOLA 2YKZA 4NCQA 2OEXA 3TOLA 1E83A 1BR2A 2Q9AA 3L34A 3QTHA 2NUPB 4AE4A 3S90A 5L0JA 4G78A 3JRMO 3CEXA 4Z9IA 4U9DA 1VB5A 4CS8A 2H7BA 1VMAA 2EIKC 2IM8A 2Q3TA 1ZVZA 2LIGA 3V5ZA 4G7OF 5FZTA 1E84A 1M2OA 3RYLA 1PD1A 3U9JA 2B0JA 1E86A 4JE9A 3FXHA 1MMGA 3K66A 4D4XA 2YRFA 1OW7A 3AGUA 3M4CA 4Z9HA 2J9UA 3GEHA 3SNHA 3ASNC 4ONSA 2HFIA 3ZQVA 4DVZA 3LUTB 1PD0A 2GAQA 2PFDA 1TWCA 2Q00A 1AVOB 2HSBA 4G0HA 5B1AC 3U9MA 1IW7F 1OCCC 3LNMB 3M15A 4O6NA 4GYTA 5JP7A 2R05A 1FTSA 4MVUA 4BEJA 4NTFA 2Q9BA 4NTBA 4QI2A 3HNJA 4AK9A 3N24A 4DXWA 2QNLA 4YWQA 1YA7O 5E2QA 1MMNA 2AWYA 4ER9A 1S05A 3DZAA 2HV6A 2YEVA 3C8GD 4BPMA 4EBJA 1BZ4A 5DS4A 1DOWA 4JEBA 3U8VA 2DB4A 2J9WA 4JIOA 4OD4A 2R7VA 1KU2A 1GGQA 4JTCB 3EHNA 2WZLA 5AGFA 4CIHA 1SYQA 2FAPB 3LS1A 3O6XA 4UDVA 3E9VA 2P0NA 4MW8A 3ZVRA 1Z63A 3VF0A 2YL3A 1M2VB 2XRHA 2BL2A 3B71A 3CAXA 3EH1A 4KC9A 4XEFA 3RIPA 5A69A 3ZSUA 4U5DE 3HNKA 3IQ6A 1NSGB 4K0DA 4PR9A 3TJ5A 1B68A 1U89A 4AE4B 1QSPA 3U2LA 4ZLCA 5F5HA 3KMIA 1AEPA 1VLTA 1RXQA 1OKKD 2XM4A 2LQGA 3EPVA 4IJJA 4X0RA 3V5XA 3DXJF 1VK5A 1U6HA 2D4UA 2X0CA 4KNVA 3ZWIA 3ZIBA 3JYHA 1MMAA 4J7YA 3B0UX 1SMYF 3EGXB 3WHNA 5HV9A 4Q5SF 1ZW3A 3AG1C 5DLJA 3EH2A 2EILC 2A69F 1W2WA 3JSEO 3RKOF 1U0BB 4JZAA 2H7VC 5CI8A 4IB4A 4J30B 4C3EA 4FWVA 1HE9A 3US6A 4WJ0A 3JCUQ 2HSQA 2LD6A 3JRTA 3JYYA 1K05A 4MVMA 4O7GA 4H4KC 1LS4A 1V55C 4GEHA 4QI0A 5BQIA 3M4BA 3NKEA 1O3UA 4E7ZA 1QKRA 1VYKA 2OQMA 4DRIB 2EIMC 1LPEA 2J0WA 1WWPA 4OD5A 4YL1A 2L9JA 1I5NA 3FDQA 1EI7A 4ANJA 1LIHA 5D92A 4XWJA 4LERA 1M57C 2DI3A 4BJ6A 1BBHA 1BDJB 1OKKA 3GWNA 1FAPB 4E7SA 1FFHA 1E2XA 5DS6A 4FX5A 3QVYA 1D1BA 1A7EA 3S9OA 4MVSA 2ZXWC 3RQEA 3S0XA 2NUPA 3JSZA 1SF8A 3UGPA 3AQCA 3DKAA 3MYFA 3NYLA 2CW0F 2EPLX 2XLDA 1C02A 1D0YA 4U5FE 3SP1A 2AU5A 1Y4CA 3LS0A 2V26A 1F1MA 3ZG1A 1L3PA 5CI9A 5IY5C 1NU9C 3K1IA 5GPGB 1TQGA 1D1AA 1TFOB 2HZ8A 1NFNA 2PX3A 1OXBA 4H54A 2XSEA 2Y3HA 2P61A 4OINF 3S27A 4EIYA 3IHUA 3KYJA 3M1CB 3IPMO 2HV7A 3W2WA 4YN0B 4JTAB 3LESA 2A6EF 4N06A 4U5EE 3C8ZA 3X1OA 3I5PA 3B0VC 3DE8A 2AVKA 5CIVA 1OQCA 3E70C 4PJLA 3DD7A 2PNOA 3DAFA 4XLPF 1ZU4A 3DJUB 3EFOB 4G7HF 1H7IA 1HW1A 2IXPA 2P1AA 3HNIA 3Q7LA 3RF3A 3X2QC 1APCA 5HSWA 4ZLDA 3JT1A 4U9EA 3N2ZB 3TULA 4XEVA 1V54C 1Z3IX 2XM0A 3NMIA 4CJOA 1A0BA 2XL8A 1H6GA 2R7RA 1M2VA 2VCCA 3LLIA 5L0DA 4XPXA 1YAUO 1XZPA 3KPHA 4ULWA 3AQBA 3LEVA 1XWJA 4LDRA 5EGYA 4CBEA 3NMKA 1JAFA 5KYYB 5TJ5E 1ZHTA 3GM3A 1M56C 4MS2A 5JSLA 4AL1A 5B1BC 1CPQA 3POVA 3NMJA 4NC3A 4MW3A 1JPNA 2R25A 3GEEA 2J7PD 1HE1A 3ZTZA 1ST6A 3HTKC 1FMWA 4XQ1A 1ORJA 4RDAA 3HNLA 3EGXA 3FAPB 4NQFA 2IXNA 1D0ZA 2FGYA 2H8AA 2KK1A 3S84A 3RFYA 5K0IA 3H65A 2XLOA 1S7ZA 4IRUA 5DQTA 2JX0A 2VCAA 1M6TA 1G4US 4DBQA 1YYXA 3ECSA 4MVOA 4U5CE 2R7QA 3RVYA 4CS8C 2L6FA 2RD9A 3LAYA 1LM3B 4NTAA 1QQ3A 4C3BA 1D1CA 256BA 3DAGA 2LFFA 3VAYA 3WG7C 3QZCA 1A41A 3IQCA 2O9XA 2KJGA 2R7OA 2EPMX 2QLAA 2XL6A 1N1CA 2IXMA 2EPNA 1Q0KA 1R5ID 2OJED 4Q4ZF 4YT5A 3T9OA 4BJ5A 1YZAA 4YJWA 3NG1A 3VYWA 4HEAJ 3MYIA 1VLSA 4E18A 2PP4A 2J7PA 2R7UA 3KH2A 2AP3A 4EHPA 2NG1A 4OIRF 5L0CA 1JOGA 2D5RB 4I1OB 3TD7A 2ETSA 4LACB 4A4AA 1T6UA 2YLDA 2WVQA 5T1DB 4K7BA 1RKCA 1VYIA 2OEVA 3GEIA 2ZXOA 4KI2A 3EZIA 2YHSA 4CS9A 1J8YF 1MNEA 3GANA 3EHMA 4ULVA 2YL0A 4D4NA 4R32A 4BJ5C 2WZFA 2ZPAA 4EBBA 2NSFA 2XLEA 2F22A 5EHHA 2NPUA 2CYDA 1LE2A 3HKKA 4HE8D 5D91A 5F28E 1Z7Qc 1LE4A 2G3VA 4C3DA 1ZW2A 3LNRA 1V74B 4XPYA 4JRZA 3Q6MA 1EQ1A 2UUIA 5COGA 4U5GA 1FMVA 4LDKA 3A11A 2C04A 1NBBA 3AG4C 4E17A 1RMVA 4OIOF 2MYSA 5T3WA 1RJ9B 4I3MA 2J45A 2LSEA 4JC7A 1NZEA 2KNHA 4W8KA 4YT4A 4CSAA 2XL4A 4CS9C 5BUOA 3U3FA 2XLWA 1HMDA 3DJNB 2HJ3A 4N6HA 1BR1A 4AX2A 3PDMP 3EFOA 1T5OA 4NY3A 2VH3A 4LLEA 3L8IA 4MTFA 2A68F 4DRJB 2ZD9A 3GWLA 4JCHA 3FHDA 4J7TA 4JJFA 4LDQA 3TQOA 3SXYA 2WVNA 4CIPA 4CJGA 3AOUA 3CZ6A 5JT4A 4B6IA 2YZSA 3EZHA 1GM5A 3UNGC 3N0TA 4F4BA 3L8JA 3Q7GA 4CX9A 1JR8A 1K04A 1Q0DA 2A0BA 2CGEA 1FNTc 1OR2A 4P9FA 4JCZA 2HS5A 4HFKB 4IGGA 3DWWA 4FAPB 1XZQA 3DE9A 1ZHYA 3R2PA 2C03A 4MVZA 4P6IC 2HJMA 3DM5A 1UFBA 3KL4A 3SZRA 3U5SA 4YT2A 4LLCA 3H2UA 2R7TA 2WL8A 2G62A 4JVSA 3H2VA 1SR2A 4PFPA 2NUTB 3IQ5A 1ORYA 3UGOA 2XXAB 2UUHA 3C18A 1RKEB 1TWGA 4BJ1A 4KBLA 1WN0A 1Z23A 3W4YA 1G5ZA 1NG1A 3DI5A 2PX0A 4BJ6C 5JLIA 1G8XA 2KSFA 1JRAA 5EK0A 1TKNA 3DMDA 3JZ0A 2W4MA 2VCBA 3CQZA 1MQVA 3U8PA 2LP4A 2YL1A 2FFHA 2H7OA 2OG2A 5B3SC 1E85A 2OU6A 3NRHA 4DRHB 1H9GA 2PF4E 3L1MA 4EUKB 1ZHZA 2A0UA 3FAJA 4AL0A 3G4ZA 2Z15A 5KYWA 1QPUA 4IAQA 5KYUB 2DYRC 1Y6DA 3NYMA 2WB7A 3LJBA 4RBNA 2R03A 3VM6A 1UG7A 4DVYP 1A7DA 4A2NB 2IOQA 2XLMA 3K1IC 4O6YA 3CSKA 3IEEA 3G4XA 3WAQA 5E33A 3C7JA 3C63A 5A6BA 4JURI 1LS1A 5COFA 1DOVA 2P6VA 4XPWA 4K1OA 2EINC 1YZCA 3NYJA 1T01A 2Y3DA 3BEHA 5JS5A 4BEMJ 3B0PA 3RVZA 2ZXPA 3EQLF 3GM1A 3K33A 3K1HA 1H9TA 2MWQA 2L6HA 3QW1A 1SZIA 3FVYA 4IAOA 4N4WA 4PJJA 1BR4A 2HMZA 4U5HA 3RQGA 3ZC4A 3OWTA 5E3CA 1HY5A 4E0IA 2W45A 4QDLA 3G50A 5L0FA 2J46A 2WZGA 1IZMA 2J0XA 1MNDA 2KW3C 2QTVA 2ICWG 2Y39A 2QUPA 3HLZA 4JTDB 4W8PA 4WGYA 3ZDLA 4PJMA 3EG9B 3O10A 5AC5A 1AUEA 1YVIA 3U2MA 5JVEA 2LK4A 2YQYA 3I5QA 3KYIA 5KYNA 1WATA 4O6MA 5KYXB 3ABKC 4C7OB 4EWCA 3AGTA 5T3TA 3TJ6A 3NDBB 1GQAA 1OW6A 2RSEB 4L6RA 2OJQA 1T9KA 4PACA 2MHRA 2TMVP 3DM9B 2GWWA 4EBKA 1RJ9A 3WODF 1Q0FA 1WASA 5KYWB 4E0HA 1GS9A 1L7CA 5L3QA 1V4AA 1J8MF 1LKXA 1ZYRF 3MLGA 1YDIA 3MX3A 1LI5A 3S28A 3T6JA 1ORSC 5COMA 2W4BA 1LVKA 4FESA 1C17M 2Y69C 3JTLO 4GQHA 4CDAA 2CNWD 2YLIA 2R7SA 1OR3A 2YLGA 2X51A 3B29A 3QMKA 3UMHA 2W9YA 3EGDA
chains in the Genus database with same CATH topology
1HW2A 3C7JA 3SXKA 3SXYA 1E2XA 1H9GA 3SXMA 3SXZA 1HW1A 1H9TA 3IHUA 3FMSA 4P9FA 2DI3A 2HS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HW2 A;  3C7J A;  3SXK A;  3SXY A;  1E2X A;  1H9G A;  3SXM A;  3SXZ A;  1HW1 A;  1H9T A;  3IHU A;  3FMS A;  4P9F A;  2DI3 A;  2HS5 A; 
#chains in the Genus database with same CATH topology
 2VB6 A;  4JKV A;  1VTM P;  4MVR A;  1FFT C;  2JD3 A;  3F46 A;  2PBE A;  4P9T A;  4G7Z F;  1G4W R;  2G3K A;  3ABM C;  2L6G A;  4KNW A;  1TFK B;  4JEA A;  3MFN A;  4Q7C A;  2KC3 A;  5KYY A;  4JW1 A;  1PCX A;  3B9Q A;  2Y3B A;  3T6G B;  2AWC A;  3TOM A;  1HMO A;  2NUT A;  3O55 A;  5BQH A;  3ABL C;  5DS5 A;  2XXA A;  1WGW A;  2ZXR A;  1QVX A;  1RKE A;  1EKY A;  2Y3G A;  3MBG A;  3F47 A;  2BE5 F;  2B0H A;  4OIQ F;  3M79 A;  5A6J A;  1LI7 A;  1RCP A;  1WTY A;  3O39 A;  4OIP F;  3SYN A;  3L0I A;  5A6K A;  3GOR A;  3GM2 A;  2YWA A;  2Q7R A;  2A6H F;  3I4U A;  2CNW A;  1QLE C;  2CCY A;  5BQG A;  5KYU A;  2R9R B;  3SXM A;  2M4E A;  3EJN A;  1Q0M A;  3S29 A;  3TK0 A;  4MND A;  5L3V A;  2R7X A;  3V5Y A;  2OCC C;  1MMD A;  4U5B E;  1JPJ A;  4I44 A;  2QE9 A;  1KTM A;  2LCH A;  2P7V A;  1ZZP A;  2DGJ A;  4XLN F;  1EA8 A;  1JMW A;  4IAR A;  4MQ9 F;  4RD9 A;  3QVZ A;  5L0G A;  1YJG A;  5JRA A;  4CDV A;  5AC4 A;  1O5H A;  2KQ9 A;  3PCV A;  3EGD B;  1NFO A;  4YL3 A;  2HUJ A;  3C8G A;  4BJT A;  4Z9J A;  3T6B A;  2EIJ C;  3A9C A;  4YT8 A;  4WGZ A;  1HW2 A;  4CSA C;  1R4T A;  3LEO A;  1OCO C;  4YK5 A;  4EKW A;  5A6B D;  5DQZ A;  3J06 A;  1Q0G A;  1CGN A;  1Z6A A;  4CDY A;  4DBR A;  5A6A A;  2J8W A;  3UMI A;  1T6Q A;  4XEK A;  2M64 A;  3T4R A;  2HKV A;  3K6B A;  2NSG A;  1ZHW A;  2Q9C A;  4IWB A;  4MTO A;  3U3B A;  3EG9 A;  3W2V A;  2KYH A;  5DVW A;  1CGO A;  2DYS C;  2OKU A;  3ASO C;  3BRJ A;  3RW0 A;  5KYX A;  1CGM E;  2I15 A;  2IXO A;  4C7O A;  2CDQ A;  5F5F A;  5L0I A;  1O87 A;  2HMQ A;  1VOM A;  3FOO A;  1YAR O;  5JUA A;  2Q4F A;  1FR0 A;  1TWA A;  2OOC A;  2QY9 A;  1A7V A;  1ZU5 A;  2XS8 A;  2I8B A;  4MVQ A;  3AG2 C;  2YVK A;  3FMS A;  3VRC A;  3KKB A;  1I4Y A;  2R02 A;  3ZQY A;  1YLM A;  4DOZ A;  2XLH A;  3OA1 A;  1NLX A;  1TR2 A;  1KNY A;  3HJC A;  3Q6N A;  4YL0 A;  4WAB A;  3UR3 C;  5B3I A;  3GOD A;  1CPR A;  4PJN A;  3W8H A;  3K7D A;  5FCL A;  1T6I A;  4PFO A;  4O79 A;  2GA0 A;  4MTG A;  3ZTM A;  3NKD A;  4DJ9 A;  1YYJ A;  1D0X A;  1PV3 A;  3OEO A;  2E87 A;  2IBF A;  1OCZ C;  2VC9 A;  1NU7 D;  3FOP A;  3PMR A;  2J9B A;  4I1M A;  4J32 B;  5E3A A;  2R7W A;  3SXK A;  3C8G B;  1I4Z A;  3AG3 C;  2BC5 A;  2WVO A;  3UMK A;  2GFH A;  3W8I A;  1OW8 A;  3RQF A;  3RH3 A;  4BG0 A;  1OCR C;  3U0C A;  1K40 A;  2L7A A;  3SEO A;  3ITF A;  3LLK A;  1TWH A;  2XS1 A;  4PK4 A;  3R7C A;  2EPK X;  2EPO A;  4JJG A;  4CS7 A;  3QW0 A;  1Z5Z A;  3IQT A;  1QZX A;  4M63 A;  3SXZ A;  5L0H A;  1ZHX A;  3AJM A;  2KGO A;  2XLV A;  2V3C C;  4XTK A;  1C03 A;  3ATP A;  3PHF 2;  2IYL D;  2GDC A;  2VAS A;  4HFF B;  3V7O A;  1OXK A;  3C62 A;  2A1D D;  2JPU A;  2J9V A;  2LFD A;  2ASR A;  1YA9 A;  2L81 A;  2YL7 A;  4N6C A;  1WOL A;  2YKZ A;  4NCQ A;  2OEX A;  3TOL A;  1E83 A;  1BR2 A;  2Q9A A;  3L34 A;  3QTH A;  2NUP B;  4AE4 A;  3S90 A;  5L0J A;  4G78 A;  3JRM O;  3CEX A;  4Z9I A;  4U9D A;  1VB5 A;  4CS8 A;  2H7B A;  1VMA A;  2EIK C;  2IM8 A;  2Q3T A;  1ZVZ A;  2LIG A;  3V5Z A;  4G7O F;  5FZT A;  1E84 A;  1M2O A;  3RYL A;  1PD1 A;  3U9J A;  2B0J A;  1E86 A;  4JE9 A;  3FXH A;  1MMG A;  3K66 A;  4D4X A;  2YRF A;  1OW7 A;  3AGU A;  3M4C A;  4Z9H A;  2J9U A;  3GEH A;  3SNH A;  3ASN C;  4ONS A;  2HFI A;  3ZQV A;  4DVZ A;  3LUT B;  1PD0 A;  2GAQ A;  2PFD A;  1TWC A;  2Q00 A;  1AVO B;  2HSB A;  4G0H A;  5B1A C;  3U9M A;  1IW7 F;  1OCC C;  3LNM B;  3M15 A;  4O6N A;  4GYT A;  5JP7 A;  2R05 A;  1FTS A;  4MVU A;  4BEJ A;  4NTF A;  2Q9B A;  4NTB A;  4QI2 A;  3HNJ A;  4AK9 A;  3N24 A;  4DXW A;  2QNL A;  4YWQ A;  1YA7 O;  5E2Q A;  1MMN A;  2AWY A;  4ER9 A;  1S05 A;  3DZA A;  2HV6 A;  2YEV A;  3C8G D;  4BPM A;  4EBJ A;  1BZ4 A;  5DS4 A;  1DOW A;  4JEB A;  3U8V A;  2DB4 A;  2J9W A;  4JIO A;  4OD4 A;  2R7V A;  1KU2 A;  1GGQ A;  4JTC B;  3EHN A;  2WZL A;  5AGF A;  4CIH A;  1SYQ A;  2FAP B;  3LS1 A;  3O6X A;  4UDV A;  3E9V A;  2P0N A;  4MW8 A;  3ZVR A;  1Z63 A;  3VF0 A;  2YL3 A;  1M2V B;  2XRH A;  2BL2 A;  3B71 A;  3CAX A;  3EH1 A;  4KC9 A;  4XEF A;  3RIP A;  5A69 A;  3ZSU A;  4U5D E;  3HNK A;  3IQ6 A;  1NSG B;  4K0D A;  4PR9 A;  3TJ5 A;  1B68 A;  1U89 A;  4AE4 B;  1QSP A;  3U2L A;  4ZLC A;  5F5H A;  3KMI A;  1AEP A;  1VLT A;  1RXQ A;  1OKK D;  2XM4 A;  2LQG A;  3EPV A;  4IJJ A;  4X0R A;  3V5X A;  3DXJ F;  1VK5 A;  1U6H A;  2D4U A;  2X0C A;  4KNV A;  3ZWI A;  3ZIB A;  3JYH A;  1MMA A;  4J7Y A;  3B0U X;  1SMY F;  3EGX B;  3WHN A;  5HV9 A;  4Q5S F;  1ZW3 A;  3AG1 C;  5DLJ A;  3EH2 A;  2EIL C;  2A69 F;  1W2W A;  3JSE O;  3RKO F;  1U0B B;  4JZA A;  2H7V C;  5CI8 A;  4IB4 A;  4J30 B;  4C3E A;  4FWV A;  1HE9 A;  3US6 A;  4WJ0 A;  3JCU Q;  2HSQ A;  2LD6 A;  3JRT A;  3JYY A;  1K05 A;  4MVM A;  4O7G A;  4H4K C;  1LS4 A;  1V55 C;  4GEH A;  4QI0 A;  5BQI A;  3M4B A;  3NKE A;  1O3U A;  4E7Z A;  1QKR A;  1VYK A;  2OQM A;  4DRI B;  2EIM C;  1LPE A;  2J0W A;  1WWP A;  4OD5 A;  4YL1 A;  2L9J A;  1I5N A;  3FDQ A;  1EI7 A;  4ANJ A;  1LIH A;  5D92 A;  4XWJ A;  4LER A;  1M57 C;  2DI3 A;  4BJ6 A;  1BBH A;  1BDJ B;  1OKK A;  3GWN A;  1FAP B;  4E7S A;  1FFH A;  1E2X A;  5DS6 A;  4FX5 A;  3QVY A;  1D1B A;  1A7E A;  3S9O A;  4MVS A;  2ZXW C;  3RQE A;  3S0X A;  2NUP A;  3JSZ A;  1SF8 A;  3UGP A;  3AQC A;  3DKA A;  3MYF A;  3NYL A;  2CW0 F;  2EPL X;  2XLD A;  1C02 A;  1D0Y A;  4U5F E;  3SP1 A;  2AU5 A;  1Y4C A;  3LS0 A;  2V26 A;  1F1M A;  3ZG1 A;  1L3P A;  5CI9 A;  5IY5 C;  1NU9 C;  3K1I A;  5GPG B;  1TQG A;  1D1A A;  1TFO B;  2HZ8 A;  1NFN A;  2PX3 A;  1OXB A;  4H54 A;  2XSE A;  2Y3H A;  2P61 A;  4OIN F;  3S27 A;  4EIY A;  3IHU A;  3KYJ A;  3M1C B;  3IPM O;  2HV7 A;  3W2W A;  4YN0 B;  4JTA B;  3LES A;  2A6E F;  4N06 A;  4U5E E;  3C8Z A;  3X1O A;  3I5P A;  3B0V C;  3DE8 A;  2AVK A;  5CIV A;  1OQC A;  3E70 C;  4PJL A;  3DD7 A;  2PNO A;  3DAF A;  4XLP F;  1ZU4 A;  3DJU B;  3EFO B;  4G7H F;  1H7I A;  1HW1 A;  2IXP A;  2P1A A;  3HNI A;  3Q7L A;  3RF3 A;  3X2Q C;  1APC A;  5HSW A;  4ZLD A;  3JT1 A;  4U9E A;  3N2Z B;  3TUL A;  4XEV A;  1V54 C;  1Z3I X;  2XM0 A;  3NMI A;  4CJO A;  1A0B A;  2XL8 A;  1H6G A;  2R7R A;  1M2V A;  2VCC A;  3LLI A;  5L0D A;  4XPX A;  1YAU O;  1XZP A;  3KPH A;  4ULW A;  3AQB A;  3LEV A;  1XWJ A;  4LDR A;  5EGY A;  4CBE A;  3NMK A;  1JAF A;  5KYY B;  5TJ5 E;  1ZHT A;  3GM3 A;  1M56 C;  4MS2 A;  5JSL A;  4AL1 A;  5B1B C;  1CPQ A;  3POV A;  3NMJ A;  4NC3 A;  4MW3 A;  1JPN A;  2R25 A;  3GEE A;  2J7P D;  1HE1 A;  3ZTZ A;  1ST6 A;  3HTK C;  1FMW A;  4XQ1 A;  1ORJ A;  4RDA A;  3HNL A;  3EGX A;  3FAP B;  4NQF A;  2IXN A;  1D0Z A;  2FGY A;  2H8A A;  2KK1 A;  3S84 A;  3RFY A;  5K0I A;  3H65 A;  2XLO A;  1S7Z A;  4IRU A;  5DQT A;  2JX0 A;  2VCA A;  1M6T A;  1G4U S;  4DBQ A;  1YYX A;  3ECS A;  4MVO A;  4U5C E;  2R7Q A;  3RVY A;  4CS8 C;  2L6F A;  2RD9 A;  3LAY A;  1LM3 B;  4NTA A;  1QQ3 A;  4C3B A;  1D1C A;  256B A;  3DAG A;  2LFF A;  3VAY A;  3WG7 C;  3QZC A;  1A41 A;  3IQC A;  2O9X A;  2KJG A;  2R7O A;  2EPM X;  2QLA A;  2XL6 A;  1N1C A;  2IXM A;  2EPN A;  1Q0K A;  1R5I D;  2OJE D;  4Q4Z F;  4YT5 A;  3T9O A;  4BJ5 A;  1YZA A;  4YJW A;  3NG1 A;  3VYW A;  4HEA J;  3MYI A;  1VLS A;  4E18 A;  2PP4 A;  2J7P A;  2R7U A;  3KH2 A;  2AP3 A;  4EHP A;  2NG1 A;  4OIR F;  5L0C A;  1JOG A;  2D5R B;  4I1O B;  3TD7 A;  2ETS A;  4LAC B;  4A4A A;  1T6U A;  2YLD A;  2WVQ A;  5T1D B;  4K7B A;  1RKC A;  1VYI A;  2OEV A;  3GEI A;  2ZXO A;  4KI2 A;  3EZI A;  2YHS A;  4CS9 A;  1J8Y F;  1MNE A;  3GAN A;  3EHM A;  4ULV A;  2YL0 A;  4D4N A;  4R32 A;  4BJ5 C;  2WZF A;  2ZPA A;  4EBB A;  2NSF A;  2XLE A;  2F22 A;  5EHH A;  2NPU A;  2CYD A;  1LE2 A;  3HKK A;  4HE8 D;  5D91 A;  5F28 E;  1Z7Q c;  1LE4 A;  2G3V A;  4C3D A;  1ZW2 A;  3LNR A;  1V74 B;  4XPY A;  4JRZ A;  3Q6M A;  1EQ1 A;  2UUI A;  5COG A;  4U5G A;  1FMV A;  4LDK A;  3A11 A;  2C04 A;  1NBB A;  3AG4 C;  4E17 A;  1RMV A;  4OIO F;  2MYS A;  5T3W A;  1RJ9 B;  4I3M A;  2J45 A;  2LSE A;  4JC7 A;  1NZE A;  2KNH A;  4W8K A;  4YT4 A;  4CSA A;  2XL4 A;  4CS9 C;  5BUO A;  3U3F A;  2XLW A;  1HMD A;  3DJN B;  2HJ3 A;  4N6H A;  1BR1 A;  4AX2 A;  3PDM P;  3EFO A;  1T5O A;  4NY3 A;  2VH3 A;  4LLE A;  3L8I A;  4MTF A;  2A68 F;  4DRJ B;  2ZD9 A;  3GWL A;  4JCH A;  3FHD A;  4J7T A;  4JJF A;  4LDQ A;  3TQO A;  3SXY A;  2WVN A;  4CIP A;  4CJG A;  3AOU A;  3CZ6 A;  5JT4 A;  4B6I A;  2YZS A;  3EZH A;  1GM5 A;  3UNG C;  3N0T A;  4F4B A;  3L8J A;  3Q7G A;  4CX9 A;  1JR8 A;  1K04 A;  1Q0D A;  2A0B A;  2CGE A;  1FNT c;  1OR2 A;  4P9F A;  4JCZ A;  2HS5 A;  4HFK B;  4IGG A;  3DWW A;  4FAP B;  1XZQ A;  3DE9 A;  1ZHY A;  3R2P A;  2C03 A;  4MVZ A;  4P6I C;  2HJM A;  3DM5 A;  1UFB A;  3KL4 A;  3SZR A;  3U5S A;  4YT2 A;  4LLC A;  3H2U A;  2R7T A;  2WL8 A;  2G62 A;  4JVS A;  3H2V A;  1SR2 A;  4PFP A;  2NUT B;  3IQ5 A;  1ORY A;  3UGO A;  2XXA B;  2UUH A;  3C18 A;  1RKE B;  1TWG A;  4BJ1 A;  4KBL A;  1WN0 A;  1Z23 A;  3W4Y A;  1G5Z A;  1NG1 A;  3DI5 A;  2PX0 A;  4BJ6 C;  5JLI A;  1G8X A;  2KSF A;  1JRA A;  5EK0 A;  1TKN A;  3DMD A;  3JZ0 A;  2W4M A;  2VCB A;  3CQZ A;  1MQV A;  3U8P A;  2LP4 A;  2YL1 A;  2FFH A;  2H7O A;  2OG2 A;  5B3S C;  1E85 A;  2OU6 A;  3NRH A;  4DRH B;  1H9G A;  2PF4 E;  3L1M A;  4EUK B;  1ZHZ A;  2A0U A;  3FAJ A;  4AL0 A;  3G4Z A;  2Z15 A;  5KYW A;  1QPU A;  4IAQ A;  5KYU B;  2DYR C;  1Y6D A;  3NYM A;  2WB7 A;  3LJB A;  4RBN A;  2R03 A;  3VM6 A;  1UG7 A;  4DVY P;  1A7D A;  4A2N B;  2IOQ A;  2XLM A;  3K1I C;  4O6Y A;  3CSK A;  3IEE A;  3G4X A;  3WAQ A;  5E33 A;  3C7J A;  3C63 A;  5A6B A;  4JUR I;  1LS1 A;  5COF A;  1DOV A;  2P6V A;  4XPW A;  4K1O A;  2EIN C;  1YZC A;  3NYJ A;  1T01 A;  2Y3D A;  3BEH A;  5JS5 A;  4BEM J;  3B0P A;  3RVZ A;  2ZXP A;  3EQL F;  3GM1 A;  3K33 A;  3K1H A;  1H9T A;  2MWQ A;  2L6H A;  3QW1 A;  1SZI A;  3FVY A;  4IAO A;  4N4W A;  4PJJ A;  1BR4 A;  2HMZ A;  4U5H A;  3RQG A;  3ZC4 A;  3OWT A;  5E3C A;  1HY5 A;  4E0I A;  2W45 A;  4QDL A;  3G50 A;  5L0F A;  2J46 A;  2WZG A;  1IZM A;  2J0X A;  1MND A;  2KW3 C;  2QTV A;  2ICW G;  2Y39 A;  2QUP A;  3HLZ A;  4JTD B;  4W8P A;  4WGY A;  3ZDL A;  4PJM A;  3EG9 B;  3O10 A;  5AC5 A;  1AUE A;  1YVI A;  3U2M A;  5JVE A;  2LK4 A;  2YQY A;  3I5Q A;  3KYI A;  5KYN A;  1WAT A;  4O6M A;  5KYX B;  3ABK C;  4C7O B;  4EWC A;  3AGT A;  5T3T A;  3TJ6 A;  3NDB B;  1GQA A;  1OW6 A;  2RSE B;  4L6R A;  2OJQ A;  1T9K A;  4PAC A;  2MHR A;  2TMV P;  3DM9 B;  2GWW A;  4EBK A;  1RJ9 A;  3WOD F;  1Q0F A;  1WAS A;  5KYW B;  4E0H A;  1GS9 A;  1L7C A;  5L3Q A;  1V4A A;  1J8M F;  1LKX A;  1ZYR F;  3MLG A;  1YDI A;  3MX3 A;  1LI5 A;  3S28 A;  3T6J A;  1ORS C;  5COM A;  2W4B A;  1LVK A;  4FES A;  1C17 M;  2Y69 C;  3JTL O;  4GQH A;  4CDA A;  2CNW D;  2YLI A;  2R7S A;  1OR3 A;  2YLG A;  2X51 A;  3B29 A;  3QMK A;  3UMH A;  2W9Y A;  3EGD A; 
#chains in the Genus database with same CATH homology
 1HW2 A;  3C7J A;  3SXK A;  3SXY A;  1E2X A;  1H9G A;  3SXM A;  3SXZ A;  1HW1 A;  1H9T A;  3IHU A;  3FMS A;  4P9F A;  2DI3 A;  2HS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...