3SY0B

S25-2- a(2-8)-a(2-4)kdo trisaccharide complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Germline antibody recognition of distinct carbohydrate epitopes
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords S25-2 FAB (IGG1K) light chain
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2011-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sy0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sy0B01
3RWCB 1F6FB 3B9KA 2OTWB 1DBAL 3RAJL 5HYEA 5DJ8B 1F6LL 1VFAB 4I5BA 4U6TA 2EYTA 3IAPA 3PJSB 4Y8AA 3QSKB 4PJHB 4JFFA 2ENSA 1UQSA 4F9LC 3SEPA 1J18A 3FONB 4NRZB 5IIEA 4OZGF 1N2RB 2YPVH 2BMKA 4FQJH 3GSUA 1C12A 4WU5B 2ZSVB 1UZ8A 3GBLA 4WFEE 1NAKL 2XA8L 1FNGA 3QUXA 2F54A 3QIWC 1ZLSH 4Y8DC 9CGTA 4F9LA 4HLJA 4GAJH 4KRPC 2RB8A 1IC1A 4NWUL 4HWZA 4NM8H 3PJSA 5ACLA 4FFVC 3PQYA 4PRHE 1T89A 3SOBH 4KMTH 3MBXH 4YXKH 3EYFA 3ULSB 1PY9A 4JHWH 3TYGL 2WP3T 3VXSE 5EC1A 1YEDA 5F7UA 4MZ3A 4Q6YA 4WUUB 4GH7B 2GSIA 3QIBB 1M7IA 4UMGA 4HG4J 4FFWC 1N8ZB 4JO2H 4GRLC 3UZVB 5I73B 1KCVH 4O5LL 5D70L 2EE9A 2YPLD 4HWBA 1ZKAA 4UV4L 1K85A 2PYEE 2R9HC 4LCWD 4M6OL 1JMZA 1XGQA 1TVBA 5HJ3B 3AXLA 2X1OA 1U41A 3OKEA 3KPQB 2XWBA 1UB6B 4GG6E 2CIIB 3SE9L 3QUZA 5DLMH 5GGVL 1CG9B 1HYRC 5MI0C 15C8L 4QRSB 2NX5B 1YPZA 1DSFL 5EIQA 4OCLC 1WITA 2EIEA 3FB8B 1HHIA 3GJFA 2JF1A 4G8FA 2VR9A 4PJ5B 4OBSA 2CDEB 1IQDB 5ELIA 4NUGH 4Z7WB 4OKDA 5MP6L 2R9HD 1ZHLB 4IJ3B 5INDB 4K55A 4GRLD 3X11A 4XNYH 1IGIL 1XR9A 4OUUB 1U42A 5K9KB 1KULA 4NQUA 5D2LB 1A6ZB 5CBEA 1U0QA 1BX2B 4XCNB 4YUEH 2JJTA 2GJ6A 4LLMB 5J11C 2P5WE 3IJSB 5JW4N 1XH3A 3RVVD 4P46A 2IGFH 4NBXB 4O4YL 4G8IB 3FFCD 3C5ZC 3G04A 1D5ZB 4P5TD 2QSVA 1FNSL 1I7TA 3OPZH 2VSCA 4NO0A 4YDJB 1RURL 1T6WA 1GOFA 2F5AH 1G9MC 4BSVA 4I9WD 4M1CC 1KCLA 2XTJB 3BAEH 1RZFL 2R56H 4OM0H 3U9PL 4NGHL 5FHBL 4H25B 3WJJC 1AO7D 1EMTH 1QQDB 3F58L 1B4JL 3O6FB 1J0JA 2NYYD 3NH7H 2LAGB 3UDWC 4WDIA 1KC5L 1F45A 1OTUD 5GHWL 4HBCH 4GKOA 2QQKL 5I9QB 3U0PA 3K3QA 2XWJB 1T7VA 5FYJL 3VXQA 4N9OB 5IOPB 2EIZB 2GJ6D 3EJYD 3OJVC 5CSBA 5IHUH 4M7LT 3QO1A 3GSWB 2HN7B 4HWNA 1EEYA 2IFFL 4KPHL 1MHPH 1UT9A 2KDGA 4FA8A 1MHHA 1MPAL 4WW2A 4H25A 4FQXC 5AEAA 1U8OB 3D0VA 4X4ME 2DIBA 3X13B 1ITBB 3O3EA 3PWUB 3RWFA 5CILH 1G0XA 2GAZA 3U0WH 2OMNA 4MXQD 1E4WL 4JFDA 3L7EA 3MLVH 4O2EA 4XP4L 5HYSA 4FQLH 4IHOA 1NMCB 5E1AB 5I1HH 2BY2A 4Y4KA 4H88H 5IBUG 1QSFA 4OB5H 4LKCB 3CH1B 5B4MC 4JLRA 1T5WB 4HX1A 4MLSA 1XGPA 4HCRH 4PJHF 1QBLH 3FB7A 4KHTL 3U7WL 2LQRA 5K9KA 5L88H 3GDBA 3ESUF 3ULUC 1CXHA 1DL7H 4KKNA 5I2IA 4OF5A 5E2TL 4XWOC 5GGVY 4DGIH 3ARFB 4Y4FC 4O2FB 4MNQB 3SCMD 3L3HB 4E5XB 1P6FA 4AM0B 1NEZB 3DV4B 5J13B 2MPAL 2JTDA 3CFCH 3QEHA 2C1OB 3QQ9C 3IF1A 2R1XA 4S10A 4PLJD 3VI3E 4XCYB 4X4YA 3RIAF 2GY7B 4LK4A 1H3PH 1HHHB 1RUKL 3OGCB 4L3EB 3RWJB 4Y4FA 4JFDD 1QFWI 3AVEA 4PJGF 1RK1A 1JGLL 2EDHA 4Y1AE 3NFPB 1BZ9A 1T66D 5JPMA 2XWBB 1ND0B 3T0ED 3VXSA 4O2CA 4F7EB 1CGVA 3MRRB 2A2QT 1A6TA 5LAXA 1Y0LB 2FJHA 4Y5VB 4ZAKB 1HK6A 2A6JA 3RZCB 1BD2E 1ZS8B 4APQD 2VERN 4UV7L 4KK8D 1ZSDA 5K9JH 5K9OA 5JUEL 3O2DH 1J8HE 4DVBB 4Y4HD 3T1FA 1G7PB 1OAZL 2E6PA 1FGNL 1P4LB 2CR6A 1N59B 1ZHBB 3FQRA 3VFUA 4ZXBD 4RMRA 1OSZA 2Y7QA 4YHNA 2NLJA 4KK6D 3KAAA 3NOIA 4L8SC 2YN5A 1G9NL 3QUXB 3MV7A 4KKCD 5ESAB 4EDWH 1P4LA 1NANI 5D1XB 3S5LA 4PRIB 4XCEB 3FQWB 5DMKA 4Q6IC 3NFSH 5C0GA 5CBAB 1I8LC 3GBMH 4K7PL 2DQJH 2J8UB 5FM4A 1J10A 3WLWD 4WO4A 4GXUN 5F96H 1KTDB 5H2BB 1C8PA 1ZS8A 4Y2DD 5ACMA 2VB5A 1BQHB 2Z8RA 4S1RL 2C3VA 2Y36H 2P5WA 3BT2L 3MTRA 4Y7MA 4HUNB 4H5SB 1I8LA 1D5XB 5F3BB 2VLJB 4XMKH 5I1LA 1JV5A 2O5YL 2V9TA 4QHUB 4NZRH 3I6KB 1YEHL 2PYEA 2EDYA 3DVFA 4S1SL 1E27B 5HHXH 1CI5A 5TF1L 4K2UL 1WT5C 5FOJA 4WV1A 1NFDE 3IFLL 4PBWD 3GHBL 4P2RE 5DQDL 1FBIL 3BQUC 4K94C 4LHUB 5FECB 3HB3C 4JO1L 4LRNL 1S78C 4ZUVB 5DD0H 1ETZA 2P4AB 2X70A 1U8QB 1TJIL 1RUQL 5IBLD 3MRQB 2H32A 4BUGA 1FVEA 3W9EB 4XCCL 4F7PB 1CE1H 5HBBA 3S5LG 2BVPA 1Y6MR 2AGJL 3MRIA 5DRZA 2ED7A 3VA6A 1FGVL 4P4KC 5E2UH 2PETA 2FR4A 3PIQB 4TUOA 3JV4B 2WWKT 4NQDD 3QDMD 2MQCA 3IDMA 4NIKB 2VE6B 4R7DA 3TFKD 2EDDA 1QSFB 3NCJH 1FFNA 1FZMA 5C0JA 4JDTH 2XQYG 3RUGE 3MLRL 4J3UA 3MGTB 5HI3C 4EI5C 7FABH 1HSAB 4GKSB 4NO5B 2ARJA 3DHJA 1UZ6E 3QNYA 2DMBA 3JXAA 4LAQH 2XG4A 2OYPA 2XTLA 4ISVA 5E7FA 3DECA 4HIEB 4ZYKA 5F1NB 4D0CB 1JHLL 1MHHB 1GC1H 4EI5A 1BF8A 4AIOA 3G5ZA 5DJ2B 3JWOH 1I75A 4IIQC 4Y2DA 5FCUL 1SBSH 3RZWA 3OKNA 4ZSOA 4YBHA 5GGQL 3GSRA 2J3SA 4YHLH 1S7XB 1BD2D 4G6FB 2VJXA 3PWVB 3ARDD 2E7CA 1F3RB 1DUZB 1VPOH 4O2FA 3MJ9L 4NM4L 3O6FA 4X7FC 2FO4A 4JFEE 2NR6D 4KKCC 3RY4A 5JXAH 4I18B 3LS5H 1M4KA 5D7IF 3FT4A 4LCWE 4P4RA 2AK4D 4F2MB 3B3IB 5BRZE 4EKXA 5KVDL 3NA4A 3O6FC 1T20A 4LLAA 3RU8H 1YNLL 1ZLUH 3BKJH 4UB0H 4Y88A 2OMBA 1CLYL 5DD5L 3TM6A 2Z31C 2A77L 4AH2A 2QADD 3ARDB 5IF0A 2R29H 2GAZB 3BRGC 4IS6A 4FFVD 1OM3L 4UZGA 2AEQL 3KPLB 3C5ZB 4ELMF 3VFTB 5LWYL 5C0BA 1FNEB 2W91A 2K7QA 4GMSL 3ZKMD 4G5ZH 4BQ6A 4JHZA 2WZPD 5E6IB 3BDYL 1NPUA 4ZPTB 1RZKH 1BQLH 2NX5D 4LRIC 4BZ1L 3U0PB 2XN9D 4O58H 2I60H 3LKQB 2CRIA 3CX5J 4CJ0A 5ALCH 4JM4L 3NAAL 4QWWD 2GFBA 4TQEH 1KELH 5FGSA 4P5TC 1UWXK 1A3QA 3VRIB 4PJ9D 5D1QD 4ELME 1QBAA 3MOBH 5FYJU 1TVBB 3EFFB 3T4YB 4IRSB 5E08H 4YO0B 3ZLQC 4JFOA 5DMGD 4FQXA 3BYTA 3MLXL 1UFUA 2PN5A 1LO0H 2VXUH 2EDWA 3C9NA 5FYJH 3G6AB 5A3IC 2XQBL 1JGVL 1B6UA 5EUOA 3NTCH 1T6VN 5DD6B 2DYPA 4XNZB 5IW6B 5GHWH 3ORJA 1S7QB 1GH7A 3KR3H 2AJUH 4ZFZB 3KPMA 3TN0A 1YNKL 5SWZB 1YY8A 2Y25A 1QFUL 4HIEA 1IM9D 1GGBH 2IH3A 1YZZA 4IMLA 2M26A 4LSUH 1FZKB 1EZVY 5C0CD 3D69B 3HE6C 1PKOA 4FRWA 1KPVA 2EKJA 2MCPH 4IRJB 5DI8B 2APTA 1P7QA 4P4KB 4ZTPH 3A0OA 4TUKL 3VDCA 2AEIT 4QT5A 3CSYA 2W65B 1WBXA 4OCRL 2C9AA 5D7LB 3QNZA 5ERWA 4W6WB 1RHHA 1I8KA 4NQEA 2OR9L 3QUMB 1GOGA 1KN2L 3EYUL 4IMKA 4NRZA 2IBZX 2X4SA 1EHLH 5HI3D 3GMOA 1HZHL 4LCIH 3CFJB 4HKBB 1WAAA 1CL7I 4JFYB 2C3GA 3TO4D 3GJFK 4ODHH 1I8IA 2BFVH 5JORA 1ZVSA 3CAFA 3BKYL 3NGBC 1VKXA 1UB6A 4TVPD 2DJUA 1F2XK 3IVKA 4M8QB 1ETZB 4Y19B 3KPTA 3PWLB 4TUJA 5CFHA 1NC4D 3C09C 1A7OH 1R3JA 5DC9B 3RI5F 3RUGA 32C2A 2MSPA 3ULVD 2XTJC 1ITCA 1MLBA 2IALB 1A6AA 5IVXA 3I9GH 4M7ZB 3BOVA 3TH4T 1BJ8A 4X7EC 1X7QB 3LKOA 2Y5TA 3B9VA 4PLKC 1F5WA 3D3VB 4NFBA 3T0EB 4QEGA 4J1UB 3OG4B 4QHUA 3MX0A 3ZSSA 1DBKL 1EXUB 2IPTL 4C59B 3QXVA 3FO9B 1X5ZA 4YHKH 1CICA 2X4TA 3QJFA 5EU5A 5E56A 2P5WB 5BZWA 2R0WL 3ECBB 5D1ZD 4UV4H 3OJDA 3LPFA 1YMHB 4LSRL 1KCVL 4J12A 4P3WA 5C09B 3GMOB 1RIHL 3VMPA 4WFFD 4R90H 4YWGH 5FYLL 1CFNA 1JWSB 3TT3H 1IFHH 2VQUA 1T21A 1WWAX 2AI0H 4NQEB 5CGMA 1U3HC 3V7MA 4EVNB 3TCXA 3RIFF 5DJDB 4CUCA 1T2QL 3CNKA 4H1LA 2DQDH 3LKNB 1A21A 4P2CG 1RMFL 4EBQL 3D69A 5DVOA 3ECBA 4KJWD 4JJ5B 3S96A 4QKXB 2Y7QB 1MFBL 2VDPL 4KJQD 5J12C 1CICB 5C0AD 1Q72L 3ESVF 4K07A 1Z2KA 1YA5A 1CFQA 2EDJA 2VDKH 5DUBB 1VGEH 3BEWA 3H9SA 2CIKA 4PJ9C 3VD5A 5T5FL 4LF3A 5F89B 2EDNA 4TPRL 5IK3B 3GSXB 5K93A 43CAA 3BWAB 1SYSB 3D87B 4NSKA 4LCCC 1AGEA 5FB8A 2GJJA 1WAAE 2JJUA 2EC9T 1A9EB 1HXYA 4GS7B 4JHAH 4F7TB 5JOPD 4WI2A 4PRPA 5KAQG 4OJFL 2BOBB 1FFPB 1U92A 2X4OA 3FQUA 2CSPA 1I9EA 1NC4A 2BXYA 2ESVA 1OCWL 4MNGA 5DD1H 5ESQA 2R29L 4Z5RA 3K4AA 3OAYH 5FYKE 4Z0BL 2HKFL 3OXRA 4QRQA 1U8KB 4ZOEA 3SKMA 4OLYH 3C6LA 3UX9B 4UU9B 2KUTA 3SE8H 2X4SB 3WFZA 5MEPA 4G7VL 4RFOL 1OLLA 2IADB 1B4RA 4JKPH 3STZB 2X4NA 3NZHL 1TETH 4OAWB 1B88A 2YPLB 3IDNA 5C0BB 3L95B 3P4MB 3VWKA 2DKSA 3D1MC 2P8MB 1YN7A 4QYOB 1UKSA 3U2SA 3H42L 1FZKA 4NM4H 4I48B 2H2SD 3D85A 4TNWK 2GCYB 1MIEL 2P8PA 1A4JA 1JF1B 1WZKA 4LQFL 1R0AH 4PRPD 3ZHKA 1JPGB 1TNMA 4QHLB 4LHQB 2VDNH 3O3DA 5MERA 3WJJA 3OL2A 1Q9LB 2VO5A 5GRWA 3PL6A 1K2DA 4JCMA 4QO1A 2NXYD 3HI5H 4JPVH 3LEVH 4HUUA 3VFRA 2CK0L 5JXED 1UWEL 4MNHB 3O2VL 3QHTC 1DQDL 5C0AA 3V52H 3HI5L 1I9JH 1VENA 1HE7A 1YYLL 2H41A 3MRHB 5TE7L 3UTSE 4Y5XA 1J5OH 5KSAD 1SJHA 3BQUB 3EYOB 4M93C 2V2WB 2XTJE 4PJAA 2DLEA 5D6DC 4MSWB 5E4EB 1PQZB 1PJ9A 4NN7C 4OZHB 4M5YH 1MNUH 3AS2A 1S9KC 4LGRB 3KJ6H 4K71C 4RQQA 1A3RL 3PABB 1N3NA 3KHOA 1OAQH 1AO7E 3H42H 5HY9B 3SQOL 2X9WA 3VGAB 2HJFB 4WFHE 3TGXA 1FVCB 3BW9A 2JK5A 2VXQH 4XNXH 5D7KE 1IAKB 3VFPA 2F9BT 2BCKB 1NLBL 1ZTXH 2RIKA 5C2BH 1JJUA 4G7VH 4I48A 2NY3C 3VGGA 5ESVA 4UTAH 2GJ6E 4NO0B 1MFCL 3F7YB 1HSAA 4GKSA 3NCBB 4LGSB 4ZTOH 5MENA 3HRZA 1F4AA 1I8MB 4FXGB 3IDXH 1ODAA 2VDLH 3IRPX 3VWKD 5FO9B 2EKSA 4Z8FL 5IUSA 5HTSA 1X4XA 3QFJA 3MV9A 5CGYD 1KCSH 3UZEA 3K0WA 2O5YH 3WMSA 3GHEH 2YMXL 1SY6H 2CJUH 1U3JA 2XY2A 4A2LA 4APQC 3PUCA 4NCC1 5FXCH 2H45A 2ZUQB 4LVOB 2VXSL 5I8OL 1G9NC 4GQPH 3S6CA 4HH9A 4JRXA 4U3HA 2VDPH 3QB7C 1RZIA 3RZCC 4Y5VC 4ZAKC 2Z35B 3DROA 1ZLWH 3L3GA 5CMAA 5EU6D 5I73C 3EDDA 1OTSD 4OLWH 2W60A 1TENA 3ZYZA 3WXWL 1JV5B 2YRZA 1AP2A 3IDGA 1NMAH 2X44D 3ARBD 1BQHG 2DQEH 1CIUA 1Q0YH 4EUPB 3CC5B 3O45B 1TVHB 3H3PL 4KRPB 4WO4B 3TBSB 4PRHD 5JIHA 2WW8A 2VDOH 2F5BH 5HGBA 2FB4H 5DS8B 5LG1A 5BCAA 2VZOA 1KPUB 4NKIH 1QBBA 1OY3B 2AJVL 4FZEH 5C9JB 2BRQA 1NCUA 4FQQA 1EAPB 1YJDL 3VH8A 2Q1EA 5E2VL 1G7LA 1BZ7A 1XR8B 2EXWD 2NZ9D 3W0WD 3ZT7A 1EVTC 3TPKA 1U8QA 5AD0B 5JPNA 1KFAL 3MGAA 4JM2B 1CZ8L 4P57A 4HZAA 4F57L 2K7PA 2V5SA 1ZGLM 1D9KA 2ZKHL 5L6YH 3P9LA 2EH8H 3IKCB 3WIFA 2CR3A 2P49B 4NC1C 3DLQR 2BK8A 2C5DC 4OGYL 3QH3B 4XT1C 1KF9B 4M7KL 4AENA 5KSBB 1I1AA 5F9JB 1EHLL 2CKNA 1A6TB 5LAXB 5CJOH 3SDCC 5EB9A 1QO3B 5FUZL 2OR9H 2FGWL 3KYKL 4UINH 4N0YH 5L2KD 1ZHNB 4GBXC 4V1DA 4IDLA 2W60B 3E6FA 3FTGA 4ACPA 1MRDH 1GL4B 5BMFL 4XNUH 1U58A 5DA4A 3QP3A 4X5WB 4ZO8A 4H0GA 3MOAH 4XNQA 1KIPB 1ZVYA 5I1HL 1UKTA 4RFEA 2XZQL 1D6VL 5T1KA 1HQ4B 5GS0L 2BHYA 4JM2A 3EUUA 3DYOA 4JG1L 5F7YC 4P2QE 5D7JC 2A6DB 3MO1B 4HUXB 3ARFA 1K8IA 4IOIA 4F33B 3HMXA 2N56A 5JIKA 4FTVB 5KW9H 1F4HA 2ZCKL 4OF6A 2AXHA 3VH8G 5IMMB 1T3FA 2XQBH 5FYKH 4MXQC 2F58L 4EIZC 1AI1H 5DZLA 3G5XB 4HCRA 1CFTB 2R4RH 3HZKB 4Z0XA 5DQ9A 2DQCH 2P42B 3GKZA 2GUOA 4M48H 5IQ9B 1C5CH 2A1WH 2NY0C 2W38A 4WJ5A 1NGQH 2F19H 4UOW1 5EUKB 4KKBD 5GISL 4JFDB 5KANG 1OQOA 3G6AA 1XCQB 4WUKH 3D0LB 3F58H 3KPSB 4BZ1H 3PGDA 3O3EB 1CL7L 1H5BC 3D2UD 1O5DT 4Q97A 2OJZL 1EHNA 2D9CA 3UBXI 1AC0A 4NDMB 3ROOB 3NVQA 5DRWA 1X5GA 1EEZB 4OCSL 1FC1A 1S7UA 2F54D 1I1YA 4GMSH 3U1SL 3OR7A 3L3GB 3OPZL 2ZP0T 3PHQA 5BS0A 1HYSC 4PP2A 4X4YB 4UDUB 1CDYA 2PKDA 3QDGA 1YN6A 4LDOB 4MQTB 1IMHC 4UILL 2FGWH 3FT3A 4JR9H 1K6QL 2BXZA 4M4RA 3RIFK 5EU3A 1HCVA 4P5TB 2DM2A 4OCXL 5AUMB 1IKNC 4HK0A 4KZDH 2E27H 4FFWD 1G7IB 3D5OF 3BPLB 3DWTA 4XPHL 1IGIH 4F80A 1MLCB 5GJSL 2WQ8A 3QDHA 1P5VA 3B8SA 1CE6A 1CZ8H 2VXVH 5TE7H 2Z8WC 2DYPD 4MMZC 4W4OA 4DGYL 1RIUL 4N9GB 1EGJL 3ZDYF 2FIKB 4PGCB 3ZKXC 1YJDH 5JXAL 1GPOL 5T1LD 4YDKL 1U8IA 4MZ2A 2QBWA 1DSFH 3ARED 4JPVL 4HS8L 2JJSA 2NY7L 3RGHA 3RKDC 1DEEB 2VSDA 4PGEB 4QRPB 2CH8A 5ESVB 3QIWB 1MY7A 3L7FB 4U6VH 1NUFA 1T7YA 4LPTA 1G7JB 3TVMD 4OUUA 3PWNB 1MCPH 1P4BL 5E4EC 1Q94B 3QI9D 4JPIA 2ZCLH 1FE8H 3TF7C 1Q0YL 1I85A 1A6UH 5E99H 1E6OL 2WWKO 5HY9A 4POZD 5C7XH 4YXKL 5J57B 4LAQL 4XVTL 3BE1H 4MA8L 3OKDB 3OZ9L 4KMTL 3HI6L 1X5AA 1U8JA 3DHMA 5FUOH 3FQXB 3ARRA 2AEWA 1YQVH 1JYNA 1FDLH 4EN3D 5ICYB 3SGEI 5CCKH 1DLHA 5IBUB 1QA9B 1WTGT 5F9JA 5DWUH 3DTXA 3QDGD 2P24B 4ALAL 4WFED 1FO0H 5DSCA 4AG4H 4R96A 1NCCL 4H0IA 4RGOL 5I1EH 1DE4B 2XZCL 2VZUA 5ILTL 1MH5A 2ZSWB 3VFVA 3TNNA 3S9DB 3Q0HA 3GHEL 2AVGA 5D7JD 2ADFH 5JPNB 1V7MH 1OP5K 1A64A 4WTZG 5FDWA 2NY1C 5C70A 5MEQA 2IPUG 1WICA 3WNNA 5EORL 1FO0L 4AG4L 5EU4B 5TF0A 5I6XC 5C09D 1S9WA 1HI6B 4P0DA 4G8GA 5I76B 1M7DA 2NMSA 3GSQB 1TQCC 4LCYA 5CCKL 3DETD 3CZFB 4OSUH 4XPAH 5CEZE 7CGTA 1LO4H 2H32B 4NNYA 4NBYB 3MRCB 3FO1A 1IEBA 4WU5A 4R4BB 1KSRA 3QWRA 5C2BL 3M07A 5JMOC 1FIGH 1KCUH 3QUZD 4FFYL 2RFXA 3MUGB 3V0AC 4UOW0 1OGTB 4RGNE 5JHDD 1BBDL 3B2VH 4CMMA 1E27A 3GJEA 1YNTA 4LP5A 5TE6L 1MJ7L 3FTGB 1RIHH 1I7ZB 1PLGH 4NWTL 1ZAGA 3MJGX 1T1XB 4YXHL 1CGSL 3NFSL 3TIEA 1HHKA 3B9KB 2GT9B 1MNUL 1FZOA 3VFSB 1RJLA 4TSCL 3H9HA 3UYRH 4OI7A 1CICC 4Y19E 4DJMA 1N8ZA 2V17H 3T3PF 4R3SA 2ADJA 1JZ7A 3DX9A 4RBPH 3U6RB 1A5FL 1QPPA 4KROC 1MSPA 3I9GL 2CK0H 5F7DB 1WBZA 3SJVA 4H20L 3DUUB 3U0TA 1A7OL 5LBSH 3DVNA 5IM7B 4UV7H 3GMMA 3QDJE 4H8WC 1WEJH 2Q8AL 2J6EA 1FAKT 2EDOA 5KZCD 2UWEE 3MUZ1 5DC4B 3IDJB 3KJ4B 1RFDH 4QHKI 4OV5B 1EERB 1UCBL 4U2YA 1WAAF 3T0DA 5IIEB 1VA9A 1MFAH 2DQFA 3DMMA 1UVQB 3UJTH 4P4KA 4Z7VE 5I1KL 3NA9L 2L4OA 1H3PL 4U4BA 1P2CB 1V7NL 5CZKA 3WS6A 4HS6A 3ZKNC 4JZJC 4AT6B 4KI1A 4R0LB 4POUB 5EBMB 3U1SH 3BH9B 1VFAA 4I5BB 2N1KA 4S0SD 1JRHI 2I5YL 1YECL 3TA3A 5ABDE 2YUWA 2HKFH 5HHPB 2R2CA 3L1OH 5F3HA 4DGVL 4R4FH 4PR5B 4U33A 3K2UL 3GSNA 3B5GA 2XNAB 3GIZL 2IMNA 4PLJC 4WUKL 5CD5C 5BRZD 3AUVA 2P8LB 4XHJD 4JCLA 5IEKB 4LCUA 4IRSA 4U6XA 2B8OT 5E94A 2DN7A 5SV3A 1VFBB 3LH2H 2VXUL 1NCAH 5HYSG 4XXDB 3M1BA 3CPLA 1OSPL 4XP4H 3I02A 3MOBL 1HHJB 2VDRL 1KG0B 5T5FH 2YD4A 1YQ2A 2ICES 2OZ4A 2HAZA 5E8DL 5KW9L 2YEZA 1QRNA 1AXTH 2UYLA 1QSVA 1HHGA 1MFBH 3LKPA 4X6FB 4CVXB 1HSBA 4FQIH 4NQCE 4PV9B 3X17A 3BP6A 1FL5B 1RZKL 2UVFA 3HS0B 3JUZA 3EOAA 1EZVX 4YBQD 3L7EB 4HXBL 1IT9L 2YZ1A 4DEPB 1WBYA 1CXFA 3TV3L 1K4CA 8CGTA 2AI0L 4L8DB 4ORZC 4KJQC 1S7RB 4YWGL 1U6AH 1DR9A 4G80A 3PWJB 2XG5A 2JLLA 5D71L 1KENL 3KYKH 5D9SB 1B4JH 1NGXA 2X10A 3LV3B 4JGMA 4QXUL 1OPGH 4FQCH 4KWUA 2PXYA 1LE5B 2EIZA 5I30L 4U1IA 1CLYH 5DD5H 5E00A 1FLRH 1DBKH 2X5PA 3B3IA 1GSMA 3FFDA 5JNYA 3MNWB 3S37X 4LL9A 4D9LL 4XBEL 2A9NH 4L4VE 4PJAB 4X6DA 1G7IA 1KIQA 3J8F7 3UBXA 5FM5M 2DB8A 2OLDA 3BEVB 1GIGH 3F7PC 2H8PA 3RWGB 4Q2ZA 3KS0J 2I27N 3WHXB 3JSSA 4HZLB 3VFRB 2Z93A 3MODH 4ODTH 1HIMH 3UTSD 2EEAA 4BFIB 1K2DB 5HXMA 2BFVL 3HUJE 3NPSB 4FNLH 2ILLA 5D9SA 3L6FB 3MV7D 4YE4L 5GZNC 1MREH 3U4AA 4X9HA 1D3CA 1F4XL 3VRLE 1RZJC 4MAYB 1H8NA 4HKXA 1A14L 1CDGA 3TWCL 3UROR 1K4CB 3BH8A 1IAOA 1NGWB 3BPCB 4U1MB 2AJSL 3DRTB 4U1JB 2EEBA 1NMAL 3VFNB 5D7KD 3BZDA 1MCSA 2KH2B 3WFDH 3V4VH 4TRPL 4AMKH 3QI9C 1ZHLA 5INDA 2MCPL 4MLIA 3DX6A 4ODSL 4CW1A 2CKBB 3BKMH 5EIVA 3G5VB 1QSEE 4W6XB 3HZKA 3QXWA 4L3EE 5DFTA 4M6OH 4G6AD 1IAMA 2CLRB 1EAJA 1DUYB 1MWAA 3WFEH 3NCFB 4LSSL 5HPOA 3C5SB 4ZS7H 4M7JH 2P48B 3MO1A 4NUJA 2P45B 5FUCC 5KOVC 4X4XA 1S7TB 3VXME 3MUY1 2PXYD 2WSKA 1BECA 4A6YA 2AGJH 2X2YA 1HQ4A 4U1GC 4QHKJ 3RX7A 5SV4A 4PJ7F 1NBVL 1JIBA 2ZPKH 4FP8H 5CJXC 3V6OE 2E7LC 4JN1L 4OGAC 4FQXD 1VEMA 1ULVA 5DHXB 5IB3B 3KPSD 3SDAC 5CKAA 2OK0L 5I17A 1YEFH 4M6MH 5GS2D 5DJXA 1YEDB 5HDOA 2NTFB 1HNGA 2LV4A 4HJJH 1A6PA 4Y19A 5DK3A 4A2MA 2ICWI 4O58L 5K9QG 5I1LB 3PQYB 3DI3B 4CMMB 4UTAL 3IKKA 1G6RH 2DJ4A 3L3JB 1J0YA 4LNVA 2AJYH 2COQA 5I1JL 1KXTB 4HHAB 5C0JB 1PBYA 4OIIH 3E8UH 3VI4F 3ZDXE 3BUTA 2BNRE 4KY1H 4PRIA 1JWSA 4XAWL 4XCEA 5DMKB 3VE0A 4OZIB 2CUHA 5C2UB 3LQZA 1KTLB 1ADQH 4N1CA 1BP3B 4K3HA 3DYMA 3CX2A 3ILPB 3P0YH 1AGFB 3TJHC 1XCTB 1A02N 1VHPA 1BEYL 4G9DB 5ITBL 5GS1A 1NFKA 3TN0B 1A7RH 4I8DA 2FEDD 2NTFA 4JKKA 1O0VA 2Z31D 4HAFA 4JQVA 4X6DE 1KB9K 4JFED 4R4ND 1UWEH 1UH3A 3V5HB 3O6LH 5J89A 3ZE1E 1P9MC 4YHYC 4EUPA 1CD9B 4M5ZH 1K8DA 1MHEB 3IDGB 4Z77B 3B5TA 4MQ7A 4GQ9L 1Z9MA 1OT2A 4LQFH 3VXSB 1R0AL 3C8KA 1QP1A 1MF2L 2GTZA 2NZ9C 3G6JF 1ZA6A 3HPLA 1RK1B 1VGKB 2HTKD 5CMAB 4LVHB 2YC1A 4HGMA 1KJVB 3H8NA 4WNQB 3MA9L 1Q9WB 2NY2D 1KUMA 1L6ZA 5KJRH 5EOCH 3JUYA 2QJDA 3NZHH 2R2BB 2DQTH 4G9FE 4PJGA 4X6DF 2WAHA 4J6RL 2G5RA 4E5XA 5CWSA 3CCHA 3QAZC 4HS3A 3M17A 4OCYL 4ODXB 1I1FB 4H26A 1X6NA 3S4SA 3K80A 2FECL 4YHOL 2OSLA 3UO1L 1LEKB 3MLRH 1AFVH 3MRFB 4WEMB 2Y1VA 1BVLB 5J9PB 3GK8L 1RZ8B 4JFEA 4OIBA 4WWKB 1TJHL 1WZ1L 2VLRD 1FZJB 4KHTH 5DD1L 5FGBC 3O81A 2EKSB 1ZGLA 4R2GC 1QKZL 2CPCA 5FDWB 3O6KL 3SGEH 4JQIH 3SDYL 1UENA 4PY8J 1NCBL 3VFVB 4LHJB 4ZUSB 3HFML 3STLB 4PJ9A 3OXSA 2V5TA 2APFA 3EIFA 3TLRA 4K9EL 1INEH 5EO9A 2C4XA 1PFCA 4L1HA 5A40E 3FT4B 1VADA 1ZT1B 4P46C 3D0VB 4E42A 5JR1H 4D0BA 2Q3AA 5DQDH 1LHZA 4XMLL 3SGKC 4FG6D 2IAMC 5DD3L 2ZUXA 3QIUC 4XBGA 2FGZA 4Y4FB 3Q5YA 1E28B 4ZDHB 3WFHA 3GSWA 3MRPB 3ZDYE 1CFBA 4LARL 1Q9KA 3RVWC 5JIIA 3LAFA 1YN6B 2DTMH 1R3LA 4C4KT 1NJ9B 1T22B 3TP4A 2Q8BL 2D7OA 2R1WB 5CINL 4ONFH 4J2XA 5C0CE 4ZD3L 5CD3A 3GRWH 5DRWB 3WO4C 3KPRD 4GW4A 4ZQKA 4KDTC 4ZYKB 3UXFA 2NW2B 5T1DL 1AGDA 3U4EA 8FABA 3L7FA 3PHOA 5SWQB 4H8WH 1WCBA 1JZ6A 4TSBL 2SEBA 2BHZA 3RY5A 5H8DA 3V4UH 2IPTH 2JIXB 2R2EB 1I7RB 2EDRA 4JFPB 5T3ZL 5GS3A 1JUFA 1NUNB 1XF5A 1YEJH 4HULB 4R7DB 2GCYA 3Q6GH 5B4MD 4LSSH 1WLHA 3KNBB 2JB6A 2QSCH 1XEDA 4O4YH 5CGYC 2R69L 5L0QB 3JZ7A 1CE6B 4P5KA 2FR4B 4TSAL 4JFEB 1Q38A 5IW3A 5FHAL 4R6UA 2E3VA 2XWTA 3ARUA 3O2DL 4R7NB 3ZYJA 5I19L 2B4CH 4OAWA 4NQXB 3B9AA 2AXGB 1FVEB 5JTWA 3IS0X 4Q9QL 1NGPH 3LHPL 4P5TA 3NN8A 4KMQA 1PKQB 4PS4L 5A43C 2X4UB 4RMTA 3TEUA 3PP3K 2YWYA 5DJ6A 5DK2B 5JQHC 3MRMB 4MA1C 2GK0B 4MD5A 3TWCH 3S37H 3Q48A 4C58B 1CU4H 4GRWB 3I6KA 1ZHKA 5KS9E 1MREL 3PV6A 1FFPA 1U92B 1PDKA 4X99A 1ZK9A 5CJXA 1T7ZA 4WO4D 3KVQA 4ONHB 1QG3A 4CADA 3QCUL 5EU7E 4C56D 4LSUL 5J11B 5D7LE 4Q9QH 3QRGL 1AGEB 5FB8B 5GGTL 4NKOB 2IANE 3KDMA 4QXGH 1MRFH 3GSXA 4QCIB 1NAML 4KK6C 1D6EB 3RL1B 5AG9A 5KSAA 5EZIH 3IXAA 1GIGL 4JANB 4LMQI 1JPFA 3GB7A 5J1AA 5AD0A 1SVZA 4FQHB 3WCYA 1LK3L 2FZ3A 4HIIA 5IB2B 4AJ0A 5HGDA 2IG2H 5HGGS 2QHRL 2A9NL 3FN9A 3SDXA 1RZ8A 2DI8A 1LO0L 5CJ8A 3JVGA 3DX7A 2X1WL 3OKYA 1AD9B 5EZJA 3UPRB 4WWKC 4WHYH 2ITDA 5LCVH 2DI9A 5A2FA 4HWBH 5JW5B 5GIRB 5FF6A 5J6GB 1LO5A 4UQ2B 4GAJL 1I1FA 4LLDA 4ZSOE 4OFYA 3VXRE 2XT1B 3U36A 4D94A 5D2LF 1KELL 2FX9L 6CGTA 4I2XE 3ULUF 4RAHA 4JM4H 1NAKH 1EHXA 2JJWA 3SKNA 4DZ8B 3MRGA 1JZ5A 4NKOA 1BOGB 3CDGA 4Y16B 1OGAD 3RWIB 4X9BA 1MHPL 1U3HD 4MD4A 2J4WH 3HPLB 2J7LA 3QIBC 2DTML 1FPTL 1ORSB 2APVA 3AS1A 5BQ7B 1MUJA 1DLFH 3NFPA 5C0AE 5JPMB 5DDHB 2W07A 2KQNA 3GSOB 1ORQA 4K3DL 4PD4J 5HYQA 3OHXA 1A7QL 2FLRT 3OMZA 1OGTA 4G3YL 5J13C 5DK2A 1LMKA 3MYJA 3LKSA 3WIFB 2J8UA 5GPRA 1J1XH 2N4IA 3H7BB 3EYFB 3ULSA 4TUJB 4MA3B 2O61B 1E6JL 1NSNH 3O8XA 2HTLD 1QLFB 5JW5A 2Z9TA 1AQKL 5F8RC 4OFIA 1YEGL 3ILPA 2V7NA 3R4DA 4P49A 4X83A 3HFMH 4NNXA 4RIRB 1AD9A 3MBEC 5DGRA 4BKLB 1Z9LA 1EDQA 4WEBH 4YNYB 5HGAB 2VTFA 5EZIL 3GEWB 5JA8B 1T5WA 1EK3A 4HX1B 5D93B 1QZ1A 4CVZB 1F3DJ 4L8SA 3QO0B 4QXGL 1KLGB 1NFDF 2ZSVA 3IU3A 4JANA 4I0PD 4LEXH 3QDJD 1CTNA 1CDCA 1A22B 4LDLB 3GI9H 4KUZL 4PLKD 5GGRB 3R0NA 3WS3A 1BPVA 3GNML 3O3UN 1T1YB 3CSYB 1JCKA 1G1CA 2YBRB 4S0TD 4ZUWB 2AV1A 3RGVB 4R97B 1OVZA 2P24A 3JWOL 2NXYB 2CXGA 3FO0L 5HI5C 3HNSL 4JREB 4PRHA 4MJ6A 1JHLH 1DQLH 3SCMC 3SGDH 2ZUWA 1UCBH 4PJIB 2BOCB 1GGCL 4OZ4B 4LPVA 3VW3H 4QHNA 5IW6A 4XP9H 3WL9B 5E8NA 4PS4H 4LASH 2XKSA 2C1OA 1S9YA 2FH8A 2LVEA 2IAMA 1NBYB 3QIUA 4MNQA 3O6LL 4O5LH 1GGUA 1BBJB 4LQ1A 3BSZL 5KG9A 4OGAD 5ADPL 4NO3A 3FQTA 3OWEA 1CVSC 1FL6B 1AJ7L 1NL0L 4XHQA 2YPKB 4X7TB 2WBJA 2EE3A 5ISZA 3RNKA 4OZFB 4X7CC 2GK2A 5EO0B 1J1OH 4RAUA 4OQTH 1Q9LA 2IANB 4L8BA 3OGOE 3SDXF 2ZUVA 1JF1A 1SVCP 3QFDA 5F9DC 3VXOA 1BFTA 3F7YA 2FNBA 4RAVA 3EJYC 3L3OA 4ORGA 1RJZA 1IAOB 1NGWA 2RCSL 4MB4A 4NQDA 1J1PL 1MIMH 2YPVL 1BVLA 4POZC 1OGAE 3X13A 2AJYL 2X4QA 1YEHH 1PZ5B 1N4XL 4P3CH 1KCUL 2HWZL 3S4SG 2J88L 2OSLB 4M3KB 4CN6A 4XMKL 3RNQB 5F8QC 3I75A 2QKIB 1G6RL 3BP6B 5CD3B 1D5IL 3CCHB 4LARH 2H3NB 4RAUB 4XPAL 1J1PH 1MIML 4Z9KB 4JFXB 1IC7L 3IS1X 3SDXE 5T3XE 3U9UB 3NACH 4F2MA 5EA0L 4E41E 5BW7C 1I3VA 5ECJE 2YC1B 1NEUA 2B1AH 2OXHA 3M1BB 1TPXB 5F1IB 1EEZA 5FEBA 1ZA6B 5E8OA 4XWGH 2IMMA 3MROB 1BIIB 5EC2B 3TYFA 5HJ3A 4WW2C 1UB5B 3PNWA 1FV1A 5IEKA 1UWGH 1KGCE 2KQMA 2VLKD 1NCCH 2APXA 4FXKB 3V5HA 3O41A 2WM0A 4L4VD 1QSZA 3WFEL 3EO0A 1U8HA 2YKLL 5HHPA 1QR1A 2EDXA 1UXSA 1AR2A 1ED3A 1N6UA 2OTUA 2NY5C 4GLRH 1IGCL 5J1TC 1D9KD 4RDQF 2FH6A 1QFOA 3STBA 1BX2A 1DEDA 2PUQT 4XCNA 4JJ5A 1KJ2L 5E8EA 3P0VL 2ICWA 2CKBH 4K8RD 4M03A 3O4LE 4JRYA 3P2TA 2DQTL 4UAOC 3HTLX 1I3UA 4RMVA 5DEFA 5E99L 1DQLL 1IQWL 5KVEH 2YD8A 4HIXH 4PJCB 1NUGA 2ZCLL 5I1DA 1DQJB 1CCZA 1AR1D 2XFXA 1HHIB 1MCLA 1SJVA 3T2OA 4K3JH 1LNUA 4P5MB 4IEFB 3OXRB 4QRQB 5DMYA 4KKLC 1BJ1J 3WBDA 4X5WA 4QOKA 4XPGH 4XH2A 2KKQA 3PE9A 1BJ1H 3QUKA 1QEWB 2B0SH 3MLWH 3AREA 3TZVC 3C8KB 1CXEA 1HH6B 2XACC 3L3DA 2LU7A 5E2TH 1DL7L 2BNQD 1K8DB 1MHEA 2B2XL 2DLFL 4GUPA 1BVKB 2EIBA 3D3VA 5FYJE 2P8LA 1MCFA 1F8TL 4LKXB 4WI5A 4MX7A 4D3CL 4PP1C 3KYAA 1A1OB 1LD9B 4OM1H 4PR5A 4PJFF 1K5NA 5GJSH 4ZXBC 1ES0B 3VJ6A 3WFCH 2NY5L 1IC4H 5GRXG 3BISA 4J4PD 3LDBB 5DURB 4N8CH 4DVRH 35C8H 2RHEA 4FQLL 1Y18A 5E2WL 3SDAB 4H5SA 1QEWA 4DTGH 4L8CB 4J3WA 4WY7H 1FIEA 2C3VB 3GGWA 1QFWM 4M9PA 1SHMA 1P2CA 3RTQD 4XVJH 4XVSH 1GC1C 1YEEL 3T04D 3DMMB 4X4ZA 4JZJB 1E4XH 3FO2B 5L8LB 3VE0B 1T03L 2ICEA 5KS9B 1PEZA 5B39A 4OCSH 1ZVHA 1KYOJ 1KPRB 1GZPA 1MFEL 2VL4A 3T3PE 2UZXB 4YH6A 5IWLA 1HEZB 1INDH 2GJZA 2LFGA 2X7LA 4NN5B 4DKAA 2HVKA 2XN9B 4JFFB 3H9SE 1YUHB 4FQIL 1OTSC 4X5XB 5J3HD 5IM7A 1IAIM 1KC5H 2PTUA 3QWOA 3LQAH 2FZ3B 5FGCB 1NGQL 5EFIB 1OTTC 2VITA 4NGHH 4NJAL 1T80A 1V3MA 1AO7A 4LLUB 3OAZK 3Q6FA 5LCVL 3C60B 4PGBA 1NGYB 4U1NA 3RTQC 3C2AL 1IJ9A 3KPOB 1G7MB 1HOCB 2V9QA 4M9OA 4LBEA 3EZJB 5L9DL 2RJMA 2W1NA 4HH9B 4JRXB 4I3GA 3VXRD 3CFEB 2EDLA 4XVSL 3PWLA 3T8XB 2IPKA 2BSED 1L7TH 4E41B 1GGIL 4X99B 2BNQA 1HH6A 4OLXH 3BN3B 3MROA 5EC2A 3B9KC 1AY1L 1Q1JH 3UBXB 2DF3A 3W11D 5IHZB 4Z7QE 1MWAH 5HHMD 4ODSH 4MHHG 5TQ2L 3RPIA 5TDNB 3MOAL 4HT1L 2XFXB 4ZPTA 3TC9A 3BN9C 1L6XA 5FO9A 1CN4A 1I8KB 1UM5H 4YHZL 3VFMB 5ID0A 4RA3A 4D3CH 1X5JA 3EOTH 4WW1B 3RNQA 3NA9H 3GO1H 1UEMA 3ELAT 2VLME 1MCEA 5DI8A 1YPZF 3HZMB 3DMMC 4XC1L 2IBBA 1RJZB 2DKMA 4BSWB 2B0SL 3WLWC 1GJIA 2YD1A 5DRXB 4PJXE 2NQCA 3UJJL 3V0WL 1CGWA 3CDYA 1HQRB 2VDQH 5F6IB 1CGTA 1X44A 1A1NB 1WEJL 4XRCA 2FJGA 3SJVD 1U8IB 3ULVE 4L8BB 3LKPB 3SGKA 1U8HB 3T0XA 3HNTL 2YPLE 4MJ5B 1S9VA 3SCMA 4QRRD 3WNLA 3K8KA 25C8H 3IJYA 2MWCA 2NY1D 4P2QB 1WCBB 4N0UA 3MRLA 4GRWE 1PZUB 4CNIB 1S78D 4MMXC 4W4NA 5T3XL 2HMID 3WSQH 5KAQF 1R5WA 5E8OB 1MI5D 3ALWA 4WI7A 3SOBL 1PG7L 2GFBB 1KJ2B 3HCVA 4NPYB 1EHAA 1W2KT 3RPKA 3QUZC 3ALPA 4YGAB 5A2IH 3GSRB 1HWGB 2RR3A 2X4PA 5C08D 3ULVF 4W70A 2BP3A 3QR2A 2AXJA 4U1IB 1PLGL 4WFFE 5GRUH 3X14A 2XA8H 1KB5H 3C6LC 5EG6C 1QRNE 4DWHA 2FJGB 3QUYD 1CD1B 2DKUA 3TA3B 1P53A 4ZD3H 5JOFB 1WC7A 3MLTB 3CU7A 1SMAA 1FYTD 2WWMC 4AYFA 5D5ME 2Q87A 3CVIH 2DM4A 1GYAA 3MSPA 5F9WC 4LSQH 3MLPA 4LDEB 3CMOL 2A38A 2X4NB 1BFVL 1DZBA 4JFZH 5I8OH 1SM3H 1G6VK 3NACL 2Q86B 1CDUA 1FFNB 5IQ9A 2HFFB 5JDJA 3VI3F 1KIRB 2H1PL 4TN9A 3D9AH 5HHNB 4NCDA 3WNMA 2YUZA 1FZJA 2P46B 5EO0A 2CJUL 5DJZB 1D5IH 4DW2L 4UT9L 1FVDB 2GJ6B 5H37H 5BVJB 4N5ED 5KS9F 5BV7C 2K3TA 5J3HC 1RI8A 1T83C 3VRLF 4BZYA 4JEGB 1II4E 1BREA 1U8NA 1HDMB 3DRQB 4KKAC 3IFNL 5L2JA 4H1LH 5CIPB 4MHHI 2X70B 2P5EE 4OLZH 5EU7C 3I6GA 1F6AB 5CJQH 3H7BA 3BGFC 5AZEH 1N6VA 3QUML 4KI5C 4OZIF 1HOCA 4XNQB 2NY2C 4M02A 3I6LD 4NSKB 3QULB 3AY4C 3VWJA 3B43A 5IK3A 1TCMA 43CAB 3C60A 1U58B 3CFIC 4PY8I 4ZUTB 2BOCA 1YMMA 5C6PB 4V1DB 4QHMB 1JVKA 3P4OA 5C7XL 1AJ7H 1NQBA 5JOEA 5I1KH 5KJRL 5HHOD 4UQ3B 2VLRB 1MFAL 4MJ4A 3DUSB 5GSRB 1N64H 2X40A 5F21B 5CJ5A 3ARBB 5CSZA 2V6HA 5C0ND 3KJ6L 2ARJQ 3FOMA 1MF2H 1FZMB 2DQHH 2IH1B 5KS9A 3IDJA 2NY0B 4NNYB 3I3EA 5EU6B 4KKAD 4YPGA 3VG9B 3ARGA 4QNPF 3PIQA 4TUOB 4LCYB 1CYGA 5K59E 2Y06L 4BKLA 3L3IA 4B7IA 1G0YR 3DVGA 3O2VH 5C0IB 4BFEA 1OAUL 2X4TB 4MQXD 3LEVL 2FYYB 1K3ZA 2FRGP 4WTZA 5CHNA 4IOIB 4DAGL 4XZUB 1CFSB 5EU6A 1EXUA 3O9WC 5CEYB 1K3IA 2P43B 4ZOCA 4XP6H 3VGFA 2VLJE 2N7BA 1RUAH 1XGYL 4FQPA 4LHUA 1MCWW 1MH5B 4OCMC 3U79A 3FOMB 2Y5TB 1KOAA 4TSCH 3ZKQD 4G6MH 4OZGE 5IMOA 1TTUA 3GI9L 4KUZH 1MQKL 3MRJB 3VXRB 3MLUL 4OCXH 1Z0MA 3ARBA 3VI4E 2BRRH 4NYLA 4EXKA 4YXHH 2R1YB 1ADQL 4K9EC 5DR5L 1KXVC 3HE7B 4JR9L 1AC6A 2EYTB 3S88L 2CK2A 3MRRA 4WEBL 3GIVB 2BSRA 3KS0H 5DRNB 1ZVSB 3W2DL 4MD4B 1K4DA 4RFOH 2GK0A 4MD5B 4F37K 1NAMA 4JREC 4DZBA 1BOGA 3CDGB 4Y16A 3AFLA 3AROA 1FNAA 2OJEA 2BNUB 3S36H 4MAYD 5ALBH 5BXFB 3SKNB 3RGVC 4OSUL 4HFWB 3K7UA 2DLIA 5C0GB 3KXFB 4G3YH 3AB0C 4P9HH 4JHBA 4XZUA 2OK0H 1P7QB 3WKNA 1A1MB 3VGEA 2AAVA 3V7AG 3S3JA 3MXWH 5I76A 4N90E 1AGCA 3SE4C 3IRZA 1PEWA 1ZHBA 2VISB 4HC1H 2NY6B 2Y07H 2F58H 5F6IC 1G7PA 4MAYC 2IH1A 1BM3L 4ZS7L 3KPPA 1INQA 2VDKL 4BFGA 5GRUL 2HFTA 4R96B 2AW2A 4CN1A 1FH5H 4I2XB 2CRZA 4WO4C 4GG8B 5SWSE 3U4EB 8FABB 3PDOB 4BH7B 2O26U 4MAYA 3BKML 5D7IE 1IAKA 3QG7L 2NW3A 3ZKXB 1L4IA 3AM8A 3WSQL 1W0WB 2IG2L 1ZV5A 2XXMB 1U8JB 3OGCA 1DVFA 3MV11 1S3KL 1RV6X 2BERA 3HI1A 3VFWA 4BFIA 2R1XB 1QUNA 4GO6B 4LSRH 4RMQA 3LSOB 3FCTA 1NAMH 4UDUA 4Z95H 5DJCA 2MMXA 4LMQE 5TH2A 4OGYH 4NQTA 1G1YA 5SX4I 3QCTH 1Q94A 4V2BA 5KSVB 1BMGA 5TPWH 4X6CE 1U8NB 1X6LA 2BSSB 2X4QB 4M1DH 3FB7B 5JNYB 2D4DA 5DC0A 4YDKH 4FFZL 5E00B 2HH0H 4D0DB 2F53D 1SEQL 1S9VB 4DGYH 1ZLVH 1JGEA 3HNVL 4DKFL 5HYJA 1CK0L 2Q86A 3LN4A 2CMRH 2EDBA 3V79C 1LP9E 3C5JA 3UBXG 1Y6KR 3BKYH 1X4YA 3UTQA 2PTTB 5BS0D 1MWAL 5JHLL 3PWUA 6FABL 5IMMA 1AGDB 3FN0L 4PRIE 1FFRA 3QPQD 1HZHH 3P4MA 4LCIL 2WMPA 2X1XR 3LY6A 1KN2H 4JY4B 2FCBA 4HUXA 5IFAL 4UT7L 1Z9OA 2QSCL 5ID0B 4P3DA 3MGOB 2J1KA 4TUKH 3MV8D 2DBLL 4QRTB 3LSOA 3DIFA 5F7LB 1SQ2N 1IT9H 2CO7B 1KG0A 1L0XA 1FJ1B 2RAMA 4QHNB 1S7UB 1E4KA 2DWDB 3S8WA 1JE6A 4HBQA 1JL8A 3AMKA 2C7UB 4M00A 5E5RB 1R5VA 4MQ7B 4U49A 2F53B 3F8UB 3B6SB 3GMRB 3LQAL 4NZTL 3V6OC 5GISH 4BH7A 4U6XB 4RISH 2DQIH 3DX8A 1XZ0A 3F62A 3VXMD 4B53A 4XWOD 4L4TB 2IPUK 4GAFB 2ZG3A 1VESA 2XOTA 4CGTA 2GSIB 5CLTA 1H8OA 4BK5A 4BUHA 3KPPB 3TZVB 4YXLL 5IKCB 3VFOB 3QI9A 4XCFH 1H0DA 3Q5TA 1UEYA 3IDMB 1UG9A 3TZVD 4F8TA 4Z8FH 4OD1L 3W5NA 2Z31A 4LLMA 2PO6C 4KRMB 3C08H 4FQQB 4K3GA 3IFPB 4DTGL 5B3JF 3F12B 5GS0H 5CP3H 5E2WH 4OFPA 1J9CT 1C5BH 2X9XA 1QLFA 1MCWM 2A6DA 3BDYH 4I3RL 1FL3B 4N8CL 4DVRL 2IADA 2XXCB 3HG1D 2I07A 4OLVL 1OOAA 3FQNB 4F7MB 3MBEB 1KIPA 3NBNA 4E0RA 2A0LC 2DWEA 4N0YL 1QKZH 3U30C 3LZFL 1YC7A 1KNOB 5CJOL 3AY4A 3DVNB 1F4WH 3W9DB 3HC0B 3C60C 1CBVH 3MLWL 5CP7B 4G42B 4PRPB 2IJ0C 4IIQA 3SKJH 3VXSD 3WO3B 4P48A 3T0EA 5A1AA 3SDDD 3RBSA 2V5YA 2Q8AH 3UYOD 1ES0A 3VJ6B 1EFXD 1A6WL 3LKOB 4F57H 5ADOH 4JFHD 4NYLB 1M1SA 3LIZL 4K3JL 3GI8L 3RDTB 5H2BA 3MJ7B 2W0LA 3Q3GA 4X80L 3MLSH 3P9LB 1EX0A 4PGBB 1IC5L 5EOCL 5IGXH 2A74B 4NN5C 3V52L 4P57B 1DQDH 1IQWH 2MQ3A 5KVEL 2H2SC 2DJSA 5CEYA 1T7XA 5D1XA 3S5LB 3VXUA 1R5IA 3RHWK 2R4SH 2X09A 3NIGE 5MEOA 4WGWB 2EZ0C 3QWRD 3WDJA 5IWLC 1I7UB 1MAJA 3GMLA 5J6HB 2NLJB 4X5XA 4GQ9H 2P1YA 2FEEI 2X89D 2BHUA 5CEZH 4NKMA 2FJFA 1H9VA 1LNUB 4P5MA 1X5KA 1T1ZA 4GMTL 4HJ0D 5DEGA 3HE6A 2VABB 3V7AE 2B1HL 1B9ZA 4Q58C 3LEXB 5FKPA 4CW1B 4BYHA 1P84K 1IGTA 2EE6A 2AJZB 3QDAA 5E5MA 2B20A 4MA7H 5F7EL 4U6HA 3W39A 4ZFGH 4YGVB 1TZIA 3T77B 3FO2A 1U3HB 3A6OA 5CSZB 3P9MB 4JE4B 1KPVB 1E4JA 1HI6A 1SMOA 3WXWH 3FRUA 4FFYH 4PTUB 3MMEB 1F4YH 4S1QL 7FABL 1SYVA 3A6CL 4OF0A 4LVHC 1RULL 2V2XA 2OTUB 1ND0A 4OLYL 4Z7QF 4LHUG 2I25N 3HPJB 3MQIA 1LO4L 3O11B 3DNKA 3WFBL 2ZSWA 4RRPG 1IE5A 4Y2OA 5FGCE 1K5NB 1PGRB 2H32H 3QULA 5C3LD 3QG6A 5CP3A 4X6EA 1A6AB 3OAYK 5IVXF 4JDZB 4LEOB 3C9NB 1I3RA 4OIIL 4YHYB 4FQ2H 2X89A 1H15A 1NC2D 1XGRA 1R3JB 2IQAA 4WFGD 4YFLI 4Z7VF 4YO0A 2G5BA 1UB5A 1FG2B 1V7ML 4GAYB 4IM8A 1DLHB 2YMXH 1YPZE 1DFBH 1TQBB 1KCSL 5EDXA 2BVEA 5F1IA 4LRNH 3EYQC 5I1EL 2NNAB 5SX5K 2I9LA 3TPUB 1F00I 1AKJD 3QFJB 5KOMC 5ETUB 4HJJL 5C07A 2JB6B 2E9JA 2R0ZH 4LPUA 3ARZA 1YEFL 4M6ML 4ELKA 5FAAA 3PV7A 1FDLL 4P9ML 2HFFA 3C6SB 5IVXE 3B4NA 4EBQH 1Z3GH 4ENED 5IV2B 1XGUA 2P8PB 4G80B 3DGCR 2SEBB 3OZ9H 1A4KA 3BT2H 3OJ2C 5ACZA 1NLDL 1U93B 5AAMA 3PHOB 3QIWA 3JV6A 1NL0H 4QYOA 1LQSR 3IGAA 1HYSD 5DHVA 1E6OH 1HWHB 3VFPB 1XF4B 3LN9A 3K4ZA 3MCKA 4WW2B 3MRDA 3RY6A 4U0RB 3BPLC 5GRVK 4L5FL 2XV6B 4ZFZA 1WSST 1BQUA 4U7MA 4N90D 4G6KH 2OL3L 2VLMD 3HC4H 4PJAF 4EDWL 2ZNWA 4ZS6D 2ZUUA 5H35B 3CFDA 1QBMH 3EOYG 5F9AC 5I0ZA 4LASL 4OZFA 3HZYA 1BFOA 1OLZA 2Y4SA 3MUJA 1GGYA 4NRYA 3PNWB 5F71A 3EFFA 3T4YA 1GGCH 4HWEH 2BSSA 3EYOA 4F3FA 1P7KA 4XXDA 1BIIA 3GKWL 2IAND 4NQCA 4IRSC 5AUMA 3MRHA 1HH9B 3O6FD 1JI1A 1EGJH 5D2NE 1NBYA 3HNSH 4HMEA 5E2JA 3DARA 5K9JL 4NRYB 4YEEA 5IJKA 1F4XH 2EYSB 1A3LL 4L3CA 4P2QA 3D25B 4JDZA 4LEOA 1NBZB 4MDJA 4DCQA 4JFXA 2D7TL 1P1ZB 3LVEA 1DN2A 3LMJH 3LPWA 1XGTA 4UTBH 2E8YA 4P46B 1RJCA 4NQSA 3VRJA 2NW3B 1XF4A 4XBPB 4OFYD 3SKOA 3KPLA 2J8UE 2ENYA 4QY8B 4J3VA 3K74B 1FN4B 3FRUB 4NP4L 4ZFOL 2QQNL 5D2LA 4U05A 5C0EB 1BD2A 3MV8B 4PRAA 1QRND 1OGAA 3MRFA 4DFHA 2L7JA 4ZUWA 4HJGB 1Z6JT 1U3HA 1B3JA 3BZ4A 3F5WA 3TH3T 4X6CB 4X6FA 3HR5A 3IU3B 1J1XL 4W81A 5F1OB 3VXPA 1MQ8A 3I3BA 1OPGL 4FQCL 1G9ML 1F4WL 1ROWA 3QBTB 2PXYC 5LJYH 3IU4H 4OI8A 5D71H 2NX5A 4K3DH 4O9HH 1U6AL 1VGKA 3FQTB 1A6VL 5I75C 4JHAL 5ESQB 3NTCL 2A1WL 1I1AD 1L0YA 1XMWA 2WIIA 2DQCL 2YWZA 3GJFH 3BKCL 1B0RA 4K23H 1U8LB 5L2KA 4I3RH 3OB8A 1XGRB 3QEQD 2NZIA 3VDBA 5DT1H 4JO4H 2FX7L 3DSFL 1AGBB 2ZCKH 2Q76A 1UJTA 2EXYC 1PX4A 2JCCF 5DDHA 4LVNC 5E8DH 4XCFL 5C1MB 2PYED 5CP7A 4Q9RL 5DUBA 1RK0A 2WBWB 1D6VH 2FECI 5F7HA 3HC0A 4UT6H 2DQDL 2W9DH 4QF1A 5EOTA 5KSBF 4RWYH 1KNOA 4ZMAT 4GW1B 1MVUA 2EIDA 4AIZA 2VWEC 5KTEL 3H6JA 2OR8A 4I13B 5LWYH 1TZIB 1KN4H 2VWEE 5EZOL 4O02H 3FB5A 4X6BB 4LOUC 4JM2F 4NZTH 4GJTB 4OV5A 1TMCB 1KLGA 1RZ7H 3GIZH 4UQ2A 4DGVH 2VABA 4NQED 4EI5D 3BPNC 3QZWA 4PY7A 3ZE2F 2FYYA 1J11A 5GGTH 2F5AL 2K9UA 3F12A 2EECA 4HSQA 5JO5B 4PRNA 2BVPB 3N50A 3ARGB 5KSBE 5F7DA 3S97C 4HUMB 3RWEB 3HHRB 3ZTNL 1CU4L 4HGKC 4LP4A 5LGHL 5E2VH 4U7SA 1YC8A 3D3VD 5C0CA 1OP3H 3FFCE 1RFDL 2EYRB 1MCBA 1OTTD 1F58L 4OZGB 3VDAA 4PJ7A 1RJLB 3ZE2E 2LTQB 1TCRB 1N6QL 3MC0A 4ODHL 5FCSH 3HMXL 3PV6B 3MR9B 1J0HA 3H3PH 1MWAB 2DL2A 1NKOA 3EYUH 5B38B 1GC1L 2XKNA 5DJ0B 3MBEA 3QEHB 3Q6GL 5C92A 2DTSA 3TFKC 4EDXA 1JPTH 1F6AA 1RHHB 1S9XB 3ARPA 4XPBL 5GGVH 4PRBA 1RHFA 1QBML 3WIIL 4G8EA 3S7GA 5AYUL 3O4OB 3C8HA 3PG2A 3ABZA 1G9EA 3EYQD 1QSED 4QRRE 1QFUH 3IFPA 2DD8L 3DURB 5D7IA 4G8GB 4Z95L 3QJHB 1G84A 4N5EC 5I71C 1JPSH 3O0RL 4JKMA 4NWTH 1FVDA 4G9FB 5IFJB 3IETA 4JLRB 5EBWA 4HG4K 5EZOH 2AERT 3T3MF 3BQUD 3QI9B 1JGVH 3RBGA 3VU2A 2V2TB 3KPMB 1PG7X 2UV3A 2EDFA 5D1QA 1MCDA 1FAIH 4N9GA 3CVHL 5DTFB 5F6HI 3VGAC 5BV7L 4FXKA 1JN6B 5FYKU 1RVFH 5E8PB 4AEEA 3RWFB 1GAFH 4LPYA 1M71A 4L4VA 4CVUA 1BOYA 1IZJA 2FX7H 3DSFH 4ZTOL 4ZFOB 4PRDB 4Q74A 2WLYA 2EDKA 2Y72A 5B38G 1PG7W 3VXQB 4BQ8A 4K23L 3RKPA 3T0WA 3OKNB 5J0BA 4OTXL 2WBJC 3MXWL 1DANT 1RZGB 1F11A 3S98A 5DVMA 1V8HA 1E28A 4LVEA 2CRYA 2V2WA 2H2PD 3D18B 3QPQC 3LD8B 1FRGL 5C0RH 3O6KH 3EJJX 4DOHB 3SPVB 4D0CA 2J6EL 1DQTA 5D7JA 3PWPB 1NCWL 4MS8C 3L5IA 4AL8H 3MRKB 2IBZY 2WLZA 1A3RH 4P5KB 5EO9B 1U9KA 5EOCJ 4Y4FD 5FUOL 3KG5A 1FFOA 2G75B 4S1QH 4AY0A 4AH2B 4GLRI 2NYYC 3PL6B 1CLCA 4N0FB 4ZPVB 1C16B 2QADB 1KXQE 4OCYH 4PV9A 1VFOA 5HI4D 3UTZA 5HYJB 4X7DC 4N0FA 3TT1L 5AG8A 4PBXA 4WIQA 2VISA 1IAII 1VEPA 4GT7A 1NMCC 5EO1A 3L9RB 5DR5H 4QXTA 3I2CL 3WHE0 4J4PC 4UTBL 2FSEA 3ZL4H 4NZDA 4WI3A 1DANU 4KI5F 2E9IA 2AK4B 3WD5L 2R0KL 5GRJH 4F7PA 1VFBA 2GI7A 3LOWA 4O51A 3QIUB 1MEXL 1MIEH 3D6GA 4ZUVA 1MI5A 4U1LB 5I1CH 1E4XI 3E3QC 3MXVL 4PJ5A 5B21A 5DJCB 4RFEB 3V6OA 5BXFA 1D5MA 1OAUH 1FNFA 4D9QD 4FTVD 2JKXA 3QQNA 4HWEL 2OCFD 1CG9A 4KV5F 4X5LA 4GBXA 2PYEB 1A6WH 5ADOL 2MKWA 3PL6D 3VXTA 2KPNA 4PGZA 2MHAB 5EBMA 4J3XA 2I9TA 2A6IA 1RJYB 3EZ8A 2BNQE 3NCJL 3OJMB 2P5WD 2MQ0A 4BZ2H 1MCQA 3WN5B 1I7TB 3IAGC 3BWAA 3N1MC 4UILH 5EC1B 3OX8A 3OKKB 2EH7H 2VC2L 4YFLF 5IB5A 1KIUA 5DF0A 4OGXL 1JNHB 3RKDD 3G5XA 1QFPA 3IETB 1JP5A 3MYZA 1R3IL 5ICXA 4XCCH 3T2QA 1LP9B 4U1KB 4ZUUA 3TNMB 4QRRB 5IESL 5DRZB 1TTFA 1UM6L 4TPRH 1U91A 3SJVB 4M4PA 2OBGA 2AJXH 3MRQA 4H26B 5CJQL 4Z7UF 4PRBB 1UZ8B 4F8QA 1VGEL 2O61A 3QPXL 3DV6B 5B39B 2DLGA 1JYVA 1CR9H 4ODBD 1ACYL 2F19L 3EGSA 3R06B 4ZS6C 1GAFL 1ZSDB 4YDVB 4Z76A 3TO4B 1I85C 3T0EC 2QV2A 3TO2A 1RMFH 3V6BR 1YMHA 1DFBL 2LE9A 4CKVX 3CVHH 5DZNA 3BYYA 4KPHH 2ZPKL 4FP8L 4DW2H 3HAEB 4M7ZC 5EU5B 4QNPE 1AI1L 4ETQB 2CIIA 4XVUD 2AS5M 1XT5A 1JK8B 5FYKL 1AP2B 4S1RH 3B8YA 3C09B 3AXLB 1DDHA 2OTWA 5FK9A 5E24E 1BFVH 3PDGA 2BC4B 5DJXB 1LDPH 5TDPA 4DUVA 1HHHA 2UWEF 5GZOD 4HEPG 2G2RB 3VWJB 5I16A 4JG1H 1YY9C 5IB3A 3EYSL 4M61A 1YEKH 3CVIL 1RZFH 2R56L 4OM0L 1FNLA 1CLZL 3QIBA 4ZO9A 2W0KA 4IDJL 3UEZA 3FO1B 4LLDB 4BQ9A 3CX5K 3V4VL 3WFDL 3PGCB 5GRVL 3ZTJG 5GRZA 2V5RA 1MRDL 2HVJB 3VH8B 5IFHL 3GSQA 1I8IB 4DOHE 3TNMA 2QQLL 3BGAA 5FYKD 2E9BA 3ARGC 4X7SL 2IGFL 4Z78B 2ATPB 5EN2A 1FNGB 1GOHA 2ZOLB 1CTOA 1NGZB 5LKNA 3ARXA 2VYRE 4YE4H 4PJCA 3DX6B 1PG7H 3BXNA 1N6QH 5ERWB 1F2QA 3FB5B 4WU7A 4UIKH 2NY4B 5IVZA 4L1DA 4RMSA 1CK0H 4JPKH 2CO6B 2YD7A 4GW1A 2ERJB 4JZNB 4U1MA 4U2ZA 1N26A 2NY1B 4IMLB 3T4AA 4A6YL 2MHAA 3VXNB 5MHSE 3QIBD 2HH0L 3MNZB 2YS4A 1UA6L 1X9QA 3V6ZB 4NKIL 3ARGD 2C3HA 2JCCB 5I17B 5B8CB 3EO0B 3WKML 2GW5A 4LFHG 5DD6A 4LVNB 2Q76B 2Z35A 4PRPE 3EYVA 1I9RL 3K1KC 2DQUL 3ZE0F 2XPGA 4ODWB 5I30H 4LU5H 5TE4L 4FQXB 1JHKH 4AM0A 3U7WH 4PLNC 3LZFH 1UZ6F 3GO1L 4JQXC 3NABL 1KENH 4NFDA 4O02L 4JM2C 5ITFA 5IQ7H 1UM5L 1VDGA 1DJSA 3F7QA 1DUYA 5DFVD 1P4IH 2DIJA 4HKJB 5BVJA 3EO1B 3QG7H 3MLXH 1Q0XL 4PJFA 4OLWL 5DJZA 2W9DL 2EXWC 2WUBH 3CFDB 2GY5A 1LO2H 1C5BL 4JN2A 4MJ5A 1Q1JL 5HI4C 4LIQE 3ZE0E 1LK2B 3C08L 5GGUB 2Z8VC 1PZ5A 4X98A 3NPSC 5ALCL 1EFQA 1LDSA 4G7YH 1NCNA 1U93A 3EFDH 5CKGA 4HC1L 4S11A 3VCLA 2VL5A 4CBPA 4F9PA 1TFHA 5GSVB 4S1DD 4LSVH 3QFDB 5EULV 1WC7B 2JK5B 1NDGA 2LABA 3SDAD 1WWBX 5FKAA 4GG6A 1BWWA 1EEYB 4HUVB 1GHFH 4C57C 2QQKH 4ZNEA 2DQIL 3X14B 4ENEC 2ITCA 5MEPB 1LEIB 3IU4L 4MAUH 3HE7D 1DBAH 2YK1L 3RAJH 2C1PB 5JDSA 3RNKB 4RQQB 1EMTL 2GQHA 3GZKA 1U8KA 3O9WD 2YA0A 3H2WA 1QYGH 2QEJA 2GHWB 1U2HA 4MSWA 3S36L 4KFZC 5EOQH 3SO3B 3BD4A 3BKJL 1SEBB 2ZCHL 4N0RA 4UB0L 2UUDH 1GVIA 2VAJA 2WUCL 4UUJB 3R8BB 1A9BA 4WI8A 2X4OB 1XF3A 4MXVE 4OLUL 5JXEC 3K1DA 1WZMA 4LCUB 4I3SH 5KVDH 1T0MB 2ID5A 2VXQL 2W0FB 4XNXL 2VR5A 4NQVB 2EEDA 1KCRH 4QLRA 3RTQB 4ZSOB 5IFAH 5DTFA 3N85L 2RBLA 4DEPC 2FHFA 4WY7L 3NMEA 4WUUA 4LAJH 3BZFA 3UTTA 5C8JB 3BD3A 3THMH 3QUYB 5I18L 3HAEH 4YUEL 1A4JB 3G6JA 2VITB 1OB1B 3H9ZA 4HIHA 1F3DH 4M5YL 1CFTA 3PWJA 5JQ6H 5D2NA 5L8KB 3MFFB 4MS8D 3IGAB 1IC4L 3NCCB 3WDHA 3ES6A 3MMEA 5GGQH 3U82B 1KBGL 3U2SB 1VSCA 4PJEE 4Z18A 3DXAA 2AV1B 3VFGH 5LQBH 5LXGH 1I9JL 1YYLH 4J4PA 1W72H 2H6PB 1T1YA 5E4IA 4U6YA 3LPGA 4I77L 1KPRA 3P11L 5CWSB 3BP5B 1A5FH 4XPFH 1QRNB 4LSPL 4CVZA 3GJFB 1OARL 2V17L 3FONA 4JZJA 5TDNA 5M7QA 4NO2B 1T1ZB 2PW1B 3GSNL 4F15C 3CZJA 4WNQA 3A6BL 4EI6B 2XZAH 4NC0B 3ISWA 4NNXB 4RIRA 2BVOB 3U0TB 5F88A 3GSVB 1CGSH 2GTZB 1ZHNA 1J05A 4PJCE 4XC3H 3UMTA 4HIXL 4LLVA 1Y6NR 1QOKA 1MFDL 3RWCA 1MJ7H 3OR6A 3BZEB 2A74A 3D2UB 5D6DA 1A9EA 2Q7YB 4DN3L 1UM4L 3Q2CA 4LBEB 5E2UL 3T2NH 4JKPL 3MJ7A 3Q3GB 3P0VH 2CDFB 4PP1D 3VXMA 2E7BA 2GSGB 3CUPA 1CE1L 1D9KB 1ORQB 1M05B 2BC4A 1IGCH 3UAJC 3O11A 4JRYD 3OR6B 2GT9A 3SE8L 1AQDA 3RWEA 1DDHB 1OAKH 3IVKB 4M7LL 1L7IL 4KHXH 1KEGH 1J05B 2LU3A 1XCTA 4WTWA 3QEQE 3WUWB 4FOMA 1OCWH 5C09E 3LN5B 2FWOB 5C9JA 2AV7A 2IBGA 1Z5LA 1FSKB 2WINB 5TF1H 4ZAKD 1JYXA 5KSUA 4ONGH 2A9ML 3O3BB 4QOKD 2DQFB 1C5DB 2ORBL 5IT2H 4FQ1H 2BMKB 3VD7A 2ICEB 5ILTH 1F13A 1CFNB 2M1KA 5DXWA 2XZCH 4LLQB 4GRMB 1O7VA 3HUJA 3N9GH 2HT3C 2XA3A 4EIGB 1IAIL 1SM3L 3DSNA 1BLNA 4X9IA 1IAIH 1NFIA 3WUWA 4QF1B 1HN1A 4LSQL 2DQJL 1Y18B 2VDML 1N0XL 1JNHA 4I0CC 1TDQA 3TBTA 4YIQA 5A2LH 2D31B 4YC2B 4WENB 3OKKA 1EUTA 3BP4B 3OKMB 3S3SA 1S7QA 2ADJB 1H8SA 3DYPA 2OI9C 2CQVA 3REWA 3SDDA 4G8GD 1ZLUK 1RQ5A 3CDCA 3K8MA 4S2SB 3D2UA 3H9HB 3RJQB 4Y1AB 4R90L 2B4CC 2A6IB 2FJHB 4Y5VA 4ZAKA 2MTPA 1HHKB 4QTIL 4G42A 3OKLB 1MAML 4HPOL 5ICYA 1WK0A 4WRLA 1OAKL 1R6VA 1I7ZA 5B39G 1MQKH 4PJXF 1SJXA 5CEZL 4Z7NE 3ZMRA 2J8OA 1VACB 3MUGA 4HDIB 3L5JA 2VLLB 3LRGA 3G08B 4EN3B 4AQ1B 1D5BB 3QXTA 2VUYA 1IEBB 1NCDH 3ARYA 1SY6A 4PB0H 5JLZB 1X4ZA 3T0EE 4D8PB 1M7DB 1OHQA 2XWTB 2FSEB 4CU6A 2XZAL 3DOSA 3A6BH 1C7SA 3TIDA 2VDQL 3WS6C 2RGSA 4G6JH 4IOFD 4Y4KC 4X98B 2ICWJ 1QSEB 3VW3L 1T89C 4DGIL 3E3QE 1X5HA 3UTZB 1IKFH 2F8OA 3TCLB 5FYJD 4YBLB 3EO9L 2HJKA 1K6QH 3BIAX 4V2CB 2VZTA 4PJDA 2JJVA 3D39A 5LQBL 1DVFC 3QWQB 4FXLA 5LXGL 5C0FA 3JWDC 1DBMH 1JWUB 3JV5A 3LS4H 3X3FL 4L3CB 1TTGA 1U3YA 1XZ0B 3OF6A 4P2RA 3WYRA 1MLCA 1WFNA 5MEND 2AXFB 1U8OA 5BS0E 2XYCA 1SJHB 4GW4B 4IRSD 4YAQB 1UXWB 4D9RD 1KACB 1HKLL 2YSSA 3O2DA 4NRXA 3QCVL 3ULVC 3GBNL 4LSTH 4G9FD 4HFUL 4OF7A 4F58L 2AQ2A 2XQYK 1L7TL 2CUMA 3QDGB 4B7LA 2B39A 4DQOH 1Q9KB 2I26N 4M93B 3MFGB 1IL1A 2J12B 4HK3J 1IGJA 3VFWB 1OP3K 2AABL 5FA4A 3RWHA 4I4WA 2R4RL 1UXWA 4YBLC 5F1NA 5IHUL 2HT2D 2Z92B 3R1GL 4L4VB 2FATL 2ZZUT 4XP1L 3ET9F 5E7BA 2H1PH 4NJAH 1QYGL 3DO7A 1XCQA 1U8PA 4P2OD 4KZEH 1A7QH 3KPRE 4P2RD 2YBRA 4YHPB 1D5ZA 3LQAC 4OZIE 5FGBA 1EO5A 3KHQA 3RVUC 3W82A 4HF5H 3DXAE 1J12A 3QO0A 3IJSA 1MCIA 2MJWA 1MCJA 4FABL 2BY1A 1KT2B 4TULL 3ZT5A 3EJZC 5HD8D 4Z5RB 3S34L 4NO3B 3QRFM 1GGTA 4Q6IA 2NY0D 3SKUD 4JB9H 4P99A 2BVQA 3N1FC 1RIVH 4KK9C 5IVOA 4WEUD 5IW1A 5E03A 1IQDA 3PWVA 1D5BA 5IROA 4HFWA 5F9OL 1LILA 3O6ML 6FABH 4ODWA 4MNQE 3FB8A 2DLTA 4R8WL 3QG6B 1Q0XH 3CXDH 1FYTB 3LEYL 5HYFA 5DJYA 2VZSA 3OHXB 3SDCA 1BF2A 4P2OA 2Q7NA 3V6ZA 5FK9B 1DBJH 3BDBA 1FG9C 5MP6H 3H9SB 4Y4KD 2VLJA 1SEQH 2W9EH 1XGQB 1LVEA 3BPOC 5EWIL 3VWJC 1JFQH 2DQUH 5M94B 3B2UD 2AJVH 2IF7A 4YLQT 4XPTL 1UVQA 4TTDD 4Z76B 3QCUH 1UH4A 2LAAA 4U6HB 4J3SA 5DJDA 4WHTB 3W39B 3L3KA 5GGRA 4IRZH 5CBAA 3CK0H 4CRPA 2GEEA 2VE6A 4M62H 1U2CA 2VN4A 4P2QD 2DICA 3U7AA 3UTSA 5D7SL 4I1NB 3DVIA 3TO4C 3VXUE 2PW2B 3LRHA 3QJFB 4MQXC 1S3KH 3VWJD 4MXWL 4JM2D 5BJTA 1NC2A 3QYCA 4YPGB 3SGJA 1R5IB 1MHCA 5K33A 3NZ8A 3T1FB 4WFGE 2R8SH 3P77A 3TBSA 4RGNC 4C83A 3ZYIA 1WUNT 5KSUB 1MOEA 4DZBB 2B5IC 4HEME 1ZGLP 3RZCA 4MVBC 32C2B 3FJTA 1WWWX 5EOTB 4WFHD 1JNJA 2ZNXA 3H9YA 4IIQB 1T4KA 4PPTA 3VXTB 1H3XA 4M43H 3R0MA 3TA3D 4M8QA 4I0PB 5F1SA 3ZKSD 3RRQA 5L9DH 3CLEL 4PJ8D 5F3BA 5GS0D 1JRHH 4TVPH 1TIUA 1SY6L 2YXMA 1YNTB 2QTEA 4JAMB 3UYPA 3RWJA 2IEPA 3PP3H 4HF5L 5DA0B 3GM8A 5DD0L 4H8WL 2DOCA 3CFBB 3HRPA 4OBRA 2ZWLT 4U1LA 3QNZB 2DM3A 2A83B 3HR6A 4OUOA 1IEAA 4OD3H 1EBAA 1NC2B 2L0DA 1BZ7B 1XR8A 3WHE1 4D2NA 2PW2A 4NZRL 4QWWC 1JYWA 5EZLA 4JY6A 4X9FA 1OSZB 3K81A 2J88H 5DYOA 1XGPB 2AABH 2XRAL 4M6AA 1YEEH 3G5VA 4B41A 4QXWA 3V9FA 4JFPA 4TOYH 5DUPH 3X3GH 4HFUH 1RUPH 4XMLH 2H6PA 2QSQA 3QUYC 2AJXL 2H9GA 1U3ZA 5C0NC 3DXAB 3CC5A 3MLUH 3VG0L 3SY0A 1UACH 4U1JA 4NNPH 4G6ML 4KAQH 3ARBC 2OM5A 3MRKA 1V3LA 4XHJC 4HMDA 2DQGL 3WO4B 5I8CA 4HKXB 2NY5H 1H3UA 2NW2A 4O2CB 4F7EA 4P23A 2QADC 3Q5OA 4OGXH 1OB1A 4XNZC 3RWHB 4ZUTA 3QO1B 1FQ9C 4JPWH 5DVKA 3BSZH 4LPXA 3MLZL 3RZCD 3PABA 3V8CA 3PQYD 3CFKB 3IFOB 3GK8H 5JUEH 1N5YH 4J8RB 4LPWA 1I9IL 2X4UA 1T0NA 4YK4C 4J3TA 2O5ZH 4YQXH 4P3DB 2DDQH 3F6IA 4Q2ZB 4G6JL 4YHOH 2BVQB 5D72H 3BGFB 5F72S 3WE6B 2AXGA 3GMNA 2R0LH 4Q6IB 5JW4Q 4WCYH 4R7NA 1DN0A 4RFNC 4CVWA 1BFOB 3W5MA 4Z7UA 2D03H 5DVNA 1JGLH 3NIFE 2NY3B 4HLZH 3G6DL 4PJ9B 3W81A 5C0DA 1Q8MA 4NOFA 4GG6B 1MEXH 3CFCL 1WJ3A 1OWWA 5J12B 4O2EB 3AS3A 4BA8A 4IRJD 2R0KH 2O5ZL 2VL5B 5DHVB 2YRLA 5FM8A 3HKFA 3U4BL 1X5XA 1JWMB 3ARDC 1KB5B 1OD7A 1CS6A 1WBYB 2VXTL 4HPOH 4FTVE 1JTOA 2HLFC 4EQ2A 4F7CB 5JOFA 1TXKA 1GCFA 1FL5A 3CD4A 2X41A 5FA4B 3B9KD 3NIFF 2HJFA 2IC2A 1F11B 2PYFA 1ZT4B 2YA2A 3TA3C 1T22A 1IL1B 4G8FB 1AQKH 3BVNA 3FCTB 3UTTE 3P0YL 1KEMH 2OQJB 3V5DA 2A73A 3C6LB 4I18C 2GITB 1NCTA 3KPNB 4JFFD 3MLYL 3V4PH 1Q9OB 5B38A 4TTGA 1R24B 3D9AL 2VDMH 4BFBD 3QUZB 5BOPA 3U0WL 1R5WB 1RUPL 5D5MA 5EA0H 5B8CC 4KY1L 3HG1A 3ROOA 4YK4B 4JFZL 1IBGL 5IROC 3QQ9D 3E8UL 4E41A 4Z77A 4YDLB 3N9GL 1I4FA 4KGJA 5I1JH 2YR3A 5D2NC 4Y1AA 4GG8A 3MCLL 1JN6A 4OTXH 1MJ8L 1RU9L 5CD5D 1G7MA 4NQEE 2XNAA 4FQ1L 4NT6B 2H9GB 3OXSB 1T2QH 4PIRF 3MPCA 3QHFL 2HJKB 4KK8C 2A9MH 2YD9A 3BWUC 2CLVA 3BD5A 3INUL 2P7TA 2RCSH 5IR1A 2LU4A 4HBCL 5FYLH 3I84A 4OT1H 5GXBB 4GOSA 1QFWH 2YN3A 4KV5E 1QLEH 2FX9H 3VXNA 4TTDC 1A2YB 4FZ8H 5EZLB 3S96B 3RIAK 5AWNL 3B9DA 1RVFL 1ADQA 3U9PH 4H1LG 4HWBL 2HVKB 2XN9A 2YPLA 3IDNB 3P0GB 3S35H 2DL9A 4YHKL 5BV7H 3ULVL 1T83A 1YYMH 2CLZA 4KC3B 5FGRA 1UYWL 4HAGA 5JLZA 3STZA 4XGZB 4RA0C 2JIXD 4PYHA 1JRHL 4TVPL 1ZMYA 1A7PH 3VFMA 4ETYA 4NKQB 3C2SA 4OFDA 4OI9A 3T2NL 1UM4H 5FECA 4PJGB 5T3XH 5EBLA 3HE6B 1AE6H 3P40A 2BNUA 2ATPA 4GS7C 3EDJA 1VACA 1ZXQA 1X5LA 2XKNB 1TITA 5DJ0A 2WINA 4HC1A 4WV1B 5A2KH 4Y1AD 3JWDL 5J1SC 4GKNA 1MVUB 4DKEH 25C8L 4JFDE 5TFSL 3ULUD 3NIGF 2APBA 1QSFD 3FQUB 2PTVA 2OP4H 3WIIH 4KTDH 1QO3A 2IPKB 4NOBA 1VCAA 1YDPA 5IEHA 4XPBH 1AH1A 4ZNCD 5KSBA 1OARH 4L9LC 4LSPH 4MXWH 1MCCA 4S2SA 1YJDC 4XC1H 5KVGH 4QGTA 3UJIL 4AEIH 3S37L 3IDIA 3AU1B 3P77B 3D39E 2E7HA 5LGJA 3BEWB 2PNDA 3HN3A 1P6AB 2B5IB 5E6YA 2X1PA 2J2ZA 3GNMH 3WUWG 1BIHA 2DWEB 4LEXL 4OCWL 3MODL 4ODTL 5IMKA 5ID1B 4HKBA 4AEHL 1FORH 2D7NA 4OIAA 5I19H 3TO4A 1DBBL 2RFXB 5KANI 3N06B 5JW3L 4NJ9H 3QNXB 5MHSD 4PGDA 5D1XC 3QUMA 5FHAH 3N85H 2I07B 2HT2C 5I1DB 5D70H 1C12B 2XIDA 1GGIH 2R69H 3ZTNH 2AJUL 3KR3L 3L3KB 4PGDB 4TYUA 3P4NB 2HLAB 3O3BA 5C09A 4CDHA 1YEJL 1FHGA 5T3ZH 4IMKC 1BD2B 4G6FD 4PRAB 1N5AA 1XIWD 1E6JH 5EOQL 4QRPE 1FN4A 5CGTA 4P46D 3O6MH 4KUCF 1W72B 4NWUH 4Y4HA 4L9LB 1RK0B 4Z7OE 4PTTB 1ED3B 1YMMB 3T0AA 2YK1H 1V05A 1R3HB 1ZLSL 4TQEL 5C8JA 5CSGA 3VXUD 3NPZB 4R9HA 4NBZB 4JB9L 5T1MA 2GSGA 3S35X 1X7QA 3V2AR 3L5XH 5JHDA 3RL2A 1DLFL 5KVFL 1NBZA 2G60L 4RZCB 4NCC2 1F90H 3QHZH 4NQVA 4HUKB 2HKHL 3LB6C 2ZUTA 2I9TB 2FEDC 1EA9C 1I4FB 2YD2A 1S7TA 3OB0K 3BEVA 3WXVL 1HH9A 1F90L 3QHZL 4G8GE 2Z91A 2NR6C 3FRPA 1T03H 2DWDA 1CXIA 4QRUB 1KIQB 3EJZD 5IMLB 4JFYA 3MNWA 3LKQA 2GITA 4JKWA 4Y0GA 5HDQL 4NO2A 5GJTH 4NQDE 3IT8D 3FL7A 2GKIA 3BVNB 2A77H 1I1RA 2NPLX 1DQJA 3SE4A 5BO1H 3BO8B 5E6IA 5TDOA 1NGXB 3PGFH 3ILQD 4U6YB 2EDEA 4QTHA 1NDGB 3H9SD 4IHOB 4GRWF 1G7HA 2QHRH 1NMBH 4HJGA 3RQ3A 2ERJC 3TBWB 1LK3H