3SY0B

S25-2- a(2-8)-a(2-4)kdo trisaccharide complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
b'EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-2 FAB (IGG1K) light chain
publication title Germline antibody recognition of distinct carbohydrate epitopes
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2011-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sy0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sy0B01
3P73A 1NCCH 3MJGX 4PJBE 2OP4L 4JEGB 2AEIT 3CDYA 5T1LD 3AVEA 5ID0A 5L9DH 1A02N 5CZVL 4K23H 2GFBB 4MVBC 2NXZB 5DHVA 3QH3A 5C9JA 3RWGA 4K2UH 3MLVL 1WBZB 1TZGH 2BVQA 4PJ7A 1CLOH 2E6QA 4FQCH 3BAEL 3O2VH 1C8PA 2ZOKB 5GS2H 4XBGA 4NQXA 3QR2A 3X12B 5DLMH 2YA0A 3X3FH 1CWVA 4QY8A 1KN2L 2NY2D 5GGTL 4RISH 3UTZB 4U1KB 4WFGE 4G6ML 4I13B 1YPZF 3HE6C 1H8OA 3Q6FB 1TPXC 1NBVL 3CMGA 4NOBA 3RHWK 1JGUL 2RR3A 1HOCB 4HKXB 5ICZA 3OF6A 5TE4L 1KCVL 4L3EE 1GGYA 1XF3A 5ID1A 5B38G 3I6GA 5I15L 3RWHB 3IDJB 3NA9L 2PR4L 3VW3L 5FHAL 4RA3A 2HJKB 1CQYA 1RK1B 2ILLA 4PJXF 3ARFB 3N0PB 3SDDC 4PB9H 4JQIL 1S9WA 4IRSC 4JRYE 4OCNC 1AFVL 2ZSVB 5HY9B 1TNNA 1U95B 3GJFB 1ES0B 3FO2B 4JE4B 3WNPA 3VFVB 4U1GB 1VB9A 1WBZA 4ZMAT 1M71A 3BJ91 3GNML 1J7VR 2XRAL 4OFKA 1J1XH 1NPUA 4I0PC 2GK2A 1EHXA 1MCLA 3QFJD 3UTZA 4U1KA 2VISB 1Y18B 1OSZB 4YE4L 3GMOB 5FIEA 3WLWD 3H3BC 4P57B 3UJIH 4FQIH 5GGSA 5LWYH 1F5WA 1HOCA 3VFOB 3IDGA 4N8VA 5DA4A 4HIEA 3LSOB 5AYUL 1A6TA 1N26A 5MP6H 1BVZA 1WTLA 4L8SC 1N7MH 4PJHF 2COQA 2VWEC 3OHXB 4K3JL 4FFYH 4CUCA 2HFTA 5FYLH 1RK1A 3V5HA 1K6QH 1Q9KA 5CINL 4O2FA 5CGYD 5DEFB 5D7KD 3MCKA 2AQ2A 1NAKL 2IPKB 3F7RA 5EBMB 2XOTA 3CZJA 4OD1L 1U95A 1P7QD 4OKVB 2Q87A 3FO2A 4BJLA 3VFVA 3E6HB 5AWNH 2V9TA 2DBLL 1FQ9C 1QBML 2DMBA 1I9EA 1KCRL 3AFLA 5EPMB 2IBBA 3HFMH 5LG1A 3CXDH 4R4BB 5BV7L 3ARGB 5D5ME 1J05A 4AQ1B 4MD5B 4DOHE 5T3ZD 3D3VE 5BOZG 1OAKH 3P77B 4YPGA 1SJHA 3GMOA 4DQOL 4Y89A 1DBML 2C7UA 1SYSB 1WT5C 4OM0L 3ZDZF 3SGDI 5IHLB 2X9XA 4XI5D 2MPAL 3CUPA 4GKSB 1A5FH 2B20A 5GZND 1PYWB 4JDTL 3HA0A 4IOFD 1IQWH 1H0DB 5B8CB 3D6GA 1X4ZA 4YHOH 4FQQB 3RP1A 5DD1H 1FZKB 5I71C 3MLRL 5D70H 4RGMB 3VFPA 4QEGA 4G8IB 1WC7B 1MPAL 5EBMA 4P2QD 4L4VD 4F37K 4CW1B 5LJYH 2PYEE 3GB7B 4OKVA 5HYSB 1E0OB 4HPOL 1XZ0B 4IM8A 2EE9A 4XAKE 4KXZH 1GGIL 3B43A 1IKFL 4HLJA 3VCLB 3JV0A 2OL3H 4HS3B 3BZEB 5IP4A 5F7NC 1WCBB 5EPMA 1GHFL 1WCQA 4R4BA 4WUUD 3MUY1 5JLZA 3RA7L 3IDNA 4R8WH 4MD5A 1P7HL 1I8KB 5JXEC 4MQXD 3ARDC 3JWOL 1NUGA 4ZO9A 3PWNB 4LKCB 3V4VH 5T1LA 4PS4H 1V7NH 1WITA 3TGXA 3DRQB 4H88H 4QOKD 1IM9D 4I18B 2X7LA 4GKSA 4PJCA 3MC0A 5DSCB 1UB5B 3CX5K 2EH7L 4HG4K 1PYWA 4JFFD 3G6JA 4NM4L 3AROA 5T1KD 1H0DA 4FQQA 3B8SA 2NYYD 4YIQB 2E8YA 4EN3C 3RGVD 1QA9B 3S35L 3NIDF 5HYSA 4MXQC 1O0VA 1XZ0A 5SWQA 5C0RL 4DVBB 2J8OA 4P3DB 2BOBB 3WDHA 1NKRA 3WN5A 3BKYH 4HS3A 2X40A 5FB8A 3VGDA 4HMDA 5D7IF 3P0GB 3MLSH 5IW1B 3MCLL 3DYPA 5J11C 3HI6L 1KIUA 2LV4A 3VXSB 1RVFL 4AEFA 4ODTH 3F7PC 4KJPC 3T08A 2UZYB 1FYTE 1A3RL 1UWEH 5FV2A 3C9NA 4X5XB 2BNUB 4NQSB 2HT2C 3LKNA 1RMFL 5F6IB 1UB5A 5CBAB 4Z0BL 4C59B 4MS8C 3KYOB 3PHQB 4N0YL 2ZG1A 5FUOH 4XC3L 3QIBC 4I48A 2BVUA 1KTLA 4F33A 3TO4C 2D4FA 2BY2A 3QFJA 1I8IA 4Q9BA 4CVWA 4OSUH 3I3EA 5H35B 1EH9A 1EXUA 3KHOA 4P3DA 1SBSL 4X6CE 5F97E 2FO4B 4G6KL 2UVFA 4R97C 2JB5H 3C09B 1A1NB 4KRLB 1AD0B 5I0ZA 1CDHA 2QSQA 4LIQE 5IW1A 4XP6H 1JP5A 5HI3C 1JMXA 5DJYA 2IADB 1F4AA 1HINH 3W5MA 1U8JB 2VAAB 3IFLH 3U1SL 3LEVL 4Z7WE 1ZV5A 3C2AL 3ME0A 4WW2A 1BZ7B 2YD2A 2HMID 1G6RL 4O2EA 1UQSB 2OZ4H 4X5XA 3UZVB 4HGWB 4QXWA 1SBBA 5D8JL 1MCWM 3NCFB 5FYKD 1P7QA 1TQCB 1ONQB 4WI3A 5CBAA 5I75C 3THML 3D85D 3KYOA 1DBKL 4B50A 3PDOB 3DUSB 2WSKA 5DWUH 1FG9C 4MA8L 4POUB 4YHLH 2UZXB 1JFQL 5H35A 2VZVA 5JW3L 3CSPA 1U8QB 1IFHH 5SV3A 2QLVB 4WW1B 4QRTB 5DJ8A 3GJEA 2AJSH 4FP8H 1A1NA 1AD0A 3VMOA 3QXAB 4QOKB 2DL2A 2X4TB 3IFPB 5I1HH 1T83A 3T1FB 1I8MB 2Y06H 3GSXA 4HUWB 2IADA 2P8MB 1S7WB 2CH8A 2IPUG 3JWDL 4HF5L 1NMCB 2VZTA 5FGCE 5T1KB 3FMGL 4F80A 2IGFH 3DMMC 3STBA 1BZ7A 2Q20A 3PHOA 1CICB 5IOPA 3F62A 3D48R 5DC0A 3CVIH 1KB9K 1IL1B 4HGWA 1DQQA 3C08L 3GHEH 3GK8L 3BUTA 4IDJL 4KXZI 4P2QA 3VI4E 3LZFH 1ONQA 2YSSB 4MA7H 1LNUA 5FK9B 2VDQL 5DUBA 1D5ZB 5D1QB 5IROA 4Y5VA 3CAFA 5HYJB 5KSVB 3PDOA 3DUSA 4WUUA 1MCSA 4FG6C 4U6YB 3EYVB 3MYJA 4PJFE 4LHJB 3H8NA 3FAWA 3DXAB 3LQZB 4NKIL 5CEZH 2EKJA 4Y19E 1U8QA 4OTXH 5LGJB 4QRTA 1BGXH 5C08D 1T1WA 5I17B 1IGJB 5EWIL 4QOKA 5E6YA 5EUKB 2X4TA 3IFPA 4HUWA 2P8MA 1S7WA 5DDHA 3SO3B 5MENB 4HT1L 1GH7A 5JO5B 4JFFA 1KCLA 4LVEA 5T1KA 5IG7B 3CLEH 4PTTA 3GI8L 4NBXB 3X14B 2EDOA 2VC2H 3GMQB 3RGVA 4WHYH 3TBSA 3WJLC 4OZHE 4N68A 5C7XH 2ZG2A 4GW5A 4IRJC 3GSUB 3OKLB 3EO9H 4OGYL 3U48A 3L3IB 2Q7YB 5D72L 5KSVA 2XXMB 1BJ8A 3HNSH 4XTRC 3P11L 2AV1A 2HT4D 2BC4B 4ZFZA 4PGBB 1GXEA 4HH8A 3FO9A 3MUJA 3EYVA 3V6OE 3ZKXC 5FEBA 3AAZB 2ZWLT 4MAUH 35C8L 3EZJB 4YXLH 5FYJE 3DRTA 5HHOD 4C55A 5LGJA 4QRSB 2G5BB 2CK0H 3ES6B 3HI5L 5TE7L 3TH3T 1IGJA 4F7CB 1MCQA 1CGVA 5MENA 1ORQB 5FOBA 1T5XB 3WFBL 4OQ1A 3LB6D 2EO9A 4TNWF 5E00B 3RVXD 1JGDB 4NNPL 2F5AL 3BMVA 3FO0L 5JHDB 5F8QC 1UXSB 2XZAH 1NAML 2PTVA 3BWAA 2GHWB 1DLFL 1KPVA 3OKLA 4M9PA 1BFSA 3WKMH 4JFPB 3ILQC 2Q7YA 4TPRH 1P2CA 3DV6B 1MJ7H 3VG9B 1Q72H 3FQWB 4NBYB 5ALBL 4M8QA 1U91B 4FRWA 1DQDL 4PJ9C 2PO6D 3AAZA 4UQ2A 1G84A 3I02A 4JQVA 4O51A 4NC0B 4QRSA 1A1MB 4PRHB 1J9CT 2G5BA 4HBCH 4IRZH 3O41B 2PKDA 4RQQB 1A7NH 5HBBA 4FZ8H 5M94B 1CFVH 1GZPB 3V8CA 2BSSB 4KUZH 2Y07L 3I75B 1ORQA 2C4FT 1PX4A 2EDRA 4X7SH 3PGCB 5IGXL 3D85A 2ITDA 5HGBB 1MFAH 4QO1A 1T5XA 1RU9H 5KVEL 1PLGH 1J1PL 5I19L 2RJMA 1CDUA 5E00A 2J1KA 2R2HB 4HPYH 2GUOA 1VENA 3QFDA 4LIQL 5JW4R 1R6VA 2A9ML 5GS1B 3FCTB 1CT8B 2CD0A 4LSDA 3VWJD 3HE7C 1EMTH 4JFPA 2VZOA 4Q6IC 4XHQA 4YPJA 1P5UA 2CPCA 3DV6A 2R4SL 3O0RL 5TQ2H 2C3HA 3LH2H 3FQWA 4Y2OA 4NGHH 3UYRL 1U91A 2J6EL 4GRWE 12E8L 4RRPA 4BQ6A 5TGBA 1ZHKA 3D87B 2XKNB 1I1RA 1AXTH 2P5WE 4NZUH 2IH3A 4NQDD 4ODHL 5BRZE 5JPMB 1IILE 1A1MA 4C56E 3LRSB 5FUZL 4WHCA 4N8CH 4HK3J 4UAOC 3WLBB 3SJVE 2BSSA 2NXYD 4WUKL 1FL3B 3HPLB 3DI3B 3FRPA 3QEQE 1KPUB 4RMQA 5BVPH 5GS0D 3QUXC 2P48B 5D93B 1FPTL 3C5ZD 4LHUD 4KK6D 4ODWB 1QSFD 1R3HA 3S3JA 4WTZG 1FNHA 3BD4A 4R2GD 5GS1A 4LSTL 1A4JB 1CT8A 3RIFK 1O7SA 3I50L 1G7LB 4PP1D 5C0CE 4ODXA 4DAGL 1I9JH 3BI9X 3L5JA 3OAZH 1NGXB 4X8JB 5C08A 3JV5A 1C5CH 4ORGB 5E6IB 1ACZA 1QYGL 3HKFA 3I6LD 1JTPA 1QTYT 5LQBL 1KXQE 4POZD 3VD4A 1OQOA 4XCNB 3M07A 5KSBB 2QR0B 4YDVB 3LRSA 4NHCL 5CD3B 3ZE2E 4ISVB 5EIVA 5IEKB 2AERT 4UMGA 1Z5LA 3C5SB 4S1RL 3A6BL 3HPLA 4MMZC 4Z7UB 2GK0A 3V9FA 4JO4L 2VDML 5KOVC 3GKWH 3TPKA 5IWLC 3BDXA 3M1BB 3TH2T 4GAGH 4J6RH 3ULVC 4U7MA 1LO4L 4UILH 4Z8FL 1B4JL 3G5XA 4KV5E 1G7IB 1QBAA 1J0JA 5CP3A 5C0IB 3BW9B 3PGFL 4W4OA 3MNWA 5CEYB 2PO6B 3DVGB 1ZK9A 1A4JA 4LSUH 4PLJD 5C0AB 4ZOEA 2CJUL 5C0BE 4MZ3A 4KI5D 1EEYB 5FM4A 1EEQA 3KXFB 3BEWB 5JW5B 1NGXA 1OOAA 1QRNB 4X8JA 1YEJL 2DQGL 3F8UB 1GGTA 1NGYB 3NVQA 4ORGA 4NO0D 5D71L 1RZKH 3V52L 5DVOA 4Z7QE 3RY6A 2NXZC 1C16A 1F6AB 4RFEA 3UBXI 1X6LA 3A0OA 4XCNA 1A9BA 2QR0A 4OF6A 3H7LA 4YDVA 4HQQH 4XZUA 2F54B 5IEKA 4ZNCD 5HGDB 1J88A 1RZ7L 2QQKL 4Z7UA 3CFIC 2OR8A 3T0BA 4RGND 4LLWB 5FYJL 5I76B 1OTSC 1TJIH 4KVCL 5I30H 4FFZH 2R8SH 5F9OH 4S10A 1Z9LA 4KKLC 1D5IH 1HSAA 2H32A 3RTQB 4M4RA 4K3DH 3BW9A 4JQXA 2IPTL 5CEYA 2PO6A 5KANI 4ERSH 5C0AA 1A6VH 4UT9H 4NJ9L 1OGTA 4OLUH 4DZBA 5E08H 1EEYA 3RUGE 2AGJL 3BEWA 2LTQB 1H8NA 1X5LA 3OPZL 5DHXB 1FVCB 4YR6A 3GDBA 3D0LB 3ARFC 2E3VA 5INCB 1JYVA 3F12A 2Q1EA 5D9SA 3MLXL 1F6AA 3RWFB 3ET9F 2Z0BA 3SGEH 2BFVL 2OK0L 1DR9A 4OQTA 1YEIH 1ZA3A 2DI8A 4U1GC 1F45A 4G7VL 5AEAA 4PTUB 4AG4L 3OAUH 4NP4H 4U6VH 2WUBL 1QSFB 3U9PH 4ZUUB 5HGDA 4MGXA 3V7MA 5CJOL 3KPRD 4WHTA 4S1DD 2W38A 5GGRB 2VWEE 3BZ4B 3VWJA 4KPHH 3K4ZA 2UUDH 5I76A 4JKPL 1DP0A 2DD8H 4BSVB 1CQKA 5IVXE 4PD4K 4PRPB 4DGVH 3BMWA 4QXGH 3W0WB 3PWLB 3DIFB 5EOTB 2EDJA 3AS3A 3OXRA 2F58L 3MV9E 2OR9L 5T3XE 1P7KB 5ILTH 4NQDA 3MLZH 3CVHB 1VGKA 2WBWB 4D94A 1YY9D 3WHXB 3L3GA 1FVCA 5E0QA 4UB0L 3D0LA 3U6RB 2B4CH 2MSPA 2VZ1A 2QSTA 3T0XA 1OT2A 2V5MA 5KW9H 3OKOB 5I8EB 2HRLA 3BD5A 3RWFA 3ALPA 4BKLB 1U93B 1JYWA 5DJDB 4M1GL 3MXWL 4E42A 4JDVA 3U30B 4LPCA 4I3GA 1Q1JL 2HP4A 5E1AA 1QSFA 3ARGC 1ROWA 4LASL 5GRJH 1A22B 5EIQA 2ZPKH 1R3IL 1T4KA 1Z6JT 3ZSSA 3RVVD 1AR1C 2AVGA 2W91A 2LABA 5GGRA 4CNIB 3BZ4A 5EU3B 2HH0L 1S7RB 5C09D 1VPOL 2W60B 4FABH 3PV6A 1NCAH 2F5BH 4G5ZL 3QNYA 1VDGA 2EZ0C 2B1HH 4P9HC 4HUKB 3TBTB 5ESVB 3IDIB 4M1DH 4BSVA 4OD3L 3SE4A 1IZKA 1SVCP 4TOYH 3I85A 3PWLA 1NGPL 5HSFA 3H9HB 5EBWB 4EBQH 3I2CL 3HAEG 3TNNB 1WEJL 5D7SL 5DT1L 2R0ZH 1DCLA 3CVHA 3I84A 2VDKL 2JLLA 3L3KB 5B8CC 4WV1A 2VLRE 4V1DD 5HVWA 1GAFL 4RGMC 4Q58C 2JTDA 1NEZB 3G6DH 1JNNH 3VXOA 2E9BA 3B2VH 3VFSB 1BLNB 4BKLA 1II4E 3QCVH 5DJDA 2V2WA 3JTSA 4LSSH 4ZTPL 2Y6SC 4AEIL 4QRPE 4L8DA 2OR7A 1BX2A 1MIEH 5SWSE 1K85A 3EJZD 4NWTH 3BH9A 4K9EH 2M2DA 2Z9TA 5EN2B 1J1OH 4CNIA 1XIWD 4GO6B 4S0SD 2AABH 5JW4M 4ORZC 1EIBA 3FFCD 4PGDA 2E6PA 4XWGH 5F1OB 3TBTA 5ESVA 5J89A 3H2WA 3S37L 4NO0A 4X4ME 1YEKL 3DGCR 1F90L 1FHGA 1C08A 3H9HA 4I18C 5EBWA 3HZMB 5J56B 1KNOA 1J18A 4JHWL 3CMOH 4YC2C 3L3KA 4QNPF 1G7PB 4NUJB 3UAJD 1CDIA 4PG2A 2E9IA 1U6AL 3FN0L 3KPRB 5CJQH 4ONGH 3VFSA 4MHHI 1BLNA 5IV2B 4G8GB 3WLWC 1HWGB 2P5ED 1LEKB 4ZS7H 1PW3A 3NZHH 3PGDB 1WZMA 4LEXL 3V8OA 3EIFA 4P0DA 2YK1L 3NIFE 3IKKA 3SE8L 1U2HA 1MRFL 2HT3C 1LD9B 3P4NB 4OZIB 2BNQB 3VG0H 2IAND 2XKSA 4J7RA 4Z7VB 5DFTA 4EDWL 4U1HA 1G7HB 2I5YH 5GSVB 2GJJA 4WVRA 2N1KA 3I3DA 3SGEI 3FQXB 2YPLE 3HNTL 3BUYB 1FNSL 4MX7B 3KGRA 1CTOA 2AJUL 1HHJB 2IPUK 3LPWA 3GMPB 5HYQB 5F6IC 1EGJL 2VLME 3CH1B 4G6JL 4MZ2A 1KEGH 3AU1B 4NUJA 2HN7B 5I1LB 2FATL 3C87A 4LSQL 1OL0A 1X5HA 5JNYA 3KPRA 5F3HB 1YQVL 1A4KB 2R1XB 5C09B 2EH8L 15C8L 1D6VL 4MNQE 1J0HA 4IBLT 1OCWL 5A2FA 5HHVH 3TM6A 1LEKA 3PGDA 2IFGA 3Q5OA 3QDMD 1A3QA 3C09C 4PGJA 5EO0B 2J8UB 3T0WA 4HWZB 3O8XD 4OZIA 2EC9T 3A6OA 1FLTX 1UZ6E 3F6LA 5KSBF 3NCCB 5GZNC 2NR6D 4TUOB 5F1KC 1AHWB 1ACYH 2R29L 3X13B 1G7HA 4MD0B 5GSVA 3OKMA 5I18L 4KVNH 5DK2B 3S3SA 4XCEB 2PUQT 4J4PA 3BUYA 4OCWL 5JUEH 4X5WA 4MX7A 1CI5A 4KROD 4OJFL 1HHJA 2F74B 1TQCC 3BIKB 5HYQA 1W8OA 2PCPA 4H25A 4XMPL 2Z8RA 4KMLB 3SPVB 2I9LB 5IB1B 3BGFB 3BQUD 3DO3A 4X6BB 3W2DL 5I1LA 3QXVA 3SDCD 4NCC1 3VU2A 4J2XA 2NY7L 3MNVB 4NQCD 3I6KB 1KN4H 2UZIH 5F3HA 5CILH 4Y4KD 5C09A 3BZFB 4C57C 4PGCB 1V7MH 4ZO6A 5T3XL 1ETZB 1SYVB 4PREA 4PJXE 3PP3H 4XPAH 3RVTC 5EO0A 3KYMA 1JPSL 2J8UA 3S37X 4X6FA 4ZYKB 3ROLB 4ZO8A 5L0QB 3ZDYF 4OFPA 3FT3A 4HWZA 1RY7B 5I16A 4HUVB 4PJAE 1GOGA 1NMCC 5FYKH 4WFED 1AHWA 3X13A 4MD0A 3DTXB 3MMEA 2NYYC 5DK2A 1CICC 4XCEA 4V1DA 3FQUB 1DE4A 1MHCA 3VJ6B 2FH8A 5DVLA 5E7FA 2WWMD 3UTQA 2WUCH 1ZWIB 2QTEA 1FH5H 2YRPA 4H20L 2VXTL 3SPVA 1QVOB 4GT7A 2I9LA 5D1QC 5IB1A 1I4FB 4TTDC 3TJEH 4O9HH 4X6BA 1HKLL 4N0FB 3TESA 1J8HD 2ZG3A 4NQTA 3I6KA 2FEDC 3EOBB 4LLUB 1S5IL 2HG5B 3G04B 4XCYA 4F9LA 3BZFA 4ZNEE 2DM3A 2IANB 1OGAE 4HWEL 3FFCA 4MDIB 1R5VB 4PGCA 5TDPB 4AMKL 5KS9F 1VFUA 1DQLL 4XNQB 1JHLL 4BFEA 3QHTC 3MROB 4PGEB 1RURH 4AM0B 2BERA 3T0AA 1I7UB 1UXWA 4HLZH 3ARQA 4P2YA 5IFJB 3SO3C 4ZFGL 1HYSD 3VGAB 3GUTB 5ISZD 2P8PB 1L9NA 4JFQB 2FHFA 3DTXA 4HKBB 2H9GA 1QFWM 3ORJA 2CXKA 2M1KA 2F15A 2D7NA 2AQ1A 3NGBB 3WNNA 4H1LB 4OT1L 3MTRA 1EAPB 3C8KB 4P9ML 4AL8H 3QDGE 3IXAB 3K8LA 4U6HB 4CVZA 1ZWIA 4HS8H 3VDCA 3KPSD 3IDMB 3EYFB 2P5EA 2I60L 5EDXA 1I4FA 1Q94B 4N0FA 3ARED 1GGBL 1PG7X 3E1F1 4JN1H 3BGMB 3EOBA 2CGRH 4LLUA 1OWWA 2B8OT 1IE5A 2HG5A 3G04A 1L7TH 3P0YH 4JM4H 3RKPA 2IANA 5TDPA 4MDIA 1RHHB 1CE6A 4JQVC 1IAOA 2AXJA 5ANME 3MFGB 3MROA 2GJ6E 4KHTH 4OZFA 3NCMA 4AM0A 3BDYH 3T0VA 4KROB 5IFJA 3VXQB 2CRYA 2QSCH 2F53B 3B9DA 3GUTA 3MA9L 4JPWL 3VFUB 5L2KD 3GSWB 4JFDE 4GAFB 3LDBB 2NY5H 5E9DD 4M6ML 5B3JE 4AIZA 4I77L 2O5ZL 4R90L 1RK0B 5CP3H 2DIBA 4U6HA 1Y6KR 2HKFH 1JRHL 2W9DL 4NYLB 3IDMA 5IFHH 3RJQB 4BELD 3QDMA 1Q94A 4WWKD 4Q74A 3VG9C 2Y9RT 3M8OH 1FCGA 2AJYL 1G9MH 3O8XA 4Z7OE 5HHPB 2VZSA 4OCRH 1ZHLA 4UOW1 3K1DA 3W39A 2EDNA 1NBQA 4M1CC 3MRJB 4UNVA 5FECB 4APQD 4G3YH 3O6LL 5ACMA 2LU3A 4CJ1A 5IFAL 5KZCB 1NFDA 3NCBB 2DS4A 5TE6H 4I2XE 5HYSG 2GY5A 4MJID 4KZEH 4W6WB 1QPXA 4B7IA 1PKQE 3L6FB 3CPLA 2V6HA 1KEML 3SDCA 2X41A 4OIIH 4OZGF 1IKNC 1MY5A 2QQNL 3FB8B 5JXAL 4Y4KA 1RK0A 4M62L 5ADOL 5GS1C 3SDXE 3T4AB 3NFNA 3CD4A 1WFUA 3KR3H 4R4NC 5HDBE 2FHCA 4UOJA 4JKLA 1DLHB 4NYLA 4WFGD 1DQJB 3QQ9D 3P4OA 1TNMA 4UV4L 3D39E 3QDHA 2R2BB 3MV01 4NKMB 3VXRB 5IMOB 1EZVX 4KHXL 4L3ED 3FO1B 2VO5A 3HMXA 2IMNA 4QXUH 2LVCA 4BZ1H 3ZHKA 2OMNA 2VLJE 1LO3L 1VCAA 1V3JA 2XACC 3U0PB 4XBEL 1U8IA 1FBIL 2C9AA 3HPJB 1QFUL 2I24N 4JRYD 2BVOB 1RUML 3FFDB 1YDPB 1BWMA 4L9DA 3L6FA 5D93C 4KJYA 1J8HA 4PJEB 1SEBB 2HT4C 1XGRB 5FKPB 1LE9A 3BN3B 3L1OL 1T04A 2QADB 3OAYK 3CJJA 4RBPH 2NQCA 1DLHA 3QWQB 1DQJA 2HJLA 3O4OB 2HFGH 1BIIB 2VL5A 4JGMA 3DSFL 4RZCA 4YWGL 5TFSH 5DJXB 3SKJH 5DJAB 5E6IC 4NKMA 2IFFL 2BJMH 2XXCB 1RULH 1QZ1A 3LPGA 1EZVY 3ULVE 3CX2A 3NABL 5L2KB 1A7BA 3S88H 2I07A 1QR4A 5ISZA 1CU4L 5E9DB 4M7KL 1Y0LA 5GS0H 3U0PA 2N7BA 3MOAH 3T04D 5A16A 4XVTL 3MV8E 1OAYH 1LO2H 2BVOA 2UWEF 2VZ3A 2Z4QA 5LGKA 3FFDA 3KPSA 1E6OH 1YDPA 3S5LA 2FCBA 4PV8B 3AREA 4WWKB 1KB5B 4PJEA 2N56A 1XGRA 5FKPA 3U7YL 1ZGLB 4KRPB 5D7JB 2Z93B 4JQXC 2AS5M 2PO6C 1QBLL 1QR1A 1UM6L 4ZUSA 1JF6A 2A6JB 2W59A 1D5XB 3LIZL 5ELIA 2EYSB 3LMJH 4UT6H 4PJGF 1M1SA 1MRCH 1LQSR 1P5VA 3BISA 1BBDH 3VE0A 4CL7A 5E5UB 1MREH 4MJIB 3MJ9H 5L2KA 3DVNB 1QSEB 2E8ZA 3KNBB 5E9DA 1X5KA 2BMKB 2VE6A 4PJ7F 3P30L 5JW4Q 3MBXL 4RWHA 4ELMB 1FIGL 1X7QB 4U1NB 2DLTA 4DN3H 4KI1A 3BKJH 4YDJA 3W5NA 4NHUB 3FONB 5A3IC 3F58H 3UZQA 7FABL 2PYED 4NRZB 3MGOA 4RSVA 4PV8A 4OLWL 5BO1L 4WWKA 4A6YL 1KB5A 5F70A 3ZKNC 1ZMYA 3BSZH 4XAKD 1J5OH 1YEFL 4AK1A 2H41A 1ZGLA 1F8TH 3RTQC 5D7JA 3PWJA 4YLQT 2GJZB 2Z93A 3IU4H 4N5ED 5SWZD 1CDGA 2SEBA 1FZOA 4BZYA 1X5AA 4YGAB 2R4RH 5L8LB 5IB4A 1OP3K 4FQLH 1D5XA 1UEYA 2EYSA 1J0KA 2LTQC 4PJBA 1WSST 2HFFB 4APQA 1T3FB 4RFNB 1KBGH 4X83A 3U4BL 1LDPH 3KYNB 4YXHH 5C0EA 1MCOL 4MJIA 5DQ9A 4ZSOB 5DR5L 3UJJL 1ZA6A 3KNBA 4M48H 1IGYB 1BVKB 2YPKA 1N5AB 2Q8BL 2BMKA 1F13A 4CJ0A 1GJIA 1G6RB 5DGQA 2X44D 2YRZA 4ELMA 1X7QA 4U1NA 4XP5L 5I73B 5SX5H 4PIRF 4LSPH 2NW2B 4TQEH 3FONA 3LN5A 1CD1B 5IQ7H 4ZPVA 3ULUH 1NGQH 2H3NB 3BEVB 2WWKT 1BPVA 4G42B 2K9UA 2FX9H 1EBAA 1A0QL 1G0DA 1IGCH 2W0FB 4H8WL 2MQCA 2O5XL 3RBGA 5J8OA 1LILA 3QA3A 5FAAA 4POZC 5JOEA 4L3EA 3JZ7A 1JNLL 3GSNH 3B9AA 5F9WB 3X3GL 2W65B 5I1JH 1ZEAH 1DDHB 1T3FA 1FYTD 3MRMB 2CKBH 5CGMA 1RZGB 4L1HA 5ALCH 3G08B 2VMFA 5EA0H 3MRKB 1QFWH 2O5YH 3ZZ1A 4O4YH 2ADGA 6FABH 5CHNB 4KKNA 4WO4D 2R1WB 3SE9L 1IGYA 4JN2B 1BVKA 3U30C 4HWUA 3W9DA 4ODUB 1MCDA 1G6RA 4OF8A 4G8FB 1FNGB 4NO5B 5TH2B 2EIEA 1IAIL 4KAQL 4PLJC 1QLEH 3MA7B 1CD1A 2GW5A 5DJCA 3VFTA 4JGUA 2H3NA 1KF9B 4V2BA 4R96B 4G42A 5J1SC 4IMKC 1YNLH 3IS1X 5E2WH 5I9QB 4KGLA 4Z95L 2DMKA 3U83A 1CE1L 1Z9OA 3MRCA 3MLTB 1AO7B 1S7SB 2H2PC 2NW3A 2VUYA 1LK3H 3HZYB 4X7TA 5E2UH 1MFDH 1QLRB 2Z91B 4O2CB 4XPBH 2D03H 1HXMB 4Q2ZB 4MQTB 1N0XH 1DDHA 3OKKA 4OFIA 1RZ8A 3EBAA 1MCIA 3G08A 3ZL4H 4MA3B 5L7XL 2VABA 5DMYA 1LP9F 2A74B 1XF2B 2DWDA 4WDIB 4NPYA 2RGSA 5ITBH 4PJIB 5CHNA 2OTUB 3K74B 2JJUA 1NMBH 1WAAF 3QUZD 4NN6B 1RJCA 2OJZH 1LWRA 4P48A 1F58H 5SWZB 5TH2A 3MRIB 4RRPG 3TA3D 4EUPB 1KOAA 1BM3H 1ZVHA 4TSCH 4GAYA 3RPIB 1GSMA 1G9NH 1ZLUK 2DI9A 5CUSH 2BY1A 4DN4H 1KFAH 3Q1SL 2AJ3B 2P7TB 4G80B 5KVDL 3O4LB 5HHXL 1YN6B 4L3CB 2XWJB 4LKXB 4E0RB 3GMNB 2FJHB 3RZCB 2ICWI 1S7SA 4HWBL 4YBLB 3FRPG 4LCCA 5I8OL 2YPVL 4J12A 3QUMB 5ESAA 2X4OB 1QHOA 4LGPB 1P9MA 3H6JA 3MREB 5T1DH 2X4SB 1YUHB 3HG1B 4EI6A 4U33A 2NTFA 4MA3A 5IHUH 3VXSE 2C3WA 2A74A 2DIJA 2PTTB 4XPGL 3W11C 1AD9B 4OLVL 4TVPE 1HXYA 2Y5TB 2OTUA 2PYEA 3KWWA 1MRDH 5EC2B 5D7KE 3QRGH 1CR9H 5GS3A 2BSRB 2NY3B 4DUWA 2P8LB 2R2CA 4OM1H 4D3CH 4KMQA 5SWZA 3PWVB 3WE6B 3MRIA 4UV7L 4EUPA 2EC8A 3UC0L 5D1ZB 4RIRB 3MO1A 1YY9C 5DD0H 3BX7C 3KPNB 4Y19D 1L6ZA 5KJRL 5T3ZE 2AJ3A 4G80A 4J4PC 4CBPA 1NH6A 4LVOB 5C6PB 3IVKB 1YN6A 2H45A 4L3CA 3TBWB 5C86A 1T1YA 2FJHA 3RZCA 5F9JB 4Z76A 1E4XL 3P4LA 4DEPB 3V4PH 5DUPH 2X4OA 1X44A 3MREA 3DYOA 5J7CC 1PEZA 3HB3C 4L8CB 4PJDB 3ZYJA 1FIEA 4DCQA 4E41B 1NLDL 1AD9A 2YWYA 4OCSH 2Y5TA 4ONHB 5EC2A 2GY7B 4PY7A 4YHKL 3I9GL 3UPCA 3VWKB 1YEHL 2D9QB 2QQLL 2P8LA 2KBGA 4P3CL 4XVSL 2FJFA 3REVA 3W9EA 1E28B 2ZSWA 3PWVA 4RMWA 4BZ2H 1YNKL 4OZFH 1NAMA 1TVBB 4UQ3B 5DMIH 5HXMA 3EJYD 4G6FB 2CUMA 5CEXB 1PY9A 1AHWC 4K7FB 5FYJD 4C4KT 5IBUB 2OTWA 4JVPA 3KPNA 1QFWI 1N2RB 4WW2F 1FYTA 2OP4H 2QKIB 4HKJB 3IVKA 2FH6A 3GHBL 2DQEL 3IDXL 1A7RH 2A9NH 1KULA 1NCBH 3GSOA 4XMLL 3GJFK 4JR9L 3EDJA 3BT2L 1ZVSB 5CZVH 5F9JA 5DS8B 1XGYH 1HILB 4Y1AB 1K2DB 3BGFC 4QOKE 4XMKL 3UEZA 4L8CA 2XN9D 3MLVH 1I3GL 1N3NB 4PJDA 3EJZC 3MPCA 3BAEH 4LGSB 1OHQA 4HZAA 1CGWA 3K8MA 1RIVL 5B38B 3CFJB 4H26B 1C1EL 4PP2B 3H3PH 4XVUD 5GGTH 4BSWB 2FGWL 3C60D 1VFMA 4WEBH 3MX0A 4EIZC 1CN4A 1NBVH 1E28A 3Q5YA 5L0QC 3KDMB 4FQHB 3GZKA 2Q3ZA 1TVBA 1Z3GL 4UQ3A 1U0QA 2XTJB 3B5TA 4FQ2L 5TE4H 4AEHL 1KCVH 5FUCC 5HYJE 5KG9B 5F7HA 1MWAB 3HZVB 4P9HL 1IBGL 2CRMA 3UAJC 4Z7WA 3MOBL 5J6HA 3NA9H 2PW1B 2PR4H 1N2RA 1SJVA 2DMCA 1WZKA 5FHAH 2QKIA 3HC3L 4LLVB 3DXAE 4ZUTB 3EFDL 4KUCD 4JQIH 3KLHD 2VKXA 5DS8A 1OTUD 2IQ9L 1S7UB 4RAHA 1AFVH 1AGEB 2VDLL 4Y2DB 3QUZA 1K2DA 2EXWD 3CLFL 2Y36L 4TNWK 4J1UB 3VFRB 1N3NA 4MLSA 5MENE 1AC6A 4I5BB 4GKZB 1FAIL 2XRAH 5B38A 3CFJA 3WNLA 4CDGC 2Y7QB 4PP2A 3VI3F 1MHHA 5HDQL 4YE4H 3DVFA 4WI4A 4P5TB 4FQHA 3RWCB 5AYQA 4LLQB 1R3JA 4Y4FB 3VGAC 5KG9A 1MWAA 1MH5B 2G9HB 3OGCA 2CDGB 2P5WD 1RUKL 5CIPA 5MEQB 2PW1A 5CFHA 2G2RA 1NSNL 5IB2A 4K3JH 4C56D 4PRIB 4LLVA 3NGBC 3RL1B 3L3OB 5CINH 2YOCA 3SJVD 3NZ8B 1DANU 2VXUL 1MCFA 1ZSDB 4Y2DA 3TCXA 1IAKA 5IJKC 3QEQD 1CFBA 1DSFH 4J1UA 4EI5B 3RFZC 3VFRA 4ZTOL 2DBLH 3QEUA 2ICES 1L7IL 3VRLE 1QBMH 4I5BA 4GKZA 1P4BL 4FNLH 1WFTA 1KCRH 1MUJA 5BV7H 4N1HB 2Y7QA 4PJFA 2F19H 3KPOB 3WUWB 4AENB 5IVZB 4PY8I 5C0CD 4Y19A 5JHDE 1CDCA 4NDMB 4HD9A 4BH8B 5GGSY 4LNVA 4I3RL 4DQOH 1JN6B 2JB6A 5CMAB 1DBMH 3RWCA 4KROC 4WNQA 3G5ZA 4LLQA 4FMKA 4OM0H 4JPKH 4TVPL 2CR3A 2MPAH 1ND0B 5KOMC 2CDGA 3LDBC 3B9VA 5E70A 2NZ9D 3QIWD 3QPXL 5E8PB 2ZCKL 5T1MA 4JDTH 2XN9B 4S2SA 4GRLB 1VACB 3F7YB 2B1AL 4R26L 4Q9RL 3NZ8A 2Z31B 5DTFB 3VFMB 5D2NB 5FO7B 4KK9C 4XCCL 1X5FA 1K5NA 4PRHE 5H37H 1MPAH 1MEXL 1ZSDA 5DD5H 3WFZA 3DI2B 3ZMRA 1KCUL 2KZ1B 2ICWB 4HPOH 4OI8A 5J6GB 1QRKA 1IKFH 4X9HA 4MVBD 5C0NC 1MCPL 2Q3AA 3MBEB 5EUOB 3V6OA 5KTEL 1ZT7B 2AJVL 2JJSC 4YHNB 3WUWA 1AJ7L 4AENA 2ZCLL 5IVZA 5L8JB 4ODSH 4NDMA 3JWOH 3P9MB 5C0BD 4LGRB 5IKCB 4KDWA 3GIZL 1JN6A 1EO8L 5C1MB 1NEZG 2WWMC 5C0DB 4EXKA 2HAZA 2HWZH 2XG5A 2FX7H 4I3SL 2O93L 4FFWC 4ZUWB 5EZIL 3DGGA 1FYHB 5E8PA 2OLDA 2EH7H 2JCCB 2XN9A 5IBTL 1RUAH 1O5DT 4NM4H 5C3TA 3B3IB 2VL4A 5HDLA 1MFNA 2P46B 1H5BA 2Z31A 1TITA 1UM5L 5DTFA 1VFAA 1F4WL 5FO7A 4M6NL 5JQHC 1Y6MR 2DQIH 3C60A 4GG6B 5GRUL 1LGVA 3TO2B 3SDDD 5C0RH 1QFPA 4LSVL 5J6GA 3CXHJ 3QXWA 4IRSD 2AEQL 3EO1B 5IMKB 1GZQB 5IMMB 4EQ3A 2P47B 5EUOA 4TRPL 1N6QL 1ZT7A 3MCLH 4U1SA 4HS6B 4PG9A 4YHNA 2HVKB 4IMLA 2WWKO 3RQ3A 2MTPA 1S9YB 1DEEB 3P9MA 2J5LB 1W2KT 1RVFH 4BQ9A 3DUHA 3K8KA 5T33L 2V7HA 3FOLB 5C0DA 4YDIH 1A3RH 4NNYB 1HZHL 1Z0NA 5JIHA 3UTOA 3Q6GH 4RWYL 5D4QA 4B7LA 1U58B 3G5VB 3K2UH 4JJHA 2ZUWA 3OV6A 3WIIL 5JQ6L 1SJXA 3LKPA 4Z0BH 1VA9A 5GXBB 4LDLB 1UENA 4N0YH 4JM2D 3NCYS 4W6YB 3WD5H 4R7DA 2ESVB 4F2MA 5C71A 5KSBE 4LAQH 2QADC 2JIXD 1OP5H 3DURB 1H3PL 2E27L 4U7KA 1RIUL 2APBA 3O4OC 4ZUVA 2NMSA 3U46B 4GG6A 1F11A 4X9BA 1P53A 1KIQB 5DMGC 4YUEH 1SBSH 4G6KH 2E7LC 4Z7UE 1JUFA 5IMMA 4JHAH 5HGAB 1IC7L 4L29B 5DZOA 3MV9D 2P5WA 5CZXC 4LK4A 5T3XD 3KLAA 2X9YA 1S9YA 1DEEA 3TN0B 3U1SH 1WWBX 4AQOA 4M03A 3DX8A 4O58L 1QACA 3LEVH 4C56A 1ULVA 3C2AH 4XH2B 3FOLA 5C0AE 4OCMC 4NNYA 3CZFB 1JWUA 3SJVA 1U8MB 3T3MF 1U92B 3KXFE 3HRPA 1U58A 1Y6NR 3G5VA 5D8JH 1QRNE 2NY4D 5KVFL 4U0QB 3QEQA 2BOCA 4WWKC 4LQFL 2WBKA 5D2LB 4W6XB 2X1XR 4KRPC 5D7JC 1DBKH 4H0HB 4OGXL 4MA8H 3DHMA 4WI5A 3DURA 1UWGH 3KLDA 5C0CA 2J3SA 2FECI 3FQTA 2F54E 1JFQH 3S36L 1GVIA 1INQB 5I1EL 1AE6L 1KIQA 5B4MC 1EFQA 4OAWB 4JFHE 2VDPL 1YEGL 3MLWH 1HN1A 2V17L 5HGAA 2ZUXA 2V5TA 43C9B 3B9KB 1G0XA 3T3PF 1YYMH 3NFPA 4J8RA 3LN9A 3QIWA 3JWDH 1E4KA 4HF5H 3TN0A 2EO1A 1ADQA 1DBBL 3TVMD 2EEAA 3JV6B 5F7DA 1MQ8A 2AKRA 1LK2B 5JXED 3QXDB 1U8MA 1A1OB 5FA4B 4G9FB 3C08H 3WJJC 4IDJH 4OV5A 3AUVA 1S9XB 3V0VB 3L7FA 4OD2B 1NJ9B 1RZIA 4D2NA 2CIIB 1AIFB 4N9GA 5D2LA 5EU5B 5E5RB 1M7DB 1EERB 2VH5H 3MR9A 4NQED 5SWSD 3MUGB 5DMKB 4I4WB 4FZEL 1A7OL 5FYKU 1CLOL 4XAWL 3ZKMC 2M26A 1QSFE 3O2VL 5C0BA 3OSKA 4NKIH 1FL5A 4EN3D 3R8BB 4RFNC 3H0TB 1A14L 4YFLI 4F7EB 4U31A 4DTGH 1N5YL 2GAZB 3BN9C 3RKDC 4CMMA 4GXVL 3O3AB 2KQNA 1F6FB 4MXQD 4XNYL 5EWIH 3QO0B 2VITB 3OJMB 3Q5TA 4LRIA 4NT6B 1AQKL 4PRPE 4HT1H 1FG2B 2FYYB 3W0WE 4LCYB 2D9CA 3RBSA 5JHLH 1JNJA 1AGDB 4NO3B 4JM2B 1KJVA 3VXTA 3TIDB 5I73C 3GI8H 4K3GA 1A1OA 3UYOD 5FA4A 4PRBB 4OF7A 3IU3B 2CUHA 3LVEA 1S9XA 4KJPD 3V0VA 4OD2A 1NJ9A 3SDDA 2VR9A 2CIIA 1AIFA 4OGYH 1QOKA 1M7DA 2X9WA 5D72H 2HT2D 3MUGA 3RU8H 5MERB 5LCVH 1SJEB 5E2TL 4UT7L 2R2EB 4MS8D 5F9WC 35C8H 2YBRA 3RUGA 5HVHB 3DX7A 3QIBD 3G6AB 2VZUA 1OLLA 3TO4D 1U8NA 4FTVB 4F7EA 4A2LA 4H1LG 2FR4B 2YPLD 3KPMA 5TE7H 5DRXB 5IB3A 3QO0A 2NY4B 4NRXB 2VITA 2X4NA 2ICWJ 2EE6A 4C4KO 2VLMD 4LCYA 3HUJB 3WFBH 4JM2A 5C0JB 2W0KA 3HCVB 1ZLWH 3TIDA 5HI3D 2YUXA 5IW6B 1H3UA 3UXFA 4Q9QL 2JIXA 2F5AH 4NNPH 4L5FL 3BH8B 1N7ML 3PXHA 4PRBA 3WXVL 2J4WL 3IU3A 1T7XA 1A64A 1NAMH 3TYFB 4D9RE 1DLFH 4MNQD 3S36X 1E6JH 1D9KD 5I9QC 2YD3A 4HUUB 3ESVF 5IVXA 1NKOA 4Z7NF 2AJXH 5MERA 4UDTB 3HR5A 5ALBH 2V7NA 2R2EA 4HUNB 1DQDH 3MV9A 2PXYB 3WIHH 3DUUB 2CLZB 3BFOA 3TVMB 1LO0L 1TFHA 4GXUN 1VADB 4FTVA 5CP7B 3QG7L 3SKOA 2FR4A 4LFHG 2X4RB 1ED3A 3TNMB 1Z0MA 5ETUA 1NFIA 1B0RB 5IGXH 4NN6C 1WT5A 2DDQH 1WTGT 2DQCL 3HUJA 5KVEH 1FJ1A 3QSKB 5C0JA 1J1PH 3O6KL 5I19H 3RNKA 3GFUA 4NQEB 5ESQB 5IW6A 1A5FL 4N5EC 2DQJL 4P2RD 3BO8B 1IQWL 1XGQB 3TBVA 4LIQH 4YHOL 2A9MH 2B2XL 4Z77B 4Z6AT 2IG2H 5D70L 1FFNB 3QPQC 3STZA 1JZ8A 2V5YA 4M93B 2R4SH 4CU7A 3GMLB 1CXIA 4G8GE 3RZCC 1U3HB 2G75B 4YBLC 3SGJC 3QJHB 2J6EH 3CSBA 12E8H 2BCKB 2EECA 2HVJA 1Z9SA 1T2QL 2JCCF 4LPVA 3TVMA 4YDKH 4KKBC 4WHDA 4ODHH 5CP7A 4OZIE 2EIZB 2BNQE 3KAAA 5JXEA 5FUZH 3ULSB 4Z7VE 4FQ1L 3JSSA 5A1AA 5CSZB 5A2IH 1NL0H 1N8ZA 5C0GA 1B0RA 2NY3C 3T77B 5ESQA 4NQEA 2DKUA 5SWSA 3ULUF 2KL6A 3VD3A 3HS0B 1F3RB 1NC4B 4POYA 5D1ZC 3MNZB 1CXFA 5C07B 2CDFB 4EN3A 1Q0XH 1FFNA 4DAGH 1WJ3A 1OT1A 1AKJB 5CIPH 5C09E 4LVOC 3QJFB 5JOFA 4X4MA 4N0CD 5DFWH 3AY4C 2UWEE 3GMLA 1FVDB 2G75A 1EX0A 1VFBA 3MRQB 2BCKA 4DEPC 1YMHB 2E6JA 1YN7A 4XTRD 4WTZA 4O02L 3GO1H 3C6SB 4NC1C 4NHCH 1T1ZB 1XR9B 4MD4B 5C8JB 1QLFB 2HRPH 4ODTL 4Y4HB 4S1RH 2H26A 3A6BH 4UU9B 3VWKC 3WFCL 2VDMH 4X6DF 1D9KB 3ZSTA 3T77A 1LO4H 4GAJL 4Z8FH 1E27A 1B4JH 3LS4L 2YKLL 3OKDA 1LEIB 2Z8VC 3S6CA 2EDKA 4XXDB 4HUXB 1G1CA 2A1WL 2BVEA 1YZZA 3PGFH 4K3EH 2IBZX 4U1IB 3BVNB 3MNZA 2VUOA 2CDFA 1KENL 2CJUH 3QIBA 4AIXA 4EIGB 2XICA 2WBJB 1CGYA 1AKJA 4WEUD 1R24B 2YPLA 3QJFA 4F8TA 1YEJH 2DQGH 2OM5A 1AY1H 4OCXL 3FT4B 5GRVL 2CKNA 1YPZB 5D71H 3CVHL 2FRGP 3V52H 5HHQB 5LAXA 3ILQD 3MRQA 5E4EB 5DHYB 2G60L 3N1MC 1YMHA 3NN8B 3QCTL 2VXVH 4JFDD 1FORH 4M6AA 4RAVB 4XP6L 5FO8B 3LQAH 2OXGA 3C6SA 4PJ9D 5FUCE 4P2RB 1T1ZA 1XR9A 4MD4A 5C8JA 5JORB 4F7TA 3D69B 4HV8B 5F9DC 3ETBF 1RZ7H 2QQKH 4FQXB 3O11B 4CMHB 4IOSD 3BP4B 3BPNB 1D9KA 1WLHA 1JJUA 1EUTA 4F3FB 5JDSB 4HZLB 4KVCH 1E4JA 5GGUB 4JANA 4XXCC 2Z92B 4JZOB 5GRVK 2A77L 2XTJC 4XXDA 4GSDL 2IPTH 3BVNA 4M02A 2K1MA 4ZXBB 1I1AB 3RIAF 1G7MB 3OR7B 3BP6B 1O7VA 3X11B 1BQLL 4XC1L 4YX2L 4HFWB 5DZLA 4NJ9H 3T4YA 4PY8J 3OPZH 2IANE 3WNOA 2W9LA 4ETYA 2ITCB 2ZOLB 3FT4A 5D6CB 1IFHL 4AH2B 5HHQA 3HE7D 2OYPA 4Y2DC 5DHYA 1EJOH 3NN8A 4DUXA 3ROOA 2BFVH 4RAVA 4Y0GA 5I1HL 2IQAA 4QKXB 4G7VH 2A83A 4AG4H 4HUMB 4P2RA 4JFZL 2YN3A 4QHLB 4JFOA 2GI7A 5JORA 1MCEA 1J10A 5GHWL 1NCWL 2IGFL 3QP3A 4PJHB 4FQXA 1Q9OA 3O11A 3F6IA 3GSQA 2NY1D 3BP4A 4PJXA 4JKPH 2CDEA 4HZLA 4JHZA 3T2OA 3AB0B 2ENSA 5GGUA 4P5TC 3D39D 3LY6A 2Z92A 1KLUB 2R1YA 4MA7L 4QTHB 3QXUA 4MNGE 4Y4FC 5J1AB 1NLBL 2A73A 4GRMA 3QUXD 4PJAA 2VYRE 2C3XA 1JZ6A 2F58H 3BP6A 4OGAD 1F4HA 4RAUB 4HFWA 5F3BB 1XGPA 4PRDB 2VLJD 4Q0XL 1VEMA 3D9AL 2ATKB 2KPNA 4P5KB 4LF3A 4K7PL 5CEZL 3DECA 3JUZA 2YMXL 1RUQL 4QHNB 1QQDA 4Z0XB 4JPIB 5F7EL 1HEZB 5KBNC 4YDLB 3FOMB 1S9VA 3L3DB 3RVWC 1RJYB 4U1LA 4M1GH 4EI5C 4FXLA 4QTIL 2F53E 4OLZL 4DW2L 1TQBB 2P49B 4HULB 1EK3A 3C5JA 3E3QE 4LASH 3EJYC 2GSIB 1R3IH 4ZNEA 4PJHA 5FFLA 4GRWH 2HH0H 1D5BA 4ELKA 3WJLA 4G5ZH 2FBJL 4ONFL 3PUCA 4LDEB 2B5IB 4AJ0A 4OD3H 5DUML 2JK5A 3PE9A 4K94C 3O6FB 4QTHA 3ILPA 1K8IA 5J1AA 5L88L 3HNSL 3I2CH 4JKMA 5CSGA 4OB5H 5A43C 5JW4N 1WEJH 4JFDB 4NM8L 3RHWF 3UTTB 2ZUVA 3DROB 2VDKH 4OLYH 2LVEA 4QRRB 1KYOJ 4M7JH 4GRLC 4W70A 4PR5A 1GAFH 4XBPB 2Z31C 3GI9L 3MV8D 1CGXA 4EQ2A 5D2NC 4YNYA 4XVUC 1UJTA 2CK0L 2VB5A 3NCJL 1N64H 1L0YA 5FXCH 1RJYA 1ORSB 1VGEH 2VTFA 5LVEA 4HXBL 4KKCC 4ZTPH 4AEIH 5EU6B 1NMAH 5GZOD 5HHMB 2NXZD 2QEJA 3HAEA 3MBEC 5DO2C 2GSIA 3IDYB 3D25A 2O61A 5F72S 4MXVE 4LVNB 1CF8L 3WDIA 2XQBL 1R5WA 4NRYB 2WZPD 5EOCH 3MLYL 2ZCHL 2HYMA 1CXHA 5ANMA 1CFTB 3S37H 3BDBA 2RFXB 1YY8A 3QAZB 1XF5A 1YEKH 1F90H 1IQDB 1CYGA 1OTUC 4TPRL 3FHAA 3KPQA 2DLGA 2AXHA 1BFTA 3VXRE 4JFDA 1Q72L 1UWXH 2D0HA 4X99B 3HC0B 5D7IB 3TIEB 3DROA 4PJ9A 3CSYB 1E4WL 4XBPA 3FN0H 1CK0H 4DFHA 4HBCL 3QHFH 2NY1B 4O00A 3FB6B 2E7MA 5C92A 3ARFD 5EU6A 4DGYL 3F5WB 5IW3A 1AQDB 5L8KB 2ERJB 3QQNA 5IM7B 4MNHA 5E8EB 4LEXH 4S1SL 3TPUB 1MRFH 1SMAA 1I7RA 3CFDB 2BY3A 1OM3L 2BNRB 4HPYL 4NRYA 5GGVY 2J5LC 3PWPD 4EDWH 2I9TA 3BPOB 4JY6B 3T8XB 1KJMB 1NUNB 1TETL 2A0LD 4K7PX 3HE7A 1B90A 1IQDA 1ZXQA 4QGYA 4IHOB 4QRUB 4I2XA 4Q6IA 2Q76A 2AJUH 3RVUD 4JLRA 1EGJH 3LH2L 4FS0A 4G6JH 1DTUA 5E99L 3HC0A 5D7IA 1NDMA 1HQRB 2YN5A 1AR2A 1TTUA 2MHAB 3CSYA 1KLGB 1AXTL 5JR1L 5J3HD 3NIGF 4NZUL 3LS5H 5E9DE 1J11A 3SDXA 5I1CL 3DO7B 1MIMH 5F1IB 4HG4J 3KPPB 2EH8H 4N8CL 15C8H 1D6VH 4OZ4B 3LKRB 1FL6A 1OCWH 1JF5A 3D39A 2P42B 1U8OB 1VESA 5E8EA 4MQSB 3MRRB 5K9QG 2MJWA 5H8DA 5TPWL 3ZT7A 3QUXA 3V5DB 4M61A 2NZ9C 3TN0C 2VLJA 3Q0HA 3ARGD 4EDXB 4RDQF 2R29H 1ZVYA 2BX5A 1H3XA 2W0LA 2OJEA 4JO2L 1AR1D 1PG7W 4QWWD 2HLFC 2Y5EA 4OCWH 1M7IB 3IETB 4IHOA 2FDBP 2EZ0D 4OJFH 2OI9B 1C5CL 4XMPH 5LXGL 1A6ZB 3ZTJG 3ZE0F 1UVQB 1U3ZA 5ICYB 4MJIE 3W2DH 2MHAA 4Y16B 1KLGA 1QSEE 4ZPTB 3EDFA 3IXTA 2XZCL 5F8RC 3DO7A 1DFBL 1A6UL 2PTUA 1VEPA 4CVXB 2YWZA 5IBUG 4OCLC 4ELME 4NFDA 2D31B 5T5FL 3OB0K 3C6LB 1RSFA 3EOTH 3IT8D 4XP9L 1V3KA 2BVPB 5IK3B 5IWLA 3MRRA 1KIRB 4IOIB 4J6RL 5CBEA 4UILL 3B9KC 2Y6SD 3V5DA 3OAZK 5MEOB 4LRIC 1QEWB 1SM3L 2N7AA 4EDXA 4F7PA 3O2DA 3L5HA 2ZNXA 3MV8A 3I3BA 4YFLF 2YD1A 4HWBA 4YAQB 3IETA 3VI3E 3BZDA 1SQ2N 4P4RB 1K8DB 1FVEB 1NDGB 1A6ZA 1RV6X 3X17A 5A2KH 1UVQA 2VXTH 5ICYA 2GFBA 2YXFA 4ZSOE 1HKLH 4N8PA 4Y16A 1S7TB 3O9WB 5DXWA 3L3HB 1TENA 2PW2B 1S5IH 4CVXA 1FFPB 3V0WL 2BXZA 2EDTA 2ZOKA 2D31A 1KELH 3PWPB 4AMKH 4NQVB 3X12A 4PJBF 1DQLH 2L0DA 1JHLH 5BZWB 1T20B 2X70B 1GIGL 4B53A 2FBOJ 5FKAB 2DJUA 1HWHB 3HMXL 4IOIA 3Q6FA 3ARBB 5I30L 2DLIA 3R0NA 5MEOA 4ZFGH 1QEWA 4HKXA 2JKXA 4K3DL 5DF0A 4JM2C 3ARPA 3IKCB 4M43H 2H2SD 2HT3D 5C6TL 1OW0A 3RWHA 3IDJA 2EDWA 1V5JA 4N0UB 4OT1H 5F9AC 3VXSD 3HRZB 4YAQA 5D6DA 1UCTA 4P9MH 2HJKA 4TVPD 3ARFA 2E9WA 4JB9H 3V7AG 5CLWA 2ARJB 1G0YR 1KB9J 1P1ZB 2GT9B 4YEEA 3JXAA 1MLBB 1X9QA 4CN6A 4K07A 1GGBH 1IAIM 2A6KB 2ZSVA 3LRGA 5HY9A 1S7TA 3GJFA 1ES0A 3L3HA 2XFXB 2PW2A 1PVHA 1I7TB 3OWEA 1W0YT 4U6VL 5E94B 5HVHC 3PWPA 5MEPB 4NQVA 1EHLL 4DVRL 2EE3A 1T20A 2VISA 5ECJE 2HJFB 1Y18A 5FKAA 1OSZA 3ARBA 3DYMA 2NY4C 4P57A 2DD8L 1XMWA 1P84J 5E2VH 3VFOA 4QXGL 1MI5B 1P4LB 2MNUA 3V6BR 1DBJH 3QHZL 3IKCA 1AO7E 1KC5L 3LSOA 4M6MH 2VQ1B 1H8SA 4I77H 2O5ZH 5ILTL 2GCYB 5LKNA 4N0UA 1ZLSH 1IEBB 3WUWG 3OHXA 1S78C 4D0CB 2W1NA 2YD8A 4ALAL 5DEFA 1W72B 1JRHH 2W9DH 2ARJA 4KQ4L 2IPKA 2GT9A 3AS1A 5ITFB 5KW9L 1HQ4B 2A6KA 4PJIE 1WGOA 2C1PB 3E6HA 2AJYH 3O3DB 1VKXB 2PXYC 1I7TA 4HFUL 4MJ6B 1TTGA 5MEPA 1S5HB 5SWZE 3ARGA 4JFEB 2R15A 3TVMC 5L6YH 4M7LL 1CTNA 3U7AA 1S8DB 3SBWC 3P77A 1NCAL 3O6LH 2F5BL 1XGUB 4GMTH 1GC1C 2B1HL 3MRLB 5F7UA 4WENB 3O4LE 3UYPA 4BSJA 3UJTH 1SYSA 3RVTD 5LBSL 1ZLVH 4X4XB 3SE3C 4EBQL 5HI5C 3E2HB 4NKDB 1KEMH 1CLYH 2GCYA 5D5MF 3DWTA 4K3HA 4YC2B 4M62H 5B8CA 5ADOH 1JZ3A 4KJQC 1FZKA 4X4YB 1KB5L 1JV5B 4CADB 1CICD 1JCKA 1W72A 4KQ3L 3HG1E 2XA3A 1JNNL 4Z78B 4G8IA 1WC7A 5ITFA 3T2NL 1HQ4A 3B2VL 4M93C 4M00A 4UV4H 4CW1A 1YC8A 3GB7A 3QCVL 2C1PA 1F4YL 1FC2D 1ZS8B 1U3HC 1HIML 4LSSL 5D1QD 3VCLA 4KHXH 4TTDD 5BZDB 3BZEA 3OAYH 5HYJD 4KC3B 1WCBA 1I3VA 2VXSL 3D0VB 4JFEA 4NWTL 3CDFA 1EEZB 2FEDD 4K9EL 1UJ3B 1J0IA 1J1OL 1I8KA 1LO3H 3TBYB 1BMGA 1ITCA 1CGSH 3MRHB 2AABL 4J23A 3DXAD 4UNUA 1XGUA 2AXGB 1X5ZA 2JJWA 3PWNA 1FBIH 4LKCA 3MRLA 1U8HB 2ZJSL 1FGNH 1RUMH 4G9DB 2ZUYA 3DRQA 1CCZA 5FA3B 2CO6B 4I18A 4YHZH 3TC9A 5MEND 5K9KB 5DSCA 4M7ZB 1AI1H 3EYUL 1XAUA 2DTML 3CMOL 3L1OH 4G7YH 3LKOB 3WL9B 1IARB 3HMWH 4X4YA 4PJDE 2XY1A 4CADA 4YIQA 4X5LA 4KKAC 4NC1E 1JWMB 4Z78A 1QNZL 4E41E 5CJQL 1KCSL 1R3KB 1WZ1H 5EO9B 3T3ME 1QA9A 3DSFH 4YWGH 3TV3H 4JRWA 3KYAA 2D7PA 1H15B 1ZS8A 2IFFH 5TDOB 4P23B 4DVBA 3QZWB 4ZS7L 2BOBA 3WUZA 1MVUB 5BZDA 3NABH 4F58H 1MCBA 1LE5B 5CJBA 1EEZA 1UJ3A 4M7KH 3BRDA 4N5UA 3VG0L 2YXMA 5HGHB 5HPMB 1AGFB 3VXSA 2HTKC 4JFXB 4Y4HC 4XVTH 2I5YL 3IF1B 3ZKQD 2OX5A 4BFGA 4G9DA 1D9KC 1OAZH 2EDFA 2BNUA 4NQSA 1SHMA 2BP3A 3PL6D 4LL9A 3B6SB 4MCZB 3NACH 4LLYB 3UTSB 3E6FB 4Y1AE 1UH2A 5CKGA 1JHKL 3PHQA 3WL9A 1BOGB 2ZZUT 1QBLH 3QIUB 4U7SA 4ZD3H 4ZFFB 1JWMA 2WBJC 1DVFB 5JHDD 1FSKB 3LIZH 1R3KA 2BY0A 4DK3A 5SX4H 4S1QL 5IJVB 3U2SB 3L9RB 5TDOA 2DICA 4LSRL 1HHIB 2CSPA 3QEHB 5JZ7C 2UYLB 1FFRA 2FO4A 3NH7L 4F15B 5E4EC 4G43B 5GS2D 1OP3H 1I1FB 2WNGA 4ENEC 1LE5A 4UIMB 1A21A 2XTJE 4JFYB 5GIRB 3P30H 3K2MC 1U8JA 2VAAA 3MBXH 4DGIL 1DUZB 1JRHI 4JFXA 4ZS6C 2DQHL 3IF1A 4MJ5B 2FGZA 2IAMB 4EOWL 4EXPX 4FQXC 4PRHD 2E9JA 3L95B 4CMHC 4M1CD 5EB9A 3BPNC 1UQSA 5BXFB 7FABH 4X6CF 1TJGL 4OLWH 3WFEL 5BO1H 2R69L 3EYQC 4A6YH 4Q97A 1YEFH 4MCZA 3S35X 2YUVA 3OJDB 2LAAA 4ZXBC 1I1AC 1BOGA 4ZFFA 4I0CC 4FXGB 2C3GA 1IC5L 2VKWA 3U2SA 5IJVA 4P2CG 5F7MC 3L9RA 1V7ML 4R4ND 3S3PA 2HA1A 1FO0B 3VDBA 2DM4A 3U4BH 4WW1A 3V7AE 1P69B 1MFEL 4G43A 2H1PH 4NN5B 4HJJH 5DR5H 1I1FA 3LHPH 3QXAA 2EDQA 3BJLA 3T1FA 2Q8BH 1I8MA 3VA2C 4JFYA 2WM0A 4R6UA 4YQXL 4WI9A 3BWUC 1DUZA 4KH2A 1I9RH 3QNXB 4PFEA 4MJ5A 2IAMA 3D18B 1CLZL 3WV0A 1CICA 3N1PC 1UACL 3BGAA 4PRIE 4DJMA 1IL1A 2OXHA 1HI6B 4LU5L 3AB0C 3ECBB 4N0CC 2H8PB 1A0QH 2WUCL 3JWNC 4M9OA 5EC1B 1FH5L 2O5XH 2YSSA 3P9LB 5FK9A 1JPGB 3DETC 2FEEL 1D5ZA 5D1QA 1K4CB 3OJDA 3TJEL 2OS7A 5FYLD 1G7QB 4WI7A 5HYJA 3QNZB 3PP3K 4RCAA 1JNHB 3GRWH 3X3GH 3N9GL 4U6YA 4FXGA 2CLVB 3DXAA 5J4MA 1PZUB 3LQZA 3MZTA 4F8QA 3OG6B 3QUML 3VI4F 1R3LB 1U8LB 3DV4B 4JPVH 5GGQH 4YDLC 1RURL 1KJ2H 1CS6A 5I17A 5E6ID 5EUKA 4W81A 2C5DC 4FFVC 5F96H 3PL6B 1TQBC 1GRWA 2BZDA 5JO5A 4QRQB 2RHEA 3QNXA 5IG7A 1IAIH 1OF2B 3D18A 2RIKA 2XN9E 4KAQH 4PJFF 4RX4D 3SY0B 4RFOL 3X14A 5K59F 3GMQA 3IJSB 4XHJC 1HI6A 4H0IA 3WXWL 3WHE0 5D2NE 3BPLB 2B5IC 5IQ9B 3GSUA 5EC1A 4HS8L 3P9LA 3O6FC 1A7PH 3FL7A 1JPGA 3A67L 2WAHA 3L3IA 1CE1H 3ARRA 1G7QA 3SKNB 2D0GA 4JN1L 3QNZA 5HYIA 5INDB 2BC4A 4PGBA 1RFDL 1S3KL 1ZLUH 3WO3B 5ACLA 4PD4J 5EUOE 3E8UL 4NSKB 3PDDA 5IMLB 3MJ8B 4FQPA 5C0AD 2BHUA 3MRDB 1I3RB 3FQNB 4M5ZL 2BRQA 4OZHF 5DHVH 1JPTH 5L7XH 1R0AL 3KXFD 5FM5O 1QRND 3ES6A 3QWOB 5AUMB 4F7CA 3PL6A 1RUPL 3Q48A 2BDNH 1B6DA 4XVJL 1OAXH 1BF2A 3IDYC 1OF2A 1SY6L 1T22B 2JCCE 2J2ZA 5SX4I 3SY0A 4BH7B 1JGDA 4LVNC 2RBLA 2Q6WB 1YC7A 1BREA 1AC0A 5I1IL 5JHDA 3ULVH 2F54D 1UXSA 3S9DB 5J12B 4H8WC 3CXHK 3GSVB 3Q1SH 1DN0B 2JELL 2HKFL 4JFHD 5KVDH 5A3ID 3QAZC 5IFHL 4GG6E 3RWEB 4GXUM 1K9TA 3SKNA 5DC9B 5INDA 3ZKND 5I8OH 3RTQD 3UX9B 4YH6A 3T0EB 4ETQB 5EU7C 4OCRL 3U7WL 3MJ8A 4Z18A 3MRDA 3U9UB 4JCLA 3BPCB 1WV7T 4PRHA 4XPGH 5CCKL 2NY1C 2GTWB 3O41A 4G3YL 4RQQA 3UO1L 3QWOA 1GZPA 5K9JH 1KUMA 2AJZB 1QHPA 5AUMA 3TLRA 3I75A 5IB5B 5TE6L 2ERJC 3FZUC 3PGCA 5HGBA 2FWOB 1YEEL 1T22A 3MRNB 4UV7H 3BE1H 3P40A 4OGAC 4BH7A 2Q6WA 2R2HA 1IKNA 2ESVE 3BPOC 3FCTA 1DN0A 5KJRH 3KR3L 1F42A 4F7MB 1OLZA 1MWAL 3FAXA 3RWEA 2GSGB 4PRPD 3WHE1 3W0WD 4J3TA 4ETQA 4XP1H 1HNGA 2XKNA 5BOPA 1BEYL 4QXUL 3WYRA 3BPCA 2FB4L 2GTZB 4BZ1L 4X7DC 5JPMA 4PJ8B 1NLDH 4WWID 4H5SB 1NBYB 3ZO0A 1CXEA 2X1PA 3WLBA 4YHKH 2AJZA 3I9GH 1YEHH 4NCDA 2QQLH 3KVQA 1FL3A 2LQRA 2ED7A 1X5IA 5I74B 4FMFA 4P3CH 2AEPH 1KPUA 5SV4A 5KSAB 2FWOA 1YNKH 4GRWF 1TJHH 5EOCJ 4UNTA 3MRNA 5D2LE 3QEGL 4ODWA 2B39A 4QHUB 2IH1B 5E4IA 1I1CA 4PBXA 4JRXB 1IC1A 4X9FA 5L2JB 4RDQG 3GBML 5AD0B 1FE8L 4DKDC 1T7WA 4WI8A 1G7LA 2OQJB 3QULB 4F7MA 1UYWL 5IIEB 3GHBH 5EBGA 3DX6B 2HFGL 2DWEB 2OL3B 2OI9C 4JR9H 2AK4D 3BT2H 3SKJL 1MFCH 5E6IA 1B88A 1RULL 3B8YA 4OFDA 1IAII 1WISA 5GZOC 4R3SB 4XB8A 4Y16C 1I3GH 2H2PD 3TCLB 5KSBA 3EO0B 2GTZA 2VDNL 4PJ8A 1RIVH 4RX4A 1CLCA 1NBYA 4FN0A 3MOAL 1U9KA 5K9OB 5CD3A 4ISVA 4G8EB 2VLLB 1C1EH 3C5SA 3C6LC 4D9RD 1LO2L 2FGWH 2E7CA 4G9FE 4UDUB 2ADFL 4HKZB 1UA6L 3MRGB 3M1BA 1IGMH 3EHBC 4OKDA 5JDJA 1Z3GH 5DRZB 1G7IA 4WFHD 3W81A 4AEHH 4QHUA 1N0LA 2APVA 1MF2H 2IH1A 3DARA 5ENWB 5EIIB 1MFBH 5C0IA 4P9HH 1IBGH 5L2JA 2VN7A 5AD0A 2XY2A 3IGAB 4JDZB 1PKOA 3DVGA 3MOBH 4K94L 1Z9MA 4K8RC 2OQJA 1BQHB 1UEMA 1NGZB 1OW0C 3QULA 2V5RA 3HC3H 5IIEA 5KS9B 3LMJL 1S7VB 4J3WA 1C12B 5IHZB 5D6DC 3KXFA 5JW5A 1QRNA 4XGZB 1NGYA 2IQ9H 5FYJU 1HYRC 2X4UB 5DVNA 4Z5RB 2VDLH 4XPFL 1C5BL 3CLFH 2Y36H 4KV5F 3IS0X 3MJ9L 4GBXB 3O9WC 2XQYG 5CEZD 3EO0A 4LARL 3FB7B 4P4KB 2ATPB 4GQ9H 5K9OA 4H0GA 2F54A 1ZHBB 8CGTA 2BHZA 5I66B 1OWRM 3LEXB 2YS4A 2OCFD 5F6HI 4UDUA 5HDQH 3W11D 4C58B 4D0DB 3RDTB 3MRGA 5HJ3B 2PYFB 2A0LC 4LLWA 3ARBC 2WQ8A 1MCKA 4G8GD 5I1DB 3RVUC 5DRZA 2AQ3A 2LE9A 1F8TL 3FRUB 3NPZB 1N4XL 3RTQA 5EIIA 4YHML 2Y72A 1TIUA 3LKQB 4JY5H 3IU4L 3IGAA 4QT5B 3PHSA 5J3HC 1IGIH 1RI8A 4HJ0D 2BNQD 3OXSB 1C12A 5TQ0L 5IHZA 1G7JB 3IFNL 4ZODA 4NBZB 5C3LD 4FTVE 4XGZA 3CNKA 7CGTA 1KBGL 1T7VA 2X4UA 4J4PD 4FQJH 4LLDB 5INCA 3TWCH 3QBTB 4YFDB 5IHBA 3Q3GB 3VFGL 1LDPL 1NBZB 1WBXB 4KY1L 3EOYG 2NY0D 1RQ5A 4M3JA 4WI2A 4DFIA 2P45B 3TT3L 3AM8C 1XCQB 2Z35B 1L7IH 3MACL 1BOYA 3ARUA 4GLRH 1OD9A 4S0TD 2EKSB 3HUJE 4P4KA 2ATPA 4PTUA 1BJMA 4OLXH 4WTXA 3WKNA 3HB3D 3QDAA 4ZUUA 3RUGF 3QUYB 4LSPL 4M8VA 3LEXA 4TQEL 5ICXB 4QWWC 5IQ7L 5DJZB 2ARJQ 4I3RH 1T21B 3ULUL 3MLPA 2HKHL 1NGQL 2YD4A 3SCMB 4OUUB 3BKML 5I1DA 5EZJB 1RIHL 2AK4B 3FRUA 4PRPA 4TVPH 3W0WA 5ADPL 4GW4B 3DIFA 3QI9D 5EOTA 5F1NB 1T1XB 2GEEA 1HK6A 5C70A 4QT5A 3QPXH 4AYFA 3LN4B 2ZCKH 5BMFL 1P7KA 4YBQC 2B1AH 3INUL 4R26H 1VEOA 3WHXA 2XKUA 3U6RA 2CKBL 4LLDA 3LQAC 1MEXH 4YXKH 4LVHB 2WIIB 1F4XL 1VHPA 1KCUH 3WS3B 2EYTB 1WBXA 2DQUL 3BP7B 4NO2B 3OKOA 5I8EA 4O4YL 2AV7B 5IVXF 6FABL 1XCQA 5CZKA 4X4ZA 1U93A 5T3ZH 3CC5B 2L4OA 1TZHB 3N06B 3L5XH 4NNXB 5D1XC 5KTEH 2OZ4A 4MA1B 4TUKL 4NQEE 3E0GA 1AJ7H 4OZGB 2ZCLH 1PGRB 4HCRL 3H42L 5ICXA 2DM7A 5EU3A 1T21A 4HX1B 1S7RA 2W60A 1EO8H 3SCMA 1IC4H 2BXYA 3FB5B 3V6ZB 5DFVC 4IMKA 4I3SH 2AK4A 2X2YA 3IDIA 1ADQL 4JG1H 2BSTB 1JHTB 3A6CH 5E2JA 4PJ5B 5K93A 4OFYD 5F1NA 2MWCA 1T1XA 1RPQA 3E2HC 2IALB 3LN4A 4GMSL 5E03A 5IBTH 3ZE1E 5CS7A 3TNNA 1LK3L 3OG4B 4KK5C 2ADIB 2APTA 2D03L 1NGWB 4C83B 3LEYL 4MXWL 2XIDA 4KJWD 3KYKH 4F57H 1F4WH 4M6NH 3UTPE 4PRNB 1NEZA 2WIIA 2EYTA 4NO2A 4P59L 1M6OB 1T6WA 5FGSA 2AV7A 1KTDB 3CC5A 1OAUL 2AEQH 2PF6A 4NNXA 3SDYL 2V9QA 1W0VB 1ERNA 4OZGA 5CKAA 1UJ3C 2H2SC 5EN2A 1BM3L 4TSCL 1I85C 2A2QT 5LGHH 5T33H 2R0LL 3VXMB 5C07E 3REWB 5CUSL 1Q9WB 1HZHH 4IJ3B 4XPHH 4RWYH 3BHBB 2LFGA 2BSTA 3D2UD 3GBNL 4PB0H 1JHTA 1L9MA 1EDQA 3WIIH 5JQ6H 2NY0B 2IALA 1EFXD 3HZMA 1EUUA 4M7ZC 2ADIA 4C83A 2BHYA 1G7PA 1CFSB 1F02I 1W0WB 1T2JA 1R5IB 1OARH 4YK4C 4NZRL 5IHUL 4U6TA 4XNUL 4V2CB 3SN6N 3SKMB 1KTDA 3OZ9L 1CXKA 2UWEB 3QDJD 5IV2A 3QRGL 1CR9L 4G8GA 4P23C 1EO5A 4Q9CA 4WGVB 3RIAK 2DB8A 4OM1L 3UBXB 3PQYD 5FHBL 2X89D 2ZKHL 1MSPA 1IC7H 4X9IA 4D3CL 1XCTB 3AGVA 3QI9B 3OX8B 4LMQE 1UB6B 1LD9A 3P4NA 4O58H 2BNQA 4CRPA 4Z7VA 3CU7A 3PJSB 2WK2A 3JVGA 4JZNB 5DD6B 3P73B 4PJGB 3T0DA 3PIQB 3FQXA 5KVFH 2IBGA 2YEZB 3CK0L 4GLRI 1JL8A 5CJXA 1FDLH 3SQOH 1YPZE 5EG6C 3M45A 3S96B 2F53D 3GMPA 4MLIA 2V2TB 3NIFF 3CH1A 4WRLA 3AU1A 5C9JB 2HN7A 1CFSA 1W0WA 4HW6A 4U49A 3RWGB 2BVQB 3QIUC 4PJ7B 4ZDHB 3WO4B 5B39G 4P2RE 1DVFC 1FSKC 1DUYB 5GQBA 3S36H 4R4FH 4GKOA 2YD5A 1CBVL 4XBGB 4NQXB 3RX7A 1A4KA 2R1XA 4LFHD 3SKMA 3O6ML 4QY8B 4D9QE 2UWEA 4KK9D 4DKEH 2VDPH 1YEGH 3QO1B 3N1FC 2R9HC 4HSQA 2V17H 3EUUA 1D5MB 3UBXA 1BHGA 4JREB 4F15C 5IVNA 4JO1H 2X09A 4PYGA 2HLAB 4ONOA 4RGOH 3QI9A 3SEPA 3UPRB 3EAKA 5C0ND 2EDEA 3U4EB 5ICZB 1UB6A 1DBBH 4LRNL 4TUOA 3PJSA 4JVWA 5HYEA 3MUHL 2IAMC 4WCYL 4JJ5B 3I6GB 4JZNA 4PJGA 3PIQA 1RZJC 5JA9A 5JIIA 3KJ6L 2B0SH 2YEZA 2JJTA 1A7RL 2A9NL 3TZVB 5KZCD 1NCBL 2XT1B 4GFTB 1S9WB 4WIQA 3S96A 1IT9L 2F74A 3BIKA 2V2TA 2P1YA 1XGYL 4FFWD 4P49A 4TULH 2EXYC 1T66D 5IF0B 1UZ6F 4FZEH 1A7OH 4NKOB 4ZDHA 4XAWH 1QKZL 1M71B 3MNVA 1DUYA 3U36B 1N5YH 1A14H 4PJHE 4GOSA 1AGBB 3H3PL 4ZOCA 3QO1A 1ETZA 1SYVA 2PNDA 4GXVH 1D5MA 3MJ6A 4WEBL 4ZFOL 2VJXA 4XNYH 4NN5C 3D2UB 2HLAA 4OFYA 4KZDL 1YJDC 5GGSB 3ROLA 3VXRD 1AQKH 4ZYKA 1CL7L 4ESKA 3UPRA 2EIDA 3IDGB 4N8VB 3U4EA 1EFXB 5HI4D 4HUVA 2WV3A 4HIEB 2J88L 1GC1L 3DVIA 1A6TB 2WLZA 1MHEB 2KZWA 3K4DA 4X0KB 4JJ5A 5DJ2B 3FQUA 1Q0YH 3VJ6A 5C0FB 1I1YB 3V5HB 1AH1A 1URLA 3TZVA 1Q9KB 2VLKD 4O2FB 3MCKB 3ZTNL 1JBJA 3QDJB 2YA1A 3H9SB 5FO9B 1QVOA 1CZ8H 4MNGB 2LU4A 1WK0A 5IF0A 3PQYB 4KDTA 4PJAF 5E2TH 2DJSA 3ZDZE 4NKOA 4UT7H 3VH8B 5GPRA 3U36A 1YMMB 1A3LH 1J05B 4LLAA 2QADD 3S4SG 1JGLL 1R5VA 2AEWA 1AGBA 1FRGH 3NCEB 4XNQA 4YPGB 4D9LH 1SJHB 4AIOA 1DJSA 4PGEA 5B22A 5EBLB 3D2UA 5DMGD 5T5NF 2C7UB 1I7UA 1W8NA 4YBHA 1EFXA 3PL6C 3G9VA 1KYOK 1ZHNB 3MUZ1 4M6OH 2V9RA 1P4IL 3CUPB 5JIKA 2P8PA 1MHEA 4JFQA 4X0KA 4Q9QH 5CZXD 5E8DH 4HKBA 4L5FH 3MODL 2Z8WC 4LBEB 3UTTE 5DJ2A 5B3NA 3WXVH 2J4WH 4QRRE 5C0FA 1I1YA 4H1LA 1EAPA 2ZNWA 2R23B 3C8KA 5BS0B 5KSUB 1JPFB 3VFPB 3BPLC 3IXAA 5HGGS 1LP9B 5GJSH 4BK4A 3QDJA 3TJHD 3H9SA 3RI5F 3PP4L 5FO9A 1S7QB 3EYFA 5IJKA 4MNGA 1DSFL 1OPGH 4PBWD 3PQYA 2X89A 5EU6E 4O5LH 3BGMA 3VH8A 5HHME 4FNLL 4KRPD 5D7JD 1RJLB 5JLZB 1YMMA 1LO0H 3IDNB 2XYCA 1WWCA 2F19L 3LPFA 1RHHA 2OTPA 3QG7H 1WWAX 1JK8B 1PX3A 1OTTC 1FP5A 2QHRL 5EBLA 5B4MD 2FECL 5T1LB 3NIDE 1FGVL 1MNUL 3VXQA 2F53A 2DQCH 1ZHNA 4JPKL 3O6KH 3VFUA 2X7LB 4OIAA 4PJCB 1QSED 4ODVH 3GSWA 5C2UB 4BYHA 2DQJH 1U41A 3VXPB 1ZGLP 4LBEA 3HHRB 3G6JB 5D7IE 2X4QB 5EU7E 2MOVA 4KTDL 2B2XH 1J0YA 5J12C 1CIDA 1NANH 2R23A 5BS0A 5KSUA 1JPFA 5CSBA 2H32H 5E8NB 1LP9A 5F71A 2NY2B 5DD5L 1V05A 4XCFH 1S7QA 4NWUL 2YZ8A 1K4DB 1WAAA 3RZWA 5SWQB 5F88B 4YFEA 1MY7A 3WN5B 1L6XA 3S97C 3BIBX 5FB8B 4HC1L 3T0EC 1T2QH 1RJLA 5B3JF 5HHPA 4TSBL 2JJSA 3ZLQC 4HIIB 3UZEA 4KRMB 1BFVL 2BNRE 3ZKMD 4ODSL 1JK8A 3NOIA 5CWSB 4FQ1H 2X1QA 3WMSA 4OQTH 1L0QA 1MLCB 3MRJA 5FECA 3GM8A 2VLKB 5ACZB 2GITB 3BN9D 2HWZL 2CRIA 3C9NB 2FX7L 3FHQA 3RKDD 2EEDA 2Y1VA 3LKNB 1EJ6A 4PLOB 4Z7OF 3AS2A 1CDJA 3VXPA 1RUAL 2X4QA 5IESL 2QJDA 4WEMB 3TYGL 3FB8A 4MB5A 5JMOC 4I48B 4F33B 1KTLB 3T4AA 3ESUF 5E8NA 1XFPA 3QFJB 2KQMA 5MHSE 1T6VN 1I8IB 3R06B 2DQIL 2O26U 1EXUB 4HAFA 1K4DA 2XZZA 5F88A 2R2BA 1BQSA 2DQFB 1WQVT 5IMOA 3VXRA 4EEEA 4HBQA 5EORH 4HIIA 5DYOB 4O02H 3FO1A 5DJYB 1V8HA 4PJ8C 5CWSA 2D7TL 3SDXF 4L8BB 1MLCA 5HDBF 1I9IL 4LPYA 4WW2B 4YDIL 1DANT 2VLKA 3HPJA 4X80L 2GITA 4CAGA 5ACZA 1B4RA 4O2EB 3WFCH 3Q6GL 2IEPA 2R0WL 2C4XA 5I74C 4P5MB 3K2UL 1KT2B 2C1OB 2XQYK 4GAJH 1P7QB 5KSAC 3LS4H 3QZWG 3P0VL 2YKLH 2RQ8A 1SEBA 2A1WH 2Z8SA 1OB1B 2AAVA 3WD5L 3PWUB 1KENH 4LAQL 5EOQH 3F65A 1YECL 4OI9A 5E5MB 3AXLB 4XWOC 5F6HJ 2R56H 3R06A 1UM4L 4OCXH 1BIIA 5AZ2L 1FZMB 1GGCL 2AI0L 2YR3A 4YUEL 5DJXA 3CVHH 2DQFA 5DJAA 5DJ8B 3GJEB 2E7LA 1JGVL 1GYAA 2G60H 1BECA 4JHAL 4YHYB 3PXJA 3QCTH 3CSGA 4J3SA 5FF6B 1IEHA 3GM0A 1AO7D 4JG0H 5DYOA 3GSXB 3SGKA 5I8KH 4LCIL 4L8BA 4TUJB 5DQDH 3TH4T 3PHOB 4NJAL 5IOPB 4NKQB 1ZTXL 1OP5K 1BD2D 1DQQB 2CMRL 3C8HA 4P5MA 4P2QB 1KT2A 2C1OA 4L4VB 4Z9KB 4LOUC 3OJVC 1OSPL 1LNUB 3ULVF 2A77H 4HWNA 5DUBB 4GSDH 5DD3H 1ZANH 4Y5VB 5E56A 5CAYB 1OB1A 5CJ8A 5GGVH 4F9PA 4B5EA 4WUUB 3PWUA 1SEQH 1BQLH 4XC1H 4YX2H 5E5MA 1UWGL 2AK1H 1MJ8L 3AXLA 3MYJB 2A6JA 1MQKL 2VDRL 3PWPE 9CGTA 1DQML 1FZMA 3IAQA 4RMSA 4OF0A 3QPQD 2Y23A 3ARZA 2Q8AH 3O4LD 3MLWL 4I9WE 3OQ3B 2W9EL 1A7QL 5FF6A 1T1WB 1A6WL 1IM9B 4GBXC 5FGBA 3RZCD 2CRZA 3DVNA 4WY7H 3N85H 1QSEA 3GIVB 1YYML 5DDHB 3IRZA 3TFKC 4JFZH 1NANI 4JFFB 4YJZL 4C54A 4P4KC 5KVGL 1FNAA 4NUGH 4TUJA 5GHWH 1NCWH 4KKBD 1EV2E 4PTTB 2XWBB 3HG1D 4N0UE 4NHUA 3RGVB 3TBSB 2BRRH 1WZLA 3ARXA 4XP4L 3WJJA 3RDTC 4L4VA 4GW5B 4NRZA 5F7LB 3TT1L 3AS0A 2NY3D 3T2PA 1DBAL 1NLBH 4N9OB 1REIA 2VH5L 5AG8A 2AV1B 4ZFZB 2GJZA 3HI1B 3FO9B 2X1OA 4CN4A 4Q0XH 3D9AH 5D1ZD 4U0RB 3DRTB 4K7PH 5K59E 2YMXH 2WIMA 2HFFA 1RUQH 1P84K 4DTGL 2K3TA 5F7EH 3ZYOA 3KYNA 4HIXH 1IM9A 4ZSOA 1INEL 2IJ0C 4QTIH 3GIVA 4OLZH 4DW2H 1MI5E 3RAJH 1N5AA 4Y5XB 2XPGB 5FOBB 5JHLL 2FD6H 3U0WL 4PLKC 2EDXA 3T09A 2XWBA 4OI7A 3QUYC 3PG2A 1BAFL 2NW2A 3IDUA 4WFFE 4E41D 2FBJH 4ONFH 4BK5A 1L0XA 3SCMC 3KS0H 3TEUA 3BWAB 3BEVA