3SY5A

Crystal structure of the mutant s127a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor 6azaump
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMAHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of the mutant S127A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor 6azaUMP
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/inhibitor
total genus 83
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sy5A00
3Q37A 4IXXA 4UMAA 5BW6A 3C2RA 1WXJA 1ME7A 1W5PA 2O7SA 1KTCA 4GUJA 3TSDA 5AC6A 1HO1A 2H6RA 5G2WA 3I6RA 1QPNA 3SY5A 2QJHA 3HG2A 3IEBA 2H3DA 3P5ZA 3HPSA 4JTUA 3OHIA 4MFDA 5AB3A 1EPXA 3PWAA 3VNDA 3W2KA 1GTEA 3T55A 3L2IA 5CPOA 5EKYA 3MHFA 2GJLA 5D37A 5D30A 5D2VA 1GZGA 4LS2A 5AHEA 4XQ6A 5BMXA 4LU0A 2E5BA 2RDWA 4PTNA 2QJIA 1WDWA 3QYQA 2D73A 5GVJA 3N3MA 1W3NA 2CLOA 1W1ZA 2B4GA 1PCKA 3QPZA 4Z0SA 3B8DA 5BNKA 1KM3A 1VHNA 3EX6A 3LXAA 3P7YA 3TC7A 4DBEA 3ZWTA 3W7QA 4LVDA 3ZFHA 2A4AA 3KVMA 4ADSA 1RQBA 3N34A 3NA8A 1DKWA 2E6DA 3MW7A 1W3IA 5CG7A 4MKNA 2VFHA 3NQAA 1QCWA 3R2GA 3SGUA 4CNOA 4Z1DA 2G95A 5G1TA 1EWDA 4GXMA 4GUHA 5I3HA 1QO2A 1W5NA 3HBLA 1AG1O 3M0ZA 3KXQA 1GVOA 3TU9A 4YWIA 2QUVA 1LORA 1LP6A 4QQ3A 1XC4A 3GKAA 3NPXA 5F1VA 2B7NA 2WKJA 4OHQA 2ZZ5A 1UUOA 2DZUA 1KV8A 1Q6RA 3MP5A 3W23A 4JYFA 2Y61A 2C19A 1XXXA 4O1CA 2EAWA 4U28A 5K2ZA 4ORIA 3DGRA 5D33A 3MYPA 2OX1A 2Q8LA 5LNWA 1L2UA 5I3GA 3DH7A 4NU7A 5AHFA 5E1QA 3TDFA 2CLIA 4JGDA 3LHVA 3G24A 1IXQA 2NUWA 3E12A 3L66A 2FPYA 3SW6A 4C1LA 4HNUA 1KFLA 4Y9AA 5TIMA 4XKYB 3FKRA 2V2CA 1KFEA 1KFCA 4M19A 4CNPA 3BW3A 3UWWA 5D32A 3S1XA 3W1XA 1TRDA 2O7QA 2J27A 3R5EA 1LBLA 4EF8A 4FB7A 1G4PA 2E5DA 3OVQA 5ABTA 1SSGA 2CW6A 3KVKA 3FA5A 4ZQMA 1IGSA 1L6WA 3DXIA 3HGJA 3WJYA 2WSYA 4GC4A 1AL8A 4I7VA 3C8FA 2GQ9A 2B7OA 5MHBA 1EWEA 3W88A 4BI6A 5DY2A 1Q6OA 3EEGA 5HUPA 1I2RA 1B9BA 1V5XA 1W5OA 2GOUA 3P8IA 1VLIA 2C18A 3UZ5A 3KRUA 4AXKA 4X3ZA 3TV8A 3LOTA 3NM3A 4FEZA 3LB0A 4XKYA 4ZQOA 1KM4A 5E93A 5LKYA 2QCEA 2B7PA 3THAA 3ABQA 2DP3A 2HMCA 2ZTKA 3SFKA 3O05A 1OFPA 1IIGA 3TQKA 1ME8A 3MHUA 4O16A 3NPWA 3WK2A 5K3VA 1FUYA 5C55A 2C15A 3C6CA 1KA9F 5D2YA 4NXKA 2PE4A 3USBA 3E02A 2V0TA 3S6DA 1RVGA 3L67A 1SPQA 3F03K 1S3HA 4JICA 3A5VA 1RZMA 4IUOA 3N19B 4UIOA 3TK7A 2H90A 5K9CA 4KKXA 2VFFA 4RV8A 4IGHA 4ZMGA 4WOZA 3W7DA 1IXPA 3IGXA 3MP4A 3U8GA 1GYLA 3IIOA 2HSAA 3RMJA 3STCA 4NT0A 3P80A 3EXRA 3NL3A 4MLJA 3HPXA 5HWMA 1SFLA 3ABOA 4JTJA 4GUGA 3HGSA 5IBXA 2ZA1A 1OJXA 3G0SA 2C0AA 3DAQA 4GNJA 1F73A 5DELA 4A2SA 5CZTA 3MO7A 5HULA 5C6MA 1HUVA 3TFCA 1FX6A 3NQMA 1KBJA 1AK5A 4IWWA 1FXPA 4JEQA 2TRSA 4ONVA 1HFBA 5T26A 4BI7A 4QSHA 1QWGA 2I9EA 1W5QA 2P1FA 4FXRA 1VC4A 3UPWA 1OX4B 5D03A 1QFEA 2A85A 3NQDA 1JCMP 2X2GA 4DPPA 3JRKA 3QJAA 3OBKA 5HNRA 4N4QA 3EX2A 3W1QA 5CSRA 3NXFA 1YLVA 1VJIA 2BSLA 3GB6A 4ZL1A 4ORMA 3TAOA 2BLEA 4HSNA 2NUXA 4O10A 5HUOA 4AHOA 1KM5A 1H7NA 2G5WA 3QEZA 5DXYA 4ADUA 3MP3A 3THQA 1D9EA 1OX6A 1I8JA 1NFBA 2QCCA 3UWZA 1OFQA 1EX5A 1MSSA 1ZJIA 4UFKA 3P74A 5L9FA 5D2XA 4IMGA 1CX9A 3C2OA 5EY5A 2A6LA 2YXGA 1H50A 3PBVA 4K8EA 3HG4A 1OX4A 1LLWA 2HS8A 2KZHA 4LW7A 2WOQA 1HL2A 4O15A 2YCEA 4IPIA 3HGRA 3LRKA 1T8XA 4KWWA 5I3FA 4E0CA 2CLKA 4ALDA 4YCPA 1SO6A 2NXIA 3G1HA 5G5IA 3DHFA 4LRTA 1QOPA 4HNNA 3S5ZA 5K9XA 1SZFA 1TMHA 1F6KA 4RZ4A 3F4WA 4NJJA 5HMSA 4IMDA 1H51A 2XN0A 3IRDA 3W2JA 1X7FA 3QSTA 1KTBA 2Z0IA 2QCGA 4Y96A 4NJHA 3G1YA 4UTTC 2ZZ6A 3C4UA 3NR0A 3NZ1A 3HGOA 4JIPA 2WNNA 2Y7FA 1OABA 2TYSA 1T0OA 3S8HA 2E09A 3TJXA 1I4NA 3CEUA 2IQTA 3DHDA 2GPTA 2OT0A 3FEMA 4UUIA 1T96A 2JGYA 4U4MA 5BRBA 3U6WA 1GQNA 4FNPA 1Z42A 4DO6A 4O1BA 2GQAA 2FTPA 5D09A 4MY9A 1FDZA 3PC0A 3LCFA 1O5XA 3TFXA 1QPOA 3TR2A 3CPRA 3DZ1A 5FF0A 1WQ5A 3LRMA 3CLMA 3M44A 4LWWA 4I7UA 4Y8FA 5AYZA 5FF7A 4M6PA 3BVJA 3G1XA 2Y7DA 3PVFA 5G4EA 1ZAHA 2WSQA 1VCFA 4RZ5A 2C3ZA 1YDVA 2RHGA 2ABBA 3LHUA 3AO0A 1HTIA 1NEYA 3W74A 1VR6A 3R89A 4O14A 2E6AA 3SZ8A 4WQ6A 1G4TA 3EWYA 5AYXA 3W70A 3FYOA 4M5PA 1GG0A 1OK6A 2NX1A 4PCFA 1WX0A 3W1NA 3NG3A 3LHTA 5DBUA 1OK4A 3NVTA 1LTDA 4FNSA 1RQEA 2CFFA 4O19A 5FEXA 3FKKA 2FPTA 1TPH1 4A21A 3D0CA 1TIMA 2FFCA 3TSBA 3GXNA 3JS3A 3DFSA 2EPHA 1F5ZA 1TPC1 3Q94A 1R47A 3EWBX 1JCYA 2BTMA 2W79A 1L9WA 2Y62A 3LI0A 4WZHA 1K7EA 1LRNA 3GVGA 2ABAA 4UTJA 4WXZA 4LRSA 5F2MA 3KRSA 3HMJG 2G97A 4ZZ9A 3W7LA 3MUXA 1M5WA 3A24A 4KFOA 1PVNA 2WPBA 4Q33A 3S5YA 4JY8A 3W7JA 3N9RA 3U2OA 3HB9A 1OHLA 2X1TA 4TIMA 2E1DA 2Z1BA 4ICNA 4BR1A 2DU2A 3G3MA 3UXDA 5F1UA 3W6YA 3FIGA 4TMCA 4O11A 3W1TA 2QDHA 5CZJA 4OWGA 3JR2A 3MI6A 3PBYA 1TTJA 1LDCA 4UTWC 3DU0A 3S42A 4AH7A 3IGSA 4UMCA 3H53A 3LV5A 1OYCA 3ATYA 1LOSA 4NJKA 4QM1A 3TIMA 1ZAIA 1Y0EA 3I68A 3M5VA 4A29A 4X2RA 2QR6A 1G69A 5AC8A 4XZ9A 3A22A 1CW2A 3O15A 3RNDA 3GNNA 4RXFA 3FJ6A 1GOXA 2Q3RA 3Q58A 1G7VA 1JRBA 4NJGA 5CSSA 4UTMA 3F1QA 4OT7A 3RK8A 4UC5A 1UB3A 3WFAA 4DEFA 3TMLA 4YXGA 2YYTA 4HIBA 4R53A 3ZR4A 1H63A 3DFPA 1BEUA 1TCDA 2NXGA 3LERA 2J9YA 3CIXA 1KTNA 2J24A 2Y89A 4GE8A 2OJPA 2VFEA 3LV6A 4OE7A 6ALDA 4X22A 3TAKA 4IXHA 1T99A 3GR7A 2QJGA 4DO5A 4LS0A 3I7SA 3T40A 1YXDA 5CGQA 1FY6A 1SO3A 1TPVA 1KV5A 4S1FA 1ZY9A 1Q45A 3BARA 3HF3A 2LLEA 3L5AA 4O1DA 1NVMA 3PR2A 3FFSA 4UNLA 4UTHA 1O94A 4GRSA 3L68A 3IV3A 3LXCA 3EXTA 3O1NA 4IX0A 1F2JA 3BGGA 3LLFA 2J6XA 4PEKA 3WK1A 1JUKA 2FQIA 2JKEA 3V1PA 4FIRA 1AMKA 4P2VA 3STFA 4ADTA 4DPQA 1FWRA 2QCMA 1GEQA 1O95A 3UWVA 3LHWA 3W07A 2YX0A 3DFTA 3SI9A 3MYOA 2PRMA 1VYSX 1A5CA 4WXYA 3I7RA 1KW1A 2VEPA 1QOQA 2FB2A 1TYGA 3W7HA 2B7QA 3W86A 3W1PA 2OT1A 3TXZA 3VE7A 1YYAA 5KZEA 3BGJA 1EEPA 3GXTA 1JCXA 2XN2A 5DCEA 3CB8A 4JXCA 1K8ZA 4BK9A 3DI1A 3TNOA 4IMEA 3NDOA 4AF0B 2YZRA 1OYBA 2J9XA 1IF2A 4GWEA 5AC7A 1DQXA 1G7UA 5HQEA 2QUUA 2DZWA 2CLEA 3G1AA 4LVBA 4JR5A 4WOQA 4H4IA 4WD0A 2JKPA 2YR1A 4O50A 4LTSA 2WQPA 4HNTA 5KZMA 3NYZA 3FOKA 5KINA 4MJZA 4NNCA 3W1UA 4QISA 3NAVA 1C8VA 5K9DA 2E6YA 4IX2A 4O18A 4HN4A 3M5XA 5EPDA 4E2DA 4FNTA 3I7QA 5LSMA 3BLFA 5AHMA 3W7MA 1W5MA 4MPQA 4CNNA 3S1UA 3GDLA 3LCXA 3PUOA 3TCEA 3R12A 3W73A 3TQ0A 2OMAA 1WOBA 5AFDA 2WSRA 2A7NA 2ZCGA 1A5AA 1ADOA 4AF0A 5HR7A 1OG0A 1TV5A 1TV8A 2J88A 3QPYA 3DBPA 3S5OA 5H2ZA 1XFBA 1OX5A 3M47A 1BWLA 1SW0A 5E0KA 1KM2A 3M16A 2HTMA 2VELA 4YLWA 4PL1A 2QKFA 1WAUA 3BLEA 2Y63A 3NL6A 2DJXA 4AMAA 5A5WA 2ZRZA 3LCLA 2C6QA 1IIHA 3BG5A 4IQLA 3TX9A 3TROA 4KWVA 1YPIA 3T78A 2ZBTA 3CIWA 2C1HA 3LBMA 2BXVA 2PCQA 4M6QA 5J5DA 1JQXA 4OBTA 3TKFA 2QF7A 1EB3A 4GUFA 1G6CA 4LS1A 3QRHA 1JUEA 4R34A 4ZQPA 5HWJA 4XWUA 1P1XA 4MZ8A 1GYNA 1F74A 5H91A 2CU0A 1AW1A 1TTIA 3NQ8A 4TO8A 4UFIA 1XBVA 2VFDA 3GNDA 4FNRA 4LNYA 1EP3A 1N8FA 1THFD 3PG9A 2CLLA 3OEXA 3W71A 3C2VA 3IIVA 1GWJA 1LRQA 1X1OA 4RX0A 5AHIA 4IMCA 4BF9A 1FCVA 4XBSA 3C56A 2FDSA 4S2BA 5HJLA 2V9DA 3EX4A 5DCDA 5DXXA 3UZJA 1G4EA 3P82A 3KVLA 3MMTA 4E38A 4UTWA 5U4NA 2XFWA 4LVGA 2NZLA 4TX9A 4RLIA 1HG3A 1MO0A 2WNZA 5AYYA 3UWYA 3TW7A 1GT8A 2QUTA 3S0CA 3P5YA 3W85A 2ZZ3A 4K39A 2VFGA 1O60A 3L9CA 3TW6A 3O6DA 3WJSA 1LYXA 3LDVA 3QFEA 1VH7A 3QMRA 4EWND 5FEPA 1ZHAA 3EWZA 3KRZA 3CU2A 3T7VA 3SR7A 1TO3A 2V82A 3FYPA 3TJLA 4Q4KA 1JJKA 4NZJA 3W3OA 1M7PA 3L0KA 4UFLA 2CZEA 2W6RA 4NXSA 4OGZA 1TJPA 4HPXA 4O53A 5CPNA 3NL5A 4JX6A 3W7IA 1ICQA 3GZ3A 3G1VA 4JY9A 4DELA 1VPXA 3IVTA 1EIXA 3UXAA 5D05A 1X6UA 4JDBA 4L4LA 1U83A 3G22A 3C0JA 3PUDA 3A23A 4KFNA 4WJEA 2DZXA 4NUWA 4UFMA 3DFOA 1NF0A 1NF7A 3EWXA 2NLIA 4R33A 1GTHA 2GUUA 3M9YA 2ZFAA 4MFEA 4LVFA 1OFAA 1LBMA 1H7WA 1W8SA 5FF3A 1TTQA 1MEHA 4O57A 3GX9A 2A2IA 1ICSA 2DZVA 5FF4A 1XBYA 1OFOA 1K8XA 1YDNA 1CI1A 3EX3A 1J5TA 1RPXA 3NQGA 3NZRA 3W1RA 4RXGA 4PODA 1E51A 1W3TA 3WJWA 1G4SA 4IJBA 3DKLA 1B3OA 1XBXA 2JKAA 3L21A 4UFJA 1QPQA 1TPUA 3P84A 2V2DA 3DFNA 5FEZA 1TRIA 1J2WA 5TBOA 4FNQA 1H7RA 1VRDA 2BZNA 3KX6A 4JS3A 3B0UX 4LOCA 2QEZA 3CWNA 1VGAA 4O17A 1Z48A 2NV1A 2E5CA 3NM1A 1GVRA 3MBFA 3N2XA 4BI5A 1VLWA 3O6YX 5LGZA 1HO4A 3GLCA 1R46A 1A53A 5DBTA 1FBAA 4HSOA 3G0XA 1RQHA 5U7SA 3STGA 3W7RA 1TPFA 4OU1A 2OCZA 1RR2A 1VHCA 2A0NA 3TC6A 3P60A 4GUIA 3P81A 3TQVA 5EYWA 2R91A 4HT3A 1A5SA 5J5RA 1H7OA 4NQ1A 3SGZA 4ZQCA 1ZNNA 3L5LA 3VCRA 2YDAA 3M6YA 1MEWA 4ZVJA 2TPSA 4UR8A 3NPVA 1ZENA 2H8ZA 1L6YA 4X9SA 2ZDRA 2WNQA 4LT9A 1K02A 1ZALA 2Z6IA 6TIMA 1SW3A 3PSVA 1FDJA 3W9ZA 3W2LA 1Q3NA 3E9AA 3R8RA 4YCOA 1FWSA 4YMZA 1OF8A 3DKJA 1TQJA 1KFKA 3UNDA 1A5BA 3LTSA 4MZYA 3LGEA 4W9TA 1O5KA 2ZZ4A 3L5MA 2Y85A 3B0VC 3KHJA 4XTDA 2V5LA 5G4WA 2BWGA 5BMWA 3S1WA 1RD5A 3L65A 4EIVA 1TJRA 1BWKA 1J4EA 3TMQA 3HQ1A 1Z41A 3GXPA 1ML1A 4ML9A 3PULA 3ATZA 3S5NA 4AHQA 3ZWSA 1LCOA 1A50A 5F4XA 3GIYA 1OFBA 2PC4A 3MJYA 4TR9A 5DCBA 3CWOX 2A1YA 1SSDA 2EF9A 3KAOA 2I14A 2CZFA 4Z1AA 4JNMA 3LRLA 1XBZA 1VZWA 4LC8A 5BOOA 4MY1A 1VYPX 4NX5A 1ICPA 1K8YA 4NZFA 4JTFA 2PRLA 1FXQA 3G1FA 4UXDA 3Q2DA 3GDTA 4O28A 2G96A 5K4ZA 1XI3A 4D2JA 2PURA 3UWQA 2EKCA 5EA9A 5AN7A 3W7EA 3ZS4A 1JCJA 4UNKA 1SO5A 5C54A 2GQ8A 3PUEA 4WUIA 3EWWA 1R2TA 2ATSA 4LV4A 4O8RA 3B03A 3ABRA 5SWUA 1PHWA 1SZEA 1DJQA 1WYIA 1FWWA 1TPEA 5HWNA 4P61A 2ALDA 2A7RA 4A22A 4MYAA 4K37A 1MZHA 4HPJA 5I3IA 2CZ5A 2QCLA 3QF0A 1TTPA 5F2LA 1VCGA 3W76A 2J9ZA 3GAYA 3NQCA 4MYXA 3UQNA 3BPWA 4UR7A 5IBXC 3IGUA 3B05A 2I1OA 5FF2A 1JCLA 2NX3A 2ZA2A 4Z1BA 2Q3OA 2A21A 4JTIA 1QPRA 3QZEA 2Y7EA 1JCNA 3CTLA 2YFOA 1JQVA 4RCXA 1R2SA 3B04A 5CZSA 3UPBA 3EXSA 4I7WA 1TPWA 3GAKA 3N14A 1AL7A 4NJIA 2JK2A 2NWRA 3G1SA 4CQ8A 2R8WA 2DZTA 5G2IA 3LXBA 4YL2A 1KFJA 4WY0F 3W1LA 2V81A 3VFLA 1YPFA 4JTLA 2DZPA 1V7YA 4UTUA 1EUAA 1Q6LA 2FLIA 4UTLA 3QW4B 3G0UA 4IMFA 3S1VA 1W37A 3TA6A 1XUZA 2BX7A 4UFHA 2HS6A 3NO5A 1MEIA 3WK3A 1DJNA 1NSJA 4JTGA 3PB2A 5LZLA 5LHFA 1O4UA 1IXOA 1M7OA 1L6SA 3RFAA 2VC6A 2RDTA 2E68A 2VKZG 2H8XA 3GK0A 1W56A 3VE9A 4AWSA 4JX4A 5F4WA 3LCIA 2EHHA 2E77A 1B4EA 4LUJA 4S2CA 3HG5A 4MJMA 2F84A 3LBCA 8TIMA 3PG8A 4PC8A 3N2MA 2Q8ZA 2ZA3A 1YTEA 4JTHA 1XCFA 1EA0A 4DF0A 1VQTA 2P10A 4MOZA 1W54A 2AQWA 3W7GA 4FX6M 1X8FA 3PM6A 4O52A 4N6EA 5TQLA 3KVJA 3IIZA 4DQWA 1H62A 2CLFA 1KM1A 5I3KA 2W0UA 4UTIA 3YPIA 2YYUA 1DBTA 3PBUA 4QJ1A 1YTDA 1R2RA 5EBUA 4DBDA 3WJXA 1AW2A 1PL9A 4Z08A 2VFIA 1GVSA 4CCEA 1DHPA 3GDMA 1H1ZA 2DJLA 2VEMA 3LX9A 3BK0A 4EF9A 4FF7A 2V30A 1AW5A 4O4VA 2JBMA 2ISVA 1LROA 2NUYA 1EUNA 4AVFA 3CT7A 3HO8A 4K36A 1F05A 4IPJA 3WK0A 1EP1A 1K3UA 2H3BA 4UTTA 4DF2A 2FJKA 1Q6QA 2CWNA 4AWUA 3P61A 4WX2A 2ZYFA 4FNUA 3RU6A 4DXVA 4N6FA 4XBKA 4AAJA 4XUGA 1WBJA 3FJLA 4GJ1A 3A21A 2ATMA 4JIQA 1R30A 3M43A 1C29A 1P4CA 4PH6A 3SECA 1KM0A 1F76A 3G8EA 5EL1A 4LVAA 4AB4A 4CCDA 1BTMA 3G3DA 3FS2A 1N7KA 4NX0A 1ONRA 4BFAA 2VENA 3NQ7A 3EKLA 2VXNA 2YSWA 5LNVA 1YXCA 2NXHA 1IXNA 4N4PA 3E0IA 1H7PA 1P0NA 3FLUA 4I9AA 2DORA 4JTSA 5AOUA 1ZFJA 3MI3A 1H60A 4CQAA 3W2MA 1SU5A 2QAPA 4RKAA 3NPUA 1LBFA 3E49A 5EMUA 3VI2A 1UUMA 1H1YA 1S5VA 2ZZ1A 3B4UA 4N9CA 2RKXA 1FDYA 5G2HA 4XTIA 5F2GA 3LCWA 3QQ0A 2GVLA 3BG9A 4POCA 3TXVA 5LGXA 2ZRXA 3ABSA 1I2QA 5CPMA 1Z44A 3UY8A 2AGKA 3OVPA 1TV7A 3BW4A 5D04C 3STEA 3LTYA 2YW4A 4QNWA 1OFRA 4ZQNA 1D3HA 1LZOA 2X16A 4O13A 1JR1A 4JDYA 1WV2A 4M6VA 4OV9A 4H6KA 1XUUA 3K30A 3G8RA 2ISWA 5CKSA 1QR7A 3W2UA 4A2RA 4QAIA 3W22A 4H3DA 4R7JA 1FCBA 3W1MA 3DI0A 2R94A 3W75A 4BWLC 1H5YA 1VYRA 3T44A 4N2YA 4K6AA 2Y70A 5FESA 3LTPA 2V8ZA 3ANYA 3DENA 2VEIA 2ZRWA 1I2PA 2Z6JA 1LLZA 1XL9A 2XN1A 1P0KA 3GYEA 4RJEA 1OF6A 2JGQA 3QM3A 3CEPA 1FWTA 2Y6ZA 1OVDA 3SIZA 2QDGA 2ZRVA 2FPVA 3HPZA 3W7PA 2ZZ2A 3PF3A 4FHAA 4CLMA 4PL2A 1DVJA 4JTEA 1KFBA 4C1KA 5D38A 1FCUA 5KITA 5DLCA 3EWUA 5KTLA 3PB0A 4K7VA 2FIQA 3HG3A 1PCWA 2X1RA 1DQWA 1DOSA 4JYEA 4O0ZA 3OA3A 3E96A 4JN6A 1LOQA 3SSJA 4UCGA 4PFMA 3O16A 3PY2A 3LHYA 1SZNA 2YPIA 3M41A 1W31A 3G18A 1LOLA 3AJXA 3DFQA 3PAJA 3QQ1A 4LV9A 2RH9A 4LUIA 1KM6A 5AHLA 1GVFA 3UY7A 2A6NA 1SR9A 1OYAA 2FB3A 3IIXA 4TU1A 3C2FA 4MZ1A 2YW3A 3NL2A 4KFPA 3CM4A 1X1ZA 1UASA 3W84A 4O1AA 4RK8A 4Y6GA 2WV8A 2GVGA 3IVUA 4FO4A 1YDOA 5I3JA 5DN1A 4OV4A 3H54A 1TSIA 3C2EA 2ZQ0A 3N73A 3NQFA 3QMTA 3GDKA 3MBDA 1QMLA 2NX9A 3GKFA 1WBHA 1YTKA 2Z2UA 5IM51 2PRHA 1RV8A 4K38A 3MI2A 3M5YA 4EVZA 2C14A 3EKZA 4K8HA 4UTKA 5KSWA 4MY8A 5HINA 1KBIA 1K03A 3W2NA 1SUXA 1YADA 2RDUA 1YXYA 4J9JA 2ZRYA 5AHNA 2GVJA 2E6FA 3OVRA 5KMYA 4Z0JA 5D2TA 3C3NA 1KLZA 1XDMA 3M1ZA 2Y88A 3G1DA 3L0GA 1SQ7A 2OZ0A 1TPB1 1W0MA 5D2WA 3OG3A 2QCDB 3CQ0A 3T4CA 3B06A 4LY8A 2VEKA 1SFJA 4B5NA 3IIPA 1H61A 1GJPA 3LLDA 3TSMA 1QAPA 3UD6A 4AHPA 1DORA 3W7KA 3TH6A 3C61A 4Z1CA 4DF1A 4N9EA 4Q32A 1VS1A 1FCQA 3PS7A 3NNTA 3W87A 3MWAA 3OIXA 4CQ9A 5K7JA 4N02A 4FX8A 3R13A 1JRCA 1TB3A 2R14A 3KFTA 4QIUA 1B57A 3BW2A 2V2HA 1G67A 1UJPA 2F7FA 4QNEA 1ALDA 1DV7A 1KLYA 1TREA 3F4NA 3NQ2A 3L0NA 5K4XA 1XKYA 3O6CA 3RF9A 3P67A 3TUUA 2ZZ7A 5D02A 4K7YA 4PA8A 3UWUA 4OQVA 2V5BA 1EP2A 5LNUA 2A7PA 1ZCOA 2QAFA 4O0KA 4ZQRA 1DL3A 2GJNA 1B4KA 3INPA 2YFNA 5L6UA 4TMBA 4A3UA 2QCDA 3UYCA 4FIQA 5KZDA 4CCCA 1QNVA 1N55A 4LC6A 3QW3A 3O8AA 3W72A 4MVAA 3KOFA 3W7NA 4M7TA 4HKPA 4Y90A 4AWTA 2QCNA 2CLHA 3S9YA 2C16A 2YGYA 4N9BA 2AAMA 3NQ6A 4E2BA 2CZDA 2WJZA 1ME9A 4MLRA 4MUZA 5FI8A 3PSWA 1D3GA 2A5HA 4JTTA 1QO5A 1TQXA 2DZSA 1FWNA 1PV8A 3W7CA 1S5TA 4JYDA 4WY0B 4AEOA 4RR4A 5LHEA 1FQ0A 1OFEA 4JD4A 2ZTJA 3RLUA 2P0OA 3WJZA 2UV8G 4NNBA 3W1AA 1SO4A 3LI1A 5HR6A 3NQVA 1S5WA 4HHPA 3LHZA 2TSYA 3O06A 1QDSA 4HNVA 2NV2A 2X30A 1JVNA 3BLIA 4IOTA 4RZ6A 1MXSA 2RFGA 1LM1A 2NWSA 3HOJA 1M6JA 4NVTA 5CPLA 4MIMA 2X1UA 3QH2A 3EB2A 4EOUA 1UBSA 1PIIA 1LRTA 4O4WA 3P8JA 5F2IA 1F6PA 3CHVA 4N9DA 3BG3A 3QC3A 4O12A 1F7BA 4UMBA 5F4SA 3LCHA 1ZAJA 1GG1A 3LM7A 3BO9A 1XDLA 2QCHA 5LNRA 4QITA 4M7SA 1WA3A 1SW7A 1H7XA 1PHQA 1SZGA 1GPWA 1UCWA 3ELFA 4WY0A 2QCFA 1K7XA 2CLMA 3CC1A 3M5ZA 3MHGA 4DO4A 3BV4A 3NOEA 3IVSA 1GVQA 1JULA 3LCGA 5CZ0A 2ZRUA 2ISSA 1WOAA 3C52A 3NQEA 3QMSA 3QSRA 5DY3A 3P62A 2Y7GA 4BWLA 1VCVA 1C9DA 1PS9A 5A8GA 3SJ3A 1K7FA 1XM3A 4NNAA 3EX1A 5G1YA 1TPDA 4O54A 3NEVA 3HIJA 3HJZA 4L4MA 1I2NA 4FXSA 2WO5A 3W7OA 4G1KA 2C13A 1P5BA 3M7WA 5C5YA 2X1SA 1I2OA 5C2XA 3GR8A 1PE1A 2B0MA 2VOMA 2EGZA 1BKSA 4JX5A 1U5JA 3GDRA 4GBUA 3W83A 4GFSA 4JTKA 3I65A 2TMDA 7TIMA 4FX7A 5FEWA 3H55A 3PBWA 1JUBA 3NGJA 1NAL1 3A5FA 3A9IA 3O07A 3V75A 3N9SA 1OFDA 3RLVA 3TE9A 3B0PA 3O63A 3VKJA 5LNSA 1I45A
chains in the Genus database with same CATH superfamily
5I5RA 1D8CA 1O5RA 4TQTA 3DX5A 2D2OA 1JNEA 1WXJA 3RLGA 1ME7A 2VQTA 1BQGA 3TSDA 4U2ZA 1QPNA 3VGGA 2QJHA 3HG2A 3TONA 4MFDA 3VNDA 1GTEA 6CGTA 3DOPA 5EKYA 5D37A 3RX3A 1W3LA 4LY4A 4HJWA 4LS2A 2J74A 3CQKA 4HYWA 1QI4A 1B3ZA 1JD7A 3N3MA 1W1ZA 5B7ZA 3H21A 3AIWA 2JF7A 3B8DA 4CD4A 1VHNA 4NASA 3P7YA 4Z2HA 3IV8A 1S2VA 2PI6A 4GIAA 4HOXA 1DTNA 3ZWTA 4LVDA 1HKIA 4ADSA 2AGTA 2E6DA 1W3IA 3RX2A 5CG7A 1BSIA 4X0NA 2VFHA 1R9ZA 3H2NA 1YE6A 1W91A 2VVSA 2G95A 2ZOXA 1EWDA 1UC4A 4GUHA 4AYGA 5I06A 4FK9A 1J01A 1TJ0A 3AUOA 1C7TA 3SIMA 2F6UA 4QQ3A 1XC4A 3GKAA 1SJAA 2B7NA 3CLWA 5D4YA 1KV8A 1RCOB 2EPKX 1L0PA 1Q6RA 3VOIA 3NZPA 2C19A 2V3EA 1UA3A 1HX0A 4U28A 4K1GA 1UR9A 4KIEA 2RGMA 1Q7QA 1R3SA 2Q8LA 1L2UA 1WKEA 2QDDA 4L4PA 4W8LA 2CLIA 5KZ6A 2YLAA 4DJDC 4NAFA 4B15A 3W28A 1UR8A 4C1LA 1UWIA 3FKRA 1KFCA 4CNPA 3BW3A 3UWWA 4TXEA 3S1XA 1TRDA 4MM1A 3R5EA 1RAKA 2XIQA 2X8RA 2E5DA 2CW6A 4PR4A 1PYFA 3LMYA 1KXVA 1KGUA 4GCXA 2BHUA 3WJYA 6XIAA 5E0CA 4MWAE 3VD7A 3HV8A 2UZ9A 8RUCA 1K70A 3AOFA 4BI6A 4GVFA 3WL1A 1IR1A 2R1NA 4KRUA 3EEGA 4B4FA 5HUPA 3VGFA 1XIGA 2Z1VA 2J7DA 2ALRA 1MFVA 3L4WA 4JQAA 4MB3A 4XKYA 2INEA 1KM4A 3K13A 5LKYA 1BG9A 1XIBA 1WZLA 1UD3A 1V03A 2ZTKA 4XZWA 1EJSC 1K8CA 1ME8A 3MHUA 3NPWA 3WK2A 4C7DA 4PMUA 1FUYA 3ZR6A 4LQ1A 5I07A 3W24A 3C6CA 3C8NA 1KA9F 5D2YA 2C8NA 1XSJA 2OG9A 1W1B1 1KXHA 3F03K 3I3BA 2R9RA 1M01A 3A5VA 3N19B 2H90A 5K9CA 5A95A 4KKXA 4ZMGA 1ZS2A 2BVTA 1MNZA 1YHTA 3M0MA 1BQCA 4H83A 3TYCA 3W01A 2H9AB 1PDYA 4ACZA 5HXMA 3U8GA 4FOKA 3AHYA 4YVVA 4NI8A 3I6TA 3KL3A 4LAZA 5A2BA 3WD3A 3DHPA 4WEVX 4MLJA 3HPXA 4H8HA 3WLSA 1P48A 2NT0A 3HGSA 3GS6A 5JIPA 1EZ2A 4IWWA 4EK7A 3MS8A 4JEQA 2TRSA 4JOMA 1XLLA 5T26A 3VVGA 4GQQA 4QSHA 2I9EA 1W5QA 4FXRA 3EPMA 1OX4B 4AYSA 4NZ4A 5CBIA 3E74A 3T6CA 3NQDA 4REQA 1EPVA 1NIUA 3ALGA 3JRKA 4CGTA 1ZQ5A 4NYUA 3NXFA 3K1GA 1VJIA 3PK7A 4V1YA 4GO8A 3OQ8A 4AHOA 1H7NA 3QEZA 1D9EA 1EDGA 3OG2A 4BCEA 1US2A 1UHVA 3ZZ1A 4QS6A 1EGMA 1MSSA 6A3HA 3RR4A 3C2OA 3VUSA 5LA0A 2HK0A 2FGLA 4KGJA 3HG4A 5E9AA 5C0QA 4U5KA 1EDQA 2PTXA 3LD5A 2VTFA 2Z2BA 1WUEA 3HGRA 4KWWA 1T8XA 4B90A 2CLKA 2D2JA 4ML4A 1KRBC 1ZGDA 3VD5A 4AZCB 3G1HA 5G5IA 3ONCA 1QOPA 3MKCA 4HNNA 3U4FA 1YNQA 5K9XA 1RLCL 1SZFA 4X2PA 4HZMA 4KCWA 4RZ4A 2R24A 1CXLA 2E0PA 2XN0A 1WZMA 1KTBA 2Z0IA 1JD9A 4QJ3B 2QPXA 1O68A 4NJHA 2TAAA 4DO7A 1J93A 1VPQA 3VKBA 3S5SA 4CNSA 1OABA 5LXEA 5FJRA 1S1PA 3TJXA 2GPTA 1ZBCA 3WUEA 3SCUA 1T96A 5BRBA 3U6WA 1UWAA 1R87A 4P7OA 3KP1A 2IKJA 2GQAA 5FAJA 3NYDA 5D09A 1F8MA 2O9OA 1TWZA 4GI8A 1O5XA 1QPOA 1EHAA 4LWWA 4Y8FA 3TP4A 4DJDA 5AYZA 4M6PA 3G1XA 2Y7DA 4W86A 4RZ5A 1UJQA 3II1A 3PNZA 3WUFA 4EPBC 4Z2KA 1NEYA 3VAVA 4ZA0A 4H8VA 4H7CA 1G4TA 5AYXA 2FTYA 4AFYA 5IOBA 2NX1A 1NFPA 3ZJ8A 5A6KA 3IJQA 4NRRA 3NG3A 4Q4MA 3LHTA 3B97A 3IARA 5C7HA 5XIAA 5IHRA 2Y5EA 1XLAA 3JS3A 3S46A 4DX3A 1F5ZA 1TPC1 3Q94A 5FD0A 4FZIA 1BVZA 1TA3B 2W79A 1L9WA 1PTAA 3LI0A 6TAAA 4GKLA 4EP8C 3KRSA 1EEXA 2XFRA 5EFDA 3UNTA 4CQBA 4ZZ9A 3MUXA 1M5WA 4KFOA 1RVKA 4ROPA 3S5YA 4J1OA 4Q6JA 1V6XA 3N9RA 2Z1BA 4L7ZA 4IP4A 3N04A 4BR1A 2NT1A 4JIEA 2WMJA 1ITQA 4HTYA 5EGRA 2QDHA 4OWGA 1TTJA 1ZBKA 1E6NA 1E6SM 4FAMA 4KRTA 3E6EA 3DU0A 2O9PA 3QHMA 3S42A 4AU0A 2PUZA 2FHCA 3IGSA 4DUVA 3LV5A 3GG7A 2XVNA 2PLKA 3B8SA 1BRLA 4FI4A 4BQ3A 3Q4DA 1S39A 1HVQA 2OO0A 2D69A 3I68A 4JIHA 3ARYA 1Y8BA 4BQ2A 1BYCA 4QDMA 3A22A 1G94A 3NSXA 1CB2A 3GNNA 4RXFA 5ABGA 4UTMA 3PJXA 1R3WA 5HPOA 2WMHA 1TR9A 5AVNA 2HXTA 4UC5A 4H41A 1GOMA 2PDMA 3CZEA 3TMLA 3UVIA 1DIEA 3G6MA 1Z69A 1DXFA 3LERA 1V6VA 1M53A 1H3GA 1V3HA 5EB8A 2Y89A 1QK2A 1TX2A 2OJPA 2VFEA 1AA1B 6ALDA 5D9OA 3TAKA 4WLCA 2XFFA 4IXHA 3URAA 2QJGA 4DO5A 4YNGA 2XTKA 1RBLA 4GFIA 5CGQA 1TPVA 3SB0A 2CWXA 2RJHA 3VX0A 1MFUA 2XIOA 2GJRA 4UTHA 4IJCA 2HNEA 4E8CA 2F9RA 2PDYA 3VDBA 5C2CA 3EXTA 1RK6A 4HU3A 1X6NA 3UU0A 3KZPA 1E1CB 1P1MA 4X9YA 3WK1A 5IFTA 3AZSA 1GJUA 2WC4A 1UKTA 4FIRA 4CN4A 3VYLA 1AMKA 4CUCA 1S3TC 1V7AA 2X0SA 1O95A 4AEFA 5EMJA 4PUDA 4QAWA 2YB1A 6REQB 3W07A 3ARQA 3SI9A 4MSSA 3HQPA 3EOEA 3THCA 1TVLA 4BHYA 2WW5A 3UCCA 4HU4A 4S3BA 2FB2A 2YCLA 3P0WA 3W7HA 2B7QA 3W86A 2J8GA 1RCXB 3PPCA 1EKOA 2IQ0A 1P7TB 3OBAA 1C93A 5TD4A 1FWBC 3BGJA 1JCXA 3E2RA 3LGGA 5DCEA 3CB8A 3L7RA 1K8ZA 3HQNA 2ZUSA 4PUMA 2D3NA 2PU0A 3COTA 2YZRA 3ARVA 2J9XA 1IGWA 4MB1A 5AC7A 1O1ZA 5HQEA 4QJ4B 2QUUA 3FSUA 4WOQA 1UMLA 4H4IA 4WD0A 3ZJKA 4GD0A 2WQPA 4HNTA 3VIJA 4A8IA 1MUWA 3FOKA 4QISA 3GYCA 1C8VA 5K9DA 3VO0A 4GCAA 4IX2A 4W89A 4HN4A 4ECLA 1NY1A 2P3ZA 3B0XA 3M5XA 2FGBA 3BLFA 5AHMA 4GMEA 2OLSA 2REQA 2B81A 1W5MA 3W7MA 3ORWA 3S1UA 3R12A 3W73A 1UR4A 3TQ0A 2OMAA 4QP0A 1A5AA 1ADOA 5HR7A 3LNPA 3KCOA 4C6QA 3SCSA 3M47A 1KM2A 1JL8A 4YLWA 4JCMA 4PL1A 3T0TA 2DT0A 3S2LA 2YA2A 2DJXA 4I5RA 3LCLA 1B1YA 4H1ZA 3TCSA 1UKSA 4IQLA 4XK2A 2V5DA 3TROA 2VT0A 4GX8A 2C1HA 4JFSA 3LBMA 3GHSA 4M6QA 1JYNA 2QF7A 5CLWA 3GXDA 3EDFA 2BVWA 1NP0A 2CHOA 4MKSA 5D8WA 2PDJA 2I5GA 1F74A 4XUYA 4G7EA 3B9AA 4G5DA 4WGHA 3MPGA 4GI9A 2D0FA 1TTIA 3AHZA 1AZ1A 4ZO8A 1IWBA 1JEZA 2VFDA 4J3UA 3V7PA 1N8FA 4IIDA 2QIIA 3ECQA 3IJ6A 1XIHA 3C2VA 2GL5A 4RX0A 4IMCA 4BF9A 1NARA 1OG6A 2D23A 1FCVA 1K9FA 3BQ6A 3EX4A 4L6DA 4EPDC 5DCDA 5I7GA 2XFWA 1SJCA 5LXXA 2VZTA 5TAOA 4J27A 2A3LA 1HG3A 3H2AA 2WNZA 2J6VA 1E4MM 4Q8VA 2ZZ3A 5CPTA 3CH0A 2GGIA 3GBEA 4DI9A 3L9CA 3PZTA 3GR4A 3O6DA 3CUFA 3WJSA 1LYXA 4B9YA 3LPOA 3AWOA 4FALA 2DW7A 4RNFA 3WEMA 1GOIA 3SR7A 3MDUA 1TWIA 3R94A 1M7PA 4UFLA 2W6RA 3OZMA 4H8NA 4IIHA 4OIFA 1RA5A 4M29A 4O53A 5CPNA 1ZPTA 4YJ5A 3N3TA 4JY9A 4DELA 1VPXA 1EIXA 4JDBA 4L4LA 3VOFA 3WELA 2J75A 3PUDA 4KFNA 4WJEA 2WANA 4HHHA 3KM8A 3H26A 4WSJA 1GW9A 3EDEA 1I0DA 3U2CA 1H7WA 1W8SA 5FF3A 3BCFA 5DMNA 4XISA 1XBYA 2PDGA 1FHVA 3BURA 4C65A 1KQZA 5M2FX 1J5TA 3NQGA 3ZSTA 3W1RA 1QBAA 1W3TA 3WJWA 3WKZA 2NQ5A 4IJBA 4B3LA 1B3OA 1XBXA 3L21A 5C70A 1TRIA 1BXCA 1J2WA 4DJDD 3BSHA 3KX6A 2BZNA 4JBRA 4Z2GA 3B0UX 2IPGA 3PBGA 1KR0A 4LOCA 3CWNA 2IXUA 5HMFA 1UR3M 3ANUA 1S38A 3N2XA 4XIAA 4BI5A 4ZTYA 3SN1A 3VINA 4U3AA 1A53A 1GUVA 2PDUA 4HSOA 3G0XA 5U7SA 1VHCA 1J96A 4GUIA 1A5SA 4ZBCA 5J5RA 1VFOA 1W1PA 3SGGA 1JPDX 3SGZA 3UESA 7ENLA 3VCRA 4ZOEA 3WQFA 2YDAA 3TYEA 4GY7A 4ZVJA 1FWEC 1CDGA 1ZP4A 2QJJA 3SBFA 3NPVA 1Q6DA 2OU4A 3MKVA 2ZDRA 2WNQA 2Z7KA 4R85A 1JPIA 2WBKA 1ZALA 2VWTA 1W9PA 2GLKA 4D8LA 3W2LA 2WVVB 3DEQA 1ZLPA 2FYMA 3RG6A 4YCOA 1OF8A 2CERA 1TQJA 1IEWA 2OEMA 1ONWA 3HTWA 1P6WA 1A5BA 1W1TA 4A8NA 3VNLA 4US5A 3GZAA 2DZBA 1US0A 2ZZ4A 3B0VC 3KHJA 3GC2A 5FIPA 1BWKA 2IKGA 3HN3A 1A80A 2GGGA 1XIEA 2FZNA 5TNVA 3H12A 2YIHA 3PULA 3ATZA 5M17A 3VDCA 3S5NA 4AHQA 1LCOA 1A50A 2E7FA 1KRCC 1OFBA 1PKYA 3T09A 1A0DA 3UR5A 5C9WA 2IS7A 1AQMA 1PKLA 1ICPA 1K8YA 3H8AA 2PRLA 1NWRA 1FXQA 4UXDA 4ZGYA 3BXWA 2G96A 3VIIA 5AN7A 3ZS4A 1JCJA 4D72A 1TV4A 4UNKA 2V38A 2NVDA 4O8RA 1AFSA 1UH2A 3VGBA 2VP8A 5ENLA 4Y7EA 4JCLA 1FWWA 1TPEA 2DUAA 2RAGA 4AUBA 2CZ5A 2QCLA 1UP3A 5A6LA 3QF0A 2WLZA 2PWHA 1SR0A 1KR1A 4QR6A 2ODOA 2UBPC 2J9ZA 1E4LA 1OCJA 3EYPA 1AD4A 4MNMA 2WC7A 3IGUA 3B05A 3AXKA 2NX3A 2ZA2A 1UKPA 2XHYA 4Z1YA 1T41A 3EOSA 5M1TA 3QZEA 4H9ZA 4RCXA 3V3WA 3B04A 4P7QA 4I7WA 1TPWA 1U30A 4NJIA 3CJPA 4CQ8A 3B4YA 3T9PA 2HISA 3LXBA 4YL2A 1DIOA 1XLBA 1KFJA 3CMFA 1XLEA 3O2LA 3GUWA 1YPFA 2ZXDA 3USZA 1U33A 1FH8A 1Q6LA 4O0QA 3QW4B 2DSKA 1GQLA 4XO7A 4UFHA 4JZ5A 1NSJA 5DRIA 1QATA 3PB2A 3WQ8A 4DBWA 5LZLA 1KC7A 1QI2A 1M7OA 4PMVA 2YA0A 2E68A 3VD4A 3DG3A 4AG0A 3GK0A 3VE9A 1R85A 4DJFC 2GK1A 1O5QA 5CXPA 3VM5A 1V3IA 2EHHA 2E77A 1B4EA 4O8AA 4MJMA 3GG0A 4PC8A 2Q8ZA 1YTEA 1J6OA 4JTHA 1A5LC 2OQYA 3BICA 2XFYA 1ADSA 4FX6M 4KGLA 3LS9A 3PM6A 2VYOA 5TQLA 3KVJA 3B8TA 3IIZA 4GIEA 3T0CA 4DQWA 2XG9A 1KM1A 3NVDA 4GGBA 1GK8A 2GWNA 5I3KA 3TYUA 3YPIA 4QJ1A 1YTDA 4DBDA 1Y7VA 1LJYA 1PL9A 3SUVA 4Z08A 1YQ2A 1CGYA 3WH6A 1GVSA 1PEZA 4G56A 1DHPA 1H1ZA 4HNCA 4RE3A 3MSRA 5CSYA 5AYBA 3AZTA 2GSEA 3I6EA 4JKLA 2ISVA 2NUYA 4FSAA 2QIWA 5HOSA 1XLMA 1AJZA 4I9JA 1QXLA 1U5HA 2OSWA 3P3BA 3T05A 4D6FA 1X96A 3UGRA 4N6FA 4AISA 4XBKA 1NDZA 4LEFA 1WBJA 1IZJA 4U5IA 4TX6A 1ECEA 1KBKA 1QI3A 3G5EA 3PPGA 1F76A 5EL1A 5H6HA 4GQBA 4XB3A 4YYCA 4B5WA 2EBNA 4CN1A 2FJUB 4KQNA 3EKLA 3CUJA 1YW1A 1VJSA 2VXNA 2YSWA 5LNVA 2NXHA 2WMFA 3CUGA 4N4PA 1P0NA 2I56A 3ABZA 4NZ5A 3RPTA 1FWCC 3BL3A 1DEDA 5CGTA 5A8PA 3V36A 4B5VA 4PTWA 2VO5A 3LBOA 5EMUA 1UH4A 3KHDA 1CENA 3B4UA 2RKXA 3OQEA 4XTIA 1B54A 1XD1A 4X63A 5F2GA 3LCWA 4YTQA 4Q4PA 4POCA 5LGXA 1M03A 1I2QA 1Z44A 3O6AA 2P8CA 7REQA 1REQA 3UY8A 4HA3A 3OVPA 1EOKA 2C1GA 2IPFA 5D04C 4IH3A 4QNWA 1CLXA 1OFRA 4ZQNA 2J7HA 2J78A 2X16A 1WV2A 3PWGA 4JTRA 4QE1A 1E6QM 1XUUA 3SCRA 2OSYA 3G8RA 5CKSA 1QR7A 3W2UA 3LG3A 3ZYZA 2YDSA 2HJPA 3W22A 5FACA 1FCBA 3V0UA 2VX4A 4IFKA 1KRAC 4K6AA 3FA3A 3M0YA 3QY7A 2VL4A 3GYEA 4RJEA 1P0KA 1NH6A 2ZE3A 3LM3A 4MG4A 1DXIA 4IGMA 1VEPA 2X05A 1OVDA 3SIZA 1Q2SA 4GOAA 4IQJA 2FPVA 3WD2A 3W7PA 3C3UA 4CLMA 1O1HA 1DVJA 2BNJA 5D38A 5KITA 5DLCA 2XVPA 4K7VA 2FIQA 3WD0A 2X1RA 2FVLA 1IT7A 1DQWA 3WQDA 1DOSA 2HE8A 4JYEA 3PZNA 4QSFA 1UMYA 1LOQA 3SSJA 4PFMA 2WXDM 1YPXA 1EF3A 2ZX6A 3PY2A 3UA3A 1AUSL 4IIFA 1PZ0A 1W31A 3M46A 1HP5A 3QQ1A 4LV9A 2RH9A 1KM6A 3IGHX 2FVMA 3L23A 1OYAA 3IIXA 4S3KA 3C2FA 5A2CA 1UH3A 1NU5A 5BXRA 5AC5A 2PWUA 2WV8A 4I6KA 1ENUA 5I3JA 3ENLA 4UQDA 1F3XA 4PMNA 3QMTA 5CQ1A 1F07A 4URIA 1XLJA 4MUPA 3BJSA 3NZQA 4EWJA 2C14A 1EJUC 3VUPA 4K8HA 3H2FA 1TVPA 1V6WA 2BOEX 4MY8A 3B0YA 3W2NA 2FZBA 3RRAA 3REQB 1LG1A 1WKDA 3J7HA 4DJFA 4D6JA 1MQQA 5KMYA 4AIOA 5D2TA 1RY8A 3C3NA 1KLZA 3M1ZA 4PTMA 4HA4A 2YXXA 3CO8A 1PX3A 1TPB1 4ERAA 3VOJA 4JN7A 1Z32X 4B5NA 3WO8A 3PTQA 3IIPA 3UD6A 3W7KA 4UOJA 4US5D 3C61A 4Z1CA 4Q32A 4CD8A 4KEMA 3N12A 2I17A 3MWAA 2ZADA 3OIXA 2Q8XA 4N02A 1E0VA 3K4DA 4QIUA 4C91A 3ZM8A 2V2HA 1G67A 1UJPA 3AIBA 2DUZA 3GFZA 4FLOA 3AS0A 5HATA 3L0NA 4Q4RA 4TV6A 3O6CA 3PNUA 4XZHA 4KEVA 4Z2JA 3VIOA 3UWUA 4OQVA 2Y2WA 3TYBA 2V5BA 4C6DA 4D6DA 2GJNA 1IEXA 4A3UA 2QCDA 4HBKA 5CJNA 3UYCA 4B2DA 2OYLA 4CCCA 5G4HC 2OVLA 3NIYA 3QW3A 3W72A 4JTAA 3KS5A 1PAMA 3ARSA 3KWXA 2YGYA 3BLOA 3VM7A 3HPAA 1J5SA 3HPFA 1GVYA 1UD4A 3UWEA 5A69A 3GHTA 3JUGA 2A5HA 1CXIA 1JCTA 3OIHA 1PV8A 3CHEA 1HF6A 4W8AA 2PEVA 4JYDA 1DQUA 1VBUA 1LWIA 1FQ0A 4RV3A 1OFEA 4ERGA 3RLUA 3BOFA 3UERA 2P0OA 3WJZA 3W1AA 2G3IA 4BEQA 4ROQA 5HR6A 1E70M 4D6GA 4HHPA 1LQAA 4GC3A 4CQCA 1JVNA 1CGUA 1MXSA 3HOJA 1NDWA 4GYFA 3VNYA 4D9PA 2X1UA 3T8LA 3QH2A 3EB2A 4EOUA 1UBSA 1Q8AA 1BWVA 4EPEC 1PIIA 4LAUA 1LRTA 4O4WA 4JFWA 2BODX 4ZO6A 3CHVA 1H11A 3BAKA 4J3VA 4N9DA 4O12A 3UGVA 5BROA 3BLDA 3VD3A 3ZT5A 1ZAJA 3KCJA 3CQJA 1XH1A 2QCHA 3VFCA 4RW3A 1SW7A 1H7XA 3RM9A 2FKPA 4U3CA 3DCPA 1J9YA 3AXMA 1GPWA 2Z26A 2QCFA 3CC1A 4GXPA 3M5ZA 4PCSA 3MHGA 3S47A 4XZLX 2ZRUA 1QNSA 3AZRA 3EKGA 3C52A 4WCJA 3ZVHA 3QMSA 1H09A 5DY3A 3DIPA 3P62A 4F9DA 1M41A 1PS9A 3SJ3A 2O4MA 1K7FA 3WCZA 4NNAA 2X0YA 2V69A 1V93A 3WNNA 5G1YA 4GABA 1TPDA 4GISA 1DP0A 3ITTA 1XDJA 4GIYA 1LWHA 3HJZA 4L4MA 1I2NA 2HK1A 3DYPA 4G1KA 2F61A 3IK4A 5C2XA 1CZ1A 2B0MA 4JX5A 3GDRA 3MQTA 4P8UA 4JTKA 7TIMA 4Z2LA 3HFYA 5FEWA 3LY0A 3F2CA 4QLLA 3DESA 2DIJA 3N6HA 3A9IA 1R3VA 4IQEA 3WLQA 3RLVA 4EANA 1JG9A 5HJYA 3C2RA 4O1FA 2QLYA 1HO1A 1Q5MA 4Q8MA 2BGQA 3SY5A 1S5NA 1EC8A 3RCMA 3GTFA 3PWAA 3VDGA 3EOOA 3L4TA 3L2IA 3SUSA 5CPOA 2R1LA 4J3SA 3I3DA 5D30A 3R4IA 4NL1A 2YBUA 1GZGA 5KETA 3BAIA 4LBRA 2E5BA 2RDWA 4LU0A 4PMJA 5GVJA 4PTVA 2CBUA 2CLOA 2GJPA 1PCKA 1BVNP 3QPZA 1S2TA 1J0HA 1DXEA 3S4TA 2HPIA 3TC7A 1T40A 4ICCX 4F2UA 3N2OA 1B2YA 1VD6A 3KL0A 3WQVA 3W7QA 3ZFHA 4ZR8A 2A4AA 3KVMA 3M6DA 3MW7A 2J7CA 2Q6ZA 4P8VA 2WCGA 1E9YB 4D6EA 4L1GA 4Z1DA 2VDIA 3FYYA 1QO2A 3EGJA 1W5NA 3OOQA 1JI2A 3KXQA 1BGAA 3AIQA 1GVOA 3TA9A 3TWBA 4WR3A 4YWIA 2QUVA 2BFGA 1IEVA 1GKPA 2ZZ5A 4XZBA 4ERIA 4K8GA 4DUXA 2Y61A 3CUIA 3MSYA 2EAWA 1EL3A 2OLAA 4W4QA 4ORIA 7TAAA 5LNWA 5I3GA 5JIWA 2NVAA 4QRNA 3PBMA 5E1QA 1XYMA 2IKIA 2GUYA 4JGDA 1Q85A 1EBGA 1TJ1A 4RZBA 1IXQA 3E12A 4F3HA 3SW6A 4Y9AA 5FJIA 4F40A 4M19A 2FZ9A 5I3DA 2J27A 4M56A 1M65A 1DWGM 2D0GA 1SSGA 3KVKA 1OY0A 4ZQMA 3K4AA 1XPGA 2V67A 1VFUA 3GM8A 4RE4A 3T4WA 2F2KA 2G4FA 3C8FA 2B7OA 4I90A 3SCVA 2HE5A 1QOXA 1EJTC 1GOWA 1OC7A 4TTUA 3S83A 1Q6OA 4PMRA 2DQWA 3AWNA 4H9UA 1I2RA 1JZ3A 3K46A 2Q02A 2GOUA 3EAUA 2G41A 1GKRA 3P8IA 4TTGA 4JNYA 1TUXA 4X3ZA 4NZCA 4ZQOA 4L6OA 5E93A 2QCEA 4IPNB 3W81A 3THAA 3ABQA 2X1IA 3SFKA 2HCVA 2PF8A 4RUBA 3OYZA 4OBRA 1IIGA 2PWDA 3TQKA 4O16A 4BF5A 2YXOA 2AQOA 3N6JA 4NXKA 2PE4A 3USBA 2I7GA 1RVGA 3NCOA 3S6DA 4K68A 4XG1A 4IUOA 4RV8A 5CBBA 3FVMA 4WOZA 3W7DA 2VMFA 4H00A 3PFRA 3CK5A 1HXJA 3CL8A 4C6MA 1KFWA 3EXRA 5G1MA 4QTGA 4A3RA 3ABOA 2BHZA 3GUGA 3XINA 2V5CA 1WDPA 3GC5A 3K4WA 4A2SA 4DJFD 1QWKA 3AYVA 5C6MA 1DWAM 4RNJA 4F0SA 3FGCA 5HMEA 2VC9A 5JVLA 1LQ0A 3VZYA 1HFBA 4BI7A 2BB0A 4DYJA 1XRSA 1JI1A 2P1FA 1VC4A 4XZMX 5D03A 4B4HA 1TJ2A 5CH9A 4Q8NA 3WBAA 3FK4A 4G1NA 4DPPA 2QJMA 3QJAA 3WH9A 4A35A 5HNRA 3EX2A 2HPMA 2BSLA 1HGYA 2A3BA 2G5WA 4ENLA 5DXYA 4ADUA 2PP0A 4D6IA 3MP3A 5FJUA 1OX6A 3IWPA 2QCCA 5C7VA 4E4FA 1OFQA 1XCXA 1EX5A 1ZJIA 5L9FA 2VJXA 4UQ9A 4HPNA 2YXGA 3NEHA 4JEJA 1H50A 4B2DD 4AD5A 1JGMA 4K1WA 2ADAA 4K8EA 1OX4A 1LLWA 2KZHA 1I9CB 4LW7A 2ONEA 3R7MA 4O15A 4F2BA 1LUCB 3TW9A 3E38A 1O66A 4WKHA 2YCEA 3ANVA 2DSZA 4XD3A 4E0CA 1CGTA 2FH8A 1EXBA 4F2TA 1SO6A 2V5JA 1Q6GA 2NXIA 2OZ3A 3N25A 2Z29A 3MVIA 3CZLA 5A2AA 5CJ5A 4GZJA 5HMSA 2YL6A 1H51A 3APTA 4H2HA 2WJDA 1O12A 2YKKA 5A8OA 1X7FA 3QSTA 4KS0A 4JFUA 1X38A 4XVEA 4E2OA 1GZ1A 1E55A 2DIEA 2W5FA 2QCGA 5M3WA 4UTTC 2X09A 3NR0A 3TYDA 3EMZA 4AW7A 3GG1A 2Y7FA 3AMDA 3AMKA 4BQ4A 3H7UA 1JDDA 5BOEA 1TE1A 2OQLA 5AZ1A 4Q8PA 2XWDA 3VMPA 4UUIA 4U4MA 7CGTA 3W26A 4AZCA 1GQNA 1LL4A 4C7GA 1IZCA 4LYPA 2VX7A 4O1BA 4MY9A 1FDZA 3LCFA 4R5EA 3N9KA 1E4IA 1QTWA 5EMYA 1OT1A 4I8YA 3M44A 4I7UA 5FF7A 5G4EA 1VEMA 2CHRA 1VCFA 3QR1A 2XH2A 4XAPA 1GVIA 4AMCA 3LHUA 3K8LA 3AO0A 1HTIA 1QNRA 3PANA 4EKJA 3SUWA 2QPSA 3R89A 2YL8A 4HK7A 1L6GA 3V4BA 1E9IA 1WAWA 3EWYA 3JVAA 3W70A 1V8EA 4PTDA 1E0TA 1TWSA 1WX0A 2WPGA 2ZVIA 2YL9A 3W1NA 3KP0A 1OK4A 3NVTA 1LTDA 4FNSA 4H04A 1XLDA 2CFFA 1OGSA 3FKKA 2FPTA 2MANA 2EG8A 4A21A 1TIMA 3GXNA 2EPHA 2VGGA 2WHLA 3E0FA 4H8UA 3WN6A 3VGDA 2BTMA 3E0VA 2Y4SA 1Z89A 1K7EA 3GVGA 5JMUA 3UJRA 3WLOA 3A24A 3TTEA 4Q33A 1E4NA 4JY8A 1QUMA 3MA8A 3MDWA 3PTKA 3WLIA 4AY1A 3G3MA 3UXDA 2E40A 3AYRA 3W6YA 4QG6A 4DJEA 4TMCA 3JR2A 3PBYA 4FXJA 2WHJA 4E4UA 1IHIA 3WQGA 3NUKA 1LOSA 4MPKA 3PPHA 1NOUA 2VGBA 5GJMA 3TIMA 2WBGA 4X2RA 3BZGA 1CW2A 3O15A 4GXWA 3FJ6A 5CSSA 3Q58A 1G7VA 1JRBA 2VR2A 4ZB2A 3H22A 5JBDA 3MUY1 4DEFA 2YYTA 4HIBA 1H4PA 4IIGA 3RJXA 3ARRA 1SFSA 1TCDA 1R5YA 2NXGA 4OOZA 1J0IA 2J24A 2DV0A 3KL5A 3VGHA 2E9BA 4LF1A 1DE6A 4OE7A 3CUHA 1FH7A 1T99A 5I02A 1YX1A 4H01A 4IGSA 1R9YA 4GQ0A 4E6MA 4AXNA 4LS0A 4KWSA 3T40A 1YXDA 3BCDA 1KV5A 4S1FA 3BARA 4GYPC 4AIUA 1NOWA 3L5AA 3O9NA 1NVMA 1XICA 3FFSA 4UNLA 1XLIA 1HP4A 1TWDA 4S3CA 3WLPA 3IV3A 4C6KA 2EPMX 2FZDA 1F2JA 4IX0A 3LLFA 1DPMA 2J6XA 3IANA 3P0XA 2VVNA 1PUDA 3NDYA 3FVDA 4ADTA 4DPQA 1CPUA 2PZNA 1GEQA 2PDPA 1E73M 1LLOA 3ZJ6A 3KOXA 1YBQA 1ZRQA 1QW8A 2Q09A 2V3DA 1VYSX 1BF2A 2OLHA 3OJGA 2CESA 2HBXA 3W1PA 1OCNA 3TXZA 1TIWA 2DSUA 4F4RA 1L2QA 1P0EA 2D0HA 3MMDA 3EOUA 2VRKA 1BYDA 3TNOA 1ZBWA 3WQOA 4V15A 3TQPA 1GQKA 4M1BA 1E1CA 1DWIM 5J8LA 4XD5A 4ILSA 3ZT6A 4AD1A 2DZWA 3GW0A 3FY1A 4LVBA 1S2WA 4JR5A 4FF5A 2GGJA 2YR1A 5HNTA 4O50A 4LTSA 4I6VA 1ZJBA 1MDLA 4ACYA 3QHNA 4F0RA 1XRVA 1XP3A 4NNCA 2PMQA 3W1UA 2YCJA 3N11A 2C1IA 1JXJA 2PU1A 5T9CE 1CGVA 4RDVA 3WH5A 5EPDA 4CKQA 1POKA 4FNTA 3I7QA 5LSMA 2GSHA 1P7TA 1B3VA 4W8BA 2VR4A 3UVAA 1K77A 2HBVA 5ABFA 1EJXC 2QNEA 2XWEA 3GU9A 3U7BA 1W32A 3LU2A 2WSRA 2PBOA 5MF5A 2R6OA 1TV8A 3QPYA 1SM9A 2FMNA 1G9HA 2NQ9A 5H2ZA 1XFBA 5E0KA 3M16A 3CASA 5H8UA 2QKFA 1WAUA 3BLLA 3BLEA 4G6CA 3VOCA 4HYRA 2OZTA 3RM4A 1IIHA 1EJRC 1XC6A 2WYSA 3BG5A 4PB4A 1BF6A 1YPIA 3D5HA 1XRFA 1RPKA 5BRQA 4GBDA 1A0CA 1UWQA 1EB3A 4LS1A 4GINA 4R34A 3ARTA 4ZQPA 5HWJA 2IXVA 2NQJA 1NQ6A 4US6A 2FMOA 4MZ8A 1JGIA 1JPMA 1PZ1A 3URBA 1VENA 1F4AA 4PMQA 4GACA 3KBJA 5GJPA 3M7SA 5B7YA 4REQB 4IFRA 4NSBA 4C6CA 1W6TA 2IW0A 5HAOA 2EO7A 3WNLA 4FNRA 4LNYA 1EP3A 2OSXA 4DYEA 1BVWA 3OEXA 3RRXA 3ES7A 1VBJA 1LRQA 1GHSA 3DG6A 4TUFA 3PZOA 3D46A 3I10A 1NWTA 4S2BA 5EMMA 5DXXA 3GVVA 3UZJA 4MAVA 3W4RA 1XKJA 1HN1A 3EMQA 4LVGA 2NZLA 3WYZA 1PYMA 2EPNA 4TX9A 4RLIA 5AYYA 3IAQA 4L80A 2WVUA 2QUTA 3S0CA 1XGDA 1A3XA 3AICA 3QR3A 4P5UA 3EZ4A 3ZOAA 4HP5A 1ESWA 2EEXA 4I3GA 3QMRA 1XQKA 1ZHAA 3EWZA 3KRZA 4LCQA 1WXZA 3CU2A 1PB0A 1E5NA 2PLJA 3RAOA 3GIQA 3EB4A 3RR1A 1RBAA 4A3YA 2V82A 3SCQA 3AAMA 4K2SA 2CZEA 5HANA 1DTUA 4NXSA 4OGZA 2FZMA 4JX6A 3GZ3A 3AHXA 1FHLA 3ZJ7A 4CNTA 3A12A 5D05A 1X6UA 3PN8A 1LF1A 1U83A 2PBGA 2O55A 4C1NB 5A8NA 4NUWA 3UZWA 1NF0A 2Z1WA 3EOLA 2NLIA 4PEEA 3M9YA 4DHGA 5JBEA 4MFEA 4LVFA 1OFAA 2G3FA 1LBMA 1VBRA 3S6TA 1ZJAA 1MEHA 3OLEA 4K3ZA 2A2IA 2DZVA 1TVNA 4W5ZA 1YDNA 1CI1A 3MUAA 1GZJA 1RPXA 3B8UA 3NZRA 4R9OA 1POJA 1VPYA 4LYQA 4PODA 2ZUWA 3O7UA 1G4SA 2JKAA 4UFJA 1PZ2A 3VNKA 1QPQA 1TPUA 3OU8A 3P84A 3K8MA 5FEZA 2C79A 1L8PA 3AIUA 3TN6A 1H7RA 2VRQA 1HJUA 2F2HA 2QEZA 1VGAA 4GJIA 4GVGA 1Z48A 2NV1A 2VNCA 1HKVA 1GVRA 3MBFA 1UA7A 3QQWA 1HO4A 4A6GA 2VR5A 3STGA 1TPFA 4OU1A 3KZSA 4C5YA 9XIMA 1RR2A 3TC6A 3TQVA 5EYWA 5IRPA 3PHAA 1UKOA 8XIAA 1GCYA 3N29A 2GOKA 1HKWA 2PD5A 3EMCA 4NQ1A 1Q2RA 4R27A 2PAJA 1UD8A 1ZENA 2H8ZA 1L6YA 2OX4A 1CGXA 1UPMB 2F6KA 1SW3A 3PSVA 1A3WA 1Q3NA 3E9AA 1E9ZB 4XKMA 4YTSA 3DKJA 1ISXA 3UNDA 3LTSA 3LGEA 3BAJA 1C9WA 3MUCA 4F79A 4GI6A 4DJED 5CGMA 4L9ZA 1BKHA 4XTDA 2V5LA 2V68A 4G7FA 4W7UA 1EF2A 5BMWA 2CBJA 4LNCA 2Y5JA 4NG3A 3L65A 5E5CA 4N7QA 3VZXA 4XSLA 1Z41A 3AXIA 3GXPA 4YS1A 4ML9A 5XINA 4QE4A 3SUTA 3L2MA 3GVQA 1J10A 3MJYA 5DCBA 1DIKA 1EO7A 3OLIA 2A1YA 2PDIA 3KAOA 2W3ZA 2WB5A 1VYPX 7ODCA 3TJ4A 5EMKA 3BANA 2J13A 2P76A 3G1FA 2WVVA 2XVKA 3Q2DA 5K4ZA 2PURA 5T91A 5M03A 5ECVA 5DO8A 5EA9A 4GLEA 3QOMA 4M8UA 3VKCA 2XM2A 3CL6A 3VDHA 1SO5A 2GQ8A 2C91A 3PUEA 3H2MA 1F61A 4WUIA 1KRMA 1VBGA 3WF0A 3WH8A 3B03A 1CGWA 3VX1A 5SWUA 3WLRA 5CC3A 3LNMA 1SGJA 5HWNA 4DVOA 2ALDA 2A7RA 4DWDA 5DF0A 1MZHA 3GTHA 2G3JA 3FW6A 5F2LA 1TTPA 3W37A 3ZIZA 3OHMB 1VCGA 1OD8A 1JYVA 3UQNA 5LIUX 3NWRA 4UR7A 1Q13A 3SY1A 3G2GA 2I1OA 1QBBA 1JCLA 2TODA 3DFYA 5HPCA 4Y8EA 3POHA 4H9XA 4JTIA 1JCNA 1JQVA 4IJRA 4ZODA 5CZSA 3UR2A 3EXSA 4GY0A 1W1YA 3IJ9A 3GAKA 2NV9A 3MV11 2AOSA 1XRTA 2DW6A 2R8WA 4HCHA 2Z1SA 3PUGA 3S3GA 3KDOA 2V81A 4OJYA 3KTXA 4M51A 4WKAA 3VFLA 3WD4A 4JTLA 4DNHA 4F9JA 2BG5A 1JZ6A 5CAKA 3NTYA 1EUAA 3SCNA 1W1IE 3GXMA 1ODUA 1W37A 3CV7A 1XUZA 1KCKA 3NO5A 4HZ8A 3T8QA 3WK3A 1DJNA 5E9XA 4FLQA 4HMDA 5FJTA 1VFLA 1O4UA 3WQ6A 3TR9A 4H9VA 3RFAA 2GVYA 3GTNA 2VC6A 2H8XA 5C71A 1G0CA 1A5MC 4JX4A 1XF0A 3VNMA 4PMZA 3LCIA 3AUJA 1RSCA 3T0AA 1B0IA 2F84A 4LYKA 3T08A 3OGSA 5CSUA 1XCFA 4F0HA 2GVEA 3VXGA 1B30A 4MOZA 4AQLA 5H8MA 3BTNA 1VRXA 1E15A 4DM1A 2OGYA 1FWJC 4FOJA 1W9VA 4IMAA 3AS1A 2G37A 1MXDA 3M64A 3QY6A 1H62A 2CLFA 5TF0A 1RJRA 4PMOA 4ICMA 1CLKA 2QQ6A 4XD4A 5EBUA 1AW2A 1X97A 3U2ZA 1VIZA 4QGCA 3BK0A 4QEEA 3OGVA 2V30A 1OIFA 2CYGA 2VOTA 3RLHA 1LROA 1EUNA 3PWIA 3CT7A 1F05A 4W85A 4YTRA 4FPSA 1VBHA 2FHBA 4M81A 2F6XA 2R82A 2CWNA 4N42A 2ZYFA 1UZDA 4DXVA 3KTSA 4F8XA 4KPLA 1Q6CA 1MW2A 1P6CA 4AAJA 4XUGA 1V08A 1E5JA 4H2CA 1TX0A 4GJ1A 3A21A 1ZZMA 4NZ1A 1C29A 1P4CA 1SVDA 3CAKA 1KM0A 3G8EA 4AC7C 2OFJA 3HURA 4OUIA 4OKDA 5REQA 2BY2A 1GNXA 2JF6A 5DMLA 1V77A 3GDBA 2IQDA 1S2UA 1PPIA 4R3UA 4LCRA 2PTDA 3GNXA 4AD2A 2OGJA 3MI3A 3OW1A 4RKAA 4V1XA 4S3GA 4PBEA 3CQHA 3E49A 1RA0A 1YDYA 1UUMA 3KBVA 1S5VA 5T8GA 4OUEA 4N9CA 3MWCA 5D8ZA 3W02A 2POZA 1FDYA 3H70A 1XG4A 4UQAA 3QQ0A 1A0EA 3BG9A 3G1RA 3WX7A 1E3ZA 2ZRXA 3ABSA 4QLKA 1V79A 4KEUA 2ZXBA 3GY1A 3PPFA 3UJEA 1FWIC 5CPMA 1XCWA 1T5AA 2Z1XA 4YHEA 4S23A 1W9XA 1TV7A 3LTYA 1N8IA 1D3HA 2WCSA 4XAYA 4JDYA 1JNDA 4KESA 4HB7A 4A2RA 3VK5A 4AVOA 3KBNA 4H3DA 4C6OA 3W1MA 3DI0A 2R94A 3QR0A 4AZBA 4N2YA 1ISZA 2ISDA 3LTPA 2V8ZA 1OCQA 3C5QA 3RO6A 4WSKA 3Q65A 3DENA 2ZRWA 2Z6JA 3CIVA 2XN1A 3W27A 3LGDA 3FAWA 3T07A 4L4OA 1FWTA 4IIBA 2Y6ZA 8CGTA 3Q67A 3VABA 1AD1A 2B31A 3LK6A 2UY3A 1W1A1 1Q7ZA 1V6UA 4JTEA 4LAMA 2J4GA 3PB0A 4ZB0A 3FCPA 2A3CA 1XISA 4O0ZA 3OA3A 3RILA 3B9OA 1OB0A 5HJXA 3LHYA 1LOLA 1I60A 3AIVA 1C3FA 2E28A 2VDGA 2PD9A 1UIOA 2A6NA 2FB3A 3VIMA 2PDQA 2YW3A 4KFPA 4O1AA 4NY2A 1YDOA 1QRQA 3H54A 5A3HA 5EBAA 3ZLHA 2CXGA 4L64A 4Q7NA 3GKFA 1WBHA 1YTKA 5BZAA 5IM51 1R3RA 4K38A 3W82A 1AQ0A 4EVZA 2YA1A 2XPKA 3CYJA 4JHMA 5HINA 1KBIA 1SUXA 1TG7A 2PGEA 2WWCA 1YADA 4ZCWA 3CMGA 1UD5A 1YXYA 3QOKA 4S3JA 1YEYA 2E6FA 3OVRA 3JW7A 4IP5A 4HSHA 1XDMA 2QF8A 2Y88A 4GZ7A 4UQEA 2OZ0A 3BWWA 3VZZA 5D2WA 1ZSXA 3T4CA 3B06A 3E3HA 3GWQA 4E3TA 3TSMA 4AHPA 3WD1A 1RY0A 1EA9C 2WKGA 2JFEX 3DYMA 3WLLA 5E70A 3KBMA 3NNTA 3W87A 4A8RA 4CQ9A 3BAYA 2O56A 3R13A 1TB3A 2R14A 4I9TA 3S9ZA 2XGIA 4X61A 1UZHA 2Q71A 4PUUA 2F7FA 1XYBA 4HGXA 3B3DA 3LLXA 2KX9A 3NQ2A 3CNYA 4E8DA 1HIZA 3WF2A 4GVHA 3RF9A 3P67A 5A6TC 2W63A 3UG5A 3R1ZA 1MQPA 5D02A 1EHNA 1EP2A 5CZKA 5LNUA 2A7PA 2BHYA 4O0KA 1FHDA 1XYZA 1EYWA 3D3AA 2G50A 1D2KA 2CBVA 3KOFA 3T2QA 4M7TA 4NRSA 4HKPA 3KBWA 1Z9AA 2QCNA 4DB7A 2CLHA 3S9YA 2AAMA 1BD0A 4E2BA 2DFAA 1NFGA 2Y1HA 3PSWA 1D3GA 4LGXA 4JTTA 2DH3A 1K4GA 2DZSA 1FWNA 4WDWA 2Z27A 4WY0B 4RR4A 5LHEA 3U48A 2I5IA 4AC1X 4JFVA 3LPFA 4JD4A 5CLTA 5IDIA 2PGFA 4GZEA 5LIKX 2DH2A 1LL7A 3LI1A 1GGOA 3WDIA 3V35A 1QDSA 2CZVA 3F4CA 4RZ6A 2RFGA 1LM1A 3MO4A 4NVTA 4KWUA 4B91A 3SCTA 2O9RA 2HVOA 4LXFA 3MZ2A 4EE9A 1V3KA 3B8IA 1KXQA 3F4DA 5I24A 3MSGA 1T8QA 2NLYA 1RLDA 3MCMA 3LCHA 1GG1A 2W66A 3LM7A 1XDLA 4L65A 3DHUA 8XIMA 4ASTA 1WA3A 2WM1A 4B5SA 3AHTA 3H2OA 3PJWA 4W84A 2QVNA 1UCWA 2CLMA 4JQ1A 3BAXA 3BV4A 3F2DA 1JULA 5CZ0A 3QXBA 2Z28A 1E0XA 3QSRA 2EKGA 2Y7GA 3GNOA 2VX6A 4PUEA 1XQLA 3KLKA 3WLMA 3RGTA 4ZENA 3WL0A 4O54A 3HIJA 2DT1A 3LYEA 3SJNA 2WZHA 2Y5SA 1EX1A 3HQOA 5F7UA 2C13A 3URNA 2PDBA 3M0VA 3M7WA 3AIRA 2GK1B 5MKGB 2XIBA 2P8BA 3QFWA 1HJXA 3IUDA 3M0KA 3GR8A 1PE1A 2P50A 2QV5A 1MRAA 2EGZA 1BKSA 1U5JA 3TN3A 1MYRA 4IIEA 3CT2A 1H0IA 4GFSA 3OZPA 4FX7A 3ITVA 3H55A 3L4YA 1QNPA 1RHCA 3V75A 1ZCCA 2PGRA 3N9SA 5JH1A 1OFDA 3TE9A 3B0PA 3O63A 4WDTA 2O9TA 4IISA 5LNSA 1SZRA 5BW6A 5C8BB 2HV5A 1PTDA 1WZAA 3V18A 3P6LA 1W5PA 2YB4A 2PP3A 3APGA 5AC6A 4S3AA 3WBEA 2H6RA 5G2WA 1HT6A 2ZUVA 2H3DA 3IEBA 4AD0A 3HPSA 4JTUA 4LPCA 5D9NA 4W93A 5AB3A 4NHVA 1EPXA 4AD3A 3W2KA 1FWGC 1BFNA 3CHCA 3VC5A 3T55A 5BU9A 1UW9A 2GJLA 1MQRA 2YOCA 2V5KA 3UJFA 4HMNA 4LFYA 3ARXA 5D2VA 3IJLA 5AHEA 4XQ6A 1ODZA 5BMXA 4PTNA 1OQFA 3QYQA 2D73A 2B4GA 4GPNA 4Z0SA 2PCEA 4LUSB 1CB7B 1EC7A 2GGHA 4UTFA 5A6SA 4B5XA 3LXAA 4AIEA 3FV9A 4XVDA 1UWRA 3GG8A 4WJ8A 3U4AA 3H24A 3OBEA 3S1GA 1RQBA 3MC5A 1FH9A 3N34A 3OA5A 4M24A 4AWEA 1DKWA 1ADDA 4RDWA 3R2GA 3SGUA 3AS2A 3AJ7A 4GXMA 1Y5XA 5I3HA 4DZ5A 1TV3A 3HBLA 4CNUA 1AG1O 2PDNA 3IJDA 5LIYX 3TU9A 1ZJHA 2PDLA 1LORA 5F1VA 1UBPC 2WKJA 4OHQA 4KMQA 1UUOA 2DZUA 4MTVA 4JHOA 3MP5A 3AI0A 5D33A 2DDXA 3MYPA 2HQAA 3CQIA 2QJNA 3UT0A 5FSEC 2VZVA 7REQB 4NU7A 3NXLA 3TDFA 3LHVA 3V5CA 1V0KA 4Z17A 4MADA 4AY8A 2PLCA 3L66A 4RNIA 2FPYA 2I9UA 1KFLA 2X41A 2V2CA 4P7RA 1KFEA 4WVXA 3QV7A 3PZIA 5D32A 3W1XA 1TWWA 1LBLA 2CLPA 4EF8A 4RL3A 3CZ8A 4FB7A 7XIMA 1G4PA 4JIIX 3OVQA 4C6NA 3WFZA 1SMAA 2WVTA 3FA5A 2WK2A 1IGSA 1L6WA 3MJMA 2WSYA 4GC4A 4I7VA 1M7JA 1C90A 3K2GA 4DAFA 3W88A 4BF7A 5DY2A 1V5XA 1V02A 1LWJA 3WF1A 3H7RA 2C18A 3UZ5A 3KRUA 4AXKA 3TV8A 4FEZA 2B7PA 3UETA 3QVQA 4MDOA 4RNHA 2DP3A 2HMCA 3O05A 1S2AA 3SSZA 1QU4A 5K3VA 4LH8A 5C55A 3SM0A 2C15A 2PTWA 4LJ3A 3N2CA 3A3HA 3E02A 3HV9A 1SPQA 2WMGA 3DC0A 1S3HA 1VAHA 2YLLA 1RZMA 4UIOA 3TK7A 4J35A 1MW1A 2VFFA 4IGHA 2VUNA 4B3KA 4WGXA 3VC6A 4BZYA 3GH4A 3MUZ1 1H5VA 1I6NA 2DQXA 3RMJA 3STCA 3WNPA 3E2VA 2OEJA 1MVYA 2VM8A 1JF5A 1P43A 4PCNA 2JEPA 3NL3A 1H49A 1UWSA 5HWMA 4GA8A 3GSMA 3OLGA 1R8LA 4GUGA 5IBXA 2C0AA 1F73A 1A5OC 2VDHA 5CZTA 3MO7A 3TFCA 1FX6A 4ZTXA 3NQMA 3SQMA 5HQLA 1AK5A 3WLKX 3UFYA 3A64A 1JZ2A 1QWGA 4J3WA 1AQFA 1QFEA 2WKLA 3F5LA 5CAHA 3OVGA 5HNUA 2D22A 3UCQA 4DLMA 3W6MA 3W1QA 5CSRA 3AROA 2OODA 4XAFA 1GPFA 1UIPA 3N4AA 5CPSA 3NGFA 4ZL1A 4ORMA 3WF4A 4MWAC 3TAOA 4XO6A 2BLEA 2NUXA 5HUOA 3U5UA 2J7BA 3M0JA 1CXEA 3V0SA 1UOZA 4M80A 5HDRA 1I8JA 4IM4A 2VD9A 3I4KA 3KWSA 2AMGA 4UFKA 3P74A 2OWWA 5D2XA 4IMGA 2XIMA 1WKFA 4HK5A 4KCTA 4WIWA 3CZGA 4HU8A 3PBVA 6PTDA 4LUTB 3NSNA 4J28A 1KGXA 4Y9NA 2WOQA 1HL2A 2QUNA 1FOBA 5ABEA 3CPUA 4Y2WA 4IPIA 1J0YA 1SMDA 5I3FA 5FA5A 4YCPA 4LRTA 3S5ZA 1OZMA 4AVNA 2J47A 5I0DA 1TMHA 1GORA 4Z42C 1DJHA 4NJJA 2QHAA 2BOGX 3MB9A 3W2JA 5FJJA 3POCA 2EXOA 4Y96A 1UQYA 3C4UA 3NZ1A 1ZTVA 1QHOA 5CBJA 4DZIA 1V3JA 3R8HA 2TYSA 1FWFC 1LUCA 1T0OA 3DBNA 5DEZA 4UR9A 4JAWA 1I4NA 2IQTA 3DHDA 2OT0A 3FEMA 3ZR5A 4HPGA 4C6EA 1JYXA 2CPUA 1A5NC 4FNPA 1Z42A 3HJEA 4DO6A 4JIRA 3PTMA 2VQUA 2ACSA 2HNHA 2P53A 3PC0A 4A3HA 1J18A 2ZC1A 3TR2A 3DZ1A 1WQ5A 2D2GA 3U7VA 3ZLFA 3MUIA 3BVJA 3PVFA 3F5JA 1ZAHA 4HOZA 3MMUA 4H6QA 2RHGA 1W9BM 4L1WA 1RBOB 5HMDA 1B90A 1J11A 3ZVHB 3H4WA 1UQZA 2E6AA 4WQ6A 4LF2A 4S39A 3GHUA 4PCFA 4QFUA 4XBJA 5DBUA 2GZXA 4O19A 5FEXA 1TPH1 2FFCA 4Q8OA 3TSBA 3DFSA 4YWSA 3TOPA 1R47A 2PGWA 2EJAA 3EWBX 1JCYA 4QE5A 4PB5A 3BZJA 2QMJA 5FCZA 2MNRA 4WZHA 1LRNA 2VURA 4WXZA 4LRSA 1BSLA 2JQXA 1PTGA 2G97A 4C6BA 3N4FA 1GW1A 4JTQA 3GC4A 1PVNA 3FA4A 4BA0A 3S2NA 5HQMA 2PSNA 4PMYA 4HHMA 4O1EA 1W8GA 1OHLA 1ECQA 4TIMA 3AMCA 1C8XA 3PZQA 4YN5A 4O11A 3W1TA 2R1KA 3R43A 3MI6A 2WZEA 1HL8A 1LDCA 1BLIA 9XIAA 2XIIA 3GXFA 4UMCA 1F3EA 1M04A 1OYCA 4PRWA 4NJKA 1GYMA 4J5NA 4KRZA 2PODA 1ZAIA 1Y0EA 2WMIB 3WZ0E 2GJXB 5GQBA 1X98A 2QR6A 1G69A 1JPHA 4XZ9A 1QW7A 3RNDA 2Q3RA 3VKDA 4NJGA 1OSEA 2HDJA 3NO3A 4PUNA 2OZ8A 2XISA 3WFAA 5PTDA 1QNOA 2WZIA 4DNMA 4YXGA 2QGYA 1GJWA 4C6IA 4GIRA 1H2JA 2OTDA 3CIXA 3L2LA 4BY3A 3BOXA 4WF7A 1VEOA 4X22A 4HTBA 3GR7A 4GO9A 1O6IA 3I7SA 4PYSA 3VIHA 1FY6A 1SO3A 1ZY9A 2LLEA 4O1DA 1EIBA 4GI4A 4MWAA 4TV5A 1W9UA 1GEHA 1MUMA 2IPWA 1O94A 4G8TA 2O0TA 2FVKA 3L68A 3LXCA 2J77A 3O1NA 3OZOA 4LUYA 5AZ0A 4PEKA 5CCZA 1PX4A 3T0DA 1JUKA 3O0FA 2FQIA 2YCKX 1H1NA 3F5KA 4MF4A 2RUSA 1TV2A 2EPLX 3CUZA 3STFA 3W38A 2OO6A 2QCMA 2KAUC 1GOKA 1EQCA 3GIPA 2YX0A 3BH4A 3DFTA 3NFUA 1OD0A 1QW9A 1A5CA 3E2SA 2VEPA 1TYGA 1K9TA 4IL0A 5AYIA 2OT1A 3TLLA 2YDRA 3VE7A 5KZEA 1EEPA 3GXTA 1UROA 4KEZA 4JXCA 4BK9A 3EDJA 2A3AA 1TELA 3DI1A 5CJMA 1W2PA 3QY8A 2BGNE 4IMEA 4AF0B 1KWGA 1OYBA 4CEUC 1XINA 3WQ4A 3M4HA 4D6CA 1IF2A 4GWEA 4PE8A 4YPJA 1G7UA 3V16A 4JKKA 3BE7A 3R11A 1XYCA 4UWMA 2PS2A 5KZMA 2XH4A 3NYZA 2NW0A 2W62A 3NAVA 3WQEA 3NO1A 2E6YA 1PDZA 4DI8A 3CV1A 1RCQA 4ATWA 1WDQA 3R0DA 3WQPA 1J0JA 1A5UA 4NILA 4CNNA 3SFWA 3GDLA 3LCXA 4JL2A 3TCEA 4ZEPA 3UG3A 1EH9A 2A7NA 2ZCGA 5CC5A 1OG0A 2J88A 4LANA 1U22A 2OELA 3DBPA 2EJ1A 1QPKA 3FNDA 1OX5A 1BWLA 4PFHA 1ITUA 2WHMA 2DY3A 4V28A 2OPJA 4PULA 4RPQA 1SJDA 1R86A 1Z7AA 2BS9A 3NL6A 4MNLA 4GZIA 5A5WA 2C6QA 3ITLA 1XHGA 5M5DA 4ZB5A 3WNMA 2ZBTA 3CIWA 4M1RA 2BXVA 3AHVA 4UZSA 3TKFA 4GUFA 1GOOA 5ECUA 3SCPA 3VOHA 3FGCB 4UQCA 1JUEA 2ZWZA 1CEOA 3QBUA 4QHRA 3WG6A 1JFXA 4D71A 3IACA 3THUA 1GYNA 3WQCA