3SY5A

Crystal structure of the mutant s127a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor 6azaump
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMAHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mutant S127A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor 6azaUMP
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 83
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sy5A00
2G97A 1LYXA 3BLFA 1TRIA 4R34A 5KTLA 1KBJA 4K7YA 3C0JA 3ABSA 1FDZA 4ZQNA 2E5CA 5D03A 2DU2A 2CLFA 1LM1A 4FXRA 1OK4A 2Y89A 1VGAA 2ZZ7A 4Q4KA 4J9JA 3MP5A 3TC7A 3O6DA 4GNJA 2V30A 4KKXA 3CIWA 1SW7A 4IX2A 4EOUA 3NVTA 3P62A 3EXTA 4FO4A 5HNRA 2QJGA 3P74A 3O6CA 2DZUA 5E93A 4UTIA 5DY3A 5D2TA 3MHUA 2CZDA 1T99A 4MY8A 4Z08A 4DBEA 3VI2A 3NL2A 3Q37A 5K7JA 2V2DA 1XBZA 3DBPA 4AHPA 3HBLA 2PRLA 1W3IA 1TPDA 5AOUA 4OV9A 3IIOA 2PRMA 1VLWA 4TO8A 4WY0A 1R2TA 2GUUA 3MJYA 5CGQA 1QPRA 2CFFA 3GZ3A 2F7FA 3EX4A 5AHMA 3ATYA 4MFEA 2Y61A 3PSWA 3EXRA 3FLUA 3W74A 1DJQA 3INPA 4ZQOA 4YCPA 8TIMA 1OFQA 3PR2A 1DQXA 1FDJA 3E0IA 3M1ZA 3DFPA 2J27A 3EX2A 5KMYA 5LGXA 2YZRA 1MO0A 4MFDA 1DHPA 2QJIA 1AL7A 5F1UA 5EY5A 3W84A 1MEWA 4WY0F 4O15A 1CI1A 3W23A 1JRCA 3N34A 3LHWA 3GAYA 2GOUA 1KM4A 2EHHA 5TBOA 1TTQA 4JX6A 4UTLA 2QCGA 4CCCA 2ZCGA 1FXPA 4K37A 3LCGA 4ONVA 4UIOA 5DN1A 3ZWTA 1DOSA 5GVJA 3I7QA 1QDSA 4WZHA 4XKYB 1G67A 1ONRA 5F2LA 1FWWA 4LRTA 2W0UA 4O52A 4DO4A 1DQWA 2QCDA 1EP2A 4UNLA 1EX5A 1C9DA 3MI6A 2Q8LA 1UUOA 3W7RA 3TMLA 4K7VA 4M19A 3UPWA 3L5LA 4W9TA 4UTJA 1YLVA 4K6AA 1GVRA 2QEZA 5AFDA 3ABOA 1GYLA 3BG9A 1M7OA 3BO9A 3ZFHA 3PSVA 1QMLA 2CLIA 5C55A 3W85A 4KWVA 4RLIA 4X9SA 4JYFA 3RU6A 3NQCA 4EVZA 3UWVA 1LOSA 5D02A 2ZTKA 2QCNA 4XKYA 3HG2A 3CQ0A 3EWWA 1K3UA 5AHEA 5CPLA 1H63A 2NLIA 2QCDB 1WDWA 1H51A 3WK0A 4ADSA 1TV8A 1WAUA 4CQAA 1F5ZA 2JKPA 3SIZA 1OYAA 3DFSA 4UTUA 1RD5A 3LRLA 5G4WA 2X1UA 5KSWA 3HPZA 3W7CA 3R5EA 3NPWA 3TXZA 1SZGA 2Y63A 3NGJA 1QPOA 3PVFA 2R8WA 1R2SA 1XXXA 3NEVA 2HSAA 3S42A 3QPYA 1VPXA 1JCXA 2C13A 3WJYA 4OV4A 2ZZ4A 4NNBA 1GVSA 1ZJIA 4AEOA 2V8ZA 5G4EA 4O0KA 1IIHA 2BLEA 3W75A 3W1QA 4BI5A 5D30A 2X1RA 2JGQA 5F4SA 3NQVA 1AL8A 2CLOA 2TSYA 4KFOA 5G2IA 3Q2DA 4NNCA 3MHGA 3SSJA 1ZAIA 1SZFA 2VKZG 3W2MA 3NQ8A 3SI9A 4K8HA 1SSDA 1MZHA 1YXDA 4ALDA 1F05A 3BVJA 3GR7A 2YFOA 4FB7A 1B3OA 3BGJA 5TIMA 4DQWA 4NX0A 1TB3A 2A2IA 2O7SA 4CQ8A 4D2JA 1RV8A 2G96A 3KRZA 4FIQA 2V5LA 3TMQA 2Z0IA 4JTHA 1NAL1 1RR2A 1VJIA 3B03A 2ZQ0A 5AYZA 3LB0A 1DJNA 4LRSA 4HNNA 4KFPA 4OBTA 3SW6A 1B9BA 1RPXA 3QSRA 4YWIA 3ELFA 4L4LA 5CZSA 2TPSA 5AYYA 2ALDA 3IVTA 3L65A 1ICPA 3G3MA 5F2GA 2E5DA 1JRBA 3NPVA 3SY5A 1YDVA 5I3IA 1OX4A 3GDLA 3W1UA 4RCXA 1ZAJA 4B5NA 2OJPA 4K8EA 1KV8A 1O5KA 4UTTA 1BKSA 2CW6A 4GFSA 1EP3A 3CU2A 3B04A 1H7RA 4O14A 4HIBA 1B4EA 1AK5A 5G2HA 2D73A 3NG3A 5FI8A 1SO6A 5A5WA 1RVGA 3P67A 3UNDA 2DJLA 4O1DA 1Y0EA 3GLCA 3T4CA 1LLZA 3NM1A 1JUKA 1TPWA 1I2QA 2DP3A 3RMJA 4MZ8A 1W8SA 3LCXA 4AAJA 3RNDA 3KX6A 3GDKA 3LX9A 4ORIA 5FESA 3EX3A 1K03A 3UPBA 2G95A 4CCEA 3WFAA 3TXVA 3W22A 1IXQA 3T44A 3VE7A 1PS9A 3MWAA 3LCHA 3P8IA 3DI1A 4KWWA 4MJMA 3QEZA 5HWJA 1FY6A 2NWRA 3C52A 5BMWA 3TROA 4O11A 2CLMA 2BTMA 1W5QA 1DVJA 1XDLA 4UTWC 1FUYA 3PULA 2I9EA 2CLHA 1R2RA 3NXFA 4O50A 3HPSA 3W86A 4E38A 4Z1DA 2OT0A 1H7OA 3UYCA 4I7UA 3MI3A 1FCBA 2CLLA 3EB2A 4E2DA 2E09A 3TFXA 1KLYA 3FEMA 1C29A 3BW4A 3QQ0A 2C15A 4JTFA 2YXGA 1Q6QA 3DFNA 1U83A 3VE9A 3A5VA 5FF2A 1GG0A 3GNNA 3T55A 3W7OA 1KFEA 3STCA 5HR6A 4O10A 1HFBA 2Y7EA 5J5DA 2P1FA 1OFRA 4UFJA 5KZDA 4AF0A 3UD6A 4DF1A 4DPQA 3R2GA 2YDAA 5EKYA 3W1TA 4RR4A 1EIXA 5C6MA 2ZRZA 2ZRYA 2A85A 3GB6A 1WBHA 3W07A 3S9YA 1UJPA 2YYTA 1CW2A 4GC4A 3QH2A 4JTKA 3PF3A 2GJNA 4QJ1A 1TMHA 1RQBA 2ZZ6A 1QO2A 2ZZ5A 2NX3A 4HKPA 1XDMA 1H62A 3B0UX 3FKKA 1KFLA 4ZZ9A 2E5BA 4FHAA 2VEPA 3CWNA 5LNSA 4AH7A 3N73A 1TQXA 3G0XA 1BEUA 1J2WA 4Z0JA 5CZTA 4ZL1A 3LERA 2B7NA 4UR8A 5D37A 5K9CA 2E6FA 5DLCA 2X1SA 2Z1BA 4DO6A 4Q32A 3OEXA 4LU0A 1MEIA 3HOJA 2C6QA 5CKSA 4FNSA 2Y70A 1W0MA 5HWMA 4PA8A 5HQEA 2P0OA 3P7YA 4A22A 5KZEA 4LVBA 1A50A 3V75A 2VFDA 4N4QA 3OVPA 1TREA 3KVJA 2NV2A 3BLIA 1QAPA 3LHYA 3C3NA 2A7NA 3O05A 4GBUA 3MBDA 3C56A 1PIIA 1W54A 3LI1A 2QCMA 3HB9A 2QCEA 3CEPA 1SO3A 4JTGA 5H2ZA 3STEA 1GWJA 3KOFA 1F74A 1B57A 1OFOA 1W37A 1LBMA 3DFQA 1ZHAA 4XBKA 2B7QA 4DPPA 2VFEA 1LRTA 1UB3A 3HIJA 4UC5A 4ZQRA 1P4CA 3TAKA 3FJ6A 3IIVA 2R94A 3KVMA 1DKWA 1W5OA 3NZ1A 2E68A 5AHLA 2HTMA 1EB3A 3GVGA 1B4KA 4R53A 2QDGA 4NJKA 3G1YA 4RXGA 1Z48A 2VXNA 3BW2A 2A6LA 1WA3A 2WNQA 1OFDA 4UNKA 1IXNA 3MP3A 3LHTA 3PBUA 3QJAA 3S5ZA 1K8ZA 1ALDA 3B0VC 3SGZA 1JQVA 1ZAHA 3G18A 1W56A 3SFKA 1GJPA 3O06A 3NQFA 1HO1A 3M5XA 1FDYA 2WSYA 4O0ZA 3FFSA 4TMCA 1KM3A 3EKZA 3HQ1A 2NZLA 3NQEA 2B0MA 3UWYA 4BWLA 4A2SA 3MYPA 4BI6A 1H7PA 3B06A 4UR7A 2V81A 4JDYA 3LTSA 1HUVA 1NEYA 4XZ9A 3Q94A 4CLMA 2FB3A 4NZJA 2P10A 3W9ZA 3MBFA 1ICSA 2RFGA 4A21A 1H60A 5CZ0A 1IXOA 2NUWA 1PCWA 2C18A 2H8XA 4XBSA 4IPIA 3NPUA 1NVMA 3BGGA 2ZZ3A 4JYEA 4N2YA 3HG5A 4O13A 3C2VA 3STFA 3W7QA 3K30A 4IJBA 3S1VA 1KA9F 2OT1A 4JTLA 5K9XA 5C2XA 4FX7A 1HL2A 4UMBA 2V0TA 1VHCA 3B4UA 4I7VA 5HJLA 3NQ6A 5A8GA 3ZR4A 1OFEA 3NPXA 5HR7A 2QDHA 1G4PA 4XTDA 1WX0A 2J9ZA 2W79A 3LBMA 2CZEA 1TV5A 1I2NA 1Z44A 3W1AA 2ZRUA 3W7JA 1XBVA 5E1QA 3I65A 3NO5A 3VCRA 1JCJA 3QF0A 2GJLA 1DL3A 5HUPA 3IIZA 4FNUA 1GYNA 5ABTA 1LRQA 3HGOA 1LLWA 3NQMA 4PFMA 3FA5A 3O63A 4A2RA 4BR1A 1AW1A 3DHFA 4NUWA 1L2UA 1O5XA 3M41A 1FWRA 4BFAA 2RKXA 1D3HA 1I2PA 3LBCA 1LBLA 3Q58A 2QUTA 4JY9A 2A5HA 2PRHA 2GVJA 3CT7A 3LCWA 1V7YA 1W5PA 1YTKA 3LCIA 4S1FA 3JR2A 2VENA 1XBYA 2AAMA 3N14A 1Q6LA 2FIQA 3G0UA 3W1LA 3FIGA 4O8RA 5LNWA 4Y6GA 1BWKA 2I14A 3R89A 3W3OA 3OBKA 4HNUA 3TW6A 2ATMA 3QW4B 2ZRWA 2E6DA 3E96A 3N9SA 3W2KA 2BSLA 1C8VA 2H6RA 1QPNA 3LLFA 5C5YA 3LGEA 4ZQPA 3LHVA 3TJXA 5D2XA 1WYIA 4LS0A 5FF7A 3G8EA 1M5WA 2Q3RA 1O95A 3CWOX 1F6PA 4Y96A 1S5WA 1Z42A 2B7OA 4FXSA 3U2OA 1SSGA 1FQ0A 1FWSA 3TE9A 2E6AA 3EWBX 4BK9A 1XUUA 3FYOA 3PG8A 4GUGA 2V2HA 3NQDA 3SR7A 4DEFA 1VQTA 3TSDA 4ZMGA 2WV8A 3PS7A 3PC0A 1O60A 4GRSA 4EWND 4P61A 3DH7A 4MOZA 3ATZA 3CTLA 3UQNA 3H53A 5K4ZA 4FX8A 4EIVA 4R7JA 4HPXA 3P5YA 2EF9A 2O7QA 4JX4A 3LTPA 1KM6A 1KM1A 3HGRA 3UWQA 5K2ZA 4I7WA 1VHNA 3TUUA 4O53A 3L68A 3EWUA 1SW3A 3UY8A 1K7EA 4OHQA 2RHGA 1SZNA 1JJKA 2CZ5A 5LKYA 3PUDA 2QCCA 3G1FA 4HHPA 4WY0B 4K39A 3MUXA 3VKJA 4O16A 5D04C 3HPXA 1L6SA 3TR2A 1EWEA 2X16A 4M7SA 4WJEA 1TCDA 2DZXA 2OMAA 1TPB1 4R33A 1N55A 1FCQA 1H50A 5AB3A 1YPIA 2WQPA 4QSHA 1I4NA 3UZ5A 6ALDA 5CG7A 2ZBTA 3B0PA 2WO5A 3QZEA 5EBUA 3TAOA 1DBTA 5DCEA 3L21A 3F4WA 3R12A 4Y8FA 3C8FA 1GG1A 4TX9A 4O4VA 3W2NA 4O19A 4NXKA 2AQWA 5F2MA 3GDTA 1W1ZA 3C2EA 3C2FA 2NXIA 3A23A 1EA0A 3FOKA 1A5AA 1YDOA 3KAOA 1QOQA 3W7GA 1FWNA 1NFBA 2GPTA 4OT7A 4JS3A 3WJSA 1LCOA 5TQLA 2FFCA 3RK8A 1XFBA 3NM3A 1KW1A 4JY8A 4UMCA 1W5MA 4GXMA 1GTHA 3HMJG 2RDUA 4MJZA 3DGRA 3I6RA 1OK6A 3LRMA 4ORMA 3QQ1A 2A7RA 2C14A 5LGZA 3SJ3A 1TSIA 1IIGA 4ZQCA 1GPWA 3I68A 2I1OA 4IWWA 2FPVA 4O18A 3P61A 1T0OA 3TSMA 1NF7A 2DJXA 1EPXA 1ICQA 1TPC1 5G1TA 4YLWA 4O54A 3LCFA 3TFCA 2J9YA 3KVLA 2WPBA 5AC7A 2EAWA 4DF0A 3MHFA 4O4WA 5AYXA 4E0CA 5HMSA 2VFGA 1VRDA 2A4AA 3GKFA 1GTEA 3FJLA 3AO0A 1H7XA 5AHFA 3QC3A 4ICNA 2FLIA 3S5YA 3PB0A 4LV4A 2C3ZA 4JTJA 1K7FA 4YL2A 5DY2A 3M5YA 3W71A 1XC4A 3LTYA 3O6YX 4O1AA 5D09A 4UCGA 5FEZA 4JEQA 4NJIA 4MVAA 4QQ3A 1XUZA 3NOEA 3A5FA 1JCLA 2QAPA 5I3GA 3SGUA 5L9FA 3W7LA 1AMKA 2WSRA 1TPVA 1LOLA 1AW2A 4YMZA 1F73A 1PV8A 3N3MA 4IXHA 1GQNA 3ABRA 2OX1A 3NQGA 4DBDA 5EL1A 3TW7A 2BXVA 3DKLA 3TJLA 4Q33A 2WNNA 2V9DA 4UTMA 1KTCA 4LY8A 4JX5A 1OJXA 4WOZA 3W1MA 2RDWA 3GYEA 2Y85A 4NX5A 3DFOA 4WXYA 3LDVA 3W76A 3NDOA 5LZLA 3W7EA 3KXQA 2YW4A 2ZRXA 4AWSA 1XCFA 3P8JA 4X2RA 4M6PA 3A21A 1CX9A 3LI0A 3CB8A 2H3DA 3RF9A 4ADTA 4Y9AA 3QMSA 4LVFA 4MLJA 2TMDA 3A9IA 6TIMA 1KBIA 1TTJA 1LTDA 5IM51 2X2GA 2QUUA 1W5NA 4LUIA 1Q6OA 4JTIA 4MLRA 1SPQA 5FF3A 2ISSA 1G69A 2ISWA 3W1PA 3IIXA 4JIQA 4YXGA 3NQ2A 3USBA 1P0NA 1S5TA 4MYAA 4OWGA 4FIRA 1OX6A 2R14A 1J4EA 1OF8A 3WJZA 1FBAA 3VNDA 3W2LA 3TC6A 4EF9A 3IV3A 3MI2A 1X8FA 4QM1A 4P2VA 5DCDA 3W2JA 3W70A 4XUGA 3T7VA 3E02A 1E51A 1IXPA 4UTTC 2R91A 1S5VA 1KFBA 3EX6A 5LSMA 5KITA 4BI7A 1PL9A 2VEMA 2LLEA 4ZVJA 1XM3A 2YPIA 4M5PA 2WNZA 1SQ7A 4A29A 4M6VA 1VS1A 3EX1A 5SWUA 4Y90A 4MZYA 1XL9A 4IX0A 3I7SA 2YFNA 4UUIA 3GR8A 2C16A 2GVLA 1TPEA 3UWWA 1FCVA 2ATSA 5FEWA 2V82A 1GOXA 4FNTA 1VC4A 2A1YA 4N6EA 4UFLA 4CCDA 1P5BA 4KFNA 5IBXC 4PCFA 2KZHA 2Y62A 5D38A 1FX6A 3UZJA 1J5TA 3OVQA 3W87A 3G8RA 2JKAA 4N9EA 2B4GA 1FCUA 1S3HA 4WUIA 1JCNA 2VELA 1PVNA 2Z6JA 2YR1A 5G5IA 3LM7A 3CM4A 2ABAA 4PEKA 4H4IA 4NXSA 2YCEA 3TDFA 4IMEA 2J88A 4CNNA 1F6KA 3P82A 2DZPA 3WJXA 1R47A 4UTWA 2UV8G 3HGJA 4X22A 4ZQMA 1YYAA 4PL2A 1SO4A 3PUOA 1QOPA 3LHUA 1TO3A 2Z2UA 4LW7A 1WQ5A 3HJZA 1TJPA 4GE8A 3V1PA 3M7WA 3L5AA 3W7NA 3IIPA 4XTIA 3BLEA 3TU9A 1SFJA 3DKJA 4NNAA 3G3DA 2CLKA 5U4NA 1KTBA 3QMRA 1KFJA 3NZRA 4PL1A 3U6WA 2PCQA 3W2UA 1L6YA 1ME9A 4IOTA 4RZ6A 1QO5A 4HSOA 2YSWA 4UTHA 3G1DA 3CEUA 4RJEA 4TIMA 2Y7DA 3VFLA 5T26A 1VCGA 3ABQA 3H54A 4LC6A 3BK0A 1KFCA 1KTNA 3C61A 1TQJA 3KHJA 2Y7GA 4WXZA 4UTKA 2HS6A 1H5YA 1VR6A 3L9CA 4RZ4A 3G1SA 3ZWSA 4HT3A 2YYUA 4MY1A 4X3ZA 3SZ8A 1NF0A 1G4SA 4N9CA 1I45A 2DORA 2FPYA 4GUJA 4JD4A 2CLEA 3TNOA 1TPH1 3DU0A 4HPJA 5D2VA 4AWTA 3I7RA 3M9YA 1OFBA 2NX9A 2C0AA 1I2RA 3OA3A 3IGXA 4BF9A 5DELA 3L0NA 3EWZA 4C1LA 2WKJA 4FNQA 1JCMP 4N4PA 4HN4A 3GAKA 3GXTA 1LROA 1G6CA 4IUOA 3PM6A 1JCYA 4WX2A 5LNUA 2JK2A 5EA9A 5K4XA 3FKRA 2G5WA 4LOCA 4WOQA 3R8RA 2ZYFA 3CC1A 4UFIA 3GIYA 3TH6A 2ZRVA 3S1UA 1H1YA 4FEZA 3GKAA 3EEGA 1ZCOA 3NYZA 3L5MA 5KZMA 1VYPX 3B05A 3LLDA 3FYPA 1LOQA 1FXQA 3G1XA 4GJ1A 1QCWA 3W7MA 1YDNA 3HG4A 5EYWA 4GWEA 3C4UA 3HGSA 4H3DA 5EMUA 1XBXA 4I9AA 1IGSA 1P1XA 4S2BA 4TR9A 4MYXA 3GDRA 4LVAA 2PC4A 3C2RA 1PE1A 4IGHA 3NL6A 3C2OA 4S2CA 4AMAA 3LXBA 4H6KA 4CNOA 3W83A 4JNMA 3IVUA 3RFAA 4AHOA 3TA6A 4JGDA 4K36A 4NJHA 1R46A 2C1HA 3QM3A 1GEQA 1AG1O 1A5BA 3NR0A 5I3FA 1N7KA 2A7PA 2QF7A 4JTEA 4O57A 1VYRA 1ADOA 3PBWA 5LNVA 1QPQA 1KM5A 5I3JA 4MUZA 3M44A 3ZS4A 3N2MA 1MSSA 1WOBA 1ZALA 3TV8A 3BW3A 3DXIA 2DZVA 4AF0B 5MHBA 3S5OA 3MP4A 1KFKA 1HTIA 3NA8A 2VFIA 4IPJA 4LT9A 3W73A 4O17A 3JS3A 1BWLA 4RX0A 3LCLA 4O1BA 4DELA 4ML9A 4N9DA 2FQIA 1VZWA 1WBJA 3THQA 2YW3A 5AC8A 2NXGA 3UY7A 4AXKA 1G4TA 2H90A 3W1XA 4Z0SA 4POCA 4OQVA 5DXYA 4IXXA 2ZDRA 3STGA 1RQHA 3EKLA 1W3TA 5DBUA 1K8YA 3S1XA 2FTPA 2WOQA 1VLIA 2FB2A 3L0KA 7TIMA 1A53A 4PODA 1TPUA 2EKCA 5LHFA 4FNPA 1TPFA 3DZ1A 1TTIA 3UWUA 3DENA 3T78A 4Z1BA 2Y6ZA 4LS2A 5C54A 3FS2A 1M6JA 4CQ9A 4RV8A 1H61A 2DZTA 1PHQA 3KFTA 3TIMA 1N8FA 3L2IA 3W7KA 3TCEA 1YXCA 4E2BA 3NNTA 1A5CA 4RK8A 3KVKA 1MXSA 4MIMA 1UCWA 3O16A 5F4XA 3MW7A 3W7HA 5J5RA 4AB4A 4NJJA 5D05A 4MY9A 1W31A 1I2OA 5CSRA 2QUVA 3L0GA 3TQ0A 3N9RA 1Z41A 2DZWA 4EF8A 1H1ZA 3NL3A 1GZGA 3NQ7A 4Z1AA 1GVOA 1V5XA 3LXAA 1JR1A 2GQ8A 5D2WA 1X1ZA 1XI3A 4LC8A 2FDSA 1Q45A 3E9AA 1DV7A 3YPIA 3G1AA 2XN1A 1L9WA 3UXAA 1THFD 2GVGA 4AWUA 5HUOA 4DF2A 1G7UA 1XKYA 3C6CA 3M47A 1JVNA 1OYBA 2V2CA 4JDBA 2VEKA 5LNRA 1SUXA 1WV2A 4M6QA 2ZFAA 2J9XA 5AC6A 2B7PA 2BWGA 1UBSA 4U28A 1QR7A 1YADA 2E6YA 4JYDA 3G0SA 3GXNA 4OE7A 4JN6A 1K02A 5I3HA 5FF0A 1X6UA 2XFWA 4NVTA 3P84A 1Q6RA 3BPWA 3PB2A 4HSNA 1U5JA 2QKFA 3UXDA 1ME7A 5D32A 2ZA2A 3M5VA 4N02A 2J6XA 3WK3A 3D0CA 1GT8A 4LNYA 2H3BA 4ADUA 3QPZA 4NT0A 3S1WA 1YTDA 1GVQA 4FNRA 3IGUA 4PC8A 4QIUA 3CIXA 2A0NA 1ML1A 1SO5A 4YCOA 2ZZ2A 3O8AA 4O28A 4TMBA 4RZ5A 1PHWA 2Z6IA 3GK0A 4JICA 3NL5A 3NAVA 4FX6M 3LOTA 3QSTA 1FWTA 1P0KA 3OHIA 3QYQA 3CLMA 2JBMA 3P5ZA 1AW5A 3NQAA 1L6WA 1H7NA 3TKFA 1SFLA 3F1QA 5K3VA 2JGYA 4UFHA 4XQ6A 2QAFA 4IMCA 3P81A 2V5BA 3G24A 3S0CA 5AN7A 1HO4A 3G1HA 4CNPA 3TX9A 2C19A 1X1OA 3IEBA 3JRKA 3W1NA 3E49A 4IMGA 1LRNA 3BV4A 4JTSA 3TQKA 4MZ1A 1F76A 1G4EA 2VFFA 1OF6A 4RXFA 3GDMA 3OVRA 1JULA 2GQAA 4AVFA 5D2YA 3CHVA 4NJGA 2OCZA 2XN2A 3BG5A 3PY2A 3LV6A 1EUNA 2QCLA 3CPRA 4MPQA 2ZA3A 2DZSA 1QNVA 1OFAA 5AHIA 2FPTA 3R13A 3QRHA 4NQ1A 5DBTA 1EUAA 4JIPA 2HMCA 3BG3A 3LV5A 3M6YA 2ISVA 2Q3OA 1VCFA 2BX7A 3RLUA 2H8ZA 1ZNNA 1ME8A 2X1TA 5KINA 2NV1A 1TYGA 3O1NA 2ZA1A 5BRBA 2XN0A 2Y88A 2JKEA 5K9DA 2OZ0A 3QW3A 2RDTA 5HINA 3EWYA 3U8GA 2ZZ1A 4FF7A 1Q3NA 3W7PA 3SECA 1IF2A 1KM0A 5L6UA 5BW6A 2TYSA 3QFEA 4GUHA 4MKNA 1O94A 4K38A 4OGZA 3A22A 2IQTA 3IGSA 1K7XA 3WK1A 2J24A 3L66A 1JUEA 3P60A 5EPDA 3LRKA 2QR6A 3HG3A 5DXXA 5U7SA 2GQ9A 4PH6A 3M0ZA 3F03K 4NZFA 1TJRA 4AHQA 4GUFA 2WSQA 2Y7FA 1LZOA 1BTMA 2CWNA 3W72A 5LHEA 3AJXA 5AHNA 1ZENA 4N6FA 1DORA 1OABA 5CZJA 3ANYA 2WJZA 3M16A 4A3UA 3S5NA 4LTSA 1OHLA 3PG9A 5F2IA 4QAIA 1TV7A 1W3NA 1JQXA 3EWXA 4LS1A 1LORA 3B8DA 5H91A 2TRSA 2VC6A 1HG3A 3OIXA 2BZNA 3GNDA 2A21A 3T40A 1SR9A 4IMFA 1TIMA 1KV5A 3PBVA 4Z1CA 1SW0A 4N9BA 3TK7A 1OYCA 3KRSA 5FF4A 3S6DA 2VFHA 4O1CA 5DCBA 1F2JA 4UFKA 2QCFA 1X7FA 3M5ZA 3P80A 1LBFA 1OX5A 2ABBA 1WXJA 3W7DA 3N19B 1GVFA 3L67A 5I3KA 3IVSA 5HULA 3G1VA 1QFEA 3HO8A 3PAJA 4UXDA 5E0KA 4GUIA 1R30A 4WQ6A 3DAQA 4L4MA 1YTEA 4LVDA 1TTPA 3PBYA 3THAA 2NUYA 3WJWA 3PUEA 1PCKA 5CPOA 1K8XA 3W88A 3GXPA 5BOOA 5G1YA 3IRDA 3DI0A 2AGKA 1H7WA 2YGYA 1A5SA 2EGZA 4QISA 3LXCA 2NX1A 3LHZA 3BARA 1O4UA 1OFPA 3MMTA 3W1RA 2CZFA 1JUBA 4QNEA 1QWGA 2X30A 1VYSX 4UFMA 2VEIA 3W6YA 4BWLC 3O15A 1KM2A 1EEPA 3MO7A 2PE4A 5G2WA 1T8XA 1D9EA 2PURA 4JTTA 3DHDA 4UMAA 3O07A 1ZFJA 3H55A 4C1KA 2VOMA 1OG0A 2ZTJA 1MEHA 3DFTA 1SU5A 4LUJA 4O12A 3E12A 5FEXA 5CSSA 5F1VA 2E1DA 5FEPA 4LV9A 1LDCA 2NWSA 4XWUA 4JXCA 1KLZA 1OX4B 1UUMA 4DXVA 2E77A 3GX9A 2NXHA 5HWNA 3A24A 1WOAA 4IQLA 2FJKA 3N2XA 3S8HA 5BMXA 1YPFA 5F4WA 2CU0A 3EXSA 1OVDA 2QCHA 2RH9A 4QNWA 3OG3A 1RQEA 1G7VA 3F4NA 1ZY9A 3KRUA 1SZEA 5IBXA 4NU7A 3RLVA 1F7BA 4LVGA 5CPNA 4JR5A 4TU1A 3W7IA 1VH7A 1UASA 4G1KA 3M43A 4IMDA 3TSBA 5BNKA 1T96A 2W6RA 3UWZA 5D33A 3TQVA 2QJHA 1EP1A 1M7PA 1VCVA 2Q8ZA 4OU1A 4PTNA 1I8JA 3WK2A 1D3GA 4JTUA 1TRDA 2A6NA 4U4MA 2NUXA 4HNTA 2YX0A 2EPHA 1LP6A 3MYOA 2F84A 4HNVA 4M7TA 5CPMA 4DO5A 4QITA 2HS8A 3QMTA 4WD0A 1EWDA 3PWAA 3HF3A 1RZMA 4LWWA 3G22A 1NSJA 1YXYA 4RKAA
chains in the Genus database with same CATH superfamily
2G97A 1LYXA 1LG1A 1ENUA 1P0EA 1CT5A 3C0JA 4DY1A 2DV0A 1LM1A 1OK4A 2Y24A 1CYGA 3MP5A 2XUCA 3CIWA 2VC5A 3CASA 1QI5A 3NVTA 5JUVA 3VDCA 2QJGA 3P74A 1XYBA 2OLAA 4PUUA 5D2TA 3FDKA 1S2CA 1OC7A 5K7JA 3JW7A 2I17A 3EB4A 3WMLA 4AHPA 4MG4A 3HBLA 3T2PA 1W3IA 4FA3A 1WZMA 1VLWA 1R2TA 3A12A 2GUUA 4EXAA 3MJYA 3MT1A 1KNWA 3GZ3A 3U0HA 3EX4A 2ACRA 2CBIA 2Y61A 3INPA 4JZ5A 3AJ7A 3E0IA 3DFPA 3C0LA 3EX2A 5KMYA 2YZRA 4MFDA 4JN7A 1MEWA 2XU2A 4DUOA 1EEXA 1CI1A 4G1NA 3EDFA 1T5AA 3GAYA 1YIXA 1DTNA 1R38A 1HX0A 3PJXA 1QW7A 4CCCA 5DMLA 1PYMA 1SFSA 2ZCGA 3EA2A 4MHBA 1NARA 4UIOA 5DN1A 2WMKA 3T1GA 4GHRA 3EEZA 3PHAA 4FXJA 4PCNA 3H7VA 2G4FA 3NVDA 4DO4A 2QCDA 1EP2A 5C2GA 3DUGA 1EX5A 2Q8LA 3UEQA 3NJ3A 3GG8A 1YW1A 3ITXA 3WNMA 1UHVA 4YHEA 3VNLA 4R3UA 5XIMA 3ABOA 1GYLA 1YBQA 3W37A 4FR6A 4O1EA 1UKPA 1R0MA 4IGMA 3KL0A 2XIJA 4KWVA 1Z6KA 4JYFA 3RU6A 1BRLB 2PWFA 4QEHA 3UWVA 1LOSA 1W17A 1J96A 3WUEA 3HG2A 3CQ0A 2FH6A 5LIXX 2FGZA 1IE7C 5AHEA 1PSCA 2QCDB 1WDWA 5JBFA 5A2AA 4AWEA 1H0IA 1TV8A 4H9MA 1XLHA 4JTDA 5FIPA 1BYAA 2JKPA 4UTUA 3CL8A 4C65A 1Z69A 3WNPA 5KSWA 4LBSA 1SZGA 1KGUA 4YJ5A 3KEHA 1QPOA 2Z2AA 3ITVA 3PVFA 4EKJA 1R2SA 1XXXA 2OO0A 4D6GA 3T4WA 1JCXA 2C13A 5DT5A 4J3VA 2HK1A 2XPKA 3FA4A 3W75A 4BI5A 3W1QA 5D30A 1JDDA 3LZ5A 1M65A 2Y2WA 1AL8A 2TSYA 1MQQA 3BAYA 4B9YA 1QNQA 3NQ8A 4D8AA 2MNRA 4IPNB 4C7DA 1JXKA 1YXDA 3BVJA 4FB7A 2YFOA 4C5ZA 4UTFA 3EPNA 5TIMA 5LYRA 2A2IA 4A8LA 2O7SA 4ICCX 4CQ8A 2CKRA 1RV8A 1UD6A 4W4QA 3TMQA 4JTHA 3RM9A 5D9NA 1RR2A 1VJIA 5T9CE 4L9ZA 1UZHA 3ARPA 1XRTA 1LT7A 2W5FA 3WMSA 4OBTA 2BGQA 4PSPA 3WF3A 3AMDA 1B9BA 1RPXA 2ZVRA 3QSRA 4V15A 4YWIA 2E8YA 2E9LA 2TPSA 5AYYA 3IVTA 3WFZA 1ICPA 2E5DA 3AMKA 2PMQA 4Q6XA 2ZWYA 3P6LA 3PZNA 3GY1A 3TONA 4UTTA 1VFOA 2PTYA 4C6IA 1TWDA 5IFPA 2OU4A 3R4IA 3LPFA 2I5GA 5FI8A 1BXBA 3T8QA 2WAGA 4NILA 3IJIA 3E74A 1FWDC 3T4CA 2G3JA 1PIGA 4YTRA 4L6DA 2QVHA 4ZGYA 1XSIA 4NAFA 3LCXA 1PKNA 3RNDA 5FESA 4ORIA 1QOXA 4M24A 3KBMA 4CCEA 1OB0A 1PKYA 3VMOA 4GZIA 1CZ1A 1NWRA 1MDLA 3PK7A 5FJRA 3S5SA 3R94A 1VFHA 4ATLA 2F2KA 3T9PA 4PMRA 4CUCA 2D0FA 2OODA 3TROA 4DUVA 3WBXA 4UTWC 1FUYA 1BHGA 4NZ1A 2I7GA 3NXFA 4E8CA 2OSYA 3M0IA 4GABA 4D9PA 1XLEA 1H7OA 1TUXA 3GS6A 4I7UA 2DEPA 3UYCA 3WBAA 3MI3A 1ESWA 4HZMA 3URNA 2INEA 4B90A 1KLYA 1X6LA 3QQ0A 1W1A1 1FWJC 1X38A 1UH4A 1EC8A 2YXGA 3DFNA 1U83A 2A3CA 2GVEA 3LMYA 4LEFA 1GG0A 3GNNA 3T55A 1KFEA 3STCA 1Z9AA 3B4YA 5J5DA 2P1FA 2OZ8A 4AFYA 4AF0A 1QHPA 3R2GA 5EKYA 2FHBA 2OYKA 4RR4A 3L2LA 3GB6A 7ENLA 4R88A 1H09A 4GC4A 1CW2A 3PF3A 3VINA 2MANA 1KXTA 3V36A 1XX1A 2PODA 2ZZ6A 3BJFA 2A79A 4HKPA 1R3SA 3GO2A 4MKSA 1R3WA 3WQDA 3VIIA 3A47A 3CWNA 1JZ8A 1MMFA 4GQGA 4Q6JA 4ACZB 4Q4OA 5I00A 3MUCA 4ZL1A 5K9CA 1E71M 2X1SA 2DW7A 1TR9A 4Q32A 2FGBA 3OEXA 4P7NA 4C7GA 1WDPA 2Y70A 4PMOA 2J8TA 4DB7A 2P0OA 4IIGA 4PTXA 1KO0A 1M68A 2VDHA 3CUXA 2PTXA 4L65A 3OVPA 1MXDA 1GGOA 4MTVA 3VCCA 5MKGB 3SQSA 4DYKA 1QAPA 5I78A 3KLLA 4QG9A 1OCQA 1NM9A 1PIIA 3LI1A 3WBEA 3UZXA 4U3CA 3P0WA 4PUJA 2XTKA 5H2ZA 2HNEA 1GWJA 3KOFA 4B3ZA 1B57A 3MSDA 1LBMA 4AD4A 5A6BD 4LCSA 4HYRA 4DPPA 4C1NB 4AD0A 1LRTA 1UB3A 3ZJKA 3IIVA 1G9HA 1DKWA 1U2YA 1PTAA 3T2OA 5AHLA 2O9OA 3SCPA 2XFFA 2QDGA 4HD5A 1IWPA 2VXNA 4HU4A 2PAJA 4UNKA 4D6CA 1XP3A 3AMGA 3MP3A 3WUBA 3PBUA 3QJAA 4JQAA 4QTGA 1JQVA 3G18A 1W56A 3SFKA 3VXGA 3NQFA 3M5XA 1V3HA 1FWGC 1ZU8A 1ITCA 1GHSA 1PZ2A 1Z8AA 2GVYA 4Q4PA 1HL8A 2B0MA 4A2SA 1UH3A 3B06A 4UR7A 2V81A 3QGAC 4JDYA 2FHFA 2EJ1A 5B80A 3Q94A 2PDYA 3A3XA 3W9ZA 4UOQA 3T09A 4IIBA 1LL7A 4U2ZA 3UR8A 2RFGA 3NOYA 4FALA 5I07A 1IXOA 2NUWA 1PCWA 4GVFA 4JIEA 3CMFA 1Q7QA 3N9KA 3AU6A 2ZZ3A 4F9DA 4Q4QA 3W7QA 1HN1A 4JTLA 1SJCA 5C2XA 3B4UA 3GNOA 3TYEA 3REQA 1TJ2A 4A05A 1EO7A 4AX6A 4ZEPA 5HR7A 1G4PA 2G3MA 1V8EA 4JCLA 3AOFA 1I2NA 1Z44A 2ZRUA 2F9RA 2VC7A 3WNNA 1BQCA 1Q63A 3AIRA 3I65A 3NO5A 5CH9A 3GH7A 2GJLA 3GW0A 4L6OA 3HGOA 4Y9MA 2F61A 3H23A 3UG5A 3VFCA 3PTQA 3VM7A 3O63A 4A2RA 4PMVA 3ARYA 3WD2A 1O5XA 1FWRA 3GC5A 5ABGA 2A5HA 2PRHA 3LCWA 4JTCA 1V7YA 3LCIA 1YTKA 3JR2A 3WH8A 2YCJA 3AHYA 3UA3A 1J0ZA 2ESCA 1GOMA 2QJJA 1VBUA 2OFJA 4C6KA 3LEPA 1BWKA 2I14A 3OBKA 1OT2A 3VIGA 4LGXA 4IM4A 1DXIA 2ATMA 4GJIA 1C8VA 2WZHA 1RP8A 4ZQPA 3M6DA 1P0DA 3RX3A 5D2XA 4AZ7A 3TYUA 4MWAE 3KRBA 4J28A 2FKPA 3IJ9A 3CWOX 4DZIA 4EPEC 4I90A 4X63A 1WO2A 1FQ0A 4BS0A 2CHOA 5DT7A 1XUUA 2E28A 4WGHA 3LK6A 1HQTA 3GC2A 3SR7A 1UKQA 3TSDA 4KCUA 4LEQA 3ABZA 3UG4A 3PC0A 2NSXA 1CGXA 3EGJA 3CTLA 3VKCA 1XG4A 3H53A 4W86A 3ZVHB 3EMQA 2J4GA 4XAZA 1EJRC 4KT2A 2O7QA 1JEZA 1Z7AA 4WK9A 1EZWA 3HGRA 3UWQA 4I7WA 1EC7A 3L68A 2XVPA 4TVDA 4NRSA 1DYSA 1V6VA 4CN6A 3PUDA 3A4AA 1XH0A 2A3LA 4HHPA 1JDFA 1JI1A 2ACUA 3RR1A 3AIVA 3MUXA 4GY7A 7REQB 4CD5A 4M7SA 1TCDA 2DZXA 2V38A 2OMAA 4R33A 2ZE0A 1N55A 4KEMA 2GWGA 1W8GA 1CCWB 5FJJA 3CAQA 3K1GA 2DPEA 3XINA 4CQBA 6ALDA 2ZBTA 2WO5A 3TAOA 1DBTA 5DCEA 4PCPA 3GFYA 4WJXA 3D3FA 3BMWA 3C8FA 4O4VA 5REQA 3W2NA 4JEJA 1W1ZA 3HN3A 4KCTA 4Q7IA 3WD4A 3E38A 1A5AA 1TE1A 1KFWA 1QOQA 2GPTA 3WQ8A 3WJSA 5TQLA 4L6HA 2J7GA 4FXFA 1DIDA 1QNRA 3DGRA 3SEPA 4DM1A 3I6RA 3KBSA 2CHRA 2A7RA 5LGZA 1TSIA 1IIGA 4ZQCA 4QJ3B 2I1OA 3P61A 1ICQA 1XIDA 5G1TA 1AQMA 3CIVA 1IZKA 3ALFA 3MY9A 4TVCA 1V0MA 4J7RA 5AC7A 3R11A 4JNYA 2VEFA 4P7LA 1E15A 1OCJA 3GKFA 4YYFA 2OGYA 1ZP3A 4C6BA 4ICNA 4GNVA 2FLIA 4R9OA 3WBWA 3ALGA 4LFYA 4LV4A 3T0AA 4JTJA 1R3YA 5DY2A 3W71A 2QF8A 1W1TA 4V2XA 4JEQA 1LLOA 1CLXA 4NJIA 4PUKA 4EPKA 1US3A 3SUVA 2ACSA 1A3XA 1JCLA 1MQPA 4DJFC 1XLGA 2WSRA 3FJNA 3CAKA 1UC4A 5TNVA 1PV8A 3N3MA 1UR2A 2P88A 3ABRA 2OX1A 3F4DA 4MMWA 3NQGA 2Z25A 5EL1A 3TW7A 3VA8A 3NSNA 2YL5A 2E9MA 4XZWA 5ENLA 1KTCA 4JX5A 4JKKA 3VMPA 4JQ2A 2ZKMX 4BEUA 4NASA 1R3VA 3OODA 3UESA 3CZEA 4OVXA 4V27A 3SRKA 1CGUA 3WCZA 3LDVA 5CCZA 3I10A 3KXQA 3PNZA 4HK7A 3T0DA 4JQ4A 3RF9A 4Y9AA 3NDZA 2OZTA 1R7OA 1EQCA 1E73M 4X9YA 3A9IA 1TTJA 5IM51 2ONEA 4MLRA 2ISSA 1G69A 1AZ2A 1P6BA 2OR2A 3R7MA 4YXGA 3USBA 1BYDA 1P0NA 1S5TA 1HKJA 1XYCA 4OWGA 1E43A 1W6TA 1YKWA 3QN3A 2R14A 1J4EA 1OF8A 4H7VA 3GHTA 3OBAA 2E7FA 3TEVA 4ZB2A 2GGEA 1TA3B 3CZLA 1X8FA 4P2VA 5DCDA 3W2JA 3WQOA 3GXIA 4DJDC 3T7VA 1JCTA 3AIEA 4GIRA 3K13A 4ERAA 1KFBA 3V1HA 3AQUA 1VFMA 3PTDA 2WNZA 1SQ7A 4EK7A 5CC5A 2QYGA 4Y90A 1XD1A 1VBGA 3H2EA 5CJ5A 4DO7A 2YFNA 4I8YA 2C16A 5J8LA 2GVLA 1FCVA 4UFLA 2YOCA 3EWCA 4XAGA 2WJEA 4PCFA 2Y62A 1WKEA 2WANA 3UZJA 1WZKA 4E6MA 3ARQA 4S3JA 3G8RA 3E0VA 1KR0A 4N9EA 3UNTA 1FCUA 4U31A 1JCNA 3QR1A 2Z6JA 3WUGA 4AC1X 4MNKA 2DIEA 1YEYA 2ABAA 4PEKA 4GY0A 4H4IA 3ZZ1A 3BC9A 1E9ZB 1JDCA 4CNNA 1F6KA 1DXFA 3I3BA 1LL6A 4JIHA 3HGJA 2I57A 1HIZA 3N29A 4PL2A 4LW7A 2Z2UA 3SJNA 1UP2A 1XGDA 3SB0A 3H2CA 3V1PA 1O6IA 3E0LA 3W7NA 1ISWA 5JBEA 3BLEA 1SFJA 4NNAA 5I7GA 7PTDA 4XVEA 5U4NA 1DWJM 1KFJA 1QTWA 2PD9A 3U6WA 4JTQA 5DX7A 1V3MA 1BXCA 2YSWA 1ZZMA 3G1DA 3QOKA 4LALA 4PZVA 3RYSA 2Y7DA 1VCGA 3AI0A 1OGBA 4LC6A 3BK0A 1HKKA 4W8AA 3U2EA 4ZB0A 1UIOA 3LA4A 1OIMA 1H5YA 3L9CA 3LUTA 3PFRA 4JTRA 1NF0A 4WJ8A 1UC5A 1JPHA 3ECQA 3S2JA 2D1ZA 1RA0A 4W85A 4WVXA 2CLEA 4HPJA 4JTAA 3RPDA 3I7RA 1GOOA 3IGXA 3ES7A 4BF9A 1JYNA 4XZHA 4RUBA 1O5RA 2WKJA 1JCMP 1OG6A 2Z28A 3FGCB 4HN4A 1ZPTA 4L4PA 4PMJA 4AYSA 1LROA 1KBLA 3GNRA 3ITLA 3PM6A 4BY3A 5EA9A 1GJWA 2G5WA 4LOCA 1FWBC 2PZ0A 3CC1A 5JVLA 3GIYA 5EFDA 4FEZA 1ZB5A 2W91A 3GKAA 3GU9A 3NYZA 2G0WA 3EMCA 2GDUA 4P7OA 3GVWA 2C8NA 3L5MA 4XZMX 2BY1A 1NFPA 1JD7A 5ABEA 5HK4A 4L56A 3SRFA 3FSTA 4C6MA 3HG4A 1X96A 4H8HA 1FTXA 4UQCA 4C6CA 2GUYA 1HJSA 1IEXA 4I9AA 3OPSA 4Z2KA 3EA1A 4LVAA 3LM3A 2W67A 2V5CA 5AKQA 4IGHA 1YE4A 2PDGA 3DBNA 4AMAA 2VVSA 2PF8A 4Q4MA 3W83A 3IVUA 3RFAA 1PZ3A 4JGDA 1SM9A 4W88A 4QDWA 3LSBA 1GEQA 1CBGA 1RBOB 1A5BA 2V3DA 2A7PA 2EKGA 2QF7A 3MV11 4JTEA 1GQJA 3UA4A 3WQWA 5I3JA 3Q4DA 1WOBA 3BW3A 1GUVA 3VD3A 4JQ1A 3S5OA 5CLTA 3MP4A 1KFKA 5FACA 1HTIA 2VFIA 7XIMA 1VZWA 4KWOA 3UW6A 1MQRA 3THQA 2NXGA 1M1BA 1G4TA 3RUBL 4Z0SA 1YNYA 2OSXA 3N2OA 3BZGA 2XIBA 5DXYA 1XLCA 4IXXA 2G3FA 3STGA 4PB3A 3EKLA 1W3TA 7TIMA 2FB2A 5EMLA 4PODA 2EKCA 3E1F1 1TPFA 2PZNA 1TTIA 3UWUA 3FXGA 3T78A 4Z1BA 1DIKA 3FS2A 5CZKA 4GC3A 4RV8A 2WBKA 1PHQA 1JI2A 4US5A 1AA1B 4YTSA 1N8WA 1KCXA 1M9HA 3AIUA 4E2BA 4LBUA 1A5CA 1UG6A 1ZBCA 1A5MC 1MXSA 5J5RA 4NJJA 3WLNA 3L0GA 1W2PA 4RE0A 1Z41A 1UYQA 3HFYA 4HHHA 2GQ8A 5D2WA 3GNXA 1X1ZA 3PJTA 3U4AA 3TYDA 3UXAA 1THFD 3P3BA 3K4AA 3C6CA 3M47A 4A3HA 3LYEA 3N18A 1OYBA 3LSCA 2V2CA 1E1CB 2VEKA 5LNRA 2IW0A 3QR0A 2XFYA 2J9XA 3E3HA 1CNVA 1J11A 2BWGA 1B1YA 2E6YA 3WNLA 3GXNA 2ANUA 3P93A 2OWWA 3NIYA 5FF0A 3ZSSA 4WDWA 4NVTA 3P84A 4L5ZA 1H0GA 1ZJAA 5FJTA 4HSNA 3WNKA 2QKFA 3UXDA 1ZTVA 3EBVA 2ZA2A 3M5VA 2VUNA 3L23A 2IKIA 2OO6A 3AYVA 3QPZA 3WN6A 2J7FA 5CPSA 4F2UA 3LLXA 3W24A 3ID7A 3ZVIA 1GVQA 4QIUA 2OX4A 1WXYA 3BGAA 5MF5A 2A0NA 1SO5A 4YCOA 3S9IA 1T40A 3WQGA 1JXJA 1PHWA 3GK0A 4ZCWA 4JICA 2DT0A 1GKRA 3BQ6A 4XZBA 1DE6A 2W4XA 2XZ9A 1PX4A 3CLMA 2JBMA 3B8IA 1AW5A 3FV9A 2Z1KA 1L6WA 3TKFA 3MDWA 5K3VA 2JGYA 4UFHA 3P81A 4QGCA 2V5BA 1HO4A 1BPLB 1X1OA 3W1NA 2ZUNA 4IMGA 4MZ1A 4KEUA 2VMFA 4KETA 1AQ0A 3AYSA 3MU7A 3GDMA 1WKFA 5DMYA 2PDJA 4NJGA 3PY2A 3CZ8A 4CU8A 2ZA3A 4LYRA 2DZSA 4GLEA 3AXIA 2NVAA 4ACYA 1UR3M 4NQ1A 1EUAA 4JIPA 2OQHA 3BG3A 1IT8A 1P7TA 2ISVA 2XH0A 1VFFA 3GVRA 1KWKA 2BX7A 3SM0A 1KD0A 1EF2A 1TZ9A 2Y88A 1VPYA 2QPUA 4XKMA 5HQLA 3ZMRA 1VIZA 3QW3A 3WEZA 3MSYA 8CGTA 4FF7A 3W7PA 3E2QA 3OZPA 1U33A 3QFEA 4Q4SA 2V3FA 4BZYA 1YDYA 2ZE3A 3MSRA 3UP8A 4MKNA 3D47A 1DJYA 1K9DA 2XDFA 2Y8KA 4QE4A 3WK1A 4DJEC 3L66A 3HG3A 5DXXA 5IXEA 5U7SA 4PH6A 3F03K 1TJRA 2PCEA 3APGA 4R9XA 4GUFA 4IL2A 4J3SA 5LHEA 3NZGA 2VT0A 5FA5A 5M17A 2WJZA 4A3UA 1KQZA 4HJWA 3S5NA 4LTSA 5F2IA 4QAIA 1TV7A 4IFOA 1W3NA 1JQXA 3EWXA 4MWAC 4PE8A 1MFVA 3WD1A 5H91A 7A3HA 1EFZA 4PCSA 5AYIA 3BURA 3WL0A 1SR9A 4ZSTA 4IMFA 1DWHM 3O9NA 3GFZA 2PBGA 1SW0A 5FF4A 2VFHA 4O1CA 3IARA 1UR1A 4Z2LA 4NRRA 3M5ZA 2ABBA 1OX5A 1X1NA 4LCRA 3LQLA 1QHOA 1TA3A 2WJFA 3L67A 2JFEX 3IVSA 4L9XA 3HO8A 1JDAA 2VRJA 2D3NA 3DDMA 1G94A 3UF9A 4GUIA 2YCIX 2NQLA 1R30A 2X09A 1V08A 4L4MA 3GNPA 1YTEA 3THAA 2NUYA 4MKVA 3DFHA 3RJYA 1Y5WA 5CPOA 3W88A 1WP6A 2JQXA 2PDIA 5D8ZA 4AC7C 4CVWA 4U3AA 3SAZA 2EGZA 1V02A 1O66A 3AAMA 2EEXA 2NX1A 3LHZA 2O55A 1B3YA 1AD4A 5D9MA 5FL0A 3AHXA 1JUBA 3GH4A 5JXQA 1BKHA 2XH7A 3DCPA 3WD3A 3CQHA 5ABFB 4EACA 3F5JA 3MO7A 3CT2A 1ITUA 2NLYA 3EPOA 4TTGA 3B9OA 3I3EA 4H8UA 5BCAA 2HDJA 1X6NA 4RL3A 1SU5A 4KH2A 1PUDA 4LUJA 1B3WA 4FF5A 2E1DA 4LV9A 1KLZA 1UUMA 3UJEA 4UQAA 4C1NA 2FJKA 2WWCA 1XLMA 2J8GA 2ZC8A 2GLKA 2CBUA 4LSBA 3ZLHA 4X60A 2P53A 1F7BA 4UOJA 2VWSA 5CPNA 4R5EA 3ZXWA 3TTSA 2BVWA 4JR5A 4TU1A 3K46A 1BLIA 1UASA 4LQ1A 4PUNA 4DX3A 5BRQA 1C92A 1NOFA 5AVNA 3K4WA 5IRPA 2QJHA 1M7PA 3ZJ8A 3WO8A 1YE6A 3GUGA 4ICMA 2A6NA 1B3ZA 5DMMA 4LNCA 5HPCA 2R1LA 5T91A 4D1IA 3HF3A 1N2VA 2PWHA 3VDGA 3BMXA 1YXYA 3I6EA 4RKAA 3BLFA 2PWGA 3AHTA 3SCQA 3U4FA 3GXMA 4K7YA 4Z1YA 1FDZA 4WIWA 1B3VA 4FXRA 3NDYA 3I4EA 2Y89A 1VGAA 4QROA 1J9YA 3TC7A 3QTPA 3IUIA 4LX4A 5HNUA 3UXIA 4JHZA 5CBJA 4EOUA 3EXTA 1GZJA 3WLHA 4QJ4B 4I8DA 1PTDA 5DY3A 2R24A 2GYIA 3MHUA 1RJQA 4Z08A 4DBEA 3UZYA 3VI2A 1Q2RA 3WUFA 2OEJA 4I5RA 5LA2A 1A47A 4EXBA 2DUAA 4US5D 3DBPA 4X0NA 2JIWA 4DJDD 3D6NA 4MJ2A 3F2BA 4WY0A 2PDBA 8XIAA 4HOWA 3KZSA 2AL1A 1CECA 1A0EA 4H9TA 3IACA 1LUCB 3ATYA 1LJYA 3W74A 3WDIA 4ZQOA 1VFSA 2Z27A 8TIMA 3PR2A 1DQXA 2XGIA 1MDRA 3WQPA 1OZQA 4ZENA 2VCCA 3M1ZA 4GYJA 4NAEB 3KOYA 1IQ8A 1MO0A 2B31A 1ONWA 1JPKA 5CJNA 2QJIA 1AL7A 3BJSA 5EY5A 4CD4A 4BKNA 3VD9A 2WZMA 1P6WA 2X0YA 1KM4A 1VJSA 4I5XA 3QOMA 2Z1XA 2QCGA 2Y1HA 1NP0A 3H6OA 1DWIM 4K37A 3LCGA 3ZIZA 3ZR5A 4ZOEA 1DOSA 3VIFA 5FL1A 1QDSA 5IHRA 1MW3A 3TW9A 3UG3A 5F2LA 1FWWA 4LRTA 3R8GA 4PN2A 3IJ6A 3TZNA 5A6JA 1DQWA 4DXKA 1CGTA 1KXHA 3CHCA 4UNLA 3MI6A 1I9CB 1PYFA 4C6LA 2QW5A 3CMJA 3H2NA 3TMLA 3S3GA 4K7VA 3TN6A 3L5LA 4W9TA 1DHKA 1OCNA 4ILSA 1ISXA 5AFDA 1V02E 2J25A 2PDUA 2DSWA 5HMFA 2VOTA 1GHRA 3PSVA 4IISA 4OBSA 4A8IA 4RLIA 2QXWA 1V51A 4AVNA 2ADAA 1IT0A 1POKA 4R27A 4EVZA 2VGGA 2ZTKA 2UY4A 2QCNA 5JIWA 3EWWA 4UZUA 4DIAA 3S6OA 6XIAA 2BOGX 5CPLA 2NLIA 2CWXA 4XK2A 1EYEA 4I5UA 2YBTA 1PJ9A 1OYAA 3T08A 1RD5A 3LRLA 2Z1SA 5G4WA 3HPZA 2ZOXA 3W7CA 3WLOA 2WSPA 2Y63A 2AOSA 2ZXBA 2W92A 4QG6A 5A95A 3NEVA 2HSAA 3S42A 1WKDA 2X1IA 3CPGA 4ZBCA 3RN6A 2R82A 4NNBA 1XIIA 1ZJIA 5G4EA 1J93A 2BLEA 5A94A 2VD9A 2E9BA 3RO6A 4D8LA 2JGQA 4GJJA 4GKLA 4KFOA 1EHAA 3THDA 3PTKA 4BEQA 3U57A 1O7AA 1ZAIA 4EX4A 3S9ZA 4H9ZA 3SI9A 4EE9A 3V4BA 1SSDA 3IAPA 3BSGA 1UR0A 1B3OA 1ZJHA 4DQWA 1TB3A 2EG7A 1C90A 1S2VA 1HGYA 3KRZA 2V5LA 1UPMB 2I9UA 2TAAA 2O56A 1E0UA 3MSGA 1E40A 3VYLA 4I6KA 3WLJA 2XJ7A 4LRSA 4XB3A 4KFPA 3E5BA 3SW6A 1RA5A 3LBOA 4S3DA 2PLJA 3CXOA 5E0FA 4CD7A 3NFUA 4ERGA 3L65A 1JRBA 3GZAA 3GYCA 3W1UA 4RCXA 4B5NA 5IHSA 1G0CA 2CW6A 4OUIA 4DBUA 4ZR8A 1H7RA 4HIBA 2CZVA 5G2HA 3VMNA 1SO6A 5A5WA 4IIFA 3OOQA 4A35A 3P67A 3UNDA 4O1DA 2ZUMA 3I6TA 4R7WA 3U3HA 1JUKA 1TPWA 1XW8A 2IKJA 2YBVA 1W8SA 4AAJA 3LX9A 4F0RA 3ARXA 2VTFA 3S1GA 3DERA 2AL2B 4PTMA 1D2KA 4C60A 4EPBC 1A5UA 5FSDC 3SO7A 3W22A 5HANA 3T44A 1U1JA 1ZSXA 2GGHA 5ABHA 1FY6A 3OJGA 4GVIA 2NWRA 2F8QA 5BMWA 4O11A 2NT0A 3BUVA 3B0XA 3AXMA 3LPOA 5H8PA 2I9EA 3SQLA 3V0TA 2J8FA 1ADSA 4O50A 2BODX 1ZRQA 2J78A 3UPMA 4Z1DA 3LD5A 2QPXA 3LU2A 4MJ4A 2CLLA 3EB2A 2DH2A 4FOKA 4E2DA 3TFXA 3KTCA 1TV4A 2BV9A 3VE9A 3A5VA 3SIMA 5FF2A 3W7OA 2X05A 5HR6A 3CAWA 4O10A 1QK0A 4AEFA 1OFRA 4UFJA 3WBYA 5FJPA 1FA2A 1EIXA 5C6MA 2A85A 4AIBA 3W07A 4WKFA 3WQ4A 1UJPA 1TWZA 3THCA 1RXOB 3BMVA 2J7EA 2NX3A 1XDMA 5H8MA 3SUWA 4PEEA 3N73A 3JU2A 3UWEA 1TQXA 5H6HA 3TTOA 3G0XA 4KCWA 5CZTA 3FNDA 5BYWA 3LPGA 4IPLA 1RK6A 4LU0A 1MEIA 2C6QA 5CKSA 5AVHA 5HWMA 2CXEA 4LAOA 4PA8A 3CQJA 4M82A 1EF3A 4LVBA 3QV8A 3CQIA 1E6ZA 1XH2A 2IPFA 3VOHA 3II1A 4B15A 5A6LA 4WLCA 3N2CA 4RDVA 1UPPA 3TQPA 1S2WA 3O05A 2D23A 3MBDA 4JHMA 4L1XA 2J75A 2WVVA 2QCMA 1FOBA 2QCEA 3HB9A 4C6JA 3CEPA 1SO3A 3POCA 2RAGA 3STEA 5AECA 1OFOA 3WLMA 3NSMA 4XBKA 2V67A 3SCRA 2B7QA 5A8QA 3M64A 2VFEA 5A6TC 2H9AB 4ZQRA 3W25A 3FJ6A 2HTMA 2YB4A 1FRBA 3GVGA 4FZIA 1B4KA 5JH1A 4R53A 4HBKA 3G1YA 3GBDA 3CL6A 2A6LA 1JG9A 1OFDA 3BAXA 1XGEA 1ALDA 3B0VC 3UU0A 1GJPA 3O06A 1IEWA 3CV7A 1R6WA 3FHAA 1RLCL 5I79A 2WSYA 1W9UA 4HMNA 1Q2SA 3OIHA 4B5XA 1OC5A 4CEXC 3EKZA 2NZLA 4BWLA 1A5KC 3L4XA 5C9UA 2VR5A 4Y9NA 1N8IA 4Q7NA 1K9TA 1NEYA 2PDKA 1ITQA 2FB3A 3K8KA 5CQ1A 2P10A 3MBFA 3CHFA 3SCTA 1E70M 2ISFA 4A21A 1H60A 2VVNA 2C18A 2H8XA 3CH9A 4IPIA 1K4GA 3BGGA 2Y5JA 3W29A 3C2VA 2OT1A 1TFVA 3IJLA 1BF6A 1HL2A 4UMBA 4I7VA 5A8GA 3WF2A 1WX0A 3LBMA 3W00A 2AAAA 5FJUA 1UZDA 2WSKA 3W7JA 1KB3A 1XBVA 1JFXA 5E1QA 3FN9A 4JQ3A 1QNOA 3OLDA 4NZ5A 3QC0A 3NQMA 1WAWA 4M8UA 3LY0A 6CGTA 3RX4A 2WB5A 1SMAA 3M41A 3M46A 4BFAA 1L8NA 1I2PA 4L61A 4YVPA 2GVJA 5FOOA 3CT7A 1W5PA 3GG0A 4S1FA 4H6RA 4I6VA 4QRNA 3SRDA 2NQ5A 3N14A 1T6MA 1Q6LA 2OQLA 2FIQA 3W1LA 5LNWA 1XH1A 1CXLA 3MCOA 3R89A 3W3OA 4HNUA 3S46A 1CLKA 4F40A 3KZPA 1XYAA 3NZQA 1XRFA 3VUPA 2OWCA 1OADA 4F8XA 4NF7A 3CPUA 1IWAA 4B5VA 2PDPA 1DE5A 3LLFA 3ZQ9A 3LGEA 2WNWA 1XIEA 4H7ZA 3UYIA 3KOWA 4LS0A 4GVHA 3G8EA 4IGSA 4REQA 5M3WA 4YTQA 2QLYA 1SJAA 4Y96A 4HMEA 2B7OA 4FXSA 3TE9A 1J12A 3EWBX 3PG8A 1C7SA 3VO0A 1EJXC 1CLVA 1SMDA 4DEFA 3MS8A 3GDBA 3M0HA 4EWND 3TYCA 4P61A 3DH7A 3ATZA 3ARVA 2PTDA 3PAOA 5K4ZA 4HPXA 3P5YA 2EF9A 3BAJA 1UD8A 3LTPA 5JMUA 1KM1A 2WZTA 1I1WA 4LPCA 4P7QA 1VHNA 1NH6A 1XDJA 3R0DA 4O53A 1SW3A 4OHQA 4ZO8A 2RHGA 1SZNA 1LWHA 3IJ8A 3GTNA 1OD0A 4UOZA 4WY0B 4JPGA 4O16A 1K9EA 4Q8QA 1EWEA 1HZYA 2X16A 4WJEA 1ISVA 3D46A 3ITYA 4WF7A 1OZMA 4JFUA 3T07A 1Q6DA 2VGBA 3H24A 3AMLA 3B0PA 2XWEA 3QYSA 4QBXA 1UD2A 4NAEA 4Q8OA 2BVDA 4Y8FA 1XCXA 3N6QA 1ZL1A 2PDLA 1W1YA 3ANUA 4NXKA 5HDRA 3LS9A 3GDTA 3AICA 4AY8A 3UR5A 1RVKA 3FOKA 1YDOA 3EA3A 3KAOA 5A6MA 2FZ9A 2BS9A 3WF4A 4JS3A 3RK8A 2AMXA 2X40A 1W3HA 1KW1A 2OVLA 4GO8A 2RDUA 4IG2A 1A5OC 4TTUA 3VD5A 3CTTA 2V6AA 1GPWA 3I68A 4S38A 4O18A 1LT8A 1DJZA 1T0OA 1NF7A 2DJXA 1TZ7A 2AKZA 2C1IA 2XIOA 1TJ0A 3TFCA 3HJEA 4WCJA 2WPBA 1XKJA 5REQB 2EAWA 4DF0A 4O4WA 1A4MA 5A8PA 2VX7A 5AYXA 4E0CA 4YVXA 1GTEA 1F9CA 3AO0A 4M81A 5AHFA 3QC3A 2XIQA 3GR4A 3S5YA 3PB0A 5I5RA 2C3ZA 1UBPC 3NGFA 4YL2A 4KQNA 5DFAA 1XC4A 3O6YX 4O1AA 5FEZA 1PWMA 1XUZA 3NSXA 3UT0A 1AUSL 5DMNA 4HHLA 3EOOA 3S2LA 1LOLA 3SFWA 1GOIA 1AW2A 1S5MA 4PMXA 5GNYA 5E6YA 3WLQA 1GVYA 4PRTA 3SUTA 6TAAA 1M03A 4DBDA 2BXVA 1MWOA 4A8RA 3DKLA 3TJLA 4Q33A 1UR8A 2WNNA 3ZOAA 2AQOA 4UTMA 2RJHA 3VOCA 3N13A 1KWGA 1N82A 3PZUA 1VIWA 1KRMA 4G7EA 4NX5A 4WXYA 5BXPA 3NDOA 3PN8A 5BRPA 4R85A 2BBFA 3KBNA 4S3AA 2JALA 4M6PA 3TWAA 2YCLB 4XZNX 3M0VA 4NY2A 3M0XA 4ADTA 1EJVC 2NQJA 4MLJA 2TMDA 3VGDA 3GBEA 6TIMA 1J2BA 1HP4A 2Z1VA 2X2GA 4LUIA 3WEOA 1S1RA 4JTIA 4PB5A 1E1CA 1REQB 2ISWA 3BWWA 4K68A 4JIQA 3NQ2A 4ZXOA 5CXPA 4MYAA 2WKLA 3TR9A 3ORWA 4RNIA 3WSUA 3NQBA 2WM0A 3TC6A 1GZ1A 3IV3A 3MI2A 4XUGA 1NDYA 5FJOA 2J79A 1IXPA 4UTTC 2O0TA 4G2DA 4F0HA 3R79A 2BVYA 4EXQA 3OU8A 1XQKA 1PL9A 2VEMA 2LLEA 3ANVA 1XM3A 3BTNA 2YCLA 4MWAD 4X61A 4HOZA 1JAKA 3V0UA 3L4UA 1XL9A 4IX0A 3PFMA 4AG0A 1XIBA 5E6ZA 3GR8A 4HVXA 4AZBA 5M5DA 4GZ7A 2QUMA 3KDNA 4ZXLA 3IAQA 4GX9A 1MNZA 3WX7A 4BF7A 5DEZA 4F9JA 3G1RA 4V1YA 3W87A 1Q6CA 1DJGA 3RITA 2JKAA 3EWDA 3M07A 3GWQA 3MDUA 4CD6A 2YR1A 1UA3A 2PU1A 1Q13A 3P82A 3WLLA 1XYZA 3WJXA 4UTWA 1BXNA 3IANA 1YYAA 3PBGA 1CPUA 3PWIA 1SO4A 1QOPA 1X98A 1TO3A 4XBJA 3RILA 1TJPA 2PGWA 2VZOA 2DVTA 4KWSA 5C9WA 4LYQA 2BXYA 2Z24A 4Y8EA 4DUXA 3LNMA 3UCQA 1EX1A 3JUGA 3QMRA 3H2AA 4PL1A 2VM8A 3NZRA 2HZGA 5A8NA 3PJWA 2HEJA 1MW1A 3VFLA 1TIWA 3DESA 3QHOA 4XSLA 2VCAA 2BP1A 1QBAA 1MRAA 1KTNA 2MUCA 1KKOA 2DT2A 4RZ4A 1VBJA 4HT3A 2PBOA 4X3ZA 3SZ8A 2D2GA 1G4SA 4N9CA 4CNTA 1E56A 4PR4A 3S2MA 2PDFA 5D2VA 4LUTA 2OKTA 3E2SA 3H70A 2OQYA 2C0AA 1QW8A 1I2RA 1XCWA 5DELA 1LF1A 4EANA 1KXVA 2WLYA 3B9NA 2WKGA 2J7HA 3GXTA 1KQYA 3UJRA 2PDHA 4NI8A 4IUOA 1JCYA 1TVLA 5K4XA 1K70A 2ZYFA 1UMLA 4UFIA 1H1YA 2DQWA 1JGMA 1AJZA 4EWJA 1ZCOA 1F6YA 1VYPX 3LLDA 1QJWA 4NZ3A 1OBAA 1LOQA 2HXTA 4TUFA 3S6TA 2GZXA 3W7MA 1AJ0A 5CG0A 1C93A 4HTYA 5EYWA 4H6EA 4GWEA 3C4UA 4MUPA 4KWUA 3WFLA 1OIFA 1QT1A 4LUYA 1P1XA 4QS6A 4TR9A 3GDRA 2PC4A 1KCZA 2JE8A 1D7KA 1PE1A 4H9UA 1VBHA 2VDGA 3LXBA 4GXPA 1RLDA 2FMOA 4H6KA 4CNOA 1CENA 2JF6A 1XGZA 4K8GA 1NWUA 2WVTA 2W63A 4AHOA 3TYBA 4NJHA 3WH7A 1R46A 3CLWA 3BJTA 1D3CA 1AG1O 3AS1A 1UKOA 3QKZA 1QXLA 2QNEA 1QPQA 1KM5A 2PTZA 3M44A 1F07A 4OFCA 3WH9A 3TV8A 3U9IA 4AF0B 2UY5A 4TXEA 3NA8A 4AYGA 3A4XA 4LT9A 4RX0A 2V5KA 3LCLA 4O1BA 4DELA 4ML9A 2HPMA 1F3XA 5AC8A 2BY3A 4AXKA 3CHEA 1XLFA 2PSNA 4OQVA 4RE3A 1WCGA 4AZ5A 3ME3A 3WKZA 3S2NA 2XIIA 3ZM8A 1ZCCA 5DBUA 1K8YA 1Y65A 2FTPA 1VLIA 1XFCA 3E2VA 3T42A 1XF0A 1A53A 1VKFA 1CWYA 4FNPA 3AZTA 1E55A 4HJFA 5I0DA 4H8NA 1MZRA 5C54A 4RNHA 4WKHA 2GDVA 4PUMA 4W7VA 3GW3A 3AXXA 2DZTA 4GCXA 4DZHA 4NIRA 1PBGA 3NNTA 1US0A 1F3TA 1KRAC 1UCWA 3MW7A 4BQ2A 1TMQA 1FHLA 1YRRA 1W31A 1I2OA 4AW7A 5CSRA 1ODZA 1ISZA 4JFVA 3MCMA 3NL3A 3NQ7A 7TAAA 4DYJA 1HKWA 3REQB 4LC8A 1Q45A 3GTHA 3E9AA 2HBXA 1DV7A 1UWQA 3YPIA 1A0CA 1WPCA 2XN1A 2DSUA 1L9WA 4AWUA 4W93A 4KRUA 4DF2A 1G7UA 4ERIA 1ODUA 2X41A 3QFWA 1JVNA 1FWHC 3AS3A 3LPPA 1SUXA 4PSRA 3CJPA 3JVAA 1FWFC 1DTUA 4WEVX 1JPDX 4U28A 1YADA 3AC0A 1K6AA 3H4WA 3G0SA 3WELA 3FX4A 5I3HA 1JYWA 4J40A 2XFWA 2Y5EA 4HK5A 5D32A 4GK8A 4N02A 1M01A 2J6XA 4LNYA 2H3BA 1AODA 1HKMA 4JFWA 4NT0A 3V3WA 5C7VA 4XUYA 5I06A 2INZA 1UKSA 4P8UA 2V5JA 1YTDA 3IGUA 5A8OA 1R3QA 1WZAA 1GEHA 5C2CA 1O1ZA 5G1MA 4TMBA 3O8AA 3OGRA 4RZ5A 3ZR6A 4I9TA 5KZ6A 4FX6M 3KHDA 3ARTA 3T6CA 1E0WA 4XD4A 3TOPA 3OHIA 3QYQA 4AIEA 3P5ZA 5TAOA 5BWAA 3NQAA 1KC7A 1NU5A 3PP7A 4L64A 1PTGA 3W38A 1SFLA 4IMCA 4H04A 3G24A 5AN7A 1GVEA 3G1HA 3WF1A 4BJHA 3OQ8A 4GQQA 4H9YA 3IEBA 4KW2A 2OZ3A 3BV4A 3UZWA 1EXPA 1XLLA 1F76A 2VFFA 3ARZA 3ZO9A 1FVPA 1OF6A 1V3JA 4AQLA 1GKPA 1U22A 4QS5A 1LQ0A 4AVFA 5TF0A 3CHVA 3RRXA 1KKRA 1ZQ5A 1E6XM 1XLJA 1EUNA 2QCLA 4MPQA 1R9ZA 2PB1A 2FPTA 3JZUA 5A8MA 3QRHA 5CAKA 5DBTA 1M41A 1S46A 2O4QA 4QCFA 3OA5A 5CJMA 1AH0A 1EOKA 2P0IA 2H8ZA 2POTA 5BRBA 2XN0A 4GINA 2I56A 2JKEA 2OZ0A 3K8LA 3EWYA 3U8GA 2ZZ1A 3STPA 5BW6A 1KM0A 1RJRA 1XSJA 3LENA 4OUEA 4EPDC 2QULA 1JZ5A 1G1YA 1BVWA 1XG3A 2DZBA 3GVQA 4NZ4A 1VEOA 3VOFA 3P60A 5EPDA 1V0KA 3M0ZA 3W01A 2R1PA 4DM2A 3RIKA 2C1GA 2CYGA 4G5DA 2C91A 2Q02A 4F0MA 1LZOA 5D8WA 4B3LA 3N25A 3E5PA 3A3WA 3SUUA 1M7JA 4ZODA 3AJXA 3VU2A 4JIRA 1B2YA 2VZSA 2OTDA 5BXRA 4J5NA 3DEQA 3B8DA 2VC6A 4JL2A 3OIXA 2A21A 4AVOA 1QNSA 2GGIA 4BA0A 4Z1CA 4JL1A 1C91A 3TK7A 1HP5A 2EPMX 3H2FA 3S6DA 3OTRA 4S3GA 4AISA 1AJ2A 1PKMA 1PZ0A 5DCBA 1F2JA 1WUEA 3ONBA 1LBFA 4M80A 2E4TA 1Q4NX 2E3ZA 1GVFA 5A6KA 5A6BA 2VR2A 4IIHA 4XISA 1S3TC 4RW5A 3G1VA 1A0DA 4XV0A 1A49A 5CSUA 4E4PA 4BQ5A 1L8PA 2R9RA 3SY8A 4K1GA 5FKYA 3EOLA 3ITOA 4LVDA 1OM0A 1PCKA 5G4HC 2GGGA 5A2CA 4F2TA 3OZOA 1E3ZA 1CB2A 2YA1A 2YGYA 1MFUA 3BOXA 1BYCA 3DYPA 5I02A 1O4UA 2WHMA 1F8IA 2HWGA 2VL4A 2TODA 3MMTA 2I16A 4C6EA 1QWGA 3KP1A 4MNMA 5A2BA 1BRLA 2YB1A 3O15A 3MQTA 2HISA 3K1DA 1XQLA 3ZT6A 1Y5VA 4U10A 1RCQA 3CYVA 2PURA 4JTTA 3DHDA 4BHYA 3H55A 4C1KA 4IIDA 2ZTJA 1MEHA 4PMZA 4K3ZA 2VD8A 4DZ5A 4O12A 5CSSA 4CCZA 2ZX9A 3N2BA 2NSOA 4XWUA 3HZ3A 3SCSA 3GX9A 4IQDA 1PDYA 3WDHA 4QE1A 1XISA 3WZ0E 5I03A 1EGVA 1DJHA 4Q8MA 2BB0A 3ZSTA 4J2MA 4A3QA 2EXOA 1G01A 4PTDA 1HVQA 3WY1A 2BHZA 1EJWC 4QNWA 1RQEA 3F4NA 3TYZA 5CSYA 1CXFA 4IP5A 1E5NA 4LVGA 2J7DA 2YCKX 3RJXA 1W1VA 1VH7A 3NEHA 2GJXB 1RUSA 4IMDA 3CQKA 2W6RA 2WVSA 5CGMA 3KBWA 2A3BA 3UWZA 2JEQA 3TQVA 3AYTA 4ROQA 2A3HA 1VCVA 2Q8ZA 3WK2A 2PGEA 6PTDA 2DVUA 4JTUA 1W1B1 4U4MA 2NUXA 4JN8A 2EPHA 3MYOA 2BGSA 4DI8A 4DO5A 4QITA 1CDGA 3QMTA 4WD0A 3RAOA 3PWAA 1RZMA 5BZAA 3OO2A 1TRIA 3IS4A 1VFLA 2NQ9A 2Y4SA 3BQ5A 2GJRA 4Q4KA 4J9JA 3O6DA 2V30A 4KKXA 4O1FA 1SW7A 3T8LA 4IZGA 4IX2A 4NP7A 4XAPA 4DXXA 2EPOA 2E8ZA 4GI4A 2G3NA 1S5NA 5HNRA 1E9LA 3MZNA 1E1EA 2CERA 5E93A 2DZUA 3GXFA 1CEOA 3AZSA 4MM1A 1MW0A 1KGWA 3AZRA 2ZADA 2UY3A 2CZDA 1T99A 1ZUAX 3B97A 1FFRA 1JD9A 1BGAA 4PB4A 2PRLA 3SADA 2J47A 4Q8PA 1TPDA 5AOUA 2PRMA 3KWXA 2ZUVA 2V5DA 1PX3A 3R0UA 2VEGA 3NO3A 2CFFA 1XHGA 2WMGA 4MFEA 3PSWA 2ZX6A 1VEPA 3EXRA 3FLUA 5FSEC 1DJQA 4RW3A 4YCPA 1OFQA 1OSEA 1FDJA 4Q22A 3ES8A 5LGXA 1IZCA 3RPTA 4H19A 4BCEA 3L4TA 3MZ2A 5F1UA 3DN5A 1Q7MA 1JYXA 1AVAA 4WY0F 3TCSA 4O15A 3W23A 3N34A 4HNOA 3LHWA 3SUSA 4PRRA 2PDWA 2EHHA 1JIBA 1TTQA 1WXZA 4UTLA 1FXPA 2EBNA 3I7QA 1EDGA 4XKYB 4TVUA 1G67A 5IDZA 1D8WA 2R6OA 4XX6A 5DF0A 2VGFA 4C6PA 1R5YA 4ES4A 3QHNA 5I23A 1C9DA 1UUOA 4F0KA 1A3WA 1VFTA 1S2UA 1ONXA 4GBDA 5D9OA 2YXOA 3VOJA 3UGVA 3A4JA 2QEZA 5ECUA 1KCKA 2F6UA 3BG9A 2BY2A 3LGDA 1M7OA 1QMLA 2CLIA 5C55A 1RJPA 2W9MA 1I0BA 4X9SA 1XRSA 3KS5A 1TZZA 1K8CA 5D02A 5LIUX 3UVIA 2O9RA 3VNYA 4S39A 1RBAA 1IR2A 3MV01 2X7VA 1XIMA 1H63A 2ACQA 4H41A 3EOEA 2PFHA 2BGNE 4ADSA 3TA9A 1WAUA 4GZEA 1F5ZA 3W53A 3U7BA 3SIZA 3DFSA 4FP1A 3VC6A 4IL0A 4CKQA 4B5TA 3UERA 3NPWA 3TJIA 3NGJA 2R8WA 4F48A 1VPXA 4DWSC 2NV9A 1BG9A 3ISIX 2VQTA 3MB9A 2ZZ4A 3MVTA 1GVSA 4AEOA 2V8ZA 4RDYA 6REQB 2X1RA 3UJFA 2W3ZA 3NQVA 3SSJA 3Q2DA 3MHGA 2XYLA 2VKZG 3W2MA 1UD5A 2Z1WA 3VZXA 1NQKA 1MZHA 3P0XA 4ALDA 1F05A 3BGJA 4LH8A 2GWNA 1KGXA 3H21A 3FDGA 4NX0A 4D2JA 4D72A 4FIQA 4QJ5B 4UNIA 3B03A 2ZQ0A 3LB0A 1DJNA 5AZ0A 1J79A 3VC5A 2Z00A 3PZ9A 4QEEA 3QHMA 2IS7A 2CBVA 1EBHA 3QLDA 1EJSC 4L4LA 5CZSA 3VOGA 5GNXA 3MKVA 3HQOA 2QHAA 3G3MA 4QDMA 3NPVA 3SY5A 3B0YA 2PI6A 1R9YA 3OBEA 4AUBA 1OX4A 3IPWA 3CO4A 2OJPA 3ENLA 3M0KA 1BKSA 4GFSA 1EP3A 3CU2A 2OELA 3GD6A 2BHYA 4V33A 3B04A 2PDNA 5HQMA 1B4EA 1DQUA 1UWIA 4W5ZA 1GQKA 2D73A 4HZ6A 3NG3A 3USZA 4QHRA 4F2BA 2QV4A 1V6TA 4D1JA 3XIMA 2AMGA 4FK9A 1TUFA 1Y0EA 1PIFA 3NM1A 4MF4A 3VK5A 2DP3A 1VPQA 4KPLA 3RMJA 1JAEA 4MZ8A 1E72M 3BOLA 3KX6A 3UPBA 2G95A 3MMUA 5FD0A 1XS2A 3BE7A 1EZ2A 4XG1A 4AEEA 1IXQA 4CNSA 3F4CA 3VE7A 4GGHA 1EO5A 4PMYA 1PS9A 1V4YA 2D2JA 1R8LA 1VAHA 2BOEX 3LQGA 3SCNA 3ARRA 5HWJA 5LXEA 1HKIA 4OECA 2BTMA 1W5QA 1DVJA 1MNSA 3K2GA 4S3CA 2WPGA 1R2RA 4LANA 4CU7A 3QY8A 3HPSA 3W86A 4E38A 1M53A 2OT0A 2PDMA 4B2DA 2VQUA 1Y7VA 1WZLA 5BWFA 3FVDA 2C0HA 2PLCA 3QY7A 4W7UA 1E0TA 3FEMA 1C29A 1W32A 4OZOA 2C15A 2WCGA 4HOXA 1IHIA 1NDZA 2VUYA 1TV3A 3Q65A 2W62A 4H6QA 1KRBC 2YDAA 3W1TA 2ZRZA 4H00A 2G50A 2YYTA 3QH2A 4JTKA 4QJ1A 3EKGA 1US2A 1U5HA 3AIWA 2XM2A 1QO2A 3SCUA 3TLQA 4ZOBA 1H62A 5BROA 3B0UX 2WMIA 4PRWA 1KFLA 1POJA 1XINA 4AD2A 4IPPA 4ZZ9A 5HXMA 2E5BA 4FHAA 2VEPA 5LNSA 2BXZA 3VGEA 1V3KA 2P8BA 3N4AA 1J2WA 1TJ1A 4C7FA 3LERA 1EOMA 2BASA 4UR8A 5D37A 3KW3A 2HV5A 3EYPA 2Z1BA 1AH3A 3EOSA 3HOJA 3ZLFA 4MWAA 4FNSA 1O5QA 1W0MA 4S23A 3T2QA 1K77A 1RBLA 3P7YA 5KZEA 2YLLA 2PWUA 1A50A 3VX0A 4N4QA 2IPWA 1TREA 4HU8A 4XAFA 3AISA 2NV2A 4GD0A 3FHQA 5I24A 4G7FA 3VILA 1W9XA 3BCDA 4DN1A 2GSHA 4GYFA 3LHYA 3C3NA 2W66A 1RY8A 3VIJA 3C56A 1W54A 1Q6FA 3BLLA 4LB3A 2Z2BA 4Z42C 4PTWA 2ZXAA 4JTGA 1C3FA 1GVIA 1E9YB 3SBFA 1GOWA 3DFQA 1HL9A 1ZHAA 2EG6A 3PBMA 4UC5A 3HIJA 3UCCA 1W5OA 3W6MA 4OIFA 3NZ1A 2E68A 3L4WA 3OVGA 2EO7A 1FH7A 4AD3A 4G7EB 4RXGA 1C9WA 3BW2A 4RZBA 4A3YA 1IXNA 4H9VA 2BMBA 3VIOA 3FA3A 3S5ZA 1VP5A 1K8ZA 3FYYA 2CCRA 3SGZA 2WMJA 1ZAHA 1W1IE 1HO1A 1AD1A 4O0ZA 4HP5A 2F2HA 4TMCA 3KS6A 2DIKA 3UWYA 4F66A 3MYPA 7CGTA 4BI6A 1H7PA 3KP0A 1V3LA 3LTSA 5GJPA 1C7TA 1HUVA 4XZ9A 5M03A 4CLMA 4NZJA 3GTXA 3RCMA 4DWSD 1ICSA 4YVVA 2ALRA 3V5CA 2DH3A 2IPGA 3CWHA 4FOUA 3CGTA 2D0HA 1Y5XA 4N2YA 4P8XA 2FVMA 4QLJA 3STFA 2D2HA 3K30A 4IJBA 3S1VA 4YYCA 1KA9F 5K9XA 1BQGA 4FX7A 1VB9A 2RGMA 2V0TA 3VNJA 5HJLA 3NQ6A 4HQVA 5CC7A 1EJ7L 3M0YA 1P1MA 3TC3A 4D6EA 1RCOB 4YWSA 2W79A 2CZEA 3VCNA 4HA1A 3QGVA 1EL3A 1EA9C 3DHPA 5GJNA 3VCRA 2WW5A 1J01A 1UMYA 3SN4A 1DL3A 5HUPA 3IIZA 3XISA 1SFTA 3GUWA 1QASA 1LLWA 2P3EA 1UZ1A 4B3KA 1UROA 3DHFA 2WCAA 1L2UA 1D3HA 1LBLA 1BYBA 4O0QA 2C79A 1NOWA 4JY9A 3AWOA 2XSBA 1WDDA 1PWLA 1V93A 4Y9OA 2VENA 2EJAA 1ZP4A 2AAMA 1SR0A 3G0UA 4O8RA 2XH4A 3KOZA 1VRXA 3MUY1 4Y6GA 4S3BA 1Z89A 1XJBA 1RK5A 3TW6A 3C86A 1EKOA 2VHLA 3WIJA 2ZRWA 3TN3A 3N9SA 4UBPC 4XO7A 5EMKA 5AZ1A 3FW6A 2H9AA 1XPYA 1QPNA 3V7PA 5C5YA 5LXXA 3TJXA 4ZTYA 2PS2A 5FF7A 3W0KA 2WHJA 1M5WA 2Q3RA 3HURA 5HBFA 5GQBA 1O95A 5I6SA 1F6PA 3UVAA 1UJQA 1J0HA 5IDIA 1XIFA 1SSGA 3CYJA 2ZVIA 3EDEA 4BK9A 3FYOA 4GUGA 3AUOA 1CTNA 3NQDA 1BTCA 4JFTA 4GA8A 1VQTA 3URBA 1TKKA 1U1UA 3PS7A 5I2UA 4HSHA 3UQNA 3S47A 3B8VA 4ATDA 3W81A 4FX8A 1CXHA 2IXVA 4O8AA 2QS8A 2QV5A 2P76A 4EIVA 2ZX8A 3GU2A 4AIOA 1KM6A 4GG9A 5BXTA 3CB3A 5K2ZA 1NWSA 4KGLA 1ZJBA 1J0KA 2WWDA 2CZ5A 1H41A 2QCCA 2WBGA 4K39A 2FZMA 3V35A 3VKJA 1S2TA 3MUIA 1H11A 1A4LA 2J6VA 3KLKA 1K4HA 3E6EA 1TPB1 1UD4A 4FLOA 3RU8X 1H50A 3PANA 3WMBA 4HHMA 3MWCA 2QPSA 1Q66A 3QZEA 1PB0A 3RR4A 1AZ1A 4WDXA 1I60A 3R12A 4AXNA 1GG1A 4GOAA 4KCVA 4TX9A 1JNDA 2AQWA 3C2EA 3C2FA 3A23A 1JFHA 4AZCA 4IFKB 1FHDA 3W7GA 1FWNA 1NFBA 3HM7A 4ENLA 3APYA 2FFCA 1PX8A 3QGKC 4GYPC 5EBAA 1V79A 3IRSA 3HMJG 1OK6A 1OWQA 3LRMA 2RDXA 4GGBA 3QQ1A 1QNPA 4M56A 4Q8VA 4J27A 3BAIA 3SJ3A 2FPVA 4X0VA 1TPC1 3ARWA 3NUKA 5HMEA 2WYSA 2P50A 5C0QA 4ZOCA 4EAMA 5E70A 2PWDA 2XIMA 1UWUA 1R87A 3CHDA 3VABA 4AZCB 2VFGA 1VRDA 4KEZA