3SY5A

Crystal structure of the mutant s127a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor 6azaump
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
b'DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMAHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of the mutant S127A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor 6azaUMP
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/inhibitor
total genus 83
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sy5A00
1BTMA 3MHFA 4UNKA 4A22A 1X8FA 4R53A 3PBVA 2ALDA 3A5FA 3B0UX 3JS3A 1RZMA 5D04C 4JIPA 1MEHA 1TV7A 4FX6M 1KTBA 2J9ZA 1N7KA 4D2JA 3TK7A 3W7IA 3B05A 2CLMA 4QISA 3NQFA 1W3IA 5FESA 1KFEA 1LLWA 1IIHA 1IF2A 2CWNA 4NVTA 1H1YA 2ABBA 1FDZA 4DXVA 3DGRA 1DHPA 4KWVA 3WK2A 2FPYA 2H6RA 3HGJA 1X7FA 4GFSA 2Y7FA 2Z2UA 5HQEA 3HG2A 3R13A 3UWZA 1JUBA 4NNCA 3MP5A 5I3FA 5KITA 1Q3NA 3HG4A 3QMRA 4MUZA 4H3DA 2QUVA 2PC4A 3PB2A 3W7DA 4IMGA 2BSLA 5DCDA 5FF2A 3W72A 1XBXA 1LOSA 1I2OA 5FEXA 3NNTA 3W73A 1SZNA 3TX9A 4O1AA 4GWEA 2WSQA 4NXSA 4YL2A 4FIRA 2B7PA 4FNTA 5I3GA 4Q33A 3EX4A 1RV8A 3B8DA 4G1KA 5C54A 4CCDA 4O50A 5LKYA 2JGYA 3HO8A 2BLEA 4NT0A 1E51A 1WXJA 4WOQA 5F1VA 4ZQOA 1FX6A 2V9DA 2W0UA 4DPPA 3ABQA 3NA8A 2J24A 1TJRA 2A4AA 4O10A 3W7HA 5BMWA 1OF6A 3FJLA 4JS3A 3WJWA 2ZCGA 1VZWA 3M41A 1ME9A 3LM7A 4N9BA 1YPFA 3TA6A 4WUIA 4O17A 2ZZ7A 3WJZA 1PCWA 3U8GA 1SZGA 4FNRA 3F03K 4MZYA 1H7WA 3T4CA 1ME8A 3WJSA 3K30A 1CX9A 1OYAA 3EKZA 4MY1A 4S1FA 2YX0A 4UFKA 1TPH1 1P0KA 1Z48A 2E6YA 3PULA 2YSWA 4BK9A 3M16A 2VFFA 4GUGA 1EWDA 3HGSA 1FCUA 3MW7A 4JY8A 3W2MA 1JRBA 4MZ8A 5K4XA 1VYPX 3GZ3A 4K7VA 3OBKA 1M6JA 4N4QA 4AB4A 1B3OA 4UTWC 4DO4A 5G4WA 2AAMA 1WOAA 2YCEA 1JCNA 3PG8A 4CQ9A 2Y62A 2X1UA 4JY9A 1CW2A 3GDTA 3FEMA 2H3DA 5CZSA 3NQEA 4EF9A 1IIGA 2DZSA 3V1PA 1SW3A 4IUOA 2VEIA 4CLMA 1XUUA 1C9DA 4O12A 1GVQA 5MHBA 3DFNA 3I6RA 5HUPA 1VYRA 2QAPA 1JCMP 1OFOA 5CSSA 5LNVA 1ZAHA 2GQAA 5AOUA 4FXRA 3G3MA 1XFBA 3GNNA 3LCHA 3W1UA 4LWWA 1EPXA 1FXQA 4Z1CA 3HQ1A 4WX2A 2JGQA 4EWND 3DH7A 4QAIA 4TIMA 3W7OA 5HWMA 1ZY9A 5HMSA 1T8XA 3PY2A 3BVJA 2WOQA 4UTTC 1IXNA 1O5XA 4UFMA 4UR8A 5LGXA 3KVKA 3L0KA 1F76A 1BEUA 2Z0IA 2ZRZA 3GR7A 5HJLA 4UTKA 1AW1A 1KFBA 3B4UA 1YXYA 4PA8A 3TC7A 5H2ZA 3DENA 4P2VA 1OABA 3FA5A 4JIQA 4LTSA 5K2ZA 1R46A 2AQWA 4LNYA 4XTIA 3EXTA 4GUJA 1AL7A 1YLVA 4BI5A 3MYOA 4IXHA 4AHPA 3PUOA 3OA3A 4K38A 4FB7A 1TMHA 3UWYA 3PAJA 4O53A 4LC6A 1XKYA 1QPQA 1H7NA 1GT8A 4HT3A 1KBIA 4O28A 1Q6LA 2FTPA 1EEPA 1TPEA 5AHFA 4HN4A 3G8EA 5I3JA 5A8GA 3R8RA 4O4VA 5F2IA 3B0VC 4CNOA 3LTYA 1C8VA 3O16A 1SUXA 3IVSA 3W7RA 4DELA 4M6VA 3Q2DA 4FEZA 3N19B 5DY2A 3AJXA 4M7TA 4OGZA 4NXKA 3W1XA 1KFKA 3OG3A 5KMYA 4QJ1A 2FB3A 3W87A 3W7NA 2R91A 4O4WA 4UUIA 3W7KA 3N73A 4C1KA 3KRZA 3IIVA 3HG3A 3PVFA 4AWUA 3GLCA 3TU9A 1A5CA 1ZFJA 1TRIA 1V7YA 4Z1AA 3BG3A 2C13A 3FFSA 3NOEA 1J4EA 1TV5A 1B4EA 1VS1A 1OFPA 4HHPA 3LBCA 5LSMA 1KM3A 3B0PA 3BARA 3IRDA 5G2HA 3PUDA 1G4TA 4WZHA 2HSAA 3UYCA 2CZDA 3NM3A 1D9EA 4WXZA 2GOUA 3L67A 3QSTA 3W6YA 1QO5A 4ZQPA 2J88A 4CNPA 3LHYA 4ZQNA 4IQLA 3A23A 4WOZA 4WY0A 2EHHA 4LOCA 4NQ1A 1LRQA 3GK0A 3CLMA 1GVFA 4UFJA 1K03A 2KZHA 3VNDA 4O18A 1NF7A 1VPXA 3GDLA 4Y9AA 1K7FA 2NUXA 3SZ8A 4IPJA 3LV6A 2JKEA 4NJIA 4XWUA 1U5JA 1VCFA 4NJJA 2QCDB 3GAKA 1ZALA 3ANYA 3RNDA 3EWBX 4AF0A 3TSDA 3OVQA 3UD6A 4NZFA 3A22A 4OQVA 1FXPA 3EXSA 5AYXA 4AH7A 4JYEA 2BTMA 2YW3A 3H53A 2Y7EA 2UV8G 3BO9A 3SGUA 3KX6A 3LCLA 2ZRUA 3PWAA 3W70A 4JYFA 1SSDA 1HO1A 3W7MA 2ABAA 1BKSA 1TTQA 1GEQA 3W1MA 1TB3A 3QYQA 3QEZA 1TSIA 2Y89A 3DI0A 2WSRA 2P0OA 2CLLA 4I7WA 2FJKA 3INPA 3O1NA 4GXMA 3G1DA 4K6AA 1FQ0A 1F2JA 4ADTA 1FBAA 3L9CA 1TV8A 5DCBA 1DQXA 5J5DA 3VE9A 1L6SA 3DFPA 3W75A 4NJKA 1W1ZA 5CZJA 3F1QA 2FIQA 5HWJA 3KOFA 1HL2A 4ZQCA 3M9YA 3KVLA 3G1AA 2CLEA 1EP2A 2TPSA 2EPHA 3ZS4A 4ZQMA 4LUJA 2OMAA 5K9CA 1QFEA 3W7JA 4IPIA 2YDAA 1LDCA 1SO6A 2C19A 1H63A 4ADUA 3ABOA 3E96A 1YTDA 1I2NA 3W7PA 3A5VA 1TREA 4MYAA 1LYXA 5D2TA 5LGZA 3STGA 2GVLA 1VLWA 4MZ1A 1H60A 2QAFA 1GVOA 2VELA 3GDMA 2TMDA 3SGZA 1F6PA 1NVMA 2V0TA 4BWLC 1KFLA 3FJ6A 2DZTA 3DAQA 3W1PA 2E77A 4UTLA 4NUWA 1P0NA 3NL3A 4Y6GA 2CU0A 2NWRA 3LHVA 2ZTKA 4IOTA 4Y96A 1OVDA 1G69A 3BK0A 3L5AA 3TR2A 1EP1A 1FWRA 1LRNA 4B5NA 1QOPA 4IX2A 2X1TA 5EY5A 1KM4A 4JYDA 4PTNA 1H7OA 1SR9A 2Y7GA 1OX4A 3MHUA 1DV7A 3BG5A 3LCGA 3QSRA 3UZJA 1EP3A 2TRSA 3P7YA 1Y0EA 1F7BA 1GQNA 3W7GA 4N4PA 3C61A 3GB6A 4PFMA 3MI2A 5CPMA 4DPQA 3NZ1A 2B7NA 1H61A 3R12A 1KM2A 4ZZ9A 2A85A 1W5OA 3UWVA 1NSJA 1LM1A 3S9YA 1OFDA 3O6YX 3CEUA 1MEWA 1Q45A 1ZAJA 2A7PA 3KRSA 4UTTA 2YPIA 1LOQA 3NM1A 4JTEA 4M6QA 3T40A 1VQTA 2GJLA 1WX0A 1G6CA 2Y61A 2V5LA 2QKFA 3DFTA 4UR7A 1GVSA 4AHQA 5HR7A 3SSJA 1PV8A 3FS2A 5FF7A 2ZZ3A 5LHFA 5HULA 3Q94A 2YR1A 1SSGA 3EB2A 4JR5A 4J9JA 3DXIA 3W23A 4FNUA 4NX5A 5DXYA 3NQDA 1VRDA 1TYGA 1GWJA 1OX6A 3W85A 3M5XA 3GAYA 2VXNA 2VFGA 1EX5A 1R47A 4YXGA 2ATMA 4MFEA 3D0CA 2YW4A 3F4NA 1YDVA 3G0UA 1OX4B 3R2GA 5I3IA 4JDBA 2V5BA 4WY0F 5LHEA 2ZQ0A 2G95A 4RR4A 5FEZA 1AW2A 1W54A 5G4EA 1XBZA 2A6LA 2QCLA 4IMCA 2BZNA 3TQVA 2VFEA 3S5NA 3H55A 3R89A 5C2XA 2RDUA 1Q6OA 1JR1A 3P81A 3I7RA 3AO0A 4M7SA 2ISVA 3CTLA 4LS2A 3TW7A 1G67A 2Q3OA 4PCFA 4Q4KA 2LLEA 4EF8A 3HMJG 5G1YA 3W1QA 5G2WA 3KVMA 5D03A 2C3ZA 2A2IA 3M0ZA 4KFOA 3OVPA 2WQPA 2ZZ6A 3N9RA 1UJPA 1U83A 1JQVA 2W79A 5DELA 1GJPA 1XCFA 5I3HA 3QH2A 3L21A 1W8SA 4NNBA 3RMJA 1L6YA 1M5WA 4QNEA 1H50A 3PBWA 1XM3A 4I7VA 5U7SA 1RQHA 3MBFA 3GXTA 3BLEA 2X1RA 1K8ZA 3STFA 1QPRA 2PRMA 1O94A 4FXSA 3MI3A 4FO4A 1RPXA 1YYAA 4KWWA 5LNSA 4NU7A 4N2YA 5AHMA 1RD5A 2GPTA 1EA0A 3P67A 1K7XA 2PCQA 3W7EA 3E12A 2VEPA 3TMQA 2NLIA 1W0MA 3LXAA 4AAJA 3HPZA 1WBJA 1P5BA 1KA9F 4RXFA 3GXNA 3TAKA 3VKJA 4JTFA 3EKLA 3FYPA 3FYOA 3TSMA 2QCFA 1FWTA 2CFFA 5ABTA 3C0JA 3TFCA 5I3KA 1KM6A 4E0CA 1R30A 5HWNA 1W56A 2QDGA 1LZOA 5HINA 4ADSA 4ZVJA 5KZEA 4TMCA 3QM3A 1O4UA 2X30A 4NX0A 1EWEA 1A5BA 5CZTA 1ADOA 1WV2A 4GC4A 2ZZ4A 2CZ5A 1UB3A 3C6CA 2ZA1A 5CG7A 3PR2A 3A9IA 4KFPA 3W7CA 3MI6A 3CWOX 5CZ0A 2C16A 3N3MA 3NR0A 3ZFHA 2RDWA 3EEGA 1F5ZA 2ZTJA 3TQKA 4RZ6A 3FLUA 1DVJA 1JJKA 3NQ2A 3NPVA 4JTTA 5DY3A 1TPUA 4LUIA 1TPWA 3USBA 5EKYA 3WK0A 4JXCA 1ZHAA 3G1YA 4OV4A 4HIBA 1OFBA 4MLJA 4W9TA 3SFKA 2E09A 3UZ5A 1L6WA 1WAUA 3ZWSA 4JTJA 3WK1A 4A3UA 4PL1A 3LRKA 1RR2A 2B7OA 2RKXA 1JCLA 5J5RA 1QMLA 2DZVA 3BLFA 1VCGA 4C1LA 1Z41A 2ISSA 3LI0A 4JTLA 4BWLA 3C56A 4NJHA 3SJ3A 4LVAA 4RJEA 2HS8A 3S8HA 1XL9A 3ELFA 3S5YA 1ZAIA 4UCGA 2A5HA 1VLIA 5LNUA 2Q8LA 2NWSA 5KSWA 5E1QA 1WA3A 4MYXA 4JN6A 3C2OA 4QSHA 5D33A 4HNUA 3UPBA 4DBEA 1T99A 1JRCA 4Z08A 1GPWA 3LLDA 2YYTA 4O19A 3M43A 5EPDA 3DFQA 3LI1A 2A1YA 4XZ9A 3SW6A 4ICNA 5HNRA 4RLIA 2GQ8A 3G18A 4XKYA 4LU0A 3LRLA 1LCOA 3NZRA 1L9WA 4OV9A 3RK8A 3DI1A 3HGRA 4RZ4A 3DU0A 1J2WA 1YDNA 2VEKA 3L0GA 2H3BA 1MSSA 5AC8A 2QCEA 4HNTA 2QCNA 2EF9A 3T44A 1NEYA 2ZZ5A 4RV8A 3G24A 2XN2A 3HPXA 1KTCA 3W1LA 1WYIA 3TXVA 1LBMA 4GUFA 3YPIA 2QEZA 1TQJA 3TQ0A 2GQ9A 3JR2A 3NVTA 3QQ0A 1IXOA 3GVGA 2V81A 3F4WA 1DORA 1TQXA 1Q6QA 3G1FA 4MIMA 4X22A 5L9FA 4POCA 4UTJA 2I1OA 3TE9A 5BMXA 1GYNA 1DQWA 2QCMA 1S5WA 5F4SA 4XQ6A 3L5LA 2X1SA 3P8IA 2PE4A 2DZUA 3TH6A 2WV8A 1YTKA 5AC7A 1VCVA 4DF1A 3BW2A 2Z6IA 3NQVA 3PBYA 4BF9A 2F7FA 3GNDA 2FLIA 1G4SA 3NQ8A 4XKYB 2C0AA 4JX5A 3P74A 3W1TA 3SIZA 3W2LA 3CHVA 4U28A 4IX0A 4WD0A 4LVBA 3NGJA 1QR7A 2ZRWA 3PC0A 1VGAA 5AYZA 5AFDA 5FF3A 1G7UA 4HNNA 4JDYA 3MYPA 4LT9A 5IM51 4UFIA 5SWUA 2ZBTA 3TMLA 4GUIA 2NXHA 1OJXA 3QPYA 4AWSA 5C6MA 1TPB1 3RLVA 3U2OA 3W22A 4TO8A 4UFLA 3G0XA 5G1TA 3FOKA 3MHGA 5TBOA 4YMZA 4A2SA 4JTUA 3NO5A 1I8JA 3PSVA 1TO3A 3I7QA 1UBSA 3W3OA 3E49A 3IGSA 5H91A 3W86A 4TR9A 1ZNNA 1ML1A 5E93A 1HUVA 3E02A 2VC6A 2GVGA 2YZRA 2NUWA 5F2MA 5AHEA 2FFCA 4O16A 4O1BA 4UNLA 5AB3A 5F2GA 1KW1A 2CLKA 3G1SA 3CWNA 5LZLA 2JK2A 4ORMA 1R2SA 5CPNA 4JTHA 3RF9A 3M5ZA 2F84A 1ZJIA 1H1ZA 1YPIA 2QF7A 3L2IA 5DBTA 1R2TA 1MO0A 1PS9A 5AC6A 3KFTA 2R14A 3UPWA 4UMBA 4OHQA 1SZFA 1VHNA 4OT7A 2HTMA 1QNVA 2I9EA 4GUHA 1DJNA 4LV9A 3SECA 4UXDA 4WY0B 3WJYA 2RH9A 1AL8A 3O07A 2D73A 3S5ZA 4AMAA 1XDMA 3M5VA 4AWTA 1XDLA 3S1XA 1YADA 1TTPA 4GE8A 2E1DA 4AHOA 1YXDA 3CPRA 4LS1A 3KXQA 3GKFA 1XXXA 3NDOA 1KFJA 3KVJA 4WXYA 3EWUA 3C2RA 4RZ5A 3B06A 3C52A 2OT1A 3GX9A 1KV5A 4AF0B 2ZA3A 4XUGA 4PC8A 3S0CA 1K8YA 3UY7A 2V2HA 3ABRA 3IV3A 1DOSA 4JX6A 2ZFAA 5D2WA 1UUOA 3NQ6A 3N14A 2VKZG 2J27A 1C29A 5FEWA 3UWUA 1QOQA 3EWYA 2FPTA 3LTPA 1FCBA 3L5MA 4MVAA 4ORIA 1AK5A 3UXDA 1P4CA 4MPQA 3E9AA 1JULA 3QMSA 3W2JA 1OG0A 4IJBA 3B04A 3DKJA 1JCJA 3HB9A 1VJIA 1O60A 1LRTA 1OYCA 4LV4A 3CQ0A 1O95A 1PCKA 2RDTA 3STEA 2Y85A 3GR8A 1TIMA 2VFHA 4Z1DA 2J6XA 4QIUA 3OEXA 4HKPA 4X2RA 3QQ1A 4LRSA 4N9EA 3VCRA 1A53A 3S5OA 3RLUA 3NQ7A 1AMKA 4IXXA 8TIMA 4L4MA 5D02A 4XBSA 3C8FA 3QC3A 2I14A 2GVJA 4Y8FA 3DZ1A 5D32A 3CU2A 1KTNA 4UTIA 3LCXA 4MLRA 4TU1A 4JNMA 3LLFA 1OX5A 4R33A 3TV8A 3GYEA 3EXRA 4E2BA 3PS7A 4WQ6A 4PH6A 2NXGA 2P1FA 2DZXA 4RXGA 4HPJA 1D3HA 3N9SA 3W2NA 4K36A 2BXVA 3EWXA 3GDRA 2C15A 3L65A 3NQGA 3WFAA 4A29A 5LNRA 3GDKA 1M7OA 2OZ0A 2H8XA 3WK3A 1GYLA 3I65A 3ATZA 7TIMA 2Z6JA 3MJYA 3NYZA 5C5YA 3MP3A 2QJHA 4MJZA 4UMAA 1FWNA 5K9DA 4NZJA 1X1OA 1UCWA 3P5YA 6TIMA 4LY8A 3TIMA 4UIOA 2Y7DA 3UQNA 3MUXA 5BNKA 1PL9A 4MY8A 5D37A 3NXFA 4QITA 1N55A 1GG1A 1F73A 2Y88A 3C2VA 3SY5A 4K7YA 2WNNA 2E5DA 3NG3A 2V30A 4FNPA 3L68A 3NL6A 2DP3A 5D05A 3O05A 1HFBA 3M5YA 5TQLA 1ZCOA 3QFEA 3N34A 3Q58A 4LS0A 3R5EA 1FCVA 2WO5A 2XN1A 3E0IA 1R2RA 2PURA 2ISWA 3IGUA 4O11A 3TW6A 3WJXA 3LTSA 2VENA 2ZZ2A 2QCCA 4NJGA 1THFD 4UFHA 2YGYA 4GBUA 1A5SA 3M1ZA 3M6YA 3S1UA 1ICSA 3IEBA 4UTUA 4MFDA 4FX8A 3VI2A 3TSBA 3P60A 2A6NA 4CQAA 3MBDA 3NEVA 4A21A 1A50A 4PODA 3G3DA 5EYWA 4FIQA 4UTMA 3DHFA 3LBMA 2RHGA 3LGEA 3TFXA 4DF0A 3JRKA 5EL1A 3U6WA 2E5BA 1SFJA 3P80A 1LBFA 3A21A 1G7VA 3EX6A 1GZGA 3UXAA 1J5TA 4E38A 3W2UA 1G4EA 4K8HA 1W5MA 1UUMA 3C2FA 3TJLA 2OT0A 4LVFA 2FQIA 3N2XA 5K3VA 4O1DA 3G1XA 4RX0A 1SO4A 5KTLA 3FIGA 2ZRYA 3M7WA 5TIMA 3CEPA 1F05A 2XN0A 1B4KA 4EIVA 4N9DA 3FKKA 3V75A 3QMTA 1DBTA 3S42A 5IBXC 2NV2A 2J9YA 2JKPA 2WJZA 1X1ZA 1OF8A 5E0KA 2NUYA 3W7QA 3W74A 3BGGA 3A24A 3B03A 4QM1A 4WJEA 1Q6RA 3W88A 4LVDA 3ABSA 3DBPA 3W1NA 1EB3A 1OK6A 1QDSA 1LBLA 1YXCA 5D30A 3IGXA 4AEOA 1FUYA 1QPNA 3G1HA 4MKNA 4QNWA 4LC8A 3H54A 5KINA 1D3GA 2E6DA 1AG1O 4N6EA 1GVRA 3IVUA 5CKSA 4I9AA 1BWKA 5L6UA 1FY6A 1VC4A 3PG9A 3TDFA 4MY9A 3W76A 2QDHA 4IGHA 1JUKA 3NPXA 2H8ZA 4U4MA 4O13A 2CLFA 3QW3A 3HGOA 2A0NA 2W6RA 1I2PA 6ALDA 1S5VA 1ZENA 3TC6A 4PEKA 2V8ZA 5DN1A 1KLZA 1W5NA 2NX3A 3O6CA 3KRUA 4GNJA 3NPUA 3T55A 2NV1A 1GTEA 2WNQA 4H4IA 5CPLA 1QO2A 4UTHA 4OBTA 1LLZA 2C14A 4DEFA 1B57A 3W71A 1GG0A 3LERA 4LVGA 3IIPA 3PSWA 3DHDA 2CW6A 3BV4A 1WQ5A 2DZPA 2WPBA 2Y6ZA 3TKFA 2QJGA 1ME7A 2OX1A 3ZR4A 3T7VA 4O57A 2C18A 3G8RA 4PL2A 2DU2A 2VFIA 4MJMA 1RVGA 3LCIA 2GJNA 2QR6A 3QZEA 4DF2A 5FF0A 3FKRA 1VH7A 1H51A 3EWZA 2ZZ1A 4YCOA 2TYSA 2PRHA 4HPXA 4OU1A 3W1RA 1T0OA 1K7EA 4IMEA 4M6PA 1M7PA 1KM1A 1W37A 4CNNA 5AN7A 1H62A 4GRSA 5A5WA 3VFLA 4DO5A 2YXGA 1DL3A 1IGSA 1SFLA 5FI8A 4N9CA 4O0KA 5U4NA 3NQAA 4A2RA 1HTIA 4IWWA 5BOOA 4YLWA 2DJXA 1XBVA 5CGQA 5KZDA 4OE7A 1FCQA 1F6KA 1VHCA 2YFNA 4TX9A 2JKAA 2FDSA 1GTHA 2RFGA 3EWWA 1YTEA 3RFAA 4K8EA 2FPVA 5AHNA 4FNQA 1QWGA 4ML9A 1KBJA 1F74A 5CPOA 5K4ZA 5F4WA 1X6UA 4FX7A 3QPZA 1OHLA 3O06A 4KKXA 2CLHA 2Y70A 5HUOA 1RQEA 3Q37A 1KV8A 4JD4A 5KZMA 3KHJA 3BW3A 2YFOA 1GOXA 3QW4B 1TRDA 3P62A 2V82A 1JCXA 3DKLA 1TCDA 2CZFA 1XC4A 2QCGA 5D38A 1TPVA 3C3NA 2B4GA 4XTDA 3TAOA 3L0NA 1Z44A 1QPOA 2ZYFA 1EIXA 5EMUA 1XI3A 2X16A 1PIIA 1OFEA 1XBYA 4EOUA 1L2UA 3BW4A 1OFQA 1TTJA 1S3HA 3LX9A 3S1VA 2E68A 3UNDA 2QCDA 4Y90A 4CCEA 1WBHA 1LOLA 4O8RA 2B7QA 2E6AA 4L4LA 3SR7A 4E2DA 3TROA 4O14A 2EAWA 3PF3A 1JCYA 2CLOA 5FEPA 3PUEA 5AHIA 2E5CA 1TPC1 3VE7A 3HIJA 4HNVA 1ICQA 3L66A 2CLIA 1H7XA 4Z0JA 3BGJA 2XFWA 3P8JA 3THAA 2A21A 3LHWA 3BPWA 3S1WA 2OCZA 3HPSA 4DBDA 3I68A 2Y63A 3MO7A 3QF0A 1MEIA 1SW7A 1H7RA 3G0SA 2E6FA 2ZRXA 1I45A 5EA9A 1H7PA 4BFAA 1FWWA 1SO5A 2NX9A 1T96A 1A5AA 5AYYA 4ZQRA 1JVNA 2WKJA 3TJXA 4N6FA 4LW7A 4P61A 1NFBA 1LORA 3OVRA 1OFRA 3O8AA 1FWSA 5CSRA 3LRMA 2PRLA 4UC5A 1Z42A 1K02A 3P61A 1KM0A 1ALDA 1TJPA 4HSOA 2GUUA 1OFAA 2O7QA 2TSYA 4O1CA 2HS6A 3LCFA 1LTDA 3CIWA 1TPFA 3UWWA 4GJ1A 1NF0A 3IIXA 1YDOA 3TXZA 3GIYA 4JTIA 2OJPA 3O6DA 1I2RA 5AHLA 1LP6A 3W7LA 4JEQA 4UMCA 1FDJA 3TCEA 2V2CA 4HSNA 3M44A 3LXBA 3HBLA 3HG5A 3BLIA 2NX1A 1JQXA 1CI1A 2DZWA 4O54A 2P10A 3P84A 1ICPA 4RKAA 2G96A 1HO4A 1BWLA 3LHTA 3O63A 5D2VA 1SW0A 3MWAA 4XBKA 2DJLA 3EX2A 3CM4A 5IBXA 3ZWTA 5K9XA 5C55A 4S2BA 1W5PA 1PHWA 3TUUA 2FB2A 4FHAA 4I7UA 3NL2A 2A7RA 1FDYA 3GKAA 3PM6A 3M47A 1IXQA 2Q8ZA 4RCXA 3P82A 1KM5A 5HR6A 4X9SA 2EGZA 4DQWA 1N8FA 4DO6A 1AW5A 4K37A 2YYUA 2AGKA 4M19A 2ZDRA 3RU6A 3G22A 4ZMGA 1SZEA 3CT7A 2EKCA 3MP4A 2J9XA 2V2DA 4S2CA 3LCWA 3SI9A 4O52A 2QCHA 3NPWA 4BI7A 4JTSA 2G97A 3N2MA 5DCEA 4CCCA 2Q3RA 1VR6A 4O0ZA 3CB8A 4NNAA 3MMTA 4FF7A 1KLYA 4OWGA 1TPDA 3O15A 2VOMA 1SO3A 2ATSA 2JBMA 3W07A 3UY8A 3STCA 4BR1A 2NZLA 1QAPA 2DORA 3IIZA 3IIOA 3QRHA 5FF4A 3IVTA 3PBUA 3LDVA 3LHZA 1I4NA 1K8XA 4IMDA 5BW6A 1DKWA 1I2QA 3ATYA 3NL5A 2R8WA 1OK4A 1ONRA 1XUZA 3LV5A 3DFOA 5D09A 4ONVA 3P5ZA 3W83A 4UTWA 2Z1BA 4YWIA 1UASA 2C1HA 2QUTA 3HOJA 5F2LA 3OIXA 3EX1A 3NAVA 3DFSA 3LB0A 4AXKA 4CQ8A 1VYSX 3W9ZA 2B0MA 1B9BA 1PHQA 4FNSA 1NAL1 2CZEA 1RQBA 4AVFA 1H5YA 4TMBA 3G1VA 1QCWA 2BWGA 1PVNA 1EUAA 4IMFA 5G2IA 1IXPA 5D2XA 1W5QA 4MOZA 4BI6A 3CC1A 3I7SA 2NXIA 3EX3A 2VFDA 5DBUA 1K3UA 1G4PA 2HMCA 1PE1A 3C4UA 4ALDA 1OYBA 2C6QA 3THQA 2G5WA 4JX4A 2QJIA 1W31A 2WSYA 1EUNA 2ZRVA 5DXXA 3LHUA 4LRTA 1DJQA 4JGDA 4KFNA 3LXCA 4H6KA 2O7SA 3CIXA 5BRBA 5D2YA 3QJAA 5EBUA 3W84A 2WNZA 3NQCA 4Z1BA 4QQ3A 3KAOA 2BX7A 5K7JA 2ZA2A 3PB0A 5F4XA 5G5IA 3BG9A 1TTIA 4ZL1A 5GVJA 5F1UA 3W1AA 5DLCA 1MXSA 2H90A 4JTGA 1WOBA 1P1XA 2QUUA 4X3ZA 4R7JA 3GXPA 4YCPA 1WDWA 2IQTA 4JTKA 4M5PA 1SQ7A 4Z0SA 1MZHA 4EVZA 4K39A 3OHIA 3C2EA 1S5TA 3LOTA 1V5XA 3UWQA 4O15A 1W3TA 3HF3A 1SU5A 2VEMA 3HJZA 3TNOA 3T78A 5LNWA 1SPQA 1W3NA 1KFCA 4RK8A 4Q32A 5T26A 1JUEA 1O5KA 3S6DA 3W2KA 1LROA 2A7NA 2X2GA 3NQMA 4N02A 1HG3A 4JICA 4R34A 2R94A
chains in the Genus database with same CATH superfamily
3MHFA 4Q22A 4ZENA 3WLKX 1X8FA 1R9XA 4ZFMA 3PBVA 5EGRA 3B0UX 1OEPA 2YZ5A 1LG1A 3S83A 3AWNA 1RZMA 4B5XA 5HA7A 1MUWA 4DJFA 4QG8A 2BY0A 4D2JA 2J4GA 1W3IA 4C7FA 1RD6A 3WLHA 4DXVA 2ABBA 5EFFA 4KWVA 3AZSA 2FPYA 4GFSA 3WFLA 3HG2A 3R13A 3UWZA 4QXIA 3E2VA 3S2NA 3N6QA 1Q3NA 3HG4A 4W8LA 1JGIA 4C5ZA 3G6MA 1F4AA 4LX4A 4IMGA 1XBXA 1I2OA 2OEKA 1SZNA 1T41A 3VX1A 1ONWA 2C79A 3TX9A 3QTPA 4WKFA 2ZUUA 1BYCA 4YL2A 4FIRA 3BC9A 2GGGA 4JIEA 2B7PA 1OC6A 1C91A 3FYYA 2IW0A 1IT8A 4Q33A 1J01A 3B8DA 3MCNA 4C7GA 3PPFA 4H19A 5FL1A 3VNZA 5LKYA 3HO8A 3OZMA 4WOQA 5F1VA 3WF4A 2W0UA 4NASA 3ABQA 4YIWA 1M7XA 1XJBA 5BMWA 3EAUA 3CH9A 4PEEA 3MZNA 1VZWA 3OZPA 2VEFA 4GIYA 4PBGA 4AYGA 3WJZA 1PCWA 1ZJBA 1HKKA 1TZZA 3PZVA 1VKFA 4D1IA 3WJSA 3MMDA 3K30A 3NZPA 1JAKA 3AHTA 1OYAA 2WKGA 4L65A 4MY1A 2YX0A 1P0KA 2WKLA 4ZA0A 2DH3A 4DBSA 2YSWA 4BK9A 2AOSA 4B4FA 1FCUA 3MW7A 3QTGA 1H09A 4MZ8A 3UU0A 1E4NA 3WBXA 1TX0A 3AMLA 5D8ZA 4K7VA 2FMNA 5HJYA 3HPFA 1A3HA 1B3OA 1UP3A 4DO4A 1F61A 3PANA 3W26A 2XHYA 4GYFA 4ZSTA 2X1UA 3PBGA 5FJRA 4U10A 4M1BA 3NQEA 5CZSA 3UW6A 3RDKA 3WUGA 1DJIA 3E2SA 4ROQA 4HNOA 1XUUA 1C9DA 2A3CA 2BY1A 4RDZA 2D0FA 2AKZA 4PFHA 1J93A 5MHBA 2XZ9A 3I6RA 1VYRA 3HFTA 2QAPA 4C60A 5LNVA 5CSSA 2XIBA 1UG6A 2BOFX 3TVAA 4LWWA 4PTMA 2XFYA 4WX2A 3K2GA 2ZC1A 2FYMA 4QAIA 3PZUA 4TIMA 3W7OA 1ZCCA 3PY2A 3V4BA 4HK6A 2VWTA 4UR8A 3KVKA 1REQA 1F76A 2QV4A 3GR7A 4J2MA 3ZZ1A 1WUEA 1YXYA 1NY1A 3CZ8A 2EPKX 4LTSA 4NHVA 1R46A 2J8GA 5K2ZA 3T2OA 1E71M 3WH8A 4GUJA 3D47A 4HPNA 2OPJA 3MYOA 3WSUA 1HQTA 4JCMA 4US5D 4FB7A 1TMHA 3VNYA 4HOWA 5EMMA 1Q7ZA 5LIUX 4GO8A 1JD7A 1V93A 3H24A 1XKYA 1PXGA 3K1DA 1QPQA 3UT0A 2ASHA 1Q6LA 1XRVA 1XLCA 3KTXA 4D8AA 2BV9A 4O4VA 5F2IA 4D1JA 4CNOA 3ZJKA 3EA2A 5EB8A 4PSPA 1W9XA 4M7TA 5M5DA 4NXKA 3W1XA 3OG3A 4QJ1A 1VFSA 4J3TA 3QGAC 4UUIA 3ONCA 3N73A 1AH3A 1S2TA 2FKPA 3PVFA 4AWUA 3AIQA 3TU9A 1A5CA 1TRIA 4Z2KA 1OZMA 4BQ4A 3APYA 4LFYA 3UR2A 4F4RA 2V3FA 4J40A 4GGBA 4S3DA 3GC5A 2BOGX 4GH1A 4YU1A 1XDJA 5FAGA 2XZ7A 2CZDA 1LUCA 2FZ9A 1D9EA 1M68A 1B5TA 4ZOBA 3L67A 3W6YA 3SRHA 3WUEA 1RBOB 3IRSA 2WVTA 2X0SA 4KEZA 1TVNA 2GGIA 2UBPC 4UFJA 1K03A 4B5SA 1UR3M 3B9DA 2DT3A 4KEVA 4X60A 4A3RA 1WKFA 4IPJA 3BLOA 2DIJA 4QAWA 3SIMA 1JDAA 4NJIA 3WDRA 2Z24A 4Q7IA 2QCDB 3GAKA 3KHDA 1OG6A 4QE4A 4U3CA 3TSDA 4TTUA 3UD6A 3CZGA 4NZFA 3A22A 3BJSA 5CJNA 2VQTA 1US2A 5HNTA 1MWOA 4MSSA 3UVAA 3M0KA 1FXPA 3VOHA 4JHMA 4AH7A 2DW7A 3OVGA 2PF0A 3KX6A 1A49A 4MJ2A 3GNOA 5D9OA 5EMJA 5CBJA 1JDDA 2V68A 1GEQA 3W1MA 2WM0A 4Q3MA 1Z8AA 3QEZA 2PWFA 5M2FX 2P0OA 1RVKA 1KGWA 2PEVA 3AHVA 5HOSA 3S46A 1O5RA 3INPA 3G1DA 4K6AA 2WANA 1E0XA 1F2JA 1ONEA 3BDKA 5J5DA 3VE9A 3DFPA 3W75A 4P8XA 1Z32X 5CZJA 3F1QA 3LQGA 4ZQCA 3KVLA 5A6MA 1KBKA 3CUIA 1EP2A 4ZO8A 2TPSA 2EPHA 3TYAA 5BCAA 4LUJA 2OMAA 3W7JA 3SRFA 2FTYA 3T42A 3ITCA 4M3PA 5CBBA 4E3VA 4Q4RA 1NWUA 3HQOA 4JKMA 4MZ1A 3ZVIA 2PGRA 3BQ5A 1DPMA 3AS2A 3W25A 2VELA 2TMDA 2W27A 1F6PA 3W24A 4WEVX 3FJ6A 2DZTA 3W1PA 3MUIA 1SJBA 1P0NA 4Y6GA 2CU0A 3LHVA 2A79A 1NTHA 1UD2A 3GW0A 3NOYA 1G69A 1S2UA 3GNRA 3U2EA 2X1TA 1JZ2A 3H2AA 5FOOA 3M0IA 2Y7GA 1OX4A 4Y7EA 4DO7A 4TV5A 4RNHA 1Y0EA 1F7BA 1RBAA 1XWYA 3CIVA 1ECQA 4U3AA 1BF6A 4KEMA 1KWGA 3CV6A 1AQMA 1H4PA 2Z1XA 3QXBA 2ACSA 1TE6A 1H61A 4KEUA 1W5OA 1J2BA 3OG2A 3O6YX 1Q45A 2BS9A 3BAJA 3U9IA 3QLDA 4JTEA 2XVPA 3H2OA 1UR2A 3OOQA 2E28A 2GJLA 1WX0A 4EX4A 2ZVRA 1QWKA 2Q8XA 2QKFA 2DDXA 5I7GA 2VDIA 4PYSA 3F7JA 3SSJA 5FF7A 1PTAA 3EMCA 3WLPA 5HULA 4XD6A 2RGLA 4J2PA 3ZLFA 3Q94A 1T40A 4DBUA 4QRNA 3SUUA 4AEFA 3FDGA 5H8UA 4FNUA 3M64A 3OLDA 1PPIA 3EDFA 1OX6A 3W85A 2FVKA 1EX5A 2ATMA 3D0CA 5I3IA 2V5BA 5C2CA 1HVXA 2ZQ0A 2G37A 4FALA 1XBZA 1EGZA 2BZNA 4IMCA 2VFEA 3S5NA 3H55A 8XIMA 5C2XA 2RDUA 2GK1B 4HNLA 4YTRA 4NAEA 4N0RA 4QS6A 3WQ6A 3AMCA 3P6LA 3KVMA 1TMQA 5GNZA 2QUNA 4E3TA 1KCKA 2X41A 3RUBL 2CWXA 4H6EA 3N2OA 1A0DA 1PDZA 4NNBA 4QLLA 1XQLA 1EJWC 3T0DA 1EQPA 1M5WA 3FAWA 4QNEA 3PBWA 1XM3A 4I7VA 1E4MM 3R0UA 4LB3A 3GXTA 3F5KA 1QPRA 3MI3A 4FO4A 1RPXA 1YYAA 4DWSC 3CAQA 4N2YA 4RPPA 3U0HA 4LCQA 2OO0A 4R7WA 1EA0A 1EQCA 3P67A 1SGJA 1K7XA 5DFAA 1ZLPA 4NAFA 1W0MA 2VX5A 2BHUA 1AH4A 1KA9F 3GXNA 3KRBA 3TAKA 4DUXA 4GYKA 4JTFA 4CNUA 1Q2SA 2WZEA 3TSMA 2QCFA 3C0JA 3TFCA 4E0CA 5HWNA 3GTFA 4ILSA 2QPXA 5HINA 3JVAA 4ZVJA 1S5NA 1ZP4A 4DZ5A 4TMCA 3QM3A 3QKZA 1VFFA 1EWEA 4HYRA 2X09A 2DUZA 3LGDA 4U31A 2BNJA 2Z00A 2IXVA 2ZZ4A 3AU2A 2G0WA 3RITA 3NDZA 3ARRA 5CG7A 3SN0A 4KFPA 1WUFA 3A13A 3WQ4A 1MQQA 3HU7A 3ZFHA 1TWWA 4F8XA 4A8IA 1GQJA 1VEMA 1DVJA 1U1UA 2D20A 1UW9A 2Y8KA 3BCJA 4JTTA 1TPUA 4OTKA 3WIJA 2XM1A 3U2CA 4LUIA 1NDVA 2P8CA 3USBA 2E7FA 2XFRA 4DYJA 4KIRA 4OV4A 1CEOA 3TC3A 3RR1A 1GCYA 4W9TA 2WCSA 3URAA 1F07A 3B8VA 1RR2A 4HA0A 1Q7QA 2V3GA 2XH0A 3A64A 3AIUA 3WEMA 4MHBA 4H6QA 3BLFA 3CUZA 1TVLA 2ISSA 4HTBA 3WH7A 3C56A 4QGCA 1CGTA 2XPKA 1YBQA 4GNVA 4HPGA 1VLIA 2Q8LA 4MUPA 2NWSA 3G5EA 5KSWA 4YYFA 1RLDA 1S2AA 4JN6A 3C2OA 5D33A 4HNUA 4DBEA 1T99A 1L0PA 3WDJA 3S9IA 4Z08A 1IZKA 3RXZA 3UXKA 3KUMA 1ENUA 3G18A 4XKYA 3BCDA 4IUGA 3NZRA 4IFRA 4OV9A 1S2CA 3W01A 1IEXA 4GX9A 3VZYA 3HGRA 1HGYA 3KLKA 1W2VA 3EDJA 2VEKA 1H41A 3L0GA 2H3BA 3WL0A 1UP0A 3EEZA 4HP5A 2EF9A 4IIFA 1JI2A 3S4TA 3G24A 3VKCA 1KTCA 3W1LA 4GUFA 3TOYA 3TQ0A 3AISA 4WCJA 4XD5A 5FSDC 2KAUC 2NSXA 2VL4A 3DUGA 1PKMA 2VD8A 3G1FA 1JG9A 4POCA 4UTJA 2I1OA 4GK8A 2CNCA 4V1YA 4FXJA 3MDWA 3TE9A 1SFTA 2QCMA 5F4SA 2CXEA 4XQ6A 1PUDA 3L5LA 4WDXA 3TEVA 1V3JA 2PE4A 3TH6A 2WV8A 1W1YA 5AC7A 1JI1A 3ITVA 3K5XA 3NQVA 2PWHA 2PDXA 1VFLA 4M51A 4BF9A 4F0KA 1YHTA 2F7FA 2XJ7A 1OQFA 4XZWA 1XQKA 1EJUC 4JX5A 2XIQA 1XPGA 4P7QA 3EDDA 4IX0A 1R7OA 2OELA 3O6AA 4LVBA 4WD0A 3ZSTA 2PA6A 2ZRWA 4GIAA 3VGEA 5AFDA 1E6PA 6A3HA 3MYPA 4LT9A 3CHCA 4GPNA 2ZBTA 5SWUA 2NXHA 1B1YA 4W7UA 1XRSA 1J18A 4G2DA 4CU8A 1QI5A 3WCZA 4TO8A 4UFLA 3G0XA 2XU2A 2DY3A 1ZL1A 2GWNA 4C6DA 2AL2A 1BGGA 3ITOA 4YMZA 4B15A 1B9ZA 3N3TA 4JTUA 4IIGA 4ACZA 2INFA 2ISDA 5JU6A 1JL8A 2GJXB 3UGRA 3I7QA 3VAVA 3W3OA 1QW7A 1VFHA 3W86A 2HXUA 1ZNNA 3PJWA 4Z1YA 1HUVA 1Q7MA 2IPJA 4LUSA 4P7NA 2NUWA 5F2MA 5AHEA 2FFCA 1W1B1 4O16A 3VIKA 4REQB 1B0IA 1C3FA 3R43A 1KW1A 2CLKA 3OA5A 3ZOAA 3O0FA 5LZLA 4ORMA 3BMVA 5CC3A 1TV4A 3RF9A 3M5ZA 4G8TA 2Z1WA 1F9CA 2GVYA 3W53A 1XCWA 4DUOA 2A3EA 3W29A 3COTA 8A3HA 3GZAA 4IH3A 3L2LA 4H01A 5AC6A 4ZB0A 1KGUA 3WD0A 4YS1A 5E6ZA 4MAVA 2FDMA 2P88A 4EWJA 2HE8A 4EPEC 4WY0B 3WJYA 1R6WA 3S5ZA 4AWTA 5BWFA 4IT1A 1TTPA 3VTRA 4W84A 1YXDA 3LUTA 4ERAA 1XXXA 1TA3A 3CYVA 2QPUA 7REQA 3EPNA 3B06A 3C52A 2OT1A 4AF0B 4XUGA 1K8YA 2V2HA 4QDPA 1DOSA 2ZFAA 3TN6A 2FGLA 3NQ6A 3N14A 1VBHA 3UWUA 3ANUA 2FPTA 3UBPC 4PMOA 4MVAA 2ZUVA 1EJTC 2WMJA 1BQCA 1JULA 2Y0FA 1VJIA 1OYCA 2WHMA 2YB1A 4Z1DA 2J6XA 7A3HA 4Y9OA 3QQ1A 4LRSA 4UR9A 1A53A 5C9WA 4YTUA 3UR7A 5LXXA 3A4JA 1Z7AA 3KE0A 2I56A 1JAEA 2GVJA 4W4QA 4FPSA 3DZ1A 4DAFA 1KTNA 3KP0A 4UZUA 4MLRA 1PTDA 3UCCA 3ARWA 4BQ5A 4H9ZA 3C0SA 1EEXA 3GYEA 4R9OA 2O92A 3PS7A 1PZ1A 2Q09A 3W28A 4WQ6A 3PAOA 4PH6A 1Z9AA 2P1FA 4LF1A 2WC7A 3N9SA 3W37A 1C90A 2HDJA 2PB1A 4WDTA 3WFAA 2VWSA 2H8XA 2GZXA 1JZ4A 4GCAA 2Z6JA 3NYZA 4AIOA 2QJHA 1JD9A 3U7BA 3PHAA 1GOOA 3BZGA 1HP5A 2Y7DA 3UQNA 1M65A 4MY8A 3MA8A 1F73A 1CGWA 2Y88A 4K7YA 2WNNA 2E5DA 5JBEA 3GUWA 2DP3A 1IQ8A 3M5YA 1FTXA 3Q58A 4LS0A 1PZ2A 2WO5A 4IFOA 1M1BA 2HE5A 2EO7A 2ISWA 4K3ZA 4CEUC 3LTSA 4NJGA 3BLKA 3IEBA 3CLWA 1HL8A 3P60A 2A6NA 4GFIA 1NU5A 3BE7A 3NEVA 1E73M 1KXVA 4TVUA 2PS2A 3G3DA 3AHZA 4FIQA 4JEJA 3ZVHA 3LBMA 1MNZA 4CN4A 3TFXA 3JRKA 1OM0A 3MKVA 2XG9A 5EL1A 4AD3A 3U6WA 1R87A 3GO2A 3WQCA 3KOXA 1LBFA 1OCBA 3UJRA 4K68A 5FCZA 1R86A 1U5VA 4PBFA 3UXAA 2ANUA 1SMAA 3AXIA 3W2UA 1UKOA 3WY1A 4S23A 3N04A 1W5MA 1UUMA 3HA1A 5BWAA 1J12A 3TJLA 4JOMA 4LVFA 3NEHA 4C6IA 3QLLA 2YCJA 4O1DA 3QVQA 3G1XA 2OZ8A 3CHEA 1SO4A 1WZMA 6REQB 4IG2A 1IGWA 5G4HC 4N9DA 2OZTA 4JTCA 3V75A 1DBTA 2UZ9A 3S42A 5IBXC 2JKPA 1OWQA 1X1ZA 4O0QA 5E0KA 4OVXA 2XSAA 2VRJA 4LVDA 2FH8A 3RU8X 2I17A 1E70M 1E15A 3ONBA 4R5EA 1FUYA 4LYQA 4GXPA 4QNWA 4LC8A 4FI4A 5KINA 4N6EA 1FY6A 5BXSA 4PUEA 1Z89A 2O4QA 2QDHA 3IAQA 4P7OA 3R79A 3GG0A 2CLFA 2A0NA 1TUXA 4PEKA 4Z2JA 1ODUA 1W5NA 2NX3A 3B9NA 2EPMX 1ITUA 3KRUA 4LAKA 2NV1A 4PRWA 2WNQA 4XX6A 4OBTA 3H7VA 5A6BA 3WBAA 1B57A 4LVGA 5IOBA 4UQEA 2OQYA 1IWAA 2DZPA 2W62A 2WPBA 1V3KA 3TKFA 2QJGA 2FHBA 3CUFA 2OX1A 5DMLA 3MU7A 1JZ3A 1CIUA 3DG3A 5GJNA 3N4FA 4MNKA 3UG4A 2OEMA 3QV9A 4CNTA 2XUCA 4D9PA 4PMNA 1UC4A 4DF2A 2QR6A 4HVXA 5FF0A 1VH7A 3KW3A 4Q4OA 4YCOA 4HPXA 1T0OA 3BXWA 3LM3A 3HV9A 1EJRC 5ABFB 4D6CA 3FEQA 1EF3A 4PBEA 5ABHA 1J0ZA 2YXGA 5GJPA 3R0KA 3RO8A 4N9CA 2GSJA 4I5UA 2PAJA 4ML4A 3A4XA 2Z1VA 2DJXA 1XBVA 1P7TB 4OE7A 4C7DA 3MUZ1 1ZSXA 4H83A 2WBKA 3TWBA 1L6FA 1ISVA 4E5TA 3BOXA 2GSHA 3GD6A 5IRPA 2WSPA 4K8EA 4IFKA 2QNEA 1QWGA 4ML9A 1GORA 4IP7A 5TNVA 2WJEA 1X6UA 3SCRA 6ENLA 3O06A 1FKWA 1RK6A 2G50A 4G5DA 5HUOA 1GVYA 4JD4A 5AY7A 2PLJA 5IFTA 4PTVA 1V51A 2DH2A 3KHJA 3MS8A 4GZJA 2HISA 2YFOA 1GOXA 3URNA 4H2HA 1WXZA 1OGGA 1B3YA 3AUJA 3DKLA 1EA9C 1E40A 2V5KA 1XC4A 2QCGA 1GYMA 3C3NA 3TTOA 3OU8A 1W1TA 1A5MC 1LT7A 5I78A 1UWTA 2PCEA 1DEDA 1U5HA 5E9AA 1P0DA 4JCLA 1EIXA 3WEOA 5EMUA 1XI3A 2O55A 1OFEA 3P93A 1E0UA 3LMYA 2R6OA 1E6ZA 1L2UA 5TF0A 1TTJA 3SRKA 1UUQA 4Y90A 4M80A 1DTNA 1HXJA 1MZRA 5C7VA 2NT0A 2E6AA 2KX9A 2OYKA 2J8TA 3IJ6A 1BD0A 1HL9A 1EZWA 1TPC1 3VE7A 5H8MA 4KBXA 1R7AA 1X39A 4L9ZA 1KD0A 1H7XA 3BGJA 2WB5A 1VEOA 4J3WA 3QY8A 4YTSA 1J0YA 2OCZA 3TYUA 2Y63A 4B2DA 1MEIA 1HKJA 1SW7A 3G0SA 5CLWA 1CXEA 3MANA 4GZIA 1FWWA 3FA3A 4FR1A 1SO5A 1A5AA 5AYYA 1ZU8A 4ZQRA 2WKJA 3TONA 1FWAC 2W63A 4LW7A 4ZB2A 1ZP3A 1OFRA 4DJDA 3LRMA 3ID7A 1CLKA 1K02A 3NTYA 1TJPA 1JPIA 2TSYA 1ODZA 3LU2A 4MWAE 1TPFA 5HPCA 1V6TA 5AHLA 3W7LA 5FIPA 2W5FA 2YBUA 2GGHA 1BSIA 3HG5A 1DJGA 1JQXA 4Q8OA 3ZQ9A 3ARQA 1ICPA 3CGTA 1VB9A 1Q4NX 4HMEA 3LHTA 5D2VA 4F9DA 1SW0A 2UY2A 4XBKA 1J10A 5IBXA 2OOFA 2L5HA 5K9XA 3UCQA 1TWSA 1DWAM 2OYMA 3GTHA 1AVAA 1QNPA 3H2EA 3L4TA 4ZOAA 3I4EA 4RCXA 2Q8ZA 1HW6A 2E4TA 3AMDA 3W82A 3P82A 1KM5A 3VA8A 3ARPA 1EYWA 4DO6A 3A47A 1HKWA 3CHFA 4WLCA 2YYUA 2ZDRA 4BQ3A 3II1A 3VIIA 4ZMGA 5CJ5A 2VO5A 3GTXA 1D3CA 4O52A 3AYRA 4IIBA 2G97A 4XSMA 1NWRA 4AD5A 3MMTA 2J7GA 2IUZA 1V0LA 5BZAA 1AODA 1EJVC 3MJMA 3W07A 4OECA 4IGSA 2NZLA 3I3EA 4Q8PA 4QLKA 4HGXA 3QRHA 4KETA 3OLIA 3VC5A 1I4NA 2IMRA 3BLDA 4GYPC 5BW6A 1I2QA 5I07A 3ATYA 1XG3A 3BMWA 4W8AA 1VFMA 3IJIA 3HOJA 1F8IA 1B3ZA 2PU0A 4FF5A 2W61A 2VEGA 4FNSA 1NAL1 2CZEA 1RQBA 4S3EA 4AVFA 3K13A 2V63A 1ZB5A 3WDPP 1BF2A 1QCWA 3BAXA 1SFSA 1XF0A 2BWGA 2IKHA 3WQ8A 5G2IA 2ZX9A 3PK7A 4MOZA 3S1GA 2ZXBA 3I7SA 5DBUA 2VFDA 2HMCA 3C4UA 1Q13A 3WLTA 1N8WA 1U22A 1OYBA 1TUFA 3THQA 1N2VA 4JX4A 1W31A 4G7EB 2WSYA 1EDGA 1VPQA 1PEZA 3RJYA 3S3GA 2ZDSA 5DXXA 1DJQA 1ZTVA 4JBRA 2V3DA 5BRBA 5LYRA 3CL8A 2WNZA 4Z1BA 2ZA2A 1GJUA 5G5IA 2BMBA 1CGXA 1UPMB 3W1AA 4HTYA 1MXSA 1Q6CA 1TFVA 3Q45A 5DLCA 3WD2A 4C1NA 4FR6A 3IJ7A 4JTGA 1P1XA 3GH7A 2QUUA 2XWDA 1CTNA 4X3ZA 4R7JA 2F6XA 1R0MA 1GW1A 1AQ0A 2P50A 1XW8A 5I02A 2IQTA 4Q8QA 3CTTA 5B7YA 4RE4A 1GNXA 3M7SA 3O2LA 4KW2A 3OHIA 2HBXA 1KCZA 1X7IA 1V5XA 2Y1HA 5CCZA 1SU5A 1LQAA 4MTVA 2BHZA 3HJZA 5I77A 2V5JA 2TAAA 2GJPA 2XIMA 3SAZA 2CBVA 2QW5A 3ZO9A 2A7NA 1XLLA 3RYSA 5TQLA 4PMXA 1BTMA 4A22A 3IJDA 1OCJA 4WRHA 2W92A 3GRIA 2ALDA 3A5FA 5A2BA 1Q63A 3JS3A 4HA3A 1O6IA 3FVDA 5REQB 2WLZA 3M0MA 2D2HA 4M56A 3FK4A 1Q6FA 5A8MA 3RHGA 1IF2A 2CWNA 1RCOB 1MUCA 3VIPA 4C6QA 4C6LA 5E0FA 3WLMA 1X7FA 2Y7FA 3QR0A 2Z1SA 1ZGDA 1E43A 1ESWA 1JUBA 5ECUA 4NNCA 2CHNA 4PUJA 2G3MA 3PB2A 1P6WA 2OZ3A 3W7DA 4S38A 5DCDA 3W72A 5FEXA 2ESCA 3W73A 1DP0A 3PWGA 6CGTA 2V5DA 1Q8JA 4GWEA 2WSQA 1P0BA 4F0LA 3VNLA 5I3GA 5A3HA 3GVRA 3EOUA 4G1KA 2CC0A 4S3GA 5C54A 1LQ0A 1SYTA 1FH9A 2JF7A 2ZKMX 1TCMA 1R3VA 1M41A 1HP4A 4ZQOA 3VVGA 4DPPA 4HHHA 1TJRA 4O10A 1OF6A 4JS3A 2ZCGA 4AZCB 1DIEA 3ARXA 3LM7A 4WUIA 1C93A 4O17A 1SZGA 4FNRA 3F03K 3T4CA 3POHA 1CX9A 1E9ZB 4IISA 1DJYA 5DT7A 3L2MA 4UFKA 1Z48A 3PULA 3PBMA 1T6MA 3RCNA 2Z29A 4XB3A 3ZSSA 3SCWA 3HGSA 4JY8A 3W2MA 3SCNA 1K70A 2P76A 2XWEA 2V5CA 4N4QA 3B8UA 4PR4A 4UTWC 5G4WA 1WOAA 1FFRA 1JCNA 3V0UA 2Z26A 2Y62A 4JY9A 1CW2A 3GDTA 4AUBA 2WMIB 3G6LA 1NFGA 3HFYA 1IIGA 4IQDA 1BYDA 1SW3A 2OSYA 5E09A 5JBFA 2VEIA 4JFUA 3VD4A 1GVQA 4GYPA 3DFNA 2Y8UA 5HUPA 4Q8VA 1OFOA 4QX4A 2VRKA 4FXRA 1XFBA 4BEUA 4OOZA 1XSKA 2EG6A 2VP8A 2CERA 3W1UA 4H8HA 1EPXA 3QPEA 1HJSA 4RPQA 5HMSA 1QPKA 4KRUA 1WDPA 4GVIA 2WOQA 2FH6A 1O5XA 4C6PA 5AC4A 3L0KA 2EEXA 1BEUA 2Z0IA 2ZRZA 3KOYA 1QW9A 3WLRA 1AW1A 1KFBA 3B4UA 4D6HA 4PA8A 3H4WA 2Y5JA 4P2VA 2VCBA 1X6LA 3NZQA 2OFJA 1XIIA 2ZX5A 4XTIA 3EXTA 5XIMA 4BI5A 3EOSA 3KTCA 3PUOA 3OA3A 4H8VA 4B3LA 1F4HA 3UWYA 3H22A 4O53A 1VFOA 1GT8A 8CGTA 4I5RA 4DLFA 1O1HA 1TPEA 3G8EA 3ARSA 5I3JA 4J3SA 3B0VC 3LTYA 1C8VA 1BAGA 3W7RA 3Q2DA 1JF6A 3N19B 1DJHA 3V1HA 4XIAA 1Y8BA 1UZ4A 1GGOA 3SN1A 3KS6A 2ZC8A 3NSNA 5KMYA 2CXGA 4O4WA 4H04A 3P14A 1BG4A 1EBHA 3MV11 4LSBA 3QGKC 4LPCA 3U4FA 4PCPA 3BG3A 1ELSA 2C13A 3B8TA 3NOEA 1J4EA 1VS1A 1E6RA 2EPLX 4HHPA 3APTA 5LSMA 1W3KA 5G2HA 1J8VA 1G4TA 2PDNA 2HSAA 3UYCA 1OBAA 3K4AA 3V18A 1GVEA 3QSTA 1QO5A 1ECEA 4BKNA 4DI9A 2J88A 3MVIA 1B31A 2PDUA 3LHYA 4ZQNA 4WOZA 1E9IA 2WYSA 4LOCA 4NQ1A 5C9ZA 3ITTA 1LRQA 3CLMA 1K6WA 1GVFA 3BL3A 1CXIA 1VPXA 3CAWA 4DXKA 3EOLA 4RDWA 3AHXA 5ECVA 3IUDA 3LV6A 3TN5A 2OQHA 3QKEA 4NJJA 4RDYA 1LL7A 4JQAA 4WJ8A 3ANYA 3RNDA 1V3HA 4DM2A 4ERIA 3ZJ6A 3QFWA 2PU1A 1KR1A 3GHTA 5A6AA 2ONEA 2ZRUA 3QYSA 2BXYA 3A4WA 1HO1A 1BHGA 1DWGM 1TB3A 3QYQA 2CLLA 2O9OA 4I7WA 3XISA 1RBLA 3BAYA 3F4DA 3LK6A 5CZKA 3BLPX 1YNQA 1FQ0A 2XH2A 2XVGA 3CPUA 1DQXA 3CBWA 1L6SA 1XS2A 1E6NA 3NDYA 3DG6A 3PZOA 3L12A 2CLEA 1KFWA 3ZS4A 3WQDA 1I1XA 1DWHM 1Y5WA 5FSEC 2PDWA 1LDCA 9XIAA 1H63A 3VD7A 3ABOA 4LH8A 3E96A 3LD5A 4MYAA 3HJEA 1XYMA 4C5YA 5DRIA 3T4WA 2QAFA 4M1RA 3T9PA 1VAHA 4AZHA 2OSXA 1CPUA 2PTDA 3KZPA 3SGZA 4F2UA 4Q7NA 4QDWA 2CCRA 4BWLC 4E8CA 4NUWA 3AMKA 3NL3A 3QHNA 2BVYA 4IOTA 4PMQA 5XIAA 3BK0A 2X40A 5DF0A 1EP1A 6PTDA 1CGUA 5EY5A 1IWPA 1KM4A 2UY4A 4JYDA 4JFTA 4PTNA 1QNRA 2H9AA 3OQ8A 4ZTYA 4D6JA 3NIYA 4CD4A 3QSRA 3SRDA 3UZJA 2TRSA 5AZ0A 2OU4A 4PGLA 2DIKA 4N4PA 4PFMA 2REQB 3VKKA 3U5UA 1EDTA 4H41A 3R12A 1LWIA 4OFCA 2DUAA 4HZ8A 5A95A 5HMEA 1KB3A 1WDRA 1LM1A 1D7KA 2Y5EA 3CEUA 1ZAJA 2A7PA 3GH4A 3B8SA 1YE4A 1V6VA 2GLKA 3KWXA 4M6QA 3T40A 1VQTA 2Y61A 3VMOA 3QV8A 4IGNA 2WXDM 3BMXA 4AHQA 5HR7A 1J9YA 1PV8A 2PWVA 5T8GA 2WK2A 3FS2A 3QR3A 5CBIA 2ZZ3A 1KXHA 3V7PA 3SY1A 3BWWA 1ZBVA 4PUWA 3BQ6A 1M01A 4J3XA 4AIEA 3W23A 4NX5A 3WZ0E 1JNEA 4FP1A 5CGMA 4JFWA 1TYGA 1NARA 1GWJA 3OZOA 4XZIA 3VX0A 4MMWA 1R47A 4Z42C 1SZRA 3TN3A 3FSUA 3R2GA 1U2YA 2NQ5A 3UESA 2PFHA 3HPAA 4JDBA 6XIAA 2BOEX 1W3LA 3O9NA 4D6GA 3TQVA 3R1ZA 2OG9A 4YVPA 1JR1A 4IMAA 3AO0A 4M7SA 3CTLA 3TW7A 4LS2A 4BJHA 4PCFA 1GOIA 5C9XA 4GJIA 4Q4KA 3HMJG 5D03A 2C3ZA 3UG3A 1P6BA 1PKNA 1UH4A 3M0ZA 3OVPA 2W79A 1U83A 1JQVA 3IJQA 5I3HA 1QBAA 4QCEA 1OD0A 1E6SM 1W8SA 2G3IA 4A8NA 4LYKA 1H50A 2PDFA 3BGAA 3OGSA 4DNHA 3MBFA 2X1RA 3U2ZA 1S1PA 1K8ZA 2PRMA 1C8QA 4K1GA 1QW8A 2Z25A 4KWWA 2XH7A 2XGBA 5CLTA 3E0LA 3BAKA 1UP2A 3LSBA 2PCQA 2PMQA 4P5UA 2VEPA 3TMQA 1J6PA 3LXAA 4DJFD 1WBJA 1E9LA 2E0PA 3V0SA 3EWDA 4LUYA 3U4AA 4URIA 1O12A 1BXNA 5A1AA 1E4IA 3FYOA 3OZYA 1BLIA 2G3JA 4PUMA 2VI0A 2PZ0A 3M0YA 3GHRA 1A5LC 5I3KA 3F2DA 2D2OA 1XLMA 2QDGA 4G9PA 1LZOA 3VM7A 5AKQA 5KZEA 1KRMA 2OXNA 1O4UA 4NX0A 1XGZA 5TD4A 1EHNA 4XK2A 2YKKA 1F3EA 5CZTA 5IHRA 3PNUA 3E0WA 3N6HA 1ADOA 4M29A 4GC4A 4JIIX 4ICMA 3EMZA 3EMQA 4E4PA 3UP8A 3MI6A 4WDUA 3CWOX 5CZ0A 3GTIA 1FP8A 2RDWA 1R8LA 3FJ4A 4UQBA 1F5ZA 3PZGA 3TQKA 4RZ6A 3AXKA 1JZ7A 1WAWA 3N6JA 2DSUA 3R58A 4LEQA 1DIOA 1S46A 1US3A 4KCWA 3KM8A 1TPWA 2XTKA 4XO7A 1RXOB 5EKYA 3ZT5A 1HN1A 9CGTA 3IANA 4JXCA 1EOKA 1RP8A 3B0XA 5D9PA 1OFBA 2OB3A 4EAMA 1CXLA 2WHJA 3NQBA 1B30A 2YL6A 1WAUA 4QEHA 2QPSA 3BAWA 3MQTA 3H12A 2EJAA 4ECLA 4P7LA 3SN4A 2B7OA 1HT6A 5LIYX 1UZ1A 1HJWA 3R4IA 1JCLA 5J5RA 3VOFA 1V4YA 3REQB 4C1LA 1Z41A 3T0BA 4BQ2A 4BWLA 1A4MA 2HS8A 1RY8A 1ZAIA 2NVAA 1LLOA 1W3JA 2VZSA 1ZBWA 1MI3A 1WA3A 4MYXA 4E4UA 3CQHA 3UPBA 1IZJA 2VZTA 4FAMA 2GYIA 2G3FA 5CPSA 2YYTA 3AMGA 4JQ4A 4O19A 4J35A 5EPDA 3LI1A 5HNRA 1X1NA 3GIQA 3K46A 3OBEA 3FN9A 3BZJA 1K9DA 5CSUA 3WFZA 4RZ4A 1UD4A 4JL2A 3JU2A 4MWAB 4QHRA 3E38A 1J2WA 1GOQA 1MSSA 1XSJA 1OCQA 5AC8A 2E9MA 2WW5A 4QG9A 3T44A 1E6QM 1NEYA 3TYEA 2ZZ5A 4GISA 2XN2A 5I2UA 3WD4A 1WYIA 1LBMA 4KCVA 2HVOA 2JQXA 3NVTA 3QQ0A 1IXOA 3DECA 2V81A 2DUXA 3F4WA 1H49A 1TQXA 4LANA 3BV7A 5L9FA 3W81A 1Q2RA 3ITGA 1P1MA 3WQVA 4OBSA 3WQGA 1CXKA 4S3KA 5KEZA 3GFYA 1CDGA 2C0HA 2V67A 2GJXA 5BMXA 4MADA 3PZ9A 3P8IA 1YEYA 1VCVA 1NOUA 3MUCA 4REQA 1FWGC 3BW2A 2Z6IA 3A9BA 5CXPA 4Z2LA 4OUEA 3ES7A 2C71A 2C0AA 3UA3A 3W1TA 4GH3A 3WH9A 3CHVA 2WMFA 3E5BA 2FHCA 3NGJA 3CMGA 3PC0A 5AYZA 3GVWA 4HNNA 3AYVA 4JDYA 4F40A 4UFIA 4JFVA 1FA2A 1UR9A 1IZCA 3T8QA 1GQLA 3RLVA 1QNOA 3WNNA 1V0NA 3ZJ7A 3C0LA 1FFQA 2PWDA 5G1TA 4J5NA 1CECA 1QI4A 1IWBA 4I5XA 2FZDA 5TBOA 5HMDA 1QI2A 4QS5A 1VD6A 5HMFA 3GM8A 3FV9A 2NW0A 1RLCL 3M07A 4EPKA 5H91A 2PD9A 3FA4A 5E93A 3L4WA 3E02A 2VC6A 1W9BM 5D9MA 2DZBA 1O1ZA 2B31A 2NLYA 5DRCA 5AB3A 5FL0A 5F2GA 2O9PA 5D9NA 2VT0A 4JIRA 3BSGA 1ZJIA 3QBUA 3L2IA 3RX2A 1R2TA 3BTNA 1PSCA 1PS9A 1XHGA 5HNUA 3SURA 5AVHA 4UCFA 4V33A 3DYPA 4UMBA 1TV2A 4OT7A 4FZIA 1QNVA 2SFPA 4GUHA 2JE8A 1TE1A 2CITA 3SECA 3SGGA 4UXDA 3SADA 4AMAA 2ZXAA 1XDLA 4NY2A 2YLAA 3WF3A 3DC8A 1HGWA 1MRQA 3WH5A 4LAOA 4F9JA 3CPRA 4HSHA 1B90A 2VM8A 4MNMA 3NDOA 3VU2A 5J8LA 3EPMA 4ZE4A 4WXYA 3C2RA 4RZ5A 3UJ2A 3PTQA 3VXGA 4NZ5A 3VGFA 4RUBA 3SM0A 1YRRA 1OT1A 2ZA3A 3S0CA 4PC8A 3TCSA 4PRTA 3ABRA 4JX6A 5LA1A 2WJFA 1UUOA 1XGDA 5FJUA 1C29A 4F2TA 1JEZA 5D4YA 3PFMA 1FCBA 3OHMB 4X2PA 1AK5A 3MO4A 2XGIA 4TXEA 4MPQA 3E9AA 5T91A 1OG0A 1XG4A 1AD4A 3DYMA 3B3DA 1AFSA 1O60A 1LRTA 1PCKA 2FHFA 3STEA 1HJQA 3AYTA 1TIMA 1UR8A 3FHQA 4QIUA 4J4KA 1XLAA 4RNIA 4N9EA 3VCRA 1GW9A 1UD8A 2HPIA 1F3TA 1AMKA 1XV8A 4L4MA 1BFNA 2A3HA 4NYUA 3WQPA 3QC3A 5I23A 2HJPA 3R0DA 1L8NA 1MNSA 1NH6A 4UZSA 5D32A 4UTIA 3HN3A 3OO2A 1M04A 2FGBA 4TU1A 3LLFA 3LZ5A 1KKRA 3EXRA 1K9FA 4E2BA 1A5OC 3B9EA 3KBVA 3RMEA 4PN2A 4HMCA 3UXLA 2NXGA 1EZ2A 2DZXA 4RXGA 4LGXA 3I4KA 3VCNA 1D3HA 5A6TC 4K36A 2VX7A 2BXVA 3EWXA 3GDRA 3H26A 2ZOXA 3L65A 3NQGA 5I09A 5GJMA 3DG7A 5LNRA 3CPGA 1I6NA 2W91A 3VIGA 2HNEA 2A3AA 3URBA 5C5YA 3MP3A 4S3FA 4NZJA 1X1OA 1X97A 1UC5A 4LAZA 3AAMA 4LY8A 3TIMA 1O66A 3MUXA 1PL9A 2QYGA 5D37A 1N55A 1GG1A 4P7RA 4WHBA 1FHLA 4HZMA 2Z4GA 1Z69A 1KXQA 4GI9A 4BZYA 6REQA 4XSLA 1HKIA 3LYEA 4FNPA 4P8UA 1DE6A 3NL6A 5D05A 3O05A 4AY8A 5TAOA 1ZCOA 5DQPA 2QT3A 3W27A 3E0IA 3WJXA 3K8LA 2ZZ2A 4JTAA 4UFHA 2YGYA 3M1ZA 1ICSA 3MV01 3MSDA 4UTUA 4MFDA 3VI2A 4MKSA 5EU9A 2XSBA 3WQOA 4PODA 1UYQA 3W38A 1G01A 4GYJA 4DF0A 4NZ4A 4Q8TA 2R82A 1SFJA 3ITLA 3HV8A 2WZIA 3KL0A 3EX6A 1HVQA 1ZQ5A 3E3HA 5HPOA 3AZTA 5KETA 2PDBA 5K3VA 4H8UA 1R3SA 4RX0A 2DT2A 4Y2WA 3FIGA 2ZRYA 3HMCA 3L4YA 5TIMA 7PTDA 1B4KA 3FKKA 2JFEX 4JHOA 4PRRA 1V3LA 1CBGA 2J9YA 1RH9A 2WJZA 4NP7A 1OF8A 2HROA 2NUYA 2J7HA 3W74A 3WF1A 2WVUA 4WJEA 1A3XA 4IM4A 3WMSA 2NQZA 3GY1A 4F2BA 3DBPA 2PDLA 2P5NA 5ABFA 3IGXA 4K8GA 1NDYA 3G1HA 4MKNA 1A3WA 1EYEA 1GOKA 4AIUA 1GVRA 3IVUA 4I9AA 1BWKA 1VC4A 3TDFA 4MY9A 3UWEA 1PJ9A 4IGHA 1JUKA 1P7TA 4U4MA 4O13A 3HGOA 2INEA 5JH1A 1ZENA 3TC6A 2POZA 2V8ZA 1IEIA 1KLZA 3VM5A 1SM9A 1ADDA 4GNJA 4QSFA 3T55A 3TTQA 4AIBA 9XIMA 2GOKA 4FMVA 4NAFB 4PMDA 1QO2A 4UTHA 1MUMA 1LLZA 4W88A 4XG1A 5BOEA 1GG0A 3PSWA 4L1XA 4GBDA 4IPNB 3DHDA 1I0BA 1ZRQA 1WQ5A 3FSTA 3ZR4A 1QHOA 4PL2A 4Q6XA 3WQ5A 1RVGA 3FKRA 3TJ4A 1H51A 3NWRA 4A3HA 5C8BB 1M7PA 1W37A 4CNNA 5AN7A 1LJYA 4GRSA 3VFLA 5HK4A 1IEQA 1XD1A 5U4NA 3NQAA 4DI8A 1HTIA 4C6BA 3GS6A 5KZDA 1VHCA 2WC4A 4ACYA 4LXFA 2FDSA 4B9YA 2PDIA 1GTHA 2RFGA 1A80A 1J0JA 4F48A 1E0TA 1A5KC 2C7FA 1DJZA 1XLDA 2FPVA 5AHNA 4FNQA 1KBJA 1B3VA 3D5HA 4PMRA 3UVIA 1KBLA 1OHLA 3IUIA 4AVNA 4IIDA 4L64A 2EQDA 3CO4A 2Y70A 4A8LA 1KV8A 2WQDA 4IPLA 3PZMA 4CN6A 1C8XA 4B5WA 5KZMA 3GBDA 5BXPA 3MMWA 2NQHA 3BW3A 3IJLA 3UZXA 1VF8A 3P62A 2NQJA 2CZFA 4KMQA 1YBQB 5E0CA 1YIXA 3TAOA 2OEJA 3L0NA 2O56A 3UPMA 1QPOA 2ZYFA 3QGVA 4LYRA 4WGXA 3TN4A 1XBYA 3WL1A 4EOUA 3BW4A 4ES4A 1DE5A 3LX9A 1W1A1 3STPA 1AZ1A 4PMVA 1WBHA 1VIZA 4YHEA 4O8RA 2B7QA 1EJXC 2ZWYA 4AWEA 4AISA 1V02E 4O14A 1FOBA 5HQMA 5FAJA 5FEPA 3PUEA 2E5CA 4HNVA 4XIMA 2IQDA 3T0CA 1LWHA 4Z0JA 3CNYA 2PGFA 2CPUA 4RE0A 1OY0A 4H9UA 1CXFA 4QP0A 2A21A 3BPWA 2FGZA 3FCPA 3AIBA 2XVKA 4JQ2A 3I68A 2VR4A 5GNXA 5CGTA 1S39A 2PZNA 3MSRA 4ATLA 1FRBA 4JQ3A 2E6FA 1I45A 1O5QA 4BFAA 3VGHA 1XYBA 4PULA 1GJWA 1JVNA 2PD5A 5M17A 3L23A 4B92A 1UIOA 3RGTA 2BDQA 4GXWA 1VENA 5CSRA 2PRLA 3GXFA 3VUPA 2ALRA 3S2LA 1KM0A 1TELA 1ALDA 3N2TA 2QIWA 2GUUA 1OFAA 4HSOA 2O7QA 4D72A 3LZ3A 4O1CA 2F6KA 3CIWA 4MNLA 4XZBA 6XIMA 1NF0A 1YDOA 4O8AA 2OJPA 3O6DA 4C6OA 1LP6A 4UMCA 4EPBC 3K1GA 2YDSA 2EKGA 2DIEA 5C0QA 4GQ0A 3M44A 4R7OA 4O54A 1Y5VA 3P84A 3KOZA 2G96A 1UQYA 1H3GA 2D3LA 1BWLA 2R9RA 3IAPA 3GG1A 1A5UA 3CJPA 2DJLA 2VZVA 3EX2A 3ZWTA 1VBJA 3KBJA 4S2BA 1AJZA 3V0TA 1W5PA 4BA0A 1PHWA 4FHAA 2BODX 2O4MA 3GKAA 2QJJA 1IXQA 1X8CA 2D1ZA 1KC7A 2VX4A 2EGZA 1N8FA 3KCLA 1C7TA 3WYZA 1UD6A 2AGKA 3LMZA 3RU6A 1Q5MA 1BWVA 3LPOA 4WR3A 3LCWA 3SI9A 2QCHA 3NPWA 4BI7A 4LUSB 1RA0A 4IHCA 1JDFA 4ZXLA 4QLJA 2YLLA 4GC3A 4NNAA 3WN6A 3KEHA 2HZGA 4KCUA 4XZMX 1TKKA 1KLYA 3B40A 4MB1A 3ZLHA 1VP5A 3W00A 1E56A 1TPDA 2VOMA 1R3TA 4BR1A 4K2SA 5IDZA 1H2JA 2WMGA 2QQ6A 1DIDA 1FH7A 1E4LA 3IVTA 3LDVA 3I3BA 3CB3A 2XSXA 4MG4A 1PKLA 4IMDA 3BANA 1ONRA 3SUVA 2OGYA 2QS8A 5CEWA 4TOQA 4YWIA 4CD6A 2VCCA 5F2LA 3NAVA 3CO8A 3DFSA 3LB0A 4AXKA 2AL1A 1B9BA 1RALA 1H5YA 4X0VA 3OPSA 5IXEA 4S3AA 7REQB 5BU6A 4H1ZA 1EUAA 4ROPA 4BI6A 1GHSA 2NXIA 1G4PA 1NM9A 4L1GA 5EMLA 1TIWA 4QE5A 1IV8A 4GACA 4XZNX 1JZ5A 1RJPA 4ZO6A 5C71A 3BSHA 3CUHA 4JGDA 1UOKA 3UJEA 1TWIA 5D2YA 3GXIA 2HXTA 3WLLA 3QJAA 5EBUA 4V1XA 4EACA 4QQ3A 2PODA 2PPGA 4LYPA 7CGTA 5F4XA 3UYIA 3BG9A 1KBBA 5F1UA 3QY6A 3V35A 3KTSA 1WOBA 2G8ZA 3GXPA 4RNJA 2VCAA 4KIEA 2QJNA 3CYJA 4H9VA 3UEQA 3K8MA 4UOQA 3N9KA 4BF7A 4I8YA 4EVZA 4K39A 4YVVA 1LL4A 1S5TA 3LOTA 3UWQA 4KS0A 1W9DM 4O15A 3GIPA 1W3TA 2YDRA 3NXLA 1QHZA 5LNWA 1UKPA 3RLGA 1SPQA 1KFCA 2DEPA 2YB4A 3I6EA 1WE5A 1QUMA 3GTNA 3W2KA 4NL1A 4N02A 1XYCA 1RSCA 4R53A 1WDSA 2WWCA 4XBJA 4QTGA 5D04C 2R1PA 4JIPA 1WNOA 1QRQA 2GSEA 1MEHA 2ZX7A 4FX6M 1KTBA 2QIIA 3AOFA 3C2YA 1N7KA 2HK1A 3TK7A 3W7IA 1XD0A 3B05A 4QISA 1V03A 5FESA 3GFZA 3GFXA 3GU1A 5LXEA 1H1YA 1FDZA 3DGRA 1DHPA 2Y8VA 1TJ1A 1V6YA 1VBGA 2Z2UA 1QOXA 5HQEA 4IP4A 2HEJA 3ZYZA 5I3FA 4GIRA 3QMRA 1OIMA 2GVEA 5FF2A 3BJTA 5FJJA 4O1AA 1WCGA 4EP8C 3EX4A 4UTFA 1JXJA 4FLQA 2WMIA 3WMLA 1VEPA 2V6AA 3Q4DA 1TG7A 2BLEA 3URQA 1E51A 5EMYA 4B3ZA 4ZODA 4HA1A 4C6MA 2V9DA 3AJ7A 4V15A 3FJLA 1K1DA 3WJWA 2X42A 1RA5A 3UJFA 4QJ5B 4C90A 3M41A 1ME9A 4N9BA 1YPFA 3TA6A 3KBMA 4WSJA 4XAFA 3U8GA 3S2MA 5BOFA 3CQKA 2VR2A 4F0SA 2Z2AA 2GGJA 1KXTA 1CZ1A 2E6YA 1WB0A 4MM1A 3FXGA 2VOTA 2OSWA 3CQIA 3N25A 4UBPC 1NP0A 4GUGA 5A2AA 2YDQA 3PNZA 4NSBA 4HOXA 1S2VA 1VYPX 3GZ3A 4AB4A 1R9YA 4LBSA 4LBRA 4AZ7A 4Q8UA 2DSZA 4CQ9A 1V8EA 4B90A 1EF2A 1XINA 3FEMA 3AC0A 2CBIA 4EF9A 3I10A 3UZYA 2DZSA 3V1PA 2QXWA 4AMCA 3ZMRA 4IUOA 4CLMA 3ICJA 4O12A 5A6BD 1JCMP 4EPDC 7ENLA 3H4XA 2Z7GA 3JZUA 1ZAHA 2GQAA 4KH2A 5AOUA 3GNNA 1AQFA 3MPGA 1ZZMA 1FXQA 4Z1CA 3HQ1A 2J7EA 4GGHA 3S47A 3KBWA 4US6A 3V5OA 5A6LA 5HWMA 3C86A 3VCCA 2BVTA 9RUBA 1Q85A 2FVMA 2XGZA 1E5JA 2Z28A 3BVJA 3T8LA 4EXAA 3VIJA 4UTTC 1P43A 1EC8A 1IXNA 3AS3A 3WDQA 2YCLB 5LGXA 1ISYA 4CN1A 1BXCA 3VPLA 2XDFA 5HJLA 3CV2A 2WWDA 5H2ZA 2J25A 3ZT7A 3DENA 1PX8A 2YA2A 3FA5A 5CC5A 1G1YA 2AQWA 4E2VA 1IHIA 3P0XA 4UOJA 1IT0A 4IXHA 2ZXQA 3DFYA 1A0CA 5JXQA 8RUCA 4PCTA 2AGTA 1ISWA 3ENLA 3PAJA 3SQSA 3U7VA 4H7VA 4LC6A 4HT3A 4L9XA 1KBIA 1XIGA 2OQLA 1KKOA 4HCHA 1M53A 3ABZA 3EOEA 4L1WA 1BRLA 2FTPA 2BXZA 3CUJA 3H6OA 2PDJA 1EEPA 5AHFA 4NILA 4HN4A 4R9XA 5A8GA 3R8RA 3CZJA 3L4UA 3VFCA 3BSMA 1SUXA 5LIWX 2ADAA 1QVBA 2W4XA 1HIZA 3DIPA 5DY2A 3AJXA 4WSHA 1KFKA 3HQPA 4GJJA 3L7RA 3KBNA 2FB3A 3W87A 2P8BA 2YXXA 2F38A 4C1KA 3HG3A 2NSOA 1OIFA 3UR8A 3A3XA 1H0IA 4Z1AA 3AFBA 1B4EA 1OFPA 3LBCA 1KM3A 3B0PA 1XIBA 4GINA 3GU2A 3QQWA 4J3UA 1QK0A 4CNPA 4IQLA 2EHHA 3MCMA 3AZRA 4LNCA 1XR2A 2KZHA 3VNDA 4O18A 1NF7A 3GDLA 4Y9AA 2NUXA 4HN8A 3LENA 2WZHA 4YNGA 1UD3A 3RCYA 2RJGA 3E1F1 2J8FA 3JW7A 4XWUA 4XD3A 1RPKA 1U5JA 1VCFA 3VDHA 4ERGA 2Q01A 5CQ1A 3ITYA 4LQ1A 3E0VA 3OVQA 4B2DD 5JUVA 4XISA 1XLGA 1XH2A 4DWSA 1TJ2A 3EXSA 4JYEA 2YW3A 3VOGA 1EXBA 3H53A 2Y7EA 2UV8G 1X6NA 3SGUA 3LCLA 3QZAA 3DYOA 3W70A 1SSDA 4HPHA 2ABAA 3N15A 1BKSA 2HPMA 4DJDD 3RPTA 1TSIA 2Y89A 3DI0A 2WSRA 2OWXA 3IGHX 3SEPA 3F2CA 2FJKA 1XLJA 4GXMA 5CAHA 4QQUA 1FBAA 1TV8A 5DCBA 2NQLA 4DJEC 1RJRA 4JPGA 1G94A 4YTTA 3OTRA 3H4GA 1Y5XA 1W1ZA 5HWJA 4OIFA 3KL3A 3S5SA 1XIHA 2WSKA 4MDOA 2YBVA 4XAYA 4M8UA 1KRAC 3ZIZA 4MWAC 1QFEA 3RM8A 2PP0A 2ON3A 5FD0A 3CZKA 2YDAA 3FX4A 1SO6A 2C19A 2DVXA 4ADUA 1F6YA 1YTDA 1I2NA 2DSVA 3A5VA 1TREA 3H7UA 1LYXA 5D2TA 3WUBA 3STGA 5LGZA 4QJ4B 1VLWA 3M6DA 4WGHA 1H60A 1UR0A 3ME3A 1BGAA 4XD4A 1GVOA 3GDMA 3TLLA 1KFLA 3DAQA 3TNBA 2DW6A 4UTLA 4E2OA 1DHKA 1W2PA 3H70A 3VKDA 3DHUA 4LF2A 4Z17A 2X1IA 4Y96A 5BXTA 3L5AA 2R24A 1FWRA 1LRNA 4IIEA 3WO8A 1CNVA 2W67A 3AICA 1H7OA 1SR9A 3BAIA 1C9WA 2CKSA 3MHUA 1H1NA 3BCFA 1OT2A 5FJIA 3H2CA 1EP3A 3P7YA 3CV1A 1QJWA 4W7VA 1W9UA 3C61A 3GB6A 2G41A 3EKGA 3MI2A 3CHDA 4DPQA 4UQDA 2B7NA 4TV6A 1KM2A 2A85A 2J74A 3UWVA 4MPKA 4LUTB 3PZNA 2WM1A 4UTTA 2YPIA 1LOQA 5C9UA 4QEEA 4IQJA 2V5LA 3WLNA 3DFTA 2J7FA 1ITQA 4UR7A 4MJ4A 2IKGA 3H23A 1OADA 2C1IA 1TX2A 2AMXA 3B97A 5LHFA 1EOMA 2ZX8A 3F4CA 2MNRA 2J75A 1NJJA 4TX8A 5BRQA 1RJQA 1UA7A 3U57A 2YR1A 1SSGA 3MKKA 4U5KA 3EB2A 3E2QA 1E3XA 3DXIA 3CV7A 5A6JA 4H9XA 5DXYA 3NQDA 4C6KA 1JNDA 1VRDA 1VJZA 2VHLA 4J3VA 3E0FA 4YXGA 4MFEA 4LJ3A 3RX3A 4UNIA 3F4NA 1YDVA 2X8RA 1JFHA 3VIOA 4A05A 2AAAA 2RGMA 2QHAA 2G95A 3UZWA 2OLAA 1AW2A 1W54A 4A3YA 1YKWA 2A6LA 2D0HA 1R3RA 3I7RA 3IPWA 3VGGA 2ISVA 4PUDA 4IF2A 4M82A 2Q3OA 5JH2A 1EC7A 4HZ7A 5G1YA 1AD1A 4FK9A 3GU9A 7XIMA 3WLIA 2A2IA 4NYYA 3VOJA 2WQPA 2ZZ6A 3N9RA 3FDKA 4GD0A 1GJPA 1XCFA 2O9TA 1EBGA 3L21A 3SY8A 3E74A 1L6YA 4C1NB 5JIPA 1XPYA 3BLLA 2DFAA 3BLEA 1U1HA 1FWIC 1PB0A 3IUHA 5ABGA 1O94A 4HZ6A 3N17A 4F66A 4JN7A 4NU7A 3N2BA 3ALGA 5AHMA 3SUTA 3N4AA 1RD5A 4JTRA 2VDGA 2GPTA 5HJXA 1KQZA 4EE9A 5I06A 3E12A 2NLIA 4Q4PA 3PUGA 4AAJA 3HPZA 1P5BA 4U2ZA 3JZEA 4RXFA 2F2KA 3GYCA 3TZNA 4DUVA 3M0VA 3VKJA 2CFFA 2PGWA 3P0WA 2PF8A 5J04A 2JALA 2OWWA 3RIKA 1KM6A 4NRRA 4V2XA 1S2WA 4W7WA 4ADSA 4D71A 3H2FA 3REQA 2X30A 2E8ZA 3QOMA 1A5BA 2TODA 1QATA 3K4DA 2CZ5A 1MW3A 3C6CA 2ZA1A 3PR2A 2IPGA 3XIMA 5T9BG 4ZTXA 3W7CA 2C16A 3N3MA 3NR0A 4RE3A 4DJEA 3EEGA 2ZTJA 2UWFA 1AJ0A 3SBFA 3FLUA 2PDGA 1K6AA 1GKPA 5GQBA 3NQ2A 3NPVA 1B54A 3AIWA 4ZB5A 1KCLA 1DIKA 4MAZA 3PZQA 4MWAA 1ZHAA 4G6CA 5DEZA 3G1YA 5BXRA 4MLJA 3N1AA 1EKOA 1CB7B 4MB4A 4J3ZA 3LN3A 4JTJA 1GKQA 3WK1A 4A3UA 4PL1A 1JGMA 4ATWA 4KPLA 1KR0A 4KERA