3SY5A

Crystal structure of the mutant s127a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with the inhibitor 6azaump
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMAHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mutant S127A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor 6azaUMP
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 83
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sy5A00
3PSWA 3LDVA 1T0OA 2GQ8A 1OABA 3LGEA 3ZWTA 1HL2A 2A85A 1WAUA 3TW7A 1VYRA 4EF9A 2O7QA 3VI2A 1QFEA 3DFNA 5EBUA 2FIQA 3UWWA 5GVJA 2FFCA 4IPJA 1FY6A 2JKEA 1S5VA 2JKPA 4IMCA 3LCGA 4S2CA 1EUNA 4IJBA 2RDUA 4UTTC 1IXNA 4NVTA 1E51A 1B9BA 4XBSA 3KVJA 4FNPA 3TK7A 3STEA 1I8JA 2V82A 4POCA 1B57A 4XQ6A 2HMCA 3TJXA 4CNPA 3G1VA 1W3TA 2QJHA 1VYPX 3WJXA 4I7VA 3BG5A 2ABAA 2G96A 3P61A 3A22A 1QPQA 3HIJA 3QSTA 4UC5A 2A4AA 4OQVA 5AHLA 2VFEA 1G4TA 4HNVA 4IX0A 1TQXA 5EMUA 3O63A 1MZHA 3P60A 4Y6GA 2ZZ6A 3NQ6A 2NX3A 5TQLA 1TPEA 4ML9A 1QOPA 2QJGA 1XXXA 2VKZG 3B0VC 5I3KA 3W3OA 2YX0A 3VKJA 1KM4A 5AC6A 1LDCA 1H63A 2GQAA 5HWMA 3CWNA 3DI1A 1J5TA 1BEUA 4GUHA 2A7RA 4FB7A 4NNBA 1H7WA 3EXSA 3QC3A 1Q3NA 1LBLA 4IWWA 2WNZA 4JNMA 5E0KA 5D05A 1EUAA 1JQVA 1K02A 5CKSA 3NZRA 5AYYA 5F1VA 2GVGA 4QM1A 3W7HA 3R89A 5DY3A 3MHGA 1OFEA 4O57A 1P5BA 3GXPA 4Y8FA 4JTUA 4WY0B 1R2SA 3W7LA 5G1TA 4IXHA 1AL8A 4ADTA 3IEBA 3IIXA 4YMZA 4AHPA 1KFJA 4L4LA 1M7PA 3ABQA 2A5HA 4NNCA 3IGXA 1F73A 3PBUA 5I3HA 4AB4A 3EWXA 1CX9A 2JK2A 1OF8A 1WV2A 4FEZA 4IMEA 5LSMA 3BGJA 1L6YA 1A5AA 1O5KA 4DF0A 4UTWC 3NQ8A 1C29A 3NPUA 3S1XA 4FX7A 1XDMA 5AHMA 2A7NA 4QQ3A 5D04C 4S2BA 1ZNNA 3HOJA 1HTIA 3UPBA 3V75A 3W75A 2HTMA 4XBKA 4JYEA 4AF0B 1LOSA 2P10A 3MO7A 5I3FA 4O11A 1IXQA 3NEVA 3M5XA 3HF3A 3QQ0A 1AMKA 4QISA 4LUIA 5C55A 2G95A 3IVUA 5AHNA 2B7QA 3VCRA 1FUYA 2V2CA 3LCFA 4E2BA 3SI9A 2Y85A 3LHYA 4JTTA 1WOAA 2NXGA 4JIPA 4O8RA 2C19A 3HPZA 1WDWA 2A1YA 4GE8A 1ZENA 1BKSA 1GTHA 3P84A 4NZFA 1PCKA 3BGGA 4UFIA 2VFHA 3NL3A 4XKYB 3WK2A 4PTNA 3S9YA 2ZZ5A 3BG9A 4A2SA 2ZRYA 4MVAA 1D9EA 1K8XA 1K3UA 2ZQ0A 3MYOA 1N8FA 1H50A 2V5LA 1PS9A 3ATZA 4LV4A 4WX2A 4JTSA 4LS0A 3NNTA 1KFCA 3NR0A 3DI0A 1PV8A 3G8RA 1EP2A 1JCMP 2C18A 3GDMA 3LTPA 3FIGA 2FDSA 3GDKA 2VXNA 4M7SA 4N4QA 4LS1A 4JS3A 1T99A 2RDWA 4JY8A 3FJLA 5SWUA 4NUWA 1EP3A 3O6CA 1PCWA 4MLRA 3T55A 4JXCA 2Y7FA 3PBYA 3GKAA 4HKPA 1YDNA 1OK4A 5AOUA 4NT0A 2DZWA 3TIMA 5T26A 1VGAA 4JYDA 4RXGA 4AHQA 2H90A 3BARA 3G3DA 2E5BA 3GB6A 4GWEA 4DO5A 4WY0A 1L2UA 3PB2A 4HIBA 5G2WA 4BI7A 4A2RA 3USBA 3ABSA 4GRSA 5E1QA 2AQWA 3O6YX 2DZUA 2ZFAA 1TMHA 2DZSA 4UFHA 3G0XA 2QR6A 5LNVA 1KFEA 3G1AA 5IBXA 2X1SA 1Z44A 1YYAA 3W1MA 3NDOA 3CPRA 3W22A 3PSVA 4HNNA 1V5XA 4O28A 4CCCA 5AYZA 3HQ1A 1KTNA 1LTDA 1PHQA 1WBJA 3KXQA 2X1UA 2CZ5A 3I7SA 1R46A 3IIZA 3CC1A 3G3MA 4NQ1A 2EAWA 4O14A 1TSIA 3W1TA 5CPMA 5FF2A 2ZRWA 1MEIA 4BR1A 3H54A 4UFLA 3M5ZA 3QZEA 1CW2A 2QCCA 3JR2A 1KBJA 5EPDA 3ABRA 1WOBA 4UXDA 4BWLA 1YXCA 3N3MA 1OHLA 3HGRA 1WQ5A 2CZDA 1QO2A 5AC7A 3M16A 2X1RA 3RNDA 3BLEA 3PG8A 3G1YA 1KM0A 3L5AA 3O05A 3TR2A 3WJZA 4K6AA 4Q33A 3DFSA 2A6LA 3C8FA 4KWWA 1TV8A 4DPPA 1SSGA 3Q37A 4LVAA 1XFBA 3MI6A 5DXYA 3HGSA 3PM6A 1I2NA 1P0KA 3W07A 3OVQA 1GJPA 3SGUA 4TX9A 5D30A 1F74A 1ME8A 1OFPA 4ZMGA 3S5ZA 5AC8A 5LNRA 1GOXA 2J9ZA 2X2GA 3W2JA 1K7FA 2C0AA 5LZLA 5C6MA 5LNSA 5HUOA 4ZVJA 3E9AA 4O4WA 3JRKA 1YTDA 1SW3A 3T7VA 1OFQA 2C14A 3BO9A 2YW4A 2CZEA 5AHIA 3LXCA 4CQ8A 2RDTA 2CW6A 3DHDA 4N4PA 3LBMA 4O17A 1KFBA 1YXYA 3SGZA 4NX0A 1H1YA 1FCUA 3TV8A 1T8XA 3W1LA 1FWTA 1LORA 3TSDA 3AO0A 1UB3A 5G5IA 3LHVA 1H5YA 2F7FA 2BTMA 1N7KA 5AB3A 2B7PA 4ORMA 4UNLA 1DBTA 4RX0A 3TH6A 4Z1AA 4LT9A 4AF0A 4AWTA 1DJNA 2YR1A 5FF4A 3QW3A 4NNAA 1XBVA 5K9DA 2DU2A 4NXKA 5F4SA 1DQXA 3HPXA 3CU2A 1TPUA 3FA5A 3LCXA 4Y9AA 4UTWA 3TSBA 1NVMA 2YXGA 4ZQPA 1PVNA 1SZFA 4NU7A 1AW2A 1OYAA 2Z1BA 4Z0SA 3C6CA 2WJZA 1ICQA 3M47A 2ZRVA 1AW5A 2FB3A 2I14A 3S5NA 2ISVA 1GTEA 3W6YA 3A9IA 4O15A 3UWZA 4JR5A 2WSYA 3I68A 1A5BA 3LM7A 5F4WA 1R47A 1JJKA 1TV5A 3IIVA 4MFDA 2F84A 1WYIA 3QH2A 1TRDA 2C3ZA 4O10A 4I7WA 1TO3A 3NVTA 3P5ZA 4ONVA 6TIMA 4C1KA 4LV9A 3R12A 2ZTJA 3EX2A 1DKWA 4HSNA 4JYFA 1IXPA 2CZFA 2NUYA 4O54A 3TQKA 1AG1O 4N2YA 2V2DA 1PL9A 3C0JA 1I4NA 2A6NA 5KMYA 1H51A 5CZ0A 2QAPA 3QQ1A 4LW7A 4WZHA 3HGOA 3KRZA 3W88A 3G8EA 2C6QA 2EF9A 5D2WA 5HJLA 2QCHA 3WK0A 4N9EA 5FF3A 4E38A 3PULA 2QCLA 4Y96A 3F4WA 1FWSA 4OT7A 1F5ZA 3TXVA 4RXFA 4A21A 1VCFA 1ONRA 3L5LA 1QNVA 2VFDA 1JVNA 1X6UA 4XUGA 3MP4A 3WJSA 5G4WA 1J2WA 2G97A 2ATSA 3ZR4A 4AHOA 1G4PA 2C1HA 4ICNA 3TXZA 4AEOA 5D02A 3KRSA 4FXRA 2GVLA 5E93A 4WUIA 1C9DA 3FYOA 2ABBA 1K7EA 3DKLA 3C2FA 4LVDA 2I9EA 3EXTA 2AGKA 1Q45A 3SZ8A 3H55A 2ZYFA 2H3BA 2NX9A 3GK0A 1JQXA 2O7SA 4PEKA 5CPLA 4MY9A 3TC7A 1ALDA 2JGQA 1YADA 5DCBA 2W6RA 1FDJA 1X1OA 1JCXA 4MUZA 3QW4B 4AMAA 4Z1BA 4LOCA 1VRDA 4CQ9A 1P0NA 3WFAA 1OFAA 2J9XA 3N73A 4EIVA 1PIIA 1G6CA 4FXSA 2Y62A 4JTLA 1LBMA 3LV6A 2YGYA 2Y63A 2Q3OA 4ZQRA 5KZDA 3FKRA 3DFTA 2Q8ZA 2H6RA 4I9AA 2VFFA 1LP6A 3N2XA 2I1OA 4R7JA 3PS7A 3B05A 1ZJIA 1UJPA 3CIWA 1KFKA 5DXXA 4CQAA 3GNNA 2ISSA 3HG2A 2D73A 3DGRA 1RQEA 2R91A 4X3ZA 1VH7A 4DO4A 3W83A 4UTUA 4FNRA 3RFAA 5K2ZA 3C2EA 4UUIA 2Y7EA 2ZA2A 1QO5A 3GXNA 2NWSA 3LCHA 3DKJA 1W5OA 1UASA 3B04A 3Q94A 1NFBA 3OVPA 2RKXA 3NA8A 5F2MA 1HO1A 3P8IA 3U8GA 5K4ZA 1I2PA 1M7OA 3EWYA 5A5WA 5DCDA 4GUJA 5EL1A 1LLWA 4JD4A 3PR2A 3EX3A 4CNOA 3G0UA 3BK0A 2ZTKA 5BRBA 4TMCA 2FLIA 2H8XA 4TMBA 3SECA 3LXAA 1LOQA 2QDGA 3W1XA 3B4UA 2NXIA 1W8SA 3L68A 4JX4A 3NQCA 1O5XA 3G1SA 5HULA 3W7RA 3P80A 3F4NA 4AAJA 3M44A 1XDLA 3O6DA 1QMLA 2QUVA 3C3NA 5KSWA 3KVKA 1FXPA 1VQTA 2AAMA 2QKFA 1H1ZA 3PUOA 1JCLA 4O16A 3E02A 4LVFA 3PB0A 4ZL1A 4PFMA 2XFWA 5EY5A 5HR6A 1GYLA 3MI2A 3MHFA 2V9DA 3W74A 5BMXA 3VE7A 3W7DA 4KKXA 3E0IA 1X1ZA 1RQBA 2KZHA 3G1HA 3LTYA 4PL2A 5IM51 2C16A 4AH7A 3EX4A 4WJEA 2IQTA 3GIYA 1VJIA 3FKKA 1H7OA 3R5EA 4NJGA 1TCDA 1A53A 4JTKA 4NZJA 2CLMA 1JCYA 3W1AA 3G1XA 4QIUA 1FCQA 1D3HA 2FPTA 5D32A 3HMJG 5CSSA 5D09A 1QPNA 2FTPA 2VELA 4J9JA 1LRNA 4MKNA 3TROA 3I6RA 4P61A 3L0NA 2PRLA 2FPVA 1C8VA 3NYZA 1SQ7A 3SW6A 5D37A 1GQNA 3F1QA 3HG3A 4WOQA 1H7XA 3CLMA 3W7EA 4OBTA 1O95A 4K8EA 3DZ1A 2TSYA 3NL6A 3HB9A 4DBEA 1SW0A 1XBYA 3TQVA 3LRLA 2CLLA 3LXBA 4XTDA 3L21A 1G7UA 1RVGA 4UTJA 1DOSA 1JRBA 3TFXA 2VEKA 3OG3A 4N9DA 3STGA 3P74A 3P81A 3LHUA 4RK8A 3B0PA 3P82A 4IMFA 4NXSA 2ZBTA 3MW7A 2E6FA 2P1FA 1X7FA 2C13A 3KX6A 4YL2A 3T40A 1R2RA 3EEGA 4PC8A 3O07A 2ALDA 3TAOA 5CZJA 3GR7A 2R14A 5I3IA 3L0KA 4DF1A 1MEHA 1OK6A 1SR9A 4FF7A 3SSJA 3W85A 2WPBA 1W37A 3UWQA 2PRHA 2YYUA 2EKCA 2E68A 3TKFA 3NQEA 4WQ6A 4WOZA 2DJXA 1VC4A 3HG4A 3M5VA 2CWNA 1GZGA 1W0MA 3NL5A 1QDSA 2CLHA 3TNOA 3EWWA 1SU5A 2A21A 4ZQCA 4RV8A 4W9TA 4I7UA 1IXOA 5HUPA 1SO4A 2V81A 3GDTA 1S3HA 3BPWA 3HPSA 4MOZA 4AVFA 3PF3A 1DL3A 1GWJA 1MO0A 1LLZA 4H3DA 3S1VA 3MWAA 1UUMA 2FQIA 3S5YA 2EHHA 2XN2A 2WSQA 2GVJA 4MIMA 2Y88A 4LC6A 1I2OA 3LI0A 5CPNA 2UV8G 4O1AA 4XZ9A 5K7JA 4RR4A 5D2YA 3ATYA 3W7CA 1W5MA 5HWJA 3UY8A 5CG7A 4K39A 3TQ0A 4FX6M 1TIMA 2OT1A 4UTKA 3NQ2A 3R2GA 3JS3A 2Z6IA 3UWUA 1KM3A 1M6JA 3NM1A 1YPFA 1VS1A 4M6PA 1OYBA 1RZMA 2BLEA 3EX1A 1UUOA 3MP3A 4N6FA 3NOEA 1OFOA 1WA3A 3NQMA 3CQ0A 1RQHA 3RK8A 1LYXA 3W7NA 5KITA 1GVRA 3HG5A 1VLIA 3GDRA 1AL7A 4UR8A 3FEMA 3W1RA 2NV1A 3EWZA 4UMBA 3S8HA 3M5YA 1K8YA 2VOMA 3VFLA 3W71A 4H6KA 4X22A 3LLFA 2B7NA 4JICA 1ADOA 2TYSA 3IV3A 4M6QA 3C61A 4XWUA 2H3DA 5LGXA 5LHEA 3TAKA 3NL2A 1SUXA 3WK3A 5CSRA 4FO4A 5BMWA 5TIMA 4JTJA 5F1UA 3NG3A 1KA9F 3M43A 1QPOA 3Q58A 4N9BA 3DBPA 3BV4A 3LHWA 3N9RA 3PWAA 3CTLA 1XCFA 3PAJA 3GR8A 4O53A 3BVJA 1VYSX 4GUFA 4Q4KA 4FNQA 4Z1DA 4OHQA 1VHCA 1NF0A 5LNUA 2ZA1A 4O1BA 3DAQA 3UXDA 2OT0A 4OV9A 7TIMA 4DO6A 3GNDA 1KLYA 1DHPA 1XKYA 2GOUA 4O4VA 1A50A 2BXVA 1JRCA 1FXQA 3P62A 4MFEA 3S1WA 3NQAA 3UY7A 2TRSA 1TB3A 4R33A 3W9ZA 2Q3RA 4CLMA 1YDOA 5FF0A 5HR7A 3KOFA 1CI1A 4ALDA 3RLUA 4DQWA 5IBXC 3P67A 4LVGA 4OE7A 1IIGA 1TJRA 3GAKA 3TU9A 2E6AA 4PA8A 2BX7A 3CHVA 3E96A 1LRTA 3M9YA 1YTKA 3WK1A 1W56A 4DF2A 1TQJA 4FIQA 5HQEA 4EF8A 4FNUA 1RR2A 2VEPA 2PC4A 3ABOA 2GUUA 2QCMA 1SO5A 3L2IA 2YYTA 4MPQA 3IVTA 3O15A 3C56A 5DN1A 4LU0A 3O16A 4PL1A 4KFOA 2E6DA 1KBIA 3VE9A 3UWVA 2V0TA 3IVSA 2JGYA 1ML1A 2PCQA 4Z1CA 1NEYA 4JTIA 1EA0A 2RFGA 4QSHA 5ABTA 1TTPA 3GLCA 3NQGA 2CLFA 4GJ1A 3RU6A 2BWGA 2VEIA 3DFPA 2CLOA 3NAVA 4CCEA 3OBKA 1JR1A 1FWNA 3LHTA 5FESA 5HMSA 2H8ZA 2J9YA 3U2OA 4D2JA 1LZOA 2E09A 4BK9A 4JIQA 3GVGA 3QMSA 4UTMA 2P0OA 1QCWA 1JUBA 1KM5A 1VCVA 5DBTA 1XL9A 1GG0A 1OYCA 1TRIA 4N02A 2Q8LA 3NPVA 1XBXA 4N6EA 2NUWA 5C54A 3S5OA 4ADSA 3ZS4A 1G4EA 1H61A 1R2TA 3DFQA 2VFGA 1LRQA 3UQNA 3LRKA 4JTFA 1F6PA 4L4MA 1BTMA 3STFA 1H60A 2NUXA 3FS2A 4IOTA 3TCEA 2WOQA 1S5TA 4QITA 1GYNA 3N34A 3SR7A 4UTHA 4YXGA 1VR6A 3PC0A 4JX6A 1VHNA 4WXYA 4YCPA 4BF9A 3DU0A 3THAA 3EKLA 3B03A 1VPXA 1KFLA 2JKAA 5CZSA 5CPOA 2A0NA 3LBCA 1K7XA 2Y70A 1RPXA 1O94A 1ZAIA 1QWGA 3O1NA 2Y7GA 1XC4A 3N2MA 5J5DA 1I2RA 3T4CA 1G69A 4QNEA 1KW1A 5L6UA 3ELFA 2Y61A 3GZ3A 4UTLA 4K37A 2J24A 4A22A 1EEPA 1LCOA 3M0ZA 3W2UA 2V5BA 1KLZA 2FPYA 5L9FA 6ALDA 4CCDA 1W5QA 1A5CA 2VEMA 2OZ0A 4MY8A 5K9CA 3W1QA 4JTGA 4WXZA 2TPSA 5G2IA 2WO5A 1OFBA 2J27A 3LTSA 2B0MA 3S1UA 3N19B 4BI5A 1U5JA 2HS8A 4O0KA 3CB8A 3W23A 2YW3A 4K7VA 1F6KA 1QAPA 3G18A 1MSSA 1Z41A 4TIMA 2QEZA 2TMDA 4NJIA 3R13A 3NQFA 4K7YA 4OV4A 3MJYA 4RCXA 4BWLC 3W73A 3W7GA 1EX5A 3G24A 3YPIA 1Q6QA 3TJLA 3QMTA 1F7BA 4ZQOA 1GT8A 4JDBA 2XN1A 4UTIA 1KTBA 4PH6A 1EB3A 4MYXA 4Z08A 3W87A 1EWEA 2A2IA 4MJMA 3W7MA 4O0ZA 1LROA 3UXAA 3QRHA 4HNUA 2DORA 3QEZA 3BW4A 2ZZ7A 4IQLA 3W1PA 4O1DA 4RZ6A 3P5YA 4LUJA 3UD6A 3QF0A 2RH9A 2ISWA 5H91A 1HG3A 1TPC1 4PODA 3BLIA 3OEXA 4JDYA 4FNTA 4WD0A 5HNRA 4OGZA 3MHUA 1NSJA 5EYWA 3PBWA 1OX6A 1THFD 2BZNA 1SPQA 2E5CA 4YLWA 3A23A 3W7QA 5DCEA 3SJ3A 3LCLA 1R30A 5DLCA 2PRMA 1FDZA 3C4UA 1GEQA 3NM3A 3TMQA 3W2NA 2V2HA 1B3OA 1QOQA 4QJ1A 5D03A 3NZ1A 3BW3A 3M41A 2OCZA 3U6WA 1DVJA 2YCEA 1Q6OA 4HPJA 1OF6A 4UFKA 5AFDA 3GXTA 1ICSA 3OHIA 3CM4A 1A5SA 1N55A 3L5MA 4HNTA 3B0UX 4JN6A 1JUEA 5FEPA 3Q2DA 3RF9A 4TU1A 2E6YA 1O4UA 4UIOA 3AJXA 2DZTA 4AWUA 1FBAA 1V7YA 3S0CA 3PBVA 1B4KA 1PHWA 3EB2A 4LVBA 4RZ4A 5F2LA 3SY5A 8TIMA 4IGHA 4LNYA 4MY1A 1TPH1 4O19A 1SFLA 2FB2A 3LERA 3KVLA 2OJPA 3B06A 2ZZ4A 3QSRA 3TSMA 3EXRA 2Y7DA 2NZLA 3GAYA 3LX9A 3EWBX 1ME9A 1YDVA 1YXDA 3EWUA 3NQVA 5HWNA 3A21A 1ZY9A 3PUDA 3A5VA 4KFPA 3W7OA 4LRTA 5D2TA 1JCJA 1KM6A 2NV2A 2C15A 3W72A 1H7RA 3DXIA 2WQPA 2GQ9A 2Z0IA 2HSAA 5EKYA 3FYPA 3NPXA 2QF7A 1H62A 1QR7A 3W7KA 1BWKA 4O18A 2X16A 3UNDA 3MI3A 3G1FA 1VLWA 5MHBA 3W70A 5FEWA 4Q32A 4KWVA 3S42A 1GVOA 2ZZ2A 1FCBA 4DELA 3GDLA 3C52A 2A7PA 2E77A 1F2JA 5D33A 3I7QA 5KZMA 4IXXA 1M5WA 3QPYA 3ZWSA 3TC6A 4UFMA 3CEPA 2QJIA 3SIZA 3I65A 3UYCA 2Z2UA 3KVMA 3QPZA 2VENA 1UCWA 1IIHA 4MZYA 3HJZA 3THQA 2PURA 1AW1A 1RV8A 1OX4A 2GPTA 4QNWA 2BSLA 1ZCOA 3TE9A 1GPWA 1OVDA 4ZZ9A 1TYGA 3MP5A 1H7PA 1MEWA 4MLJA 1SZEA 1GVSA 4O13A 5LGZA 2EGZA 4IX2A 5FI8A 1LM1A 1TTIA 2YPIA 1OX5A 1RD5A 3C2RA 2V8ZA 3W86A 1DQWA 1S5WA 4JTHA 2HS6A 1ZFJA 3W76A 1GVQA 3T78A 4U4MA 3IIOA 4EOUA 2DP3A 3W2MA 1JCNA 3STCA 1W1ZA 4TR9A 2VFIA 3NQDA 5CGQA 3N9SA 4IMDA 1LBFA 4G1KA 3NQ7A 4HSOA 4Y90A 1XBZA 3TA6A 3A24A 1YPIA 4AWSA 3LHZA 4HHPA 5K4XA 1P1XA 3NO5A 5G1YA 3TDFA 4AXKA 1KM2A 1OG0A 1FDYA 1I45A 1TV7A 5TBOA 3EX6A 5K9XA 3L66A 1XUUA 1O60A 1KM1A 3PY2A 4S1FA 2QCNA 3IIPA 2DZVA 4DPQA 2ZDRA 1HO4A 4M19A 3W1UA 3L9CA 5AYXA 4X2RA 5G2HA 4Z0JA 2ATMA 2QCFA 3TW6A 1ZALA 4MZ1A 2QUTA 3H53A 4DEFA 3LRMA 2R8WA 4MYAA 4LY8A 3LI1A 2YZRA 4MJZA 2FJKA 5U4NA 4UMAA 1W5PA 5U7SA 3LCIA 5KZEA 1FWRA 2W0UA 1ZHAA 1WX0A 1TPVA 1FCVA 1W31A 2B4GA 2NWRA 3PVFA 4LS2A 1TPFA 3A5FA 3W84A 4NJJA 3L0GA 3HGJA 5A8GA 4FHAA 1MXSA 3M6YA 4MZ8A 3O06A 5DY2A 5DELA 1TPB1 4TO8A 1ICPA 2YSWA 1BWLA 5DBUA 5G4EA 4BI6A 2W79A 4JEQA 4GBUA 1WXJA 2QCEA 1L6SA 5C5YA 1QPRA 3LCWA 3QFEA 3NXFA 4GXMA 3FJ6A 4GFSA 3LLDA 1DORA 5AHEA 4NJKA 4HT3A 3T44A 1EIXA 4K8HA 2ZZ1A 3VNDA 2X30A 2XN0A 1YTEA 2JBMA 4HN4A 4M7TA 1NF7A 3MMTA 5FF7A 1VCGA 4IUOA 5CZTA 5I3GA 2J88A 2CFFA 1VZWA 5BNKA 3IGSA 1SSDA 4HPXA 4N9CA 1T96A 4YWIA 4X9SA 3QJAA 3CT7A 3OA3A 1XM3A 3MBDA 4PCFA 3UPWA 1K03A 1Z48A 4BFAA 2YFOA 4LTSA 4R34A 1OJXA 2ZRUA 4M6VA 2CLEA 2R94A 5H2ZA 1ZAHA 3E12A 5LHFA 3G22A 2E5DA 4IMGA 4M5PA 3DHFA 3E49A 5KTLA 1TPDA 1X8FA 3P8JA 1F76A 1TTQA 2RHGA 4ORIA 3DFOA 4LRSA 1Q6RA 1UBSA 2E1DA 1OFRA 2Z6JA 3KRUA 3MBFA 3GYEA 2CU0A 3QMRA 1PE1A 3DH7A 1ZAJA 3PG9A 3LB0A 1OFDA 4GUIA 1SZNA 5LKYA 3BLFA 3M1ZA 3EKZA 3V1PA 4E0CA 2QCDB 5F2IA 3MYPA 1SFJA 4JGDA 1F05A 5AN7A 1Q6LA 4ZQMA 5LNWA 3NPWA 4XTIA 3SFKA 3IGUA 3W2LA 3UZ5A 4EVZA 1G67A 2ZZ3A 1YLVA 3B8DA 2NXHA 5HINA 3KFTA 2WNNA 3DENA 4B5NA 4ADUA 1EP1A 3UZJA 2X1TA 4K36A 2Y89A 4LC8A 3FOKA 3W2KA 1HFBA 1HUVA 3OVRA 4WY0F 1SO6A 3TUUA 1OX4B 2J6XA 5FEXA 2VC6A 4NJHA 2WSRA 3ZFHA 1L9WA 3C2OA 3GKFA 4ZQNA 4U28A 3HBLA 1KTCA 5D2VA 2CLKA 3GX9A 2DZXA 3R8RA 1SW7A 1TJPA 4P2VA 4O12A 5F2GA 4IPIA 1I2QA 3LOTA 4DBDA 3OIXA 3TX9A 2OMAA 4RKAA 1TPWA 4UFJA 1IF2A 1JULA 4UNKA 4UCGA 2PE4A 4OU1A 1U83A 2EPHA 3BG3A 3C2VA 3P7YA 2CLIA 2WNQA 1XUZA 1KV5A 4JX5A 5BW6A 2LLEA 5FEZA 3L67A 1WBHA 1GVFA 5J5RA 4GC4A 1W5NA 3TMLA 4QAIA 2QUUA 2YDAA 1B4EA 3W7IA 3W7PA 5D38A 5D2XA 3CEUA 4GNJA 4H4IA 4K38A 4A29A 5KINA 4UR7A 1DV7A 3KAOA 2QAFA 3S6DA 1SO3A 1LOLA 1Z42A 1GG1A 2ZCGA 3LV5A 2B7OA 4FIRA 3G0SA 3W7JA 1EPXA 2ZA3A 1P4CA 1DJQA 1W54A 1SZGA 3L65A 4UTTA 1J4EA 3WJWA 3O8AA 4FNSA 5I3JA 2ZRXA 3CWOX 3KHJA 2Y6ZA 1EWDA 3IRDA 4DXVA 2G5WA 4EWND 4JTEA 3RLVA 1NAL1 5EA9A 4NX5A 1TREA 4OWGA 4YCOA 1IGSA 3PUEA 1FQ0A 4RZ5A 1G7VA 2NLIA 3N14A 3W1NA 4FX8A 3FFSA 4XKYA 4E2DA 4CNNA 3F03K 2QCDA 3D0CA 2WV8A 4C1LA 3HO8A 4JY9A 3ANYA 4O50A 2QDHA 3RMJA 5BOOA 3QM3A 4KFNA 2YFNA 4RJEA 4UMCA 1W3NA 1TTJA 1ME7A 3INPA 2DZPA 2WKJA 4O52A 3G1DA 3MUXA 1AK5A 2QCGA 3BW2A 3QYQA 1KV8A 5C2XA 2NX1A 1H7NA 3TFCA 2V30A 1W3IA 4GUGA 1FX6A 4A3UA 3WJYA 5AHFA 1FWWA 2OX1A 5K3VA 4R53A 2ZRZA 3FLUA 4O1CA 4LWWA 1JUKA 1L6WA 2DJLA 3K30A 1XI3A 3NGJA 2GJLA 5F4XA 1G4SA 3UWYA 3M7WA 1Y0EA 4RLIA 1D3GA 1K8ZA 3CIXA 2GJNA 3I7RA
chains in the Genus database with same CATH superfamily
3LDVA 4DJFC 2J6VA 1A0CA 2OKOA 3ZWTA 2FZNA 1WAUA 4F2TA 1KNWA 3WD4A 3RG6A 2DSWA 3T0BA 1FKWA 1DWGM 4CGTA 3THDA 4BKNA 3DFNA 3UWWA 3VIJA 2FFCA 2DIJA 3L4VA 1FY6A 1B54A 3ZSSA 1Q6DA 3ITGA 4DWSA 1S5VA 4L6HA 1TMQA 4IMCA 1V7AA 4MF4A 2D0GA 2DUZA 4IJBA 4UTTC 1IXNA 4JFVA 1E51A 4XBSA 1HGYA 1XYZA 3MUCA 3TK7A 3TJXA 4XQ6A 3WN6A 2NQ9A 2RJGA 1US0A 4IPLA 4OFCA 2DGAA 5A6TC 3KL0A 3WJXA 4S3BA 1GKRA 2WB5A 2G96A 1R9XA 4OQVA 4ZODA 2I16A 4HNVA 4M1RA 4IX0A 1E1CA 1LL7A 1MZHA 3NQ6A 1DTNA 1NM9A 3UW6A 4ML9A 1Z89A 2V3DA 1QOPA 3WH7A 1XPGA 1XYCA 2HPIA 2PTZA 4MNJA 4ZO8A 1IV8A 4GIAA 1CCWB 3DI1A 4GUHA 3DG6A 1YX1A 3E1F1 1H7WA 4LBSA 3QC3A 1Q3NA 4IFRA 2WNZA 4H1ZA 5E0KA 1VFFA 1EUAA 1JQVA 3PTMA 1KXVA 4DJED 4HOXA 5CKSA 1EJUC 1UWQA 2RJHA 5DY3A 3UA3A 1E4LA 1D7KA 1JI2A 4D6EA 4HA4A 5G1TA 3B8IA 1MXGA 3IEBA 4IFOA 4KQNA 4L64A 4ACYA 1F73A 4BF5A 3CUXA 1M65A 3GRIA 4AC1X 3VPLA 3CUFA 5LSMA 1XKJA 3S46A 3EWCA 4B5TA 1A5AA 3NQ8A 4LBUA 3NPUA 3LSCA 4DJDD 3SRDA 3BAWA 1XDMA 3BAIA 4QQ3A 3TNBA 1KB3A 1CLKA 1V6XA 5I03A 4J3ZA 3UPBA 3V75A 1GJUA 2DIKA 2WVVB 5I3FA 3ZO9A 1XSJA 4HGXA 3M5XA 3HF3A 4AZIA 2OGJA 3IVUA 3IS4A 3BCDA 2V2CA 3LCFA 4WK9A 2WANA 1X1NA 3LHYA 4GNKB 3UXKA 3HPZA 1TJ0A 4H9TA 1WDWA 3KBMA 1BSLA 3Q45A 4JCMA 3P84A 2DUXA 1PCKA 3C0LA 3NL3A 1LWJA 4EAYA 4PTNA 3NZQA 4LB3A 2DW7A 4C6IA 1D9EA 1VKFA 2ZC8A 4NAEA 4Z2GA 3C0QA 1DE5A 1RAKA 4JTSA 4LS0A 3NNTA 1VFOA 2CYGA 1RSCA 1PV8A 5CBIA 3APYA 1JCMP 3GDMA 3LTPA 3FIGA 1HX0A 2RDWA 4GIEA 3T55A 1XLMA 1PBGA 1SFSA 3GKAA 2FTWA 4HKPA 1YDNA 1RH9A 1LJYA 5IOBA 5FA5A 4JYDA 4AHQA 1U2YA 3G3DA 3DDMA 3QVQA 2Z4GA 2E5BA 3AZRA 2YZ5A 5A8MA 2IW0A 3S1GA 1L2UA 3PB2A 2G0WA 4HIBA 2CZVA 1EF2A 3WQ5A 1NH6A 3USBA 3O6YX 4KEZA 4NAFA 1XQLA 4AY7A 2D2OA 4UFHA 1TMLA 3G0XA 2QR6A 2PFHA 1J6PA 4S3DA 2XGIA 1KFEA 1XIDA 1Z44A 1YYAA 1JYNA 7XIMA 1LF1A 3B8TA 1BGGA 1O12A 3PSVA 5BWAA 3S9ZA 4O28A 5AYZA 4LUSB 3HQ1A 1LTDA 3LPPA 1LUCA 4HYRA 4D6IA 2EAWA 1C8XA 3WQOA 3CZJA 3VDAA 5FF2A 4GI4A 1U1UA 1CW2A 1HL8A 1VFTA 1MQQA 2BY2A 3SCPA 4RDVA 2X8RA 4UXDA 4BWLA 3N3MA 3ITOA 3VO0A 5AVNA 5AC7A 3M16A 3SB0A 3GDBA 3TEVA 3GUWA 4HU0A 3W02A 3BLEA 2EPKX 3G1YA 1KM0A 5HA7A 4K6AA 3DFSA 4CU7A 3C8FA 5HOSA 3H4WA 3MI6A 3VKKA 5I5RA 3PM6A 3KL5A 1I2NA 5FSDC 1K6WA 3OVQA 3V5CA 3ECQA 4TX9A 3S5ZA 5LNRA 3KTSA 3SIMA 4GYPC 3W2JA 4XB3A 1CDGA 2C0AA 5LZLA 1WDDA 4ILSA 3IJ7A 5C6MA 5LNSA 5HUOA 2YA1A 4O4WA 5FJJA 3PZMA 1W2VA 2QPXA 1N8IA 2HPMA 3BO9A 2CZEA 3HJEA 3LXCA 3AS2A 2CW6A 2JIEA 2A79A 1M3UA 2XM1A 2WVUA 3BAXA 4MSSA 3WQ4A 3ZMRA 2INEA 4CN1A 3W1LA 1FWTA 1UPPA 6A3HA 4Y9NA 3LHVA 4OBRA 1XLDA 5I23A 2B7PA 2IUZA 3IUIA 3VNZA 4ORMA 1G1YA 3KE0A 3AOFA 4Z1AA 2ISDA 4DM2A 4AF0A 4GNVA 2YR1A 3T42A 2AL1A 4GCXA 1MFVA 1XBVA 4NXKA 5EB8A 1E0TA 3VMPA 1FP9A 1DWJM 3N17A 5E70A 3T1GA 3MCOA 2UWFA 1G9HA 3QY6A 1SZFA 4NU7A 4RNFA 4HTYA 1OYAA 2Z1BA 4Z2KA 3WMLA 3C6CA 2REQB 2HNHA 4KEVA 3M47A 4YIWA 4AD4A 1F3XA 3EB3A 2FB3A 2I14A 3S5NA 3DYOA 1XRTA 5EFFA 2OYLA 5DMMA 1BSIA 1WDQA 1ZJHA 4O15A 1XFCA 3EBVA 3U5UA 2WSYA 4CNSA 3W6LA 1R47A 3MU7A 1JJKA 4TVUA 3IIVA 4MFDA 1WYIA 1BXNA 1QPKA 3CTTA 2QZRA 3CHDA 5CSUA 4ZOCA 3TZNA 6TIMA 4AISA 5EMLA 4JQ3A 1X8CA 3OLEA 4JYFA 2D69A 1S38A 4NP7A 3EOSA 2G37A 2NUYA 2XIJA 1YDYA 4ZCWA 1AG1O 2V2DA 1PL9A 3FNDA 1E70M 1JZ4A 1H51A 1EFZA 3CT2A 4I8DA 2DQWA 1NARA 1GKPA 1TWIA 3OOQA 2WHLA 4AY1A 1EGMA 5HXMA 4ZTXA 5D2WA 5HJLA 3H2AA 2D20A 1RHCA 4ZTYA 3WUEA 9XIAA 3BOFA 4Y96A 4K8GA 1H49A 4OT7A 3GHTA 3TXVA 2VDGA 3VC5A 3MCMA 5AVHA 5HMDA 4L1XA 1QNVA 2VFDA 1X6UA 2CERA 2ATSA 2W5FA 3ARZA 2VGFA 3TXZA 1ZBKA 1XRFA 1E9YB 4FXRA 3GE7A 1XRVA 5E93A 5EMKA 1WUFA 2ABBA 1K7EA 2C79A 3SGGA 1KFWA 1Q45A 3H55A 4IIHA 2ZYFA 4BA0A 3V0SA 4PEKA 5CPLA 3TC7A 4H6RA 2JGQA 3K1GA 4Z2LA 1FDJA 4E3TA 4MUZA 1NTHA 3RPMA 4Z1BA 4LOCA 1VRXA 3CMFA 5CAHA 4JTLA 2ESCA 2HISA 3BJSA 2Q3OA 4ZQRA 3G77A 4LCSA 2HJPA 5ABHA 1AD1A 2VFFA 3AIUA 4JIEA 3POCA 4C7GA 3S5SA 1OC7A 2XFFA 3HG2A 2OXNA 2D73A 1RQEA 2J7CA 3W83A 4UTUA 4FNRA 3EA1A 4UUIA 2Y7EA 3WF2A 3B0XA 2ACRA 4L1WA 3KS6A 4D1JA 3B04A 3Q94A 1NFBA 1YPXA 5F2MA 3UR8A 3P8IA 3M0MA 5BZAA 4UQDA 3EWYA 3AHYA 4GABA 3UZZA 4GUJA 2WLYA 4CNOA 4DRSA 2JFEX 2GGGA 4R88A 2ZTKA 2F9RA 3FK4A 4DXXA 3WEZA 3WD3A 2QDGA 2WM1A 4HK6A 4GIYA 4ERGA 2A3LA 1JZ6A 3WQGA 3P80A 2FH6A 1XICA 4XO7A 2QVNA 3O6DA 1QMLA 1KRMA 2QUVA 3C3NA 1ESWA 1XQKA 1QW8A 5CAKA 1W9XA 6XIMA 1FXPA 4WSKA 2AAMA 2UY2A 3E02A 3PB0A 2GQ3A 3IJ8A 1S3TC 1QBBA 5EY5A 3W74A 4XZMX 2QYGA 3W7DA 4F0RA 4ZSUA 1RQBA 2KZHA 2OELA 4CU6A 1O1HA 2FMNA 1FTXA 1SM9A 2GGEA 4Y2WA 1E9ZB 1H7OA 3M4HA 4NZJA 4H8HA 2G8ZA 4ATLA 3UYIA 3LN3A 4ACZB 1OT2A 4QIUA 1JPKA 2FPTA 3HMJG 2PTWA 1TZ7A 4W5UA 3F4CA 2VELA 3VD9A 1LRNA 4P61A 4ES4A 3L0NA 2PRLA 2FPVA 2WWDA 3FX4A 1S2AA 3ARSA 6REQA 3MV01 3HG3A 4I6VA 1E6NA 3CLMA 4OBTA 1TV2A 3U7VA 2Z1XA 3TQVA 1KBLA 4QGCA 1OQFA 1OCJA 1RVGA 4DLMA 9XIMA 3AWNA 1JRBA 3OG3A 4N9DA 3WX7A 3AHVA 1V08A 1X38A 3P81A 3H26A 3TW9A 1AJ2A 1X7FA 1H4PA 4W86A 3EEGA 2VVNA 3WYZA 5HMEA 3AUJA 2CKSA 3I4EA 3O07A 4CN4A 2WHJA 5FL1A 3WNLA 5A8PA 1L0PA 5CZJA 1IEIA 4OKDA 1ADSA 5BOEA 1UZHA 3GNOA 2BY0A 4XZHA 2CESA 4I9TA 4GY1A 1H09A 5LIWX 1F4HA 2PRHA 3FHQA 2O4QA 3EPOA 3WLIA 4GD0A 5CLTA 4HK7A 3HG4A 3NL5A 3TNOA 4X63A 3QLDA 4W8AA 3RDKA 4RV8A 4W9TA 1FWDC 2ZUWA 1BQGA 3FAWA 1IXOA 5HUPA 1U5VA 3L4TA 3HPSA 4BQ2A 1GWJA 1LLZA 1IT0A 2HK1A 3RMEA 1KRCC 3NWRA 1UKPA 1HW6A 3KUMA 2J7GA 2XN2A 2HXTA 4UNIA 1UH3A 4HVXA 2BODX 3LI0A 4IGNA 2CITA 2INZA 2W91A 3TQ0A 5LYRA 3NQ2A 4ACZA 2O9PA 1KM3A 1YPFA 2Z1VA 1RZMA 2BLEA 4N6FA 3WQPA 4J3VA 1VLIA 1AL7A 3T0CA 4G7EB 5A2BA 3W71A 3UGVA 3ONCA 2E40A 2Q6ZA 4G56A 4JICA 2OB3A 4MWAD 4QCEA 3GZAA 2OLHA 5LHEA 2ZXBA 1P6CA 5A6AA 3LMZA 1C7TA 1Q6GA 4C6EA 4FS9A 3AZTA 5TIMA 3UP8A 5C9RA 3KRBA 4PMNA 3FW6A 2VEGA 5F1UA 2OODA 2VR5A 1KA9F 3Q58A 3PPFA 4N9BA 3FVMA 2VGIA 3LHWA 1EDGA 3ENLA 3VCCA 3GR8A 2QIWA 3AXMA 3UR5A 3POHA 1CGYA 2QVHA 3MANA 1NF0A 2C8NA 4CQCA 5IFTA 5CC7A 4D8ZA 5DEZA 3PTKA 7TIMA 8XIAA 1JDCA 5KEZA 1VJZA 3T0AA 4O4VA 4R9XA 1FXQA 5M17A 4MFEA 3PFRA 3NQAA 1IZCA 5JVLA 4R33A 2Q3RA 4CLMA 2QMKA 1CI1A 3CWHA 3EDEA 4KW2A 3LNPA 3N18A 1KR1A 4LH8A 4OE7A 1OINA 3S2MA 3GAKA 1NWSA 3R1ZA 5JQ9A 4PA8A 2BX7A 3AJ7A 2WJEA 1O5QA 3SQLA 4E8CA 1YTKA 3W25A 1TQJA 4MWAC 5A8QA 4AC7C 4FNUA 2VEPA 3GU2A 3ABOA 3FXGA 4DN1A 1WDSA 1VFMA 2X2YA 5JH1A 4W4QA 2NQHA 4ZA0A 3TYAA 5DN1A 1EOKA 1VBRA 2QXWA 1H41A 4JHOA 4P7NA 4C6LA 2JGYA 5I79A 2R1LA 1TWWA 1K9DA 2PCQA 2I17A 4HB7A 1ZPTA 3AC0A 4J2MA 2Z00A 1NEYA 1TTPA 4G7EA 3QGAC 5HQMA 1EC8A 3DG7A 2BWGA 1S1PA 2V68A 3OBKA 4QLLA 1O68A 3LHTA 2G3IA 3RGTA 1BYDA 2ZX7A 5BRQA 4JIQA 1JI1A 2X05A 3KBSA 3RRXA 3QMSA 3PZOA 2W67A 2VMFA 2YDQA 1BXBA 3UXIA 5C7VA 1WUEA 5DBTA 1YHTA 4Q6XA 1EJWC 1GZ1A 3HTWA 1OYCA 3BUVA 2Q8LA 4A6GA 3NPVA 1XBXA 5C54A 3S5OA 4Q7BA 3RCNA 1LRQA 4DZIA 3STFA 4ATWA 3ZYZA 2NUXA 1J93A 3ZVHA 4LYKA 1SYTA 2BVYA 5DT5A 4UTHA 5G1MA 3PC0A 4RPPA 3THAA 4C65A 2JKAA 5CZSA 1TG7A 4M56A 5FJOA 3N2MA 1ZJBA 1KW1A 4K37A 3T6CA 4TV5A 4LUTA 1LCOA 3M0ZA 3W2UA 1JPDX 3F5LA 5L9FA 1FFRA 3W81A 4CCDA 2VEMA 3RAOA 3W1QA 4GJIA 3MMWA 1XIJA 3ERPA 4KCUA 3UF9A 4HMEA 2B0MA 4CNTA 2YCJA 2EJ1A 3N19B 3FDGA 4I6KA 1CXLA 4O0KA 3K4WA 1UPMB 2PB1A 3IRSA 2YW3A 2NQ5A 3WLSA 1MSSA 4TIMA 4NJIA 2YBTA 3ARPA 3R13A 3CYJA 2XUCA 1RBLA 3MJYA 4BWLC 2VZSA 2GVYA 2XIMA 3RITA 3W7GA 3G24A 1BG4A 3VKCA 4KERA 1GT8A 1LG2A 1XLLA 2ZWZA 3DC8A 4PH6A 4MYXA 1EWEA 2A2IA 1ZBCA 4MJMA 4O0ZA 3TZFA 3W27A 4V15A 3EDFA 2OGYA 3QRHA 5JIWA 4AD3A 4W93A 4A8IA 4IQLA 1HT6A 5CC6A 3OZYA 3VOHA 4LUJA 1EQCA 3OLGA 3NO3A 2RH9A 1UKTA 3WDQA 2IKJA 4WD0A 3N13A 4AWEA 1NSJA 2PGRA 4XAYA 4CEXC 3WLHA 1SFTA 3GG0A 1HP4A 4HMCA 4C91A 1QASA 4KS0A 1SPQA 3UU0A 3W7QA 5DCEA 2HK0A 1FDZA 3OZPA 3V16A 3WH6A 4D1IA 2V2HA 5ABFB 5T9CE 4QXIA 3LYEA 3DIPA 4IIBA 3U5YA 3U6WA 1DVJA 2JQXA 1E5NA 4H9YA 1Q6OA 3N11A 2EG8A 1OF6A 4PSPA 4B3KA 4MKVA 1EBHA 4A8LA 3AXXA 5AFDA 4XAFA 3CM4A 1A5SA 3SRFA 4BEUA 2PF0A 1A5OC 4QLKA 5FEPA 4TU1A 4U5IA 4LEQA 1O4UA 4KIEA 1IR2A 1W1PA 4AWUA 2XIQA 4G7FA 4C6BA 2OEMA 7REQB 3PBVA 3WQ6A 3K4DA 2J74A 3O2LA 4RZ4A 3QR1A 4IGHA 3B9AA 3UGRA 1UG6A 1UWUA 4DX3A 4Z17A 4X9YA 3WLRA 3OODA 1VFLA 4S3GA 2OJPA 4J3UA 3EXRA 1E0VA 2NZLA 4F0KA 1ZSXA 1V4YA 2DY3A 1YDVA 1GHRA 3WL1A 4HOZA 1AQHA 3NQVA 3PUDA 6CGTA 3UBPC 1FWGC 4A3RA 1JCJA 3AYVA 3C0SA 2ZXDA 5HNNA 2Z0IA 4JN8A 3WQCA 3W82A 3FYPA 2WSPA 3W7KA 1TR1A 2P88A 4O18A 1VF8A 2X16A 4K3ZA 3UNDA 5CC3A 1ONEA 4FMVA 3ITXA 4E2OA 5JBEA 4PBEA 2UY3A 1ZU8A 1TE1A 4PB4A 4B5VA 3C52A 3L4ZA 1DP0A 1UD3A 1FHDA 3RLHA 4Z1YA 3BC9A 4UFMA 2QJIA 3N2CA 3I65A 3UYCA 3GVVA 3QPZA 2PODA 4JN7A 1IIHA 4QNWA 5B80A 3RJYA 1A47A 1GPWA 1OVDA 1H7PA 1MEWA 4MLJA 1SZEA 3BANA 4MB5A 3BCJA 3UCDA 4E5TA 4YTRA 4IX2A 4IM4A 1R87A 3MWCA 1OX5A 1RD5A 1DJYA 2V8ZA 4QG9A 1S5WA 4QQUA 3QXBA 1K8CA 2QJNA 3T78A 1S5NA 4U4MA 5BCAA 3WKZA 3W2MA 1XW8A 1BAGA 4Z2IA 5FAJA 3JZEA 4IMDA 3ZJKA 4Y90A 4RPQA 4GIRA 4AWSA 3TYBA 3BAKA 3BLKA 3L4UA 4AXKA 3VIKA 1OG0A 3PTDA 1I45A 5TBOA 1CXKA 3EX6A 4QX4A 1I75A 1XUUA 5TF0A 2X40A 4MAZA 4GQ0A 1MUMA 3PY2A 1QU4A 1U33A 4NRRA 3GVWA 2XGBA 1HO4A 3OQ8A 1R6WA 3L9CA 2WBKA 4QAWA 4X2RA 4IL2A 1FH8A 1NQKA 5G2HA 1J12A 2QCFA 4QLJA 5DFAA 4D72A 2QUTA 4EPEC 5C9ZA 1UMLA 4GMEA 4S3EA 1GZJA 1Q8JA 4MJZA 2FJKA 5M1TA 1W5PA 5U7SA 1QHPA 3E2SA 5C70A 3FV9A 3TWAA 1AH3A 4QE5A 1BYBA 3R0DA 1ZHAA 2B4GA 2NWRA 3PVFA 1WB0A 1TPFA 1P48A 4H41A 4FLSA 3QGVA 1D7FA 3MMDA 3HGJA 2Z1SA 3O06A 1FRBA 2GDUA 3WQWA 5C9XA 4PMDA 5DBUA 3GU1A 2YSWA 1BWLA 1B31A 3OQEA 2D24A 4DBSA 3AMKA 3H2FA 5A6KA 4ZOEA 2GJRA 4BZYA 3NDZA 4GFSA 3GXDA 2ACSA 2FVLA 1Z8AA 3VNDA 2G41A 3T81A 1W9PA 1YTEA 2WLZA 1UC4A 4PTVA 1NF7A 3MMTA 4IUOA 2J88A 1TZ9A 5BNKA 3SADA 1SSDA 1REQB 3QJAA 1OC5A 1OSEA 3CT7A 4PCFA 3MB9A 2CLEA 2UY4A 5H2ZA 2GWGA 2PCEA 3G22A 5DF0A 2Y5JA 1TA3A 3GTXA 3MDUA 1F76A 5CLWA 4XD4A 3VZZA 4AQLA 1BF6A 1UBSA 1UR3M 1S2CA 3GYEA 2OQLA 1FVPA 1PE1A 3DH7A 2EBNA 3GTHA 2XJ7A 1OFDA 3EYPA 4IP4A 1UKQA 3EKZA 3E6EA 2ZVRA 4E0CA 2QCDB 3CPGA 3MYPA 1F05A 3NPWA 4M3PA 3UZ5A 5GPRA 2ZZ3A 3CL6A 2V63A 3N3TA 2NXHA 1US3A 1S2VA 1DWIM 4B5NA 4ADUA 3UZJA 2X1TA 2EXOA 4K36A 1PKNA 3FOKA 3IV8A 1HFBA 4WY0F 1VPYA 2VC6A 1L9WA 3C2OA 4B5WA 2XSBA 1UW9A 1ITUA 5DT7A 2PDGA 3ZT5A 4AYSA 3GO2A 4NIRA 1TIWA 4IPIA 1I2QA 8XIMA 3OIXA 1R3YA 1B3VA 1JULA 3WD2A 4UNKA 1CGVA 3SN4A 3WNKA 3DEQA 1Z7AA 3PZQA 3HQOA 5HQLA 5ABFA 2CLIA 1XUZA 4YWSA 1KV5A 1C91A 3R79A 2OZTA 1GOKA 2RDXA 4JQ1A 5CJ5A 2LLEA 3L67A 1WBHA 5ECUA 1GVFA 5J5RA 3TMLA 4HK5A 3W7IA 2NLYA 3EAUA 2WCAA 1UR2A 3TYCA 1WZAA 4H4IA 4HJWA 4XD6A 1G0CA 3BL3A 1MNSA 1Z42A 2PWEA 1ECQA 2ZCGA 3LV5A 3B9NA 3G0SA 3GH7A 1EPXA 2ZA3A 1JPMA 5HK4A 1VIWA 1W54A 3V18A 4V1YA 5AZ0A 3TVAA 1V3MA 3WJWA 3VCNA 5I3JA 3KHJA 1RJQA 1IEQA 5HJXA 3LQLA 3LA4A 1NAL1 1TREA 4OWGA 4KWSA 2PWVA 5D9MA 1FQ0A 3NO1A 1B3WA 4FX8A 4XKYA 4MNLA 4CNNA 3F03K 2DW6A 2ZUNA 1XG3A 3GHSA 4NHVA 4LXFA 4F9JA 4JY9A 1PZ2A 3QM3A 3A12A 4GA8A 1L6FA 2I9UA 4PTMA 4MADA 4UMCA 2VZTA 4YTUA 3GG7A 1I6NA 4UQ9A 2Q8XA 2E9MA 1XYBA 1B3XA 4FOJA 1OADA 1RP9A 4M51A 5G4HC 3WEOA 1JGMA 1W3IA 4ICCX 4REQB 1MW3A 5AHFA 1B2YA 4XZWA 5K3VA 2X0HA 3RN6A 5FJRA 3K8LA 3II1A 1JUKA 3K30A 1XI3A 3NGJA 3SCTA 3UVIA 3D5HA 5F4XA 4UBPC 3UWYA 1Y0EA 4ZOBA 2E4TA 4UWMA 3SUWA 3W2KA 3I7RA 1T0OA 1OABA 3LGEA 3PZNA 1HL2A 2WZTA 2PGWA 2DDXA 3KL3A 4F0LA 5MKGA 4ZBCA 4JFUA 2WVVA 4EF9A 2O7QA 1HJXA 4QG6A 4IGSA 3WLTA 4RV3A 1U5HA 2JKEA 2JKPA 4JIIX 4L56A 3SEPA 2VOTA 1EUNA 1MRQA 2E9BA 2RDUA 1DWHM 4LFYA 4NVTA 1E1CB 1OGGA 3KVJA 3U2CA 3STEA 1I8JA 4POCA 1B57A 4I7VA 3ABXA 2ABAA 3P61A 1QPQA 3HIJA 3MT1A 3PAOA 3DHPA 5AHLA 4ZEPA 1TQXA 3P2VA 2W9MA 1WXYA 1FKXA 1WKDA 4P5UA 2NX3A 5TQLA 4D8LA 2QJGA 3D47A 3R11A 1EHNA 1KM4A 3H2NA 1LDCA 2GQAA 2P8BA 3GSMA 3V4BA 4Q8TA 1UP0A 1K70A 1J5TA 1OY0A 4NNBA 3N1AA 3AALA 2A3AA 3I3EA 2WCSA 5AYYA 4XIMA 2GVGA 1LT8A 4MWAE 4QM1A 3W7HA 3R89A 3EDKA 4KRTA 1JF5A 3AUOA 3SN0A 4H19A 3S2JA 1KBKA 4A3HA 2YXOA 1R2SA 3HPAA 3OVGA 1ZQ5A 4HMDA 1KFJA 1MQRA 3ABQA 3SN1A 4NNCA 1BD0A 4GJJA 4AB4A 3GTFA 3EWXA 1CX9A 2AL2A 2JK2A 4TQTA 1WV2A 3BDKA 4FEZA 3QPEA 4QDWA 1NFPA 3GC5A 3BGJA 1L6YA 4DF0A 4UTWC 3N25A 2R1MA 4R9OA 1V0MA 4ZO7A 3S1XA 2VT0A 1UQYA 4EXBA 5AHMA 2A7NA 4S2BA 1EQPA 3E3HA 1ZNNA 3HOJA 1HTIA 4W8LA 3R8GA 4JQAA 4PB3A 2GGIA 3ORWA 2C91A 4YPJA 1QTWA 3NEVA 4GC3A 1J79A 2R9RA 5C55A 3H22A 3SO7A 1S2WA 2IPWA 4MPKA 1UJQA 1VFHA 1HZYA 1WOAA 2OFJA 4JIPA 4O8RA 3S2LA 2C19A 4JAWA 3ZOAA 4GE8A 5HMFA 2AQOA 2PP3A 3BGGA 1NQ6A 5I09A 2VFHA 3H2CA 2AAAA 2W61A 2ZZ5A 2VRKA 4MVAA 1XLBA 1K3UA 1N8FA 3CMJA 4FLRA 4FR1A 4LV4A 2Q02A 1KFCA 3G8RA 3AYSA 1HXJA 3GDKA 4M7SA 4ECLA 3MO4A 4JY8A 3T2PA 3VOJA 1V3HA 1C8QA 4JL1A 2VWSA 3O6CA 4MLRA 5E5CA 2GWNA 4IIDA 4YS1A 3TTYA 1OK4A 5AOUA 4NT0A 4W8BA 2IKHA 3K2GA 2DZWA 2BS9A 1YQ2A 3W4RA 4NAFB 1BWVA 3KTXA 1NDWA 3DOPA 3QV7A 3V1HA 1E40A 3P14A 1C7SA 1DJIA 4MG4A 4BI7A 3IPWA 3SAZA 2AQWA 2DZUA 1TMHA 7A3HA 4HA3A 4G8TA 1OCNA 1UH4A 5LNVA 1PZ1A 3G1AA 3AROA 5IBXA 2X1SA 1VBHA 3CPRA 3W22A 3UCQA 1V5XA 2REQA 1KTNA 1PHQA 1WBJA 2FZ9A 3KXQA 4LCRA 3I7SA 2PWDA 3PZ9A 3IIZA 3CC1A 2UY5A 1C8YA 4EPKA 1B1YA 3CAKA 3W1TA 4IG2B 5EPDA 3ABRA 4BS0A 3HGRA 1WQ5A 2PLJA 1KQZA 1Q8AA 1QO2A 3GWQA 3IWPA 3VGEA 2WW5A 3L5AA 3GNRA 3WJZA 3R94A 1WDRA 4W7UA 3BWWA 3AYTA 2R6OA 1TV8A 4DPPA 4E6MA 1DEDA 4LVAA 2OSXA 3LM3A 1XFBA 5D9PA 3AXHA 1XLFA 1JXKA 4XD3A 1P0KA 4CU8A 3F5KA 1DXIA 1GOXA 1D8WA 3OG2A 3H6OA 1JYXA 1EYEA 5C2CA 4DLFA 4CD6A 1LL4A 3QKZA 1K7FA 4GX8A 2YCIX 4CQDA 4INFA 3HPFA 4JQ4A 1SW3A 1FWCC 1JNEA 1CENA 2D3NA 2RDTA 4B5SA 3DHDA 4ZENA 3LBMA 1KFBA 4KWOA 3VINA 4NX0A 1FCUA 3NXLA 3TV8A 3AIEA 1LORA 3VKBA 2OQYA 2PP0A 5G5IA 1E6QM 2WZHA 1GNXA 1N7KA 5CQ1A 5AB3A 4P8VA 4CD7A 4DWSC 2FH8A 4CKQA 1DJNA 5FF4A 1YRRA 4ZB0A 2XYLA 4NL1A 4NNAA 1Q4WA 3WNPA 1EZWA 5K9DA 2DU2A 2ODOA 4C6CA 1DQXA 2HQAA 2NSXA 3FA5A 3KP1A 4UTWA 3TSBA 1MMFA 1NVMA 1WP6A 1OEPA 4U2YA 3PZVA 1KGWA 5GJNA 1AW5A 4GVFA 1F3TA 2ISVA 1AZ1A 4C6DA 3A9IA 4LCQA 3WBEA 1OBAA 3LM7A 1VIZA 4D6GA 4QG8A 1TV5A 4PUWA 4O10A 1NDYA 1BRLB 4I7WA 2CHNA 4KCVA 3O3RA 4LV9A 2CIPA 3R12A 1J2BA 2DVXA 1DKWA 1IXPA 1XCWA 3T9PA 4I5RA 2A6NA 3VDCA 3EOOA 2CBIA 1AZ2A 1XLGA 3NZPA 4LAUA 3GIQA 2EF9A 3SCVA 2WVSA 1Q7MA 5FF3A 3PULA 2RAGA 3WLJA 1U30A 1F5ZA 1VCFA 3W29A 3UCCA 3GIPA 2VYOA 3TTEA 1A5NC 4XK2A 3TOPA 5G4WA 1J2WA 4NSBA 2G97A 2XTKA 2ZC1A 5TD4A 3MSDA 1G4PA 4AEOA 3DG3A 1UD8A 1IWBA 2WC4A 2WXDM 3FYOA 2WPGA 1RCXB 1JXJA 1X98A 2NX9A 1JQXA 4HOWA 4LAMA 3UJFA 5I6SA 4F4RA 1YADA 3FA4A 4DUVA 3QW4B 3ZJ6A 1JZ2A 1KRBC 1POJA 1QHOA 2FVMA 4CQ9A 3HN3A 2GVEA 3HA1A 3WLMA 2J9XA 3N73A 2IQ0A 3VIFA 1LBMA 3JW7A 3LPOA 3FKRA 3EDJA 5AC4A 4JFTA 1GQIA 3V0TA 1LP6A 2I1OA 4AFYA 5AYIA 3KLLA 5A6LA 4R7JA 3PS7A 4XG1A 1KFKA 1GCYA 2PUZA 1W3JA 2WWCA 3IJ9A 3MUIA 1MUWA 1Y7VA 4GVGA 1VH7A 4DO4A 3VUSA 1R8LA 3WDHA 2ZA2A 1QO5A 3ZXWA 3OB8A 1W5OA 1JIBA 3NA8A 1F3WA 4S3FA 5K4ZA 5A69A 1XDJA 3LMYA 5HJYA 3NSXA 4IUGA 1I9CB 3RX4A 5EL1A 4JD4A 2X41A 3EX3A 3DUGA 4R27A 1UA3A 4FR6A 5BRBA 3SUVA 4WKFA 3UG8A 4QP0A 3LXAA 1UD2A 1XCXA 2NXIA 3NQCA 1GHSA 3EMQA 2Z25A 3G1SA 5HULA 3W7RA 2EPMX 2J4GA 3F4NA 3FAXA 2BGQA 4IICA 3CV2A 1X7IA 5KSWA 2QPUA 3KVKA 3VGFA 3HV9A 2QKFA 4J4KA 1H1ZA 1EL3A 2ADAA 4O16A 4ZL1A 4BQ3A 2XFWA 1GYLA 1NWRA 1WDPA 4F66A 4KKXA 3BH4A 3G1HA 1KXTA 4PL2A 5IM51 5CBJA 2IQTA 3GIYA 4WDXA 1V6VA 2PWHA 2WYSA 3VU2A 3FKKA 3UJEA 2I56A 4NJGA 4JTKA 1BTCA 2VTFA 2CLMA 3L4WA 1F07A 1JCYA 1NP0A 3WCZA 4RE2A 1A4MA 2PZ0A 3DFYA 1M68A 4EPDC 3LBOA 4MKNA 3TROA 4P8WA 1C8VA 4GVIA 3NYZA 3KBVA 1GQNA 1AD4A 3MMUA 2R1KA 3AIBA 5FACA 3W7EA 4DWDA 1O95A 1UWTA 3DZ1A 3W24A 3PZGA 3HB9A 4DBEA 4MB3A 1XBYA 3RCMA 3NUKA 2CLLA 1FWHC 1GQJA 1NOUA 2PDHA 5FOOA 3TFXA 2NQJA 5DRIA 3P74A 3LHUA 1FP8A 3GD6A 3P82A 4NXSA 3MW7A 1A3XA 2PDCA 3VDBA 3KX6A 4YL2A 3T40A 4ZXLA 1R2RA 3MZNA 1BHGA 3IACA 3LZ3A 3AIQA 3N2TA 3B8SA 1TVNA 4RE3A 3AZSA 3CHCA 3HQPA 3GR7A 5BYWA 4DF1A 4HA0A 1IHIA 3ARUA 1CXEA 1H5VA 4BF7A 4F2BA 1W37A 1CB7B 1QNRA 2YXXA 4JQ2A 1DTUA 2IQDA 1C93A 3A4AA 4WQ6A 2DJXA 1VC4A 3WQDA 5DMLA 1BVNP 4HHHA 1EKOA 1W0MA 4S3JA 4GPNA 3RRAA 2X09A 4ZQCA 1WO2A 4I7UA 3RX2A 4LAOA 4J2PA 4B5UA 5AY7A 1XLKA 3BPWA 1OT1A 3TYUA 3WF0A 1MO0A 1JNDA 2PS2A 4XIAA 3HV8A 3S5YA 6PTDA 2F6UA 1RBOB 2GVJA 4MIMA 4LC6A 2ZICA 1P0EA 4NYYA 1CEOA 3GNPA 1W5MA 3UY8A 1E55A 4FX6M 2OT1A 1R5YA 4UTKA 2BOGX 2DV0A 1ELSA 2X7VA 1GONA 2OOFA 4M6PA 1OYBA 3EX1A 1IYXA 3MP3A 3WIJA 3GHRA 3NQMA 1GVRA 3HG5A 3U4FA 4UR8A 2NV1A 3O0FA 4F0SA 3LLFA 1ADOA 2PU0A 3KBWA 3IV3A 3WZ0E 1XLHA 2D0HA 4XWUA 2H3DA 5HAOA 5BOFA 3TAKA 2I57A 4GISA 3NL2A 2WC3A 1FHVA 1SUXA 3UR2A 4YVPA 4WIWA 4JTJA 5D8WA 1A5MC 2G3FA 3NG3A 4V1XA 5DMNA 3PWAA 1CIUA 3CTLA 1U1JA 1XCFA 4O53A 3LK6A 4NZCA 4PMYA 4GUFA 4HYVA 4PSRA 5BRPA 4Q4KA 3ARRA 2E8YA 4FNQA 4AY8A 2ZA1A 1KD0A 1F8MA 3DAQA 3UXDA 2OT0A 1Q6EA 2D1ZA 1KLYA 1IWAA 2BXVA 1DIKA 3T0DA 3CS2A 1R3VA 2TRSA 1TB3A 4JPGA 3TN5A 1YDOA 3LLXA 5HR7A 1TJ2A 3KOFA 1TJ1A 1V6UA 1Z6KA 2ASHA 4J3TA 5XIAA 1UUQA 3RLUA 3CNYA 4TX6A 3ARYA 4AD1A 2J7EA 1IIGA 3PZIA 1KGXA 1H11A 3TU9A 2E6AA 1P6BA 1LRTA 4J3XA 2L5HA 1W56A 5M03A 2PDUA 4EF8A 2VHLA 2GUUA 5LIKX 3O0KA 3BQ6A 2WKLA 3H21A 5CGMA 2ALRA 1EXBA 3VNLA 3LY0A 4UZUA 1Q2RA 2DZBA 2E6DA 3E0WA 3NGFA 1ML1A 4DJFD 3WNOA 6XIAA 3OO2A 1K4HA 3RU8X 5EMMA 1EA0A 2RFGA 8RUCA 4LJ3A 2V6AA 2QF8A 5JIPA 4Y9PA 2CLFA 1H0GA 2C1GA 4GJ1A 5IDIA 1VEOA 3VM7A 2VEIA 3NAVA 4MUPA 1ZTVA 1JR1A 3KCJA 2VJXA 1AQFA 1XGEA 3RO6A 4H9UA 3FCPA 4IISA 1YEYA 5FESA 2C71A 1TKKA 2J9YA 2E09A 2Z1KA 4QE4A 4BK9A 2GDQA 1NDZA 3PWIA 5BWFA 1LWHA 3DN5A 1ZGDA 2AKMA 1QCWA 1KM5A 1JAEA 3SURA 3NURA 1EC7A 1T7LA 3W6MA 1CGUA 4N6EA 2XINA 3A3WA 1GVIA 1H61A 3NVDA 5JH2A 4GX9A 3F2DA 3CZGA 2P8CA 2VFGA 3CAWA 3LRKA 4PUEA 4JTFA 4L4MA 4LNCA 7ENLA 3KOXA 2VCCA 1HKIA 3TCEA 2HE8A 4QITA 1GYNA 2XSAA 4YXGA 3SJNA 4JX6A 2ANUA 1S2TA 4WXYA 4YCPA 1NOWA 4GZIA 4LYQA 1QT1A 3A47A 3B03A 1QVBA 3OHMB 4F2UA 3DFHA 4JKKA 1J01A 1K7XA 3QTGA 1QWGA 2WZIA 3MSYA 2VC7A 1Q6CA 2R1NA 8CGTA 4KRUA 2F6KA 4WEVX 5L6UA 3SSZA 2J24A 1E15A 3AHXA 1EEPA 1EBGA 3CZEA 4NKCA 4LSBA 2V5BA 1QJWA 2ZE0A 4PN2A 3QV9A 4DJDA 1J96A 4FOKA 5K9CA 4JTGA 4WXZA 5GNYA 2TPSA 1I60A 4UQEA 1JDFA 3WMCA 4ZSTA 2WO5A 2F38A 2J27A 3LTSA 3S1UA 3TYDA 4N42A 4BI5A 1BFNA 1U5JA 2HS8A 1Y5XA 4PUDA 3WL0A 3CB8A 3W23A 2A3CA 1UBPC 5FKYA 3UZXA 5I24A 4OJYA 1DIDA 4PCTA 3AMCA 1EGVA 2QV4A 2QEZA 1XD1A 2TMDA 1MZRA 1HKJA 3NQFA 3VNIA 4MNMA 3YPIA 2FZBA 1MFUA 4PB5A 1KTBA 1EF3A 1YKWA 5CPSA 1NWUA 1LROA 4MNKA 4G1NA 3IK4A 2DORA 3QEZA 4RW3A 1W9BM 2ZZ7A 2YIHA 4PTXA 5BU6A 5H91A 2ISWA 1E56A 1HG3A 5JU6A 2D3LA 1E3ZA 4PODA 3M0LA 5HNRA 4YYCA 3PBMA 3QV8A 2QT3A 2VZOA 5EYWA 1OX6A 2F6XA 1CLVA 2OEJA 3RM9A 4NG3A 3SJ3A 4HNOA 2E3ZA 4N0RA 2Q09A 3KHDA 4EK7A 1EJVC 3TMQA 3W2NA 4Q8OA 1O7AA 3TTQA 4QJ1A 5D03A 3NZ1A 4W85A 4GYFA 2QW5A 4JNZA 2R1PA 5A6MA 3S6OA 4HPJA 1UC5A 3D3FA 2IXVA 3NSMA 2CKRA 3EOEA 1ICSA 1N55A 2ACUA 1EGZA 4DZAA 3VGHA 4JN6A 2A3HA 2V3EA 3RF9A 4HPGA 1XD0A 2P53A 4AD2A 2DZTA 4F40A 2X42A 3R4IA 3WY1A 1FWAC 2VQTA 4P7LA 4CD4A 3EB2A 3BMXA 3CLWA 4EP8C 3J7HA 4H2CA 8TIMA 4LNYA 2PDPA 1H0IA 4NZ3A 3LERA 3B06A 3KOWA 3OBEA 1DWFM 1J0HA 3BCFA 5HWNA 4GOAA 3A21A 1CXHA 2GLKA 4LRTA 4HN8A 5D2TA 2BGNE 1KM6A 2C15A 3HFYA 2FGLA 1H7RA 4GINA 3L7RA 3VKDA 5A6JA 1XR2A 3NPXA 4YHEA 3UT0A 3UG3A 5M2FX 2XVKA 1R3QA 3G1FA 1VLWA 4V27A 1Y65A 4LANA 4IFKB 1CGTA 4DELA 1NOFA 3WQ8A 3PN8A 3QKEA 1M5WA 3QPYA 3RM8A 4M81A 2X0YA 2YL8A 3TC6A 4B9ZA 2QMJA 2XFYA 4W88A 3KVMA 5LA1A 1ZL1A 1J5SA 2GSHA 1AW1A 1RV8A 4PE8A 3GTIA 5I77A 2OSYA 2J62A 5LGZA 2EGZA 3TN4A 1GOIA 2YPIA 2WKGA 4J40A 1IEXA 4LUTB 4B3ZA 2RGLA 3QY7A 1ZFJA 1GVQA 2FHFA 2BNJA 1OIMA 3UERA 4C6FA 1X6LA 3NYDA 3WF4A 1LBFA 4G1KA 3R0KA 5H8UA 1E6SM 3TA6A 4FXJA 4NZ5A 1WZKA 1P1XA 3NO5A 2G4JA 2O92A 3VILA 1TV7A 5K9XA 1HN1A 3L66A 4QTGA 4DZ5A 2EKGA 4DJDC 4PMVA 1G94A 1KM1A 4GVHA 3VOIA 4L7ZA 3IIPA 2DZVA 3OLDA 2HVMA 3MY9A 3N4FA 2PDMA 4EPBC 1SVDA 5HPOA 4Z0JA 2ATMA 1ZALA 5IDZA 4HYWA 3TQPA 4QJ3B 4DEFA 4MYAA 2R8WA 3LI1A 5U4NA 4AZCB 3FGCA 4UMAA 2PC8A 3REQB 1FWRA 1DJGA 3ANVA 2ISFA 2W0UA 3NFUA 5I7GA 3GW0A 1FCVA 5C7HA 2FKPA 4LS2A 3WLPA 4E3VA 4WDUA 3FGCB 4NJJA 1C9WA 5A8GA 4FHAA 1MXSA 4LYRA 5DY2A 2WHMA 4B4HA 1EHAA 4JKLA 1PYMA 2C1IA 4J35A 4IFKA 1DYSA 4JNYA 1WKFA 2QCEA 1QPRA 1EO5A 1UOZA 4D6DA 1IEVA 3QFEA 3H7RA 4XISA 4IMAA 2DUAA 3M0XA 3LLDA 3PFMA 4MJ2A 5AHEA 2PDBA 4Q8MA 2OZ3A 3WENA 2ZZ1A 4NF7A 2XN0A 4F79A 1LT7A 3T8LA 4HN4A 2JBMA 4Q4RA 1E73M 1K4GA 3QHNA 1VCGA 2J66A 2D2HA 5CZTA 1XRSA 3R6IA 3SCNA 1T96A 4M1BA 4J7RA 4RW5A 4X9SA 4JHMA 3OA3A 4UQCA 1K03A 1Z48A 4IQEA 2YFOA 1TV3A 4R34A 4HHLA 2R94A 2GUYA 3E12A 5LHFA 1XIFA 1TPDA 4Q7IA 4IJCA 1X8FA 3UZWA 4OVXA 3FEQA 1BF2A 1KXHA 3M46A 2ZUVA 4ERIA 2V3GA 1W3KA 1RLCL 1BYCA 4I5XA 2BVWA 5LKYA 4BCEA 1UWAA 2G3JA 2E25A 4OZOA 1SFJA 4JGDA 5LNWA 2VVSA 4PUMA 3B9DA 3W2LA 4RNJA 4O0QA 4EVZA 1EZ2A 1YLVA 4L5ZA 4L6DA 1DHKA 1SGJA 3AU6A 2PDQA 4CVUA 2PDYA 3GTNA 3AIRA 3OVRA 4GG9A 3TUUA 2J6XA 3PWGA 4DI9A 4EKJA 3ZFHA 4J27A 3T09A 1GGOA 5D2VA 4I90A 5FJPA 4JZ5A 1TJPA 4GH3A 1VBGA 4XO6A 4O12A 4JOMA 3ARWA 3WG6A 4DBDA 1XX1A 3TX9A 1GPFA 1TPWA 4UFJA 3M0HA 3MUY1 4QE1A 4B2DA 1IZJA 1RY0A 2BFGA 1FH9A 3H7UA 2EPHA 1M9HA 2E9LA 3P7YA 3ARQA 2ZX8A 3LQGA 5I3DA 2D23A 2PBOA 4JX5A 5BW6A 3WEMA 1KCKA 1FWIC 3XINA 4XBJA 1YNPA 1DJZA 1VBUA 1B4EA 4AZBA 4E2VA 3QC0A 3GXMA 4DJEC 1SJAA 4KESA 2NT0A 3QR3A 3S6DA 1GOOA 3P93A 2FZ8A 1VEPA 1DQUA 3PUGA 5CEWA 1GOMA 3W7JA 2BG5A 1P4CA 1DJQA 1UD6A 3B97A 5D9OA 4PRRA 5E0FA 3O8AA 3R0UA 3AS0A 2VM8A 1UR9A 3U57A 3IGHX 1OZMA 4YCOA 3VDGA 4QSFA 4M6UA 3DC0A 3OZMA 1GVYA 4OTKA 3L2LA 1L2QA 2NLIA 3IJDA 1Q2SA 3FFSA 3OGRA 1MWOA 5DRCA 3IJIA 2QDHA 1R7OA 1HKKA 4KFNA 4AIEA 2GZXA 4B9YA 4DYJA 2G50A 4REQA 4Q4OA 1ISXA 2W3ZA 2JF7A 2E0PA 4NI8A 3BV7A 2DZPA 3GG8A 3MKKA 4O52A 2HEJA 4AUBA 1AK5A 2J8TA 2JIWA 1GOQA 2V30A 4GUGA 1GYMA 3WNMA 1AFSA 1EOMA 4R53A 2ZRZA 1XIIA 5DO8A 1OB0A 3FLUA 2HWGA 1CXFA 3OW1A 2DJLA 4CN6A 1JDEA 1JGIA 4C60A 3CIXA 4HU8A 5AKQA 2YZRA 3PSWA 1PIGA 2GQ8A 3DBNA 3TW7A 5GJPA 1QW9A 3FXYA 1WAWA 1V6WA 3QQWA 4D71A 2CC0A 3GH4A 5EBUA 4FZIA 2FIQA 2GK1B 5GVJA 5ENLA 4CCZA 1V03A 1UIPA 4H8VA 4S2CA 3TA9A 1MNZA 4GZJA 1B9BA 4FNPA 2OO6A 3W01A 1LUCB 2V82A 2QJHA 1VYPX 3BG5A 2INFA 3A22A 1G4TA 1RCOB 1JF6A 3O63A 5CCZA 2ZZ6A 4BQ5A 2WBGA 3VM5A 4YN5A 1TPEA 4IP7A 1XH0A 3PJXA 3B0VC 1JAKA 5I3KA 3W3OA 3VKJA 2WM0A 4Z2JA 4J28A 3VGBA 1H63A 4EE9A 4KEMA 3SQMA 4ML4A 1X97A 5HWMA 2XIIA 4DZHA 4Q8QA 4PUJA 4XV0A 4MB1A 3T0TA 5HDRA 5JUVA 4YYFA 4FB7A 3Q4DA 1UA7A 3EXSA 3REQA 4IWWA 4PCSA 2XPKA 3LUTA 2HXUA 4G6CA 4H01A 2JEQA 1AJ0A 5FJIA 5REQB 1A5LC 4XVEA 2CETA 1OFEA 4DXKA 2EPOA 1IEWA 3EPNA 4JTUA 5XIMA 4E4FA 4IXHA 3AWOA 3TJIA 4ADTA 1BYAA 4JFSA 1M7PA 1QXLA 3DECA 3WNNA 4MKSA 3PBUA 1TCMA 5I3HA 1CPUA 3EPMA 1OF8A 4HCDA 3ALGA 2ZX9A 1C90A 1BLIA 3QY8A 2OWWA 1X96A 1O5KA 3UG4A 4C6OA 1AUSL 5H8PA 9RUBA 1D2KA 4QS5A 1ZB5A 4TTUA 5FJUA 5D04C 5T8GA 4DAFA 4UZSA 2WZEA 1HF6A 2HTMA 3PZUA 4JYEA 4FLQA 4DY1A 2P10A 2E7FA 4O11A 1YBQA 1IXQA 1W91A 4LUIA 2B7QA 4ROQA 2PA6A 4JTTA 5M3WA 1EJ7L 2A1YA 4CD8A 1BKSA 3UJRA 1GTHA 3VVGA 1R3SA 4NASA 2V3FA 2GGHA 3MZ2A 4UFIA 4XKYB 2F61A 3S9YA 1P43A 1Q4NX 4QR6A 5A2CA 1TV4A 3VIMA 2ZQ0A 3MYOA 1H50A 4Q4MA 2V5LA 3ATZA 7CGTA 1C3FA 1GJWA 3NR0A 1I0DA 3K5XA 2FDSA 4N4QA 4JS3A 1T99A 3FJLA 4AEFA 1FFQA 5SWUA 1EP3A 4RL3A 4PYSA 2I5IA 3F2CA 1PKLA 2CNCA 2Y7FA 2VZUA 3T2QA 5CPQA 1TUFA 4IL0A 5T26A 1VGAA 3FVDA 3L23A 3ARXA 3N4AA 4AZ6A 2C7FA 1ZRQA 4WY0A 1VBJA 5MKGB 3VIOA 5BXTA 2O9RA 5E1QA 4GRSA 2DZSA 5AZ1A 1PZ0A 2PMQA 1MDLA 1UD5A 4UOZA 3QN3A 1BVZA 1O6IA 4DWSB 3NDOA 3VXGA 3KW3A 3ZLFA 5EMYA 3N6QA 1RP8A 2WQDA 2ZXQA 2X1UA 2OSWA 2CZ5A 4DM1A 2VX4A 4MWAA 4NQ1A 4O14A 1TSIA 5CPMA 2BDQA 2Q01A 2ZRWA 2ZOXA 3H54A 3QZEA 2FZDA 2OX4A 2QCCA 3WLNA 1WOBA 1YBQB 3IUHA 1PTAA 3N9KA 1UR0A 2Z2BA 4LY4A 1YXCA 2MANA 2V5DA 3GVRA 2Z24A 3OJGA 3RPDA 4Y8EA 1SR0A 5B7YA 1A3HA 2O4MA 2X1RA 1Q6FA 3BURA 3WF1A 2IMRA 2BY1A 1KRAC 3O05A 1CWYA 4KWWA 3WF3A 1SSGA 3VAVA 1S46A 1LQAA 4ZFCA 3W07A 4DAIA 1GJPA 5AC8A 3AXKA 1WNOA 2X2GA 2OWXA 2AQVA 4ZVJA 4HU3A 2QJMA 3G6LA 3JRKA 2YB4A 4I3GA 1YTDA 4H04A 3SM0A 1FHUA 1Y8BA 4CQ8A 2BHYA 3B9OA 1XG4A 4O17A 3WMBA 3ITVA 4ZR8A 3SGZA 4WKHA 4NRSA 3RUBL 3KDOA 4IPNB 2ZUMA 1VB9A 1TR9A 1FOBA 3G1RA 3TSDA 3AO0A 3UJ2A 1UR4A 3AMLA 1H5YA 3T4WA 2F7FA 4KT2A 3USZA 4UNLA 2HNEA 3TH6A 1E9LA 4LT9A 4AWTA 3AHZA 4F48A 1X6NA 1CYGA 1MQPA 1J0KA 2CBJA 3CU2A 1TPUA 3ZJ7A 4R7WA 1XH2A 4Y9AA 3BLLA 2YXGA 4WSJA 3S6TA 1PZ3A 2QUMA 3KM8A 1AW2A 1G01A 1UD4A 3NEHA 1BKHA 1W17A 4QDPA 3SCQA 2DH3A 2WMIA 3QHOA 1GTEA 1WZMA 1BRLA 2GUBA 4P8XA 4Y9OA 2VEFA 2DT1A 3UWZA 4IIGA 3THCA 1A5BA 3S47A 2YDSA 2FHBA 5HANA 3QH2A 2C3ZA 1TWSA 1DJWA 4ONVA 1NWTA 2WMGA 4J5NA 1CTNA 2OQHA 4DVOA 4ENLA 2NT1A 3VA8A 2ZTJA 4EAMA 3SUTA 3EX2A 4M82A 4A3YA 4R85A 1JDAA 4O54A 3C0JA 4CD5A 1PIFA 1UP2A 4L80A 4Q8VA 5CZ0A 2QAPA 4LW7A 3P0WA 4G9PA 3TN3A 1B3YA 3KRZA 3GYCA 3E0LA 1ZBWA 2C6QA 5ABGA 4JTAA 2QCHA 3WK0A 2NV9A 4E38A 4XKMA 4D8AA 4RXFA 3U4AA 3L5LA 5REQA 1JVNA 4FAMA 4XUGA 4C1NA 3MP4A 1VJSA 2Q71A 2ZX6A 4YTQA 3MPGA 1Q13A 1PX8A 4L9XA 3ZR4A 4AHOA 4ERAA 3ID7A 2C1HA 4ICNA 2PLCA 1ZBVA 4LF2A 4PMUA 1M1BA 2GVLA 3OYXA 4WUIA 3C2FA 1W2PA 2I9EA 3SZ8A 2MUCA 2H3BA 3H70A 4MY9A 1ALDA 2BMBA 4CVWA 2W6RA 3CV6A 1X1OA 1JCXA 1MW0A 3AU2A 1B3ZA 4K1WA 4O1EA 4QCFA 1HL9A 5J04A 1ITQA 1VRDA 3WFAA 4FK9A 3NDYA 4EIVA 3MUAA 1G6CA 4FXSA 3UNTA 1RJRA 2Y62A 4R7OA 5AC5A 3B3DA 6ENLA 2NVDA 3QFWA 3A4WA 2Q8ZA 4I9AA 4WKAA 1KCXA 4X61A 1ZJIA 3CIWA 2XG9A 5DXXA 1XIEA 4XAPA 4CQAA 2PTYA 3GNNA 1IGWA 2PDFA 2Y1HA 5H8MA 2VRQA 2R91A 4X3ZA 3VNMA 1I0BA 1HJWA 5K2ZA 3C2EA 2NWSA 4QRNA 3D46A 1OCBA 3OVPA 1HO1A 3U8GA 4TUFA 2VCBA 1I2PA 3GH5A 4WR3A 5DCDA 2QNEA 3LEPA 1BPLB 4S3AA 1LLWA 3PR2A 4Q22A 4YNGA 1OGBA 3MKCA 2FLIA 2H8XA 2Z26A 3SECA 1UWRA 1XIHA 2VC5A 2CXEA 3B4UA 4GFIA 1W8SA 4E4PA 4S23A 1O5XA 3SY8A 1AQMA 4PMQA 2EPLX 4AAJA 3MDWA 1RPKA 1Y5WA 2J13A 4KF1A 3OGVA 4PFMA 4FA3A 5HR6A 1M03A 3F5JA 4H9ZA 1B0IA 1X1ZA 3KP0A 5LA0A 2J8GA 3ZR5A 2BHUA 4PCPA 1QNOA 3LTYA 2C16A 4AH7A 3KCLA 1TX2A 4WJEA 4AMCA 3B4YA 4GGBA 3R5EA 4MMWA 1A53A 4B3LA 2VO5A 3GU9A 3RX3A 3W1AA 2XZ9A 2Y8VA 4V33A 3EGJA 3GS6A 4LEFA 3G1XA 1FCQA 5C0QA 5D32A 4L4OA 2XIBA 3LU2A 3XIMA 3UZYA 2QV5A 2PWFA 8A3HA 3M7SA 1SQ7A 3SW6A 3LG3A 2VCAA 4V28A 5D37A 3F1QA 3DGBA 1H7XA 4K8EA 4HHMA 1K9TA 3DESA 1W9UA 3OU8A 2J47A 4LBRA 1JFHA 5C71A 4Q8WA 3LXBA 4XTDA 4AVOA 3L21A 1G7UA 2DT3A 1DOSA 3STGA 1IE7C 4OIFA 1UROA 3CV7A 4RK8A 3B0PA 1DPMA 4IMFA 2ZBTA 3FJNA 2E6FA 1BQCA 2P1FA 2C13A 4TVDA 4WCJA 2E67A 5GJMA 4AZ5A 4AYGA 4PC8A 2RUSA 4ZO6A 4HA1A 3TAOA 1HJUA 3WBXA 3L0KA 3E0FA 1MEHA 4US5D 5HNUA 4GYPA 3FDKA 4HSHA 1SR9A 4FF7A 1HVQA 1XS2A 2J7DA 1LQ0A 3CQHA 1HJQA 3TKFA 3MUZ1 3NQEA 4WOZA 2CWNA 1GZGA 1E4MM 1QDSA 4OUIA 2CLHA 1SU5A 3M6DA 4AIBA 3CIVA 2A21A 4PGLA 4IQJA 1J0IA 1EIBA 5FCZA 4KIRA 3KWSA 2PDIA 3GDTA 3NCOA 4AVFA 1DL3A 3ZVHB 4H3DA 1V79A 2HBVA 3MWAA 4NILA 3QZ6A 1J10A 4HCLA 3S1VA 1UUMA 3JVAA 3JU2A 5FAGA 3WLQA 2WSQA 1JZ7A 2Y88A 1I2OA 2UV8G 1B9ZA 4O1AA 1CLXA 4XZ9A 5D2YA 3ATYA 4DNHA 3W7CA 5CG7A 4K39A 1TIMA 1PX4A 3UG5A 1EX1A 3JS3A 3VX1A 4D9PA 1M6JA 1J9YA 3NM1A 1VS1A 1PEZA 3PHAA 1UUOA 1DXFA 2WVTA 1OFOA 1UOKA 3GBEA 3RK8A 1LYXA 1CB2A 5A94A 3GDRA 2EO7A 3W00A