3SY7A

Improved crystal structure of pseudomonas aeruginosa oprd
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
421
structure length
382
Chain Sequence
DAFVSDQAEAKGFIEDSSLDLLLRNYYFNRDDRVDWTQGFLTTYESGFTQGTVGFGVDAFGYLGLKLDGTDDYSRAGGAVKVRISKTMLKWGEMQPTAPVFAAGGSRLFPQTATGVQLQSSEFEGLDLEAGHFTEELYATYAGETAKSADFIGGRYAITDNLSASLYGAELEDIYRQYYLNSNYTIPLASDQSLGFDFNIYRTNDEGKAKAGDISNTTWSLAAAYTLDAHTFTLAYQKVHGDQPFDYIGFGGAGGDSIFLANSVQYSDFNGPGEKSWQARYDLNLASYGVPGLTFMVRYINGKDIDGTKMSDNNVGYKNYGYGEDGKHHETNLEAKYVVQSGPAKDLSFRIRQAWHRANADQGEGDQNEFRLIVDYPLSILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords Porin D
total genus 115
structure length 382
sequence length 421
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3sy7A01
1E54A 1GFPA 4GCPA 3VZUX 4D5UA 4GCSA 2O4VA 3PORA 3T20A 5JDPA 3HWBA 4JFBA 2XG6A 1HXUA 2Y0KA 3POXA 1BT9A 4RJWA 4BUMX 4D64A 4AUIA 2Y2XA 3NSGA 4FMSA 4GCQA 4LSHA 4FRTA 4LSEA 3VY8X 1H6S1 2XE2A 3WI5A 3FYXA 3T24A 4KRAA 1GFQA 2Y0HA 2FGQX 3EMNX 3PRNA 6PRNA 3O0EA 1GFMA 1OPFA 4FSOA 5PRNA 3UPGA 2J4UP 5FVNA 1HXTA 1GFNA 5DL7A 1HXXA 2PRNA 1PHOA 3VY9X 4KR4A 3SZVA 2XE5A 2ZFGA 2XE3A 3VZTX 4LSIA 4RJXA 3POQA 2FGRA 2ODJA 3HW9A 4FSPA 3VZWX 4C69X 4FT6A 3WI4A 4KR8A 2ZLDA 3SY7A 2Y0LA 2PORA 3SYBA 3UU2A 3SYSA 3POUA 1MPFA 2OMFA 7PRNA 1GFOA 1PRNA 5DL8A 4D65A 3A2SX 2J1NA 3K19A 8PRNA 2XE1A 3SY9A 3T0SA 1BH3A 1OSMA 3JTYA 5DL5A 2K4TA 4FOZA 5DL6A 3SZDA 2QTKA 4FRXA 4LSFA
chains in the Genus database with same CATH superfamily
1G90A 1E54A 1GFPA 4Z3TA 5AFUK 1ZHYA 4GCPA 4AYMC 3LK42 4C4VA 5ADXK 3VZUX 2KXPA 1ORMA 4PUXA 4FZLA 4D5UA 4FUVA 4GCSA 1ZHTA 2LFUA 2O4VA 3PORA 4K3BA 5AFUL 3PGSA 3T20A 2KC0A 5JDPA 1T16A 4AKRA 4PJ0O 3HWBA 1BXWA 2XMXA 4JFBA 2XG6A 1HXUA 3VE1A 2AXTO 2Y0KA 2R8AA 3DZMA 3LK3B 3POXA 4QQ1A 4AKMA 1BT9A 4O4UA 4RJWA 4UB8O 3UAQA 1QJPA 3KZIO 4BUMX 4D64A 3V8UA 5H2FO 4FZNA 2IWVA 2R89A 5B5EO 3AA6A 4B61A 2F1VA 4RLBA 4E1TA 2ERVA 3GP6A 2YPVA 4AUIA 2Y2XA 5D5DA 3AA7B 3NSGA 2R4NA 4FMSA 4GCQA 4LSHA 4FRTA 5E79O 3AA1A 2W80C 3LK2B 3A0HO 3PQUA 4FQEA 4LSEA 4O4XA 5KAFO 4AYEC 2WJQA 4N75A 4G75A 4AZLA 5IYUA 5B66O 3HOEA 2LHFA 3VY8X 3BRYA 5G38A 5GTIO 1H6S1 2XE2A 3G7GA 1QJ9A 3C5OA 3WI5A 2JQYA 1P4TA 3FYXA 5EE2A 3T24A 4C4VB 4KRAA 1GFQA 3AAEB 1S5LO 2Y0HA 4K3CA 2WJRA 4O49A 2FGQX 2MNHA 4E1SA 3AA7A 3EMNX 1YS5A 3PQSA 4IL6O 4C00A 3PRNA 6PRNA 5GV0A 2XTRA 1T1LA 1GFMA 1OPFA 2R4PA 2JMMA 3LK41 3O0EA 4JCHA 5T5FA 5G26A 2N2LA 2F1TA 4FSOA 5PRNA 3UPGA 3VE2A 5FVNA 2J4UP 1HXTA 2XTQA 3AA0A 2N2MA 2R4LA 1GFNA 1IZNB 4N74A 2KZ7B 4O3ZA 3PGRA 4AYDC 4AYID 5DL7A 1HXXA 2F1CX 2PRNA 3QRCA 1PHOA 3VY9X 4O3WA 4G76A 1ZHWA 4KR4A 3SZVA 2XE5A 2ZFGA 2XE3A 1IZNA 3AA1B 3VZTX 1Q9FA 1MM5A 4LSIA 4RJXA 3POQA 2FGRA 5ADXL 3DWNA 2ODJA 3HW9A 4FSPA 3VZWX 3HOLA 4N59A 4AYNA 2R88A 3PGUA 3WU2O 2M06A 4C69X 1THQA 4FZMA 4FT6A 3AAAB 3WI4A 5GTHO 4KR8A 2ZLDA 4O3XB 2KZ7A 3DWOX 2X27X 4PR7A 3A0BO 5TISO 2Y0LA 4N58A 2W81C 3NJTA 3RBHA 3SY7A 2KXPB 2PORA 1QJ8A 3TZGA 3AAEA 3SYBA 3UU2A 5G39A 5G3AA 4FESA 3POUA 4RLCA 4UB6O 1ZHXA 3SYSA 4U9CA 3PF1A 1MPFA 4RL9A 2OMFA 4AKRB 1GFOA 5KAIO 7PRNA 3DA3A 1PRNA 4XNLA 2R4OA 2YNKA 5DL8A 3AA6B 2GE4A 2KDYA 2MHLA 4GHBA 4D65A 3A2SX 2J1NA 3K19A 4F4BA 4XNKA 8PRNA 2IWWA 2XE1A 3LK3A 4GF4A 4AFKA 3AA0B 2Y7SA 3LK2A 2K0LA 3QRAA 1Q9GA 2WVPA 2M07A 3SY9A 3T0SA 1BH3A 1ZHZA 3BS0A 1OSMA 3JTYA 3BRZA 4O3YA 2K4TA 4FOZA 5DL5A 5DL6A 3KVDD 3SZDA 2QTKA 1MM4A 4FRXA 4CTDA 3DA4A 3AAAA 4LSFA 3JCUO 2X9KA
chains in the Genus database with same CATH topology
1G90A 1E54A 1GFPA 4Z3TA 5AFUK 1ZHYA 4GCPA 4AYMC 3LK42 5ADXK 3VZUX 2KXPA 1ORMA 4PUXA 4FZLA 4D5UA 4FUVA 4GCSA 1ZHTA 2LFUA 2O4VA 3PORA 5AFUL 3T20A 2KC0A 5JDPA 4AKRA 3HWBA 1BXWA 2XMXA 4JFBA 2XG6A 1HXUA 3VE1A 2Y0KA 3LK3B 3POXA 4QQ1A 4AKMA 1BT9A 4O4UA 4RJWA 3UAQA 1QJPA 4BUMX 4D64A 3V8UA 4FZNA 3AA6A 4B61A 2F1VA 4RLBA 4E1TA 2ERVA 3GP6A 2YPVA 4AUIA 2Y2XA 5D5DA 3AA7B 3NSGA 4FMSA 4GCQA 4LSHA 4FRTA 3AA1A 2W80C 3LK2B 3PQUA 4O4XA 4LSEA 4AYEC 4AZLA 5IYUA 4G75A 3HOEA 2LHFA 3VY8X 1H6S1 2XE2A 3G7GA 1QJ9A 3C5OA 3WI5A 1P4TA 3FYXA 5EE2A 3T24A 4KRAA 1GFQA 3AAEB 2Y0HA 4O49A 2FGQX 2MNHA 4E1SA 3AA7A 3EMNX 1YS5A 3PQSA 3PRNA 6PRNA 5GV0A 2XTRA 3O0EA 1GFMA 1OPFA 2JMMA 5T5FA 3LK41 4JCHA 5G26A 2N2LA 2F1TA 4FSOA 5PRNA 3UPGA 3VE2A 5FVNA 2J4UP 1HXTA 2XTQA 3AA0A 2N2MA 1GFNA 1IZNB 4O3ZA 2KZ7B 4AYDC 4AYID 5DL7A 1HXXA 2PRNA 3QRCA 1PHOA 3VY9X 4O3WA 4G76A 1ZHWA 4KR4A 3SZVA 2XE5A 2ZFGA 2XE3A 1IZNA 3AA1B 3VZTX 1Q9FA 1MM5A 4LSIA 4RJXA 3POQA 2FGRA 5ADXL 2ODJA 3HW9A 4FSPA 3VZWX 3HOLA 4N59A 4AYNA 4C69X 2M06A 1THQA 4FZMA 4FT6A 3AAAB 3WI4A 4KR8A 2ZLDA 4O3XB 2KZ7A 2X27X 3SY7A 2Y0LA 4N58A 2W81C 3RBHA 2KXPB 2PORA 1QJ8A 3TZGA 3AAEA 3SYBA 3UU2A 3SYSA 4FESA 3POUA 4RLCA 1ZHXA 4U9CA 4RL9A 1MPFA 2OMFA 4AKRB 1GFOA 7PRNA 3DA3A 1PRNA 4XNLA 2YNKA 5DL8A 3AA6B 2GE4A 2KDYA 2MHLA 4GHBA 4D65A 3A2SX 2J1NA 3K19A 4F4BA 4XNKA 8PRNA 2XE1A 3LK3A 4GF4A 4AFKA 3AA0B 2Y7SA 3LK2A 2K0LA 3QRAA 1Q9GA 3SY9A 2M07A 3T0SA 1BH3A 1ZHZA 1OSMA 3JTYA 4O3YA 5DL5A 2K4TA 4FOZA 5DL6A 3KVDD 3SZDA 2QTKA 1MM4A 4FRXA 3DA4A 3AAAA 4LSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E54 A;  1GFP A;  4GCP A;  3VZU X;  4D5U A;  4GCS A;  2O4V A;  3POR A;  3T20 A;  5JDP A;  3HWB A;  4JFB A;  2XG6 A;  1HXU A;  2Y0K A;  3POX A;  1BT9 A;  4RJW A;  4BUM X;  4D64 A;  4AUI A;  2Y2X A;  3NSG A;  4FMS A;  4GCQ A;  4LSH A;  4FRT A;  4LSE A;  3VY8 X;  1H6S 1;  2XE2 A;  3WI5 A;  3FYX A;  3T24 A;  4KRA A;  1GFQ A;  2Y0H A;  2FGQ X;  3EMN X;  3PRN A;  6PRN A;  3O0E A;  1GFM A;  1OPF A;  4FSO A;  5PRN A;  3UPG A;  2J4U P;  5FVN A;  1HXT A;  1GFN A;  5DL7 A;  1HXX A;  2PRN A;  1PHO A;  3VY9 X;  4KR4 A;  3SZV A;  2XE5 A;  2ZFG A;  2XE3 A;  3VZT X;  4LSI A;  4RJX A;  3POQ A;  2FGR A;  2ODJ A;  3HW9 A;  4FSP A;  3VZW X;  4C69 X;  4FT6 A;  3WI4 A;  4KR8 A;  2ZLD A;  3SY7 A;  2Y0L A;  2POR A;  3SYB A;  3UU2 A;  3SYS A;  3POU A;  1MPF A;  2OMF A;  7PRN A;  1GFO A;  1PRN A;  5DL8 A;  4D65 A;  3A2S X;  2J1N A;  3K19 A;  8PRN A;  2XE1 A;  3SY9 A;  3T0S A;  1BH3 A;  1OSM A;  3JTY A;  5DL5 A;  2K4T A;  4FOZ A;  5DL6 A;  3SZD A;  2QTK A;  4FRX A;  4LSF A; 
#chains in the Genus database with same CATH topology
 1G90 A;  1E54 A;  1GFP A;  4Z3T A;  5AFU K;  1ZHY A;  4GCP A;  4AYM C;  3LK4 2;  4C4V A;  5ADX K;  3VZU X;  2KXP A;  1ORM A;  4PUX A;  4FZL A;  4D5U A;  4FUV A;  4GCS A;  1ZHT A;  2LFU A;  2O4V A;  3POR A;  4K3B A;  5AFU L;  3PGS A;  3T20 A;  2KC0 A;  5JDP A;  1T16 A;  4AKR A;  4PJ0 O;  3HWB A;  1BXW A;  2XMX A;  4JFB A;  2XG6 A;  1HXU A;  3VE1 A;  2AXT O;  2Y0K A;  2R8A A;  3DZM A;  3LK3 B;  3POX A;  4QQ1 A;  4AKM A;  1BT9 A;  4O4U A;  4RJW A;  4UB8 O;  3UAQ A;  1QJP A;  3KZI O;  4BUM X;  4D64 A;  3V8U A;  5H2F O;  4FZN A;  2IWV A;  2R89 A;  5B5E O;  3AA6 A;  4B61 A;  2F1V A;  4RLB A;  4E1T A;  2ERV A;  3GP6 A;  2YPV A;  4AUI A;  2Y2X A;  5D5D A;  3AA7 B;  3NSG A;  2R4N A;  4FMS A;  4GCQ A;  4LSH A;  4FRT A;  5E79 O;  3AA1 A;  2W80 C;  3LK2 B;  3A0H O;  3PQU A;  4FQE A;  4LSE A;  4O4X A;  5KAF O;  4AYE C;  2WJQ A;  4N75 A;  4G75 A;  4AZL A;  5IYU A;  5B66 O;  3HOE A;  2LHF A;  3VY8 X;  3BRY A;  5G38 A;  5GTI O;  1H6S 1;  2XE2 A;  3G7G A;  1QJ9 A;  3C5O A;  3WI5 A;  2JQY A;  1P4T A;  3FYX A;  5EE2 A;  3T24 A;  4C4V B;  4KRA A;  1GFQ A;  3AAE B;  1S5L O;  2Y0H A;  4K3C A;  2WJR A;  4O49 A;  2FGQ X;  2MNH A;  4E1S A;  3AA7 A;  3EMN X;  1YS5 A;  3PQS A;  4IL6 O;  4C00 A;  3PRN A;  6PRN A;  5GV0 A;  2XTR A;  1T1L A;  1GFM A;  1OPF A;  2R4P A;  2JMM A;  3LK4 1;  3O0E A;  4JCH A;  5T5F A;  5G26 A;  2N2L A;  2F1T A;  4FSO A;  5PRN A;  3UPG A;  3VE2 A;  5FVN A;  2J4U P;  1HXT A;  2XTQ A;  3AA0 A;  2N2M A;  2R4L A;  1GFN A;  1IZN B;  4N74 A;  2KZ7 B;  4O3Z A;  3PGR A;  4AYD C;  4AYI D;  5DL7 A;  1HXX A;  2F1C X;  2PRN A;  3QRC A;  1PHO A;  3VY9 X;  4O3W A;  4G76 A;  1ZHW A;  4KR4 A;  3SZV A;  2XE5 A;  2ZFG A;  2XE3 A;  1IZN A;  3AA1 B;  3VZT X;  1Q9F A;  1MM5 A;  4LSI A;  4RJX A;  3POQ A;  2FGR A;  5ADX L;  3DWN A;  2ODJ A;  3HW9 A;  4FSP A;  3VZW X;  3HOL A;  4N59 A;  4AYN A;  2R88 A;  3PGU A;  3WU2 O;  2M06 A;  4C69 X;  1THQ A;  4FZM A;  4FT6 A;  3AAA B;  3WI4 A;  5GTH O;  4KR8 A;  2ZLD A;  4O3X B;  2KZ7 A;  3DWO X;  2X27 X;  4PR7 A;  3A0B O;  5TIS O;  2Y0L A;  4N58 A;  2W81 C;  3NJT A;  3RBH A;  3SY7 A;  2KXP B;  2POR A;  1QJ8 A;  3TZG A;  3AAE A;  3SYB A;  3UU2 A;  5G39 A;  5G3A A;  4FES A;  3POU A;  4RLC A;  4UB6 O;  1ZHX A;  3SYS A;  4U9C A;  3PF1 A;  1MPF A;  4RL9 A;  2OMF A;  4AKR B;  1GFO A;  5KAI O;  7PRN A;  3DA3 A;  1PRN A;  4XNL A;  2R4O A;  2YNK A;  5DL8 A;  3AA6 B;  2GE4 A;  2KDY A;  2MHL A;  4GHB A;  4D65 A;  3A2S X;  2J1N A;  3K19 A;  4F4B A;  4XNK A;  8PRN A;  2IWW A;  2XE1 A;  3LK3 A;  4GF4 A;  4AFK A;  3AA0 B;  2Y7S A;  3LK2 A;  2K0L A;  3QRA A;  1Q9G A;  2WVP A;  2M07 A;  3SY9 A;  3T0S A;  1BH3 A;  1ZHZ A;  3BS0 A;  1OSM A;  3JTY A;  3BRZ A;  4O3Y A;  2K4T A;  4FOZ A;  5DL5 A;  5DL6 A;  3KVD D;  3SZD A;  2QTK A;  1MM4 A;  4FRX A;  4CTD A;  3DA4 A;  3AAA A;  4LSF A;  3JCU O;  2X9K A; 
#chains in the Genus database with same CATH homology
 1G90 A;  1E54 A;  1GFP A;  4Z3T A;  5AFU K;  1ZHY A;  4GCP A;  4AYM C;  3LK4 2;  5ADX K;  3VZU X;  2KXP A;  1ORM A;  4PUX A;  4FZL A;  4D5U A;  4FUV A;  4GCS A;  1ZHT A;  2LFU A;  2O4V A;  3POR A;  5AFU L;  3T20 A;  2KC0 A;  5JDP A;  4AKR A;  3HWB A;  1BXW A;  2XMX A;  4JFB A;  2XG6 A;  1HXU A;  3VE1 A;  2Y0K A;  3LK3 B;  3POX A;  4QQ1 A;  4AKM A;  1BT9 A;  4O4U A;  4RJW A;  3UAQ A;  1QJP A;  4BUM X;  4D64 A;  3V8U A;  4FZN A;  3AA6 A;  4B61 A;  2F1V A;  4RLB A;  4E1T A;  2ERV A;  3GP6 A;  2YPV A;  4AUI A;  2Y2X A;  5D5D A;  3AA7 B;  3NSG A;  4FMS A;  4GCQ A;  4LSH A;  4FRT A;  3AA1 A;  2W80 C;  3LK2 B;  3PQU A;  4O4X A;  4LSE A;  4AYE C;  4AZL A;  5IYU A;  4G75 A;  3HOE A;  2LHF A;  3VY8 X;  1H6S 1;  2XE2 A;  3G7G A;  1QJ9 A;  3C5O A;  3WI5 A;  1P4T A;  3FYX A;  5EE2 A;  3T24 A;  4KRA A;  1GFQ A;  3AAE B;  2Y0H A;  4O49 A;  2FGQ X;  2MNH A;  4E1S A;  3AA7 A;  3EMN X;  1YS5 A;  3PQS A;  3PRN A;  6PRN A;  5GV0 A;  2XTR A;  3O0E A;  1GFM A;  1OPF A;  2JMM A;  5T5F A;  3LK4 1;  4JCH A;  5G26 A;  2N2L A;  2F1T A;  4FSO A;  5PRN A;  3UPG A;  3VE2 A;  5FVN A;  2J4U P;  1HXT A;  2XTQ A;  3AA0 A;  2N2M A;  1GFN A;  1IZN B;  4O3Z A;  2KZ7 B;  4AYD C;  4AYI D;  5DL7 A;  1HXX A;  2PRN A;  3QRC A;  1PHO A;  3VY9 X;  4O3W A;  4G76 A;  1ZHW A;  4KR4 A;  3SZV A;  2XE5 A;  2ZFG A;  2XE3 A;  1IZN A;  3AA1 B;  3VZT X;  1Q9F A;  1MM5 A;  4LSI A;  4RJX A;  3POQ A;  2FGR A;  5ADX L;  2ODJ A;  3HW9 A;  4FSP A;  3VZW X;  3HOL A;  4N59 A;  4AYN A;  4C69 X;  2M06 A;  1THQ A;  4FZM A;  4FT6 A;  3AAA B;  3WI4 A;  4KR8 A;  2ZLD A;  4O3X B;  2KZ7 A;  2X27 X;  3SY7 A;  2Y0L A;  4N58 A;  2W81 C;  3RBH A;  2KXP B;  2POR A;  1QJ8 A;  3TZG A;  3AAE A;  3SYB A;  3UU2 A;  3SYS A;  4FES A;  3POU A;  4RLC A;  1ZHX A;  4U9C A;  4RL9 A;  1MPF A;  2OMF A;  4AKR B;  1GFO A;  7PRN A;  3DA3 A;  1PRN A;  4XNL A;  2YNK A;  5DL8 A;  3AA6 B;  2GE4 A;  2KDY A;  2MHL A;  4GHB A;  4D65 A;  3A2S X;  2J1N A;  3K19 A;  4F4B A;  4XNK A;  8PRN A;  2XE1 A;  3LK3 A;  4GF4 A;  4AFK A;  3AA0 B;  2Y7S A;  3LK2 A;  2K0L A;  3QRA A;  1Q9G A;  3SY9 A;  2M07 A;  3T0S A;  1BH3 A;  1ZHZ A;  1OSM A;  3JTY A;  4O3Y A;  5DL5 A;  2K4T A;  4FOZ A;  5DL6 A;  3KVD D;  3SZD A;  2QTK A;  1MM4 A;  4FRX A;  3DA4 A;  3AAA A;  4LSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...