3SY7A

Improved crystal structure of pseudomonas aeruginosa oprd
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
421
structure length
382
Chain Sequence
b'DAFVSDQAEAKGFIEDSSLDLLLRNYYFNRDDRVDWTQGFLTTYESGFTQGTVGFGVDAFGYLGLKLDGTDDYSRAGGAVKVRISKTMLKWGEMQPTAPVFAAGGSRLFPQTATGVQLQSSEFEGLDLEAGHFTEELYATYAGETAKSADFIGGRYAITDNLSASLYGAELEDIYRQYYLNSNYTIPLASDQSLGFDFNIYRTNDEGKAKAGDISNTTWSLAAAYTLDAHTFTLAYQKVHGDQPFDYIGFGGAGGDSIFLANSVQYSDFNGPGEKSWQARYDLNLASYGVPGLTFMVRYINGKDIDGTKMSDNNVGYKNYGYGEDGKHHETNLEAKYVVQSGPAKDLSFRIRQAWHRANADQGEGDQNEFRLIVDYPLSILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porin D
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 115
structure length 382
sequence length 421
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3sy7A01
2FGQX 4LSHA 4C69X 7PRNA 5JDPA 3PRNA 2PRNA 3SZDA 2ZFGA 4BUMX 3K19A 4FSPA 3SYBA 3HW9A 4D65A 3VZTX 2Y0KA 2J1NA 4GCPA 3FYXA 4FT6A 3T20A 1GFNA 2Y2XA 2XG6A 3O0EA 4LSIA 1HXXA 4KRAA 3WI4A 2FGRA 3UU2A 2XE5A 1MPFA 3WI5A 3JTYA 3UPGA 5FVNA 3VY8X 1H6S1 2XE1A 4KR4A 4KR8A 4D5UA 2O4VA 2PORA 2K4TA 5DL6A 6PRNA 5DL7A 1PHOA 5DL8A 1OSMA 2OMFA 1GFMA 2ODJA 4FMSA 1GFQA 4LSEA 5PRNA 1BH3A 1GFPA 3A2SX 3SYSA 1PRNA 5DL5A 3VY9X 3HWBA 4FRTA 3SY7A 4LSFA 3SZVA 2J4UP 2QTKA 4RJWA 3NSGA 3SY9A 4GCQA 8PRNA 3POQA 3PORA 4GCSA 3VZUX 2Y0HA 3T24A 3T0SA 4D64A 2XE3A 4FSOA 3POXA 3POUA 1BT9A 1GFOA 4AUIA 1OPFA 3EMNX 1HXUA 4FOZA 4RJXA 2Y0LA 3VZWX 2XE2A 1E54A 4FRXA 1HXTA 2ZLDA 4JFBA
chains in the Genus database with same CATH superfamily
2JMMA 4FZMA 2FGQX 1ZHWA 5ADXK 3NJTA 5G3AA 4AFKA 4AKMA 4IL6O 3DA4A 2KC0A 3AA6A 3AA6B 3KZIO 4FUVA 4LSHA 4PR7A 3QRAA 4C69X 7PRNA 5JDPA 3PRNA 2PRNA 2YPVA 3SZDA 2ZFGA 4AKRA 1S5LO 1ZHXA 1P4TA 4AKRB 5B5EO 4BUMX 2W81C 2K0LA 2W80C 3JCUO 2KZ7A 3HW9A 2KZ7B 3K19A 3BRZA 3LK2A 3LK2B 3PGRA 4FESA 4PJ0O 3VZTX 4FZLA 4AYID 3DWOX 2AXTO 2Y0KA 5G38A 3AA1B 3PGSA 5KAFO 3LK3A 4RLBA 3LK3B 1QJ8A 2J1NA 3PF1A 5IYUA 4GF4A 4GCPA 3FYXA 3AA7A 2M07A 2YNKA 3AA7B 3HOEA 4FT6A 4K3BA 3T20A 1GFNA 2Y2XA 4N58A 2XG6A 3O0EA 4LSIA 4N75A 4AYMC 1HXXA 3AAAA 3AAAB 4KRAA 3A0BO 4K3CA 2F1CX 3VE2A 3SYBA 2LHFA 4O49A 3WI4A 2FGRA 2R4OA 1MM5A 3UU2A 2XE5A 1MPFA 3WI5A 4RL9A 2XTRA 3JTYA 2WVPA 5GTIO 4U9CA 3UPGA 5FVNA 3VY8X 3WU2O 3C5OA 1H6S1 2XE1A 3AAEA 3BS0A 3AAEB 5EE2A 1BXWA 4N74A 4B61A 4F4BA 1QJ9A 5H2FO 2N2LA 4KR4A 4XNKA 4UB6O 2R4LA 4FSPA 4FQEA 2XTQA 4KR8A 4D5UA 2O4VA 2WJQA 4Z3TA 2PORA 2K4TA 3QRCA 5DL6A 6PRNA 1THQA 5DL7A 2WJRA 1PHOA 5DL8A 4C00A 1OSMA 4AYDC 2KXPA 2ERVA 2KXPB 2OMFA 2XMXA 3DWNA 4E1SA 1GFMA 5GV0A 4G75A 2ODJA 4FMSA 1GFQA 3V8UA 2IWVA 3PQUA 5AFUK 2F1TA 4LSEA 2R4PA 4AYEC 1Q9FA 5PRNA 3KVDD 4D65A 3G7GA 4UB8O 1BH3A 1GFPA 3A2SX 4E1TA 2GE4A 4JCHA 4XNLA 4G76A 2R4NA 2MHLA 3SYSA 1T16A 1PRNA 3PQSA 5DL5A 3HWBA 5T5FA 3VY9X 5ADXL 2KDYA 4FRTA 5D5DA 2F1VA 3SY7A 3DZMA 4LSFA 3TZGA 3SZVA 4FZNA 2X27X 3LK42 2J4UP 4RLCA 2IWWA 1T1LA 1ZHTA 2N2MA 2QTKA 3NSGA 4GCQA 2Y7SA 4RJWA 3SY9A 2LFUA 8PRNA 2R89A 4O4XA 3POQA 2M06A 2R88A 1IZNA 3PORA 1IZNB 4GCSA 4O3YA 1MM4A 5G39A 3VZUX 2Y0HA 3T24A 1QJPA 3T0SA 3UAQA 4C4VA 2R8AA 4N59A 4C4VB 4D64A 2X9KA 2XE3A 4FSOA 4AYNA 4AZLA 5B66O 1YS5A 3GP6A 3POXA 3HOLA 5KAIO 3VE1A 3POUA 3A0HO 5TISO 4O3WA 3AA0A 1BT9A 3AA1A 3AA0B 4O3ZA 5AFUL 1Q9GA 1GFOA 4AUIA 1OPFA 1ZHYA 3PGUA 3EMNX 3DA3A 2JQYA 4O4UA 5E79O 1HXUA 1ZHZA 4FOZA 4RJXA 5GTHO 2Y0LA 4CTDA 4O3XB 4PUXA 3RBHA 1ORMA 2MNHA 2XE2A 3VZWX 4QQ1A 3BRYA 1G90A 1E54A 4FRXA 1HXTA 2ZLDA 4GHBA 3LK41 4JFBA 5G26A
chains in the Genus database with same CATH topology
2JMMA 4FZMA 2FGQX 1ZHWA 5ADXK 4AFKA 4AKMA 4E1TA 3DA4A 2KC0A 3AA6A 3AA6B 4FUVA 4LSHA 3QRAA 4C69X 7PRNA 5JDPA 3PRNA 2PRNA 2YPVA 3SZDA 2ZFGA 4AKRA 1ZHXA 1P4TA 4AKRB 4BUMX 2W81C 2K0LA 2W80C 3K19A 2KZ7A 3HW9A 2KZ7B 4FESA 3LK2A 4FSPA 3LK2B 3SYBA 4AYID 3VZTX 4D65A 4FZLA 2Y0KA 3AA1B 3LK3A 4RLBA 3LK3B 1QJ8A 2J1NA 5IYUA 4GF4A 4GCPA 3FYXA 3AA7A 2M07A 2YNKA 3AA7B 3HOEA 4FT6A 3T20A 1GFNA 2Y2XA 4N58A 2XG6A 3O0EA 4LSIA 4AYMC 1HXXA 3AAAA 3AAAB 4KRAA 3VE2A 3WI4A 2LHFA 4O49A 2FGRA 1MM5A 3UU2A 2XE5A 1MPFA 3WI5A 4RL9A 2XTRA 3JTYA 3UPGA 4U9CA 5FVNA 3VY8X 3C5OA 1H6S1 2XE1A 3AAEA 5EE2A 3AAEB 4B61A 1BXWA 4F4BA 1QJ9A 2N2LA 4KR4A 4XNKA 2XTQA 4KR8A 4D5UA 2O4VA 4Z3TA 2PORA 2K4TA 3QRCA 5DL6A 6PRNA 1THQA 5DL7A 1PHOA 5DL8A 1OSMA 4AYDC 2KXPA 2ERVA 2KXPB 2OMFA 2XMXA 4E1SA 1GFMA 5GV0A 4G75A 2ODJA 4FMSA 1GFQA 3V8UA 5AFUK 3PQUA 2F1TA 4LSEA 4AYEC 1Q9FA 5PRNA 3KVDD 3G7GA 1BH3A 1GFPA 3A2SX 2GE4A 4JCHA 4XNLA 4G76A 2MHLA 3SYSA 1PRNA 3PQSA 5DL5A 3HWBA 5T5FA 3VY9X 5ADXL 2KDYA 4FRTA 5D5DA 2F1VA 3SY7A 3TZGA 4LSFA 3SZVA 4FZNA 2X27X 3LK42 2J4UP 4RLCA 2N2MA 1ZHTA 2QTKA 3NSGA 4GCQA 4RJWA 2Y7SA 3SY9A 8PRNA 2LFUA 4O4XA 3POQA 2M06A 1IZNA 3PORA 1IZNB 4GCSA 4O3YA 1MM4A 3VZUX 2Y0HA 3T24A 1QJPA 3T0SA 3UAQA 4D64A 4N59A 2XE3A 4FSOA 4AYNA 4AZLA 1YS5A 3GP6A 3POXA 3HOLA 3VE1A 3POUA 4O3WA 3AA0A 1BT9A 3AA1A 3AA0B 4O3ZA 5AFUL 1Q9GA 1GFOA 4AUIA 1OPFA 1ZHYA 4O4UA 3EMNX 3DA3A 1HXUA 1ZHZA 4FOZA 4RJXA 2Y0LA 4O3XB 4PUXA 3RBHA 1ORMA 2MNHA 2XE2A 3VZWX 4QQ1A 1G90A 1E54A 4FRXA 1HXTA 2ZLDA 4GHBA 3LK41 4JFBA 5G26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FGQ X;  4LSH A;  4C69 X;  7PRN A;  5JDP A;  3PRN A;  2PRN A;  3SZD A;  2ZFG A;  4BUM X;  3K19 A;  4FSP A;  3SYB A;  3HW9 A;  4D65 A;  3VZT X;  2Y0K A;  2J1N A;  4GCP A;  3FYX A;  4FT6 A;  3T20 A;  1GFN A;  2Y2X A;  2XG6 A;  3O0E A;  4LSI A;  1HXX A;  4KRA A;  3WI4 A;  2FGR A;  3UU2 A;  2XE5 A;  1MPF A;  3WI5 A;  3JTY A;  3UPG A;  5FVN A;  3VY8 X;  1H6S 1;  2XE1 A;  4KR4 A;  4KR8 A;  4D5U A;  2O4V A;  2POR A;  2K4T A;  5DL6 A;  6PRN A;  5DL7 A;  1PHO A;  5DL8 A;  1OSM A;  2OMF A;  1GFM A;  2ODJ A;  4FMS A;  1GFQ A;  4LSE A;  5PRN A;  1BH3 A;  1GFP A;  3A2S X;  3SYS A;  1PRN A;  5DL5 A;  3VY9 X;  3HWB A;  4FRT A;  3SY7 A;  4LSF A;  3SZV A;  2J4U P;  2QTK A;  4RJW A;  3NSG A;  3SY9 A;  4GCQ A;  8PRN A;  3POQ A;  3POR A;  4GCS A;  3VZU X;  2Y0H A;  3T24 A;  3T0S A;  4D64 A;  2XE3 A;  4FSO A;  3POX A;  3POU A;  1BT9 A;  1GFO A;  4AUI A;  1OPF A;  3EMN X;  1HXU A;  4FOZ A;  4RJX A;  2Y0L A;  3VZW X;  2XE2 A;  1E54 A;  4FRX A;  1HXT A;  2ZLD A;  4JFB A; 
#chains in the Genus database with same CATH topology
 2JMM A;  4FZM A;  2FGQ X;  1ZHW A;  5ADX K;  3NJT A;  5G3A A;  4AFK A;  4AKM A;  4IL6 O;  3DA4 A;  2KC0 A;  3AA6 A;  3AA6 B;  3KZI O;  4FUV A;  4LSH A;  4PR7 A;  3QRA A;  4C69 X;  7PRN A;  5JDP A;  3PRN A;  2PRN A;  2YPV A;  3SZD A;  2ZFG A;  4AKR A;  1S5L O;  1ZHX A;  1P4T A;  4AKR B;  5B5E O;  4BUM X;  2W81 C;  2K0L A;  2W80 C;  3JCU O;  2KZ7 A;  3HW9 A;  2KZ7 B;  3K19 A;  3BRZ A;  3LK2 A;  3LK2 B;  3PGR A;  4FES A;  4PJ0 O;  3VZT X;  4FZL A;  4AYI D;  3DWO X;  2AXT O;  2Y0K A;  5G38 A;  3AA1 B;  3PGS A;  5KAF O;  3LK3 A;  4RLB A;  3LK3 B;  1QJ8 A;  2J1N A;  3PF1 A;  5IYU A;  4GF4 A;  4GCP A;  3FYX A;  3AA7 A;  2M07 A;  2YNK A;  3AA7 B;  3HOE A;  4FT6 A;  4K3B A;  3T20 A;  1GFN A;  2Y2X A;  4N58 A;  2XG6 A;  3O0E A;  4LSI A;  4N75 A;  4AYM C;  1HXX A;  3AAA A;  3AAA B;  4KRA A;  3A0B O;  4K3C A;  2F1C X;  3VE2 A;  3SYB A;  2LHF A;  4O49 A;  3WI4 A;  2FGR A;  2R4O A;  1MM5 A;  3UU2 A;  2XE5 A;  1MPF A;  3WI5 A;  4RL9 A;  2XTR A;  3JTY A;  2WVP A;  5GTI O;  4U9C A;  3UPG A;  5FVN A;  3VY8 X;  3WU2 O;  3C5O A;  1H6S 1;  2XE1 A;  3AAE A;  3BS0 A;  3AAE B;  5EE2 A;  1BXW A;  4N74 A;  4B61 A;  4F4B A;  1QJ9 A;  5H2F O;  2N2L A;  4KR4 A;  4XNK A;  4UB6 O;  2R4L A;  4FSP A;  4FQE A;  2XTQ A;  4KR8 A;  4D5U A;  2O4V A;  2WJQ A;  4Z3T A;  2POR A;  2K4T A;  3QRC A;  5DL6 A;  6PRN A;  1THQ A;  5DL7 A;  2WJR A;  1PHO A;  5DL8 A;  4C00 A;  1OSM A;  4AYD C;  2KXP A;  2ERV A;  2KXP B;  2OMF A;  2XMX A;  3DWN A;  4E1S A;  1GFM A;  5GV0 A;  4G75 A;  2ODJ A;  4FMS A;  1GFQ A;  3V8U A;  2IWV A;  3PQU A;  5AFU K;  2F1T A;  4LSE A;  2R4P A;  4AYE C;  1Q9F A;  5PRN A;  3KVD D;  4D65 A;  3G7G A;  4UB8 O;  1BH3 A;  1GFP A;  3A2S X;  4E1T A;  2GE4 A;  4JCH A;  4XNL A;  4G76 A;  2R4N A;  2MHL A;  3SYS A;  1T16 A;  1PRN A;  3PQS A;  5DL5 A;  3HWB A;  5T5F A;  3VY9 X;  5ADX L;  2KDY A;  4FRT A;  5D5D A;  2F1V A;  3SY7 A;  3DZM A;  4LSF A;  3TZG A;  3SZV A;  4FZN A;  2X27 X;  3LK4 2;  2J4U P;  4RLC A;  2IWW A;  1T1L A;  1ZHT A;  2N2M A;  2QTK A;  3NSG A;  4GCQ A;  2Y7S A;  4RJW A;  3SY9 A;  2LFU A;  8PRN A;  2R89 A;  4O4X A;  3POQ A;  2M06 A;  2R88 A;  1IZN A;  3POR A;  1IZN B;  4GCS A;  4O3Y A;  1MM4 A;  5G39 A;  3VZU X;  2Y0H A;  3T24 A;  1QJP A;  3T0S A;  3UAQ A;  4C4V A;  2R8A A;  4N59 A;  4C4V B;  4D64 A;  2X9K A;  2XE3 A;  4FSO A;  4AYN A;  4AZL A;  5B66 O;  1YS5 A;  3GP6 A;  3POX A;  3HOL A;  5KAI O;  3VE1 A;  3POU A;  3A0H O;  5TIS O;  4O3W A;  3AA0 A;  1BT9 A;  3AA1 A;  3AA0 B;  4O3Z A;  5AFU L;  1Q9G A;  1GFO A;  4AUI A;  1OPF A;  1ZHY A;  3PGU A;  3EMN X;  3DA3 A;  2JQY A;  4O4U A;  5E79 O;  1HXU A;  1ZHZ A;  4FOZ A;  4RJX A;  5GTH O;  2Y0L A;  4CTD A;  4O3X B;  4PUX A;  3RBH A;  1ORM A;  2MNH A;  2XE2 A;  3VZW X;  4QQ1 A;  3BRY A;  1G90 A;  1E54 A;  4FRX A;  1HXT A;  2ZLD A;  4GHB A;  3LK4 1;  4JFB A;  5G26 A; 
#chains in the Genus database with same CATH homology
 2JMM A;  4FZM A;  2FGQ X;  1ZHW A;  5ADX K;  4AFK A;  4AKM A;  4E1T A;  3DA4 A;  2KC0 A;  3AA6 A;  3AA6 B;  4FUV A;  4LSH A;  3QRA A;  4C69 X;  7PRN A;  5JDP A;  3PRN A;  2PRN A;  2YPV A;  3SZD A;  2ZFG A;  4AKR A;  1ZHX A;  1P4T A;  4AKR B;  4BUM X;  2W81 C;  2K0L A;  2W80 C;  3K19 A;  2KZ7 A;  3HW9 A;  2KZ7 B;  4FES A;  3LK2 A;  4FSP A;  3LK2 B;  3SYB A;  4AYI D;  3VZT X;  4D65 A;  4FZL A;  2Y0K A;  3AA1 B;  3LK3 A;  4RLB A;  3LK3 B;  1QJ8 A;  2J1N A;  5IYU A;  4GF4 A;  4GCP A;  3FYX A;  3AA7 A;  2M07 A;  2YNK A;  3AA7 B;  3HOE A;  4FT6 A;  3T20 A;  1GFN A;  2Y2X A;  4N58 A;  2XG6 A;  3O0E A;  4LSI A;  4AYM C;  1HXX A;  3AAA A;  3AAA B;  4KRA A;  3VE2 A;  3WI4 A;  2LHF A;  4O49 A;  2FGR A;  1MM5 A;  3UU2 A;  2XE5 A;  1MPF A;  3WI5 A;  4RL9 A;  2XTR A;  3JTY A;  3UPG A;  4U9C A;  5FVN A;  3VY8 X;  3C5O A;  1H6S 1;  2XE1 A;  3AAE A;  5EE2 A;  3AAE B;  4B61 A;  1BXW A;  4F4B A;  1QJ9 A;  2N2L A;  4KR4 A;  4XNK A;  2XTQ A;  4KR8 A;  4D5U A;  2O4V A;  4Z3T A;  2POR A;  2K4T A;  3QRC A;  5DL6 A;  6PRN A;  1THQ A;  5DL7 A;  1PHO A;  5DL8 A;  1OSM A;  4AYD C;  2KXP A;  2ERV A;  2KXP B;  2OMF A;  2XMX A;  4E1S A;  1GFM A;  5GV0 A;  4G75 A;  2ODJ A;  4FMS A;  1GFQ A;  3V8U A;  5AFU K;  3PQU A;  2F1T A;  4LSE A;  4AYE C;  1Q9F A;  5PRN A;  3KVD D;  3G7G A;  1BH3 A;  1GFP A;  3A2S X;  2GE4 A;  4JCH A;  4XNL A;  4G76 A;  2MHL A;  3SYS A;  1PRN A;  3PQS A;  5DL5 A;  3HWB A;  5T5F A;  3VY9 X;  5ADX L;  2KDY A;  4FRT A;  5D5D A;  2F1V A;  3SY7 A;  3TZG A;  4LSF A;  3SZV A;  4FZN A;  2X27 X;  3LK4 2;  2J4U P;  4RLC A;  2N2M A;  1ZHT A;  2QTK A;  3NSG A;  4GCQ A;  4RJW A;  2Y7S A;  3SY9 A;  8PRN A;  2LFU A;  4O4X A;  3POQ A;  2M06 A;  1IZN A;  3POR A;  1IZN B;  4GCS A;  4O3Y A;  1MM4 A;  3VZU X;  2Y0H A;  3T24 A;  1QJP A;  3T0S A;  3UAQ A;  4D64 A;  4N59 A;  2XE3 A;  4FSO A;  4AYN A;  4AZL A;  1YS5 A;  3GP6 A;  3POX A;  3HOL A;  3VE1 A;  3POU A;  4O3W A;  3AA0 A;  1BT9 A;  3AA1 A;  3AA0 B;  4O3Z A;  5AFU L;  1Q9G A;  1GFO A;  4AUI A;  1OPF A;  1ZHY A;  4O4U A;  3EMN X;  3DA3 A;  1HXU A;  1ZHZ A;  4FOZ A;  4RJX A;  2Y0L A;  4O3X B;  4PUX A;  3RBH A;  1ORM A;  2MNH A;  2XE2 A;  3VZW X;  4QQ1 A;  1G90 A;  1E54 A;  4FRX A;  1HXT A;  2ZLD A;  4GHB A;  3LK4 1;  4JFB A;  5G26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...