3SYNA

Crystal structure of flhf in complex with its activator
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
258
structure length
258
Chain Sequence
PEPLRKAEKLLQETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVLFGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYRIAAVEQLKTYAELLQAPLEVCYTKEEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGFVRMLCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar biosynthesis protein flhF
publication title Structural basis for the molecular evolution of SRP-GTPase activation by protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Protein transport
total genus 92
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3synA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3synA02
1WF3A 5BQ5A 4TMKA 4A8JA 1QHHA 3EZ7A 3LX5A 4FMDF 4BQSA 4MYUA 1W47A 1T4GA 3MFYA 4PC7A 1FMJA 2ZSEA 3BH6A 3I73A 1TQ2A 5DH9A 1L7VC 2OBMA 1E9AA 2D7DA 2D3WA 3ECCA 5GJWC 1VHTA 2G9NA 3A8TA 4LJ9A 4KSBA 3TR5A 3RS2A 4C0KA 4BFSA 2O0HA 1P2VA 4DIEA 4HAZA 1N0UA 2GDJA 1E9FA 2J7PD 1NJGA 2GCOB 2XXAA 2YOHA 1E79D 4PSKA 1OFUX 1WDTA 4DIDA 1UEIA 2CCGA 1Z6YA 2ZAMA 3DZDA 3U3JA 1F48A 1MO3A 3C8UA 4D82A 2PJZA 4NP6A 2J0VA 1TMKA 2GCNA 4WBSA 3B60A 2XOKA 2FF7A 3GQBA 4TSFA 4TL9A 1AQUA 3RWMB 3EG5A 2D2FA 2LKDA 3O8BA 1M7GA 1TU4A 3B6EA 3GLIB 4CEJA 5BN4A 3K09C 4DSOA 1O3YA 4NCKA 3RAPR 5G53C 3F5FA 1F60A 1M74A 2W6IA 3IILA 4ZKEA 4B71A 4GMXA 1S8FA 1CJVC 1HYQA 1T91A 4DC9A 2NO0A 3FWYA 3A1UA 4RZ3A 5CIWA 4X8LA 4GSYA 2HYIC 2KBFA 1RIFA 4DDVA 1N0VC 1KKMA 4BWYA 2C2HA 4PQRA 3I5XA 3GLGE 2X1VA 3SZRA 1XMVA 2QY9A 3F3YA 3MWYW 2GWHA 1ZCBA 3NEYA 4RD3A 1DBSA 4BZQA 1YZTA 4HAWA 4AYTA 3OEED 1NY5A 1JAHA 1XJQA 4TTPA 1D2NA 1E98A 4Q66C 1SULA 1P2TA 2ZUDA 5AK0A 4RCYA 3QEOA 1OF1A 5JSZA 3T12A 5E7JA 3VKWA 1OHHA 1DE0A 2ZETA 1MOZA 1XTJA 5JWOA 2ZE5A 4N3NA 2O8EA 2BJVA 2JJ1D 4NU0A 2O52A 1XCPA 3B85A 3BB4A 1QHGA 4FMCB 3DEFA 1FOEB 2MSEB 1FUKA 3B13B 4W5HA 1A82A 2AR7A 2J9RA 3LBHA 3ZLJA 3I8SA 3OHMA 1N5LA 1G6HA 1XF9A 2JIZD 2YC2C 3QXHA 4CEHA 1TEXA 4XIGS 4XVRA 5JHGB 2FJUA 4II7A 2ZS9A 4QC2A 2R6AA 1SQ5A 4DCNA 3PR1A 4PHTA 4D25A 3AKDA 1VCOA 2RGAA 1CU1A 1U90A 1QHSA 1KDRA 2Q9CA 4MRPA 1IHUA 2WIAA 3I5YA 1KMHA 1RRFA 2H16A 4LPKA 4F4JA 5LBIA 2CCJA 1XD2A 4KITB 2QRNA 1QG4A 5CK5A 1ZM4A 1J70A 2Z4RA 3IPYA 4LC1A 3DPUA 4UNPA 4B3DA 1GKYA 4YMSA 2ZROA 2IUTA 3T61A 3M0EA 5TB5A 2F3RA 1E4VA 4DSTA 4ZIRB 4TMTA 4FI3C 1PUIA 1XMIA 1KI3A 4HLCA 3AP3A 4ON9A 2TMKA 3MMPA 4QBFA 1V43A 1YZGA 2GVDC 3QKSB 3THXA 1NSFA 1Z2CA 2P65A 3FHCB 1DAMA 2WWHA 1PUJA 4DLUA 3CPHA 2F9MA 2I4IA 2R9VA 2WKRA 5IK2A 2OV2A 5J4VA 3TW8B 4ZCLA 3EA0A 3HR8A 3QIAA 3B9PA 2DB3A 5JRZA 1X6VA 4EQ6A 8OHMA 4Q18A 3SE0A 1D9XA 1XEWX 3VR6A 4PC6A 5TV2A 4IOMA 4JJKA 2HYDA 4M9XA 1E2DA 4JLJA 3I3SR 4BLOA 1JAIA 2CVFA 1EG7A 2PZEA 2EW1A 2OT3B 3LBNA 3UATA 4FWTA 3TBKA 3L0IB 1IQPA 1Z0JA 5DHFA 4I1UA 3QXSA 2Q0HA 4TYWA 2QQEA 2UZ3A 4X8MA 3CLVA 4C2UA 1O87A 4EPVA 4OQFA 1E96A 3SYNA 2QL6A 3RRNA 5CDFE 3TAHA 3MLEA 4YXWA 1P72A 1UAAA 1RYHA 2J87A 4FMBB 2ZRJA 1US8A 1VDZA 3LD9A 1II8A 2VPPA 4PQFA 5DISB 4A0RA 1IN7A 4QJ3A 4D26A 4M22A 4OK3A 4TN1A 5KPJA 3IEVA 3QKUA 1YR6A 1P5ZB 1KO1A 1DG1G 2ZRNA 5L3QB 3WHLA 1EFCA 3IBYA 3GLGB 5FBWB 1KK3A 4DCVA 2OLJA 2BBWA 5A5GA 3PEWA 1DAGA 1Z28A 1AKEA 4B34A 3RDPA 1PV4A 2C95A 4JZKA 5GJCA 1ZAKA 2FFBA 2A30A 3TUJC 5G3ZA 3QNUA 3V4RA 1C4OA 2VYFA 5D3MA 1AZSC 3KKOA 3U4QA 3WYGA 3N2EA 4KFSA 1T5LA 3U7FB 3C4JA 2FPMA 4Q03A 4QKQA 1OYYA 3A37A 3IIJA 3MCAA 1XD8A 4MH0R 5LD2C 4UNNA 4W9MC 3D8BA 2QE7A 1NSTA 5KNCA 4FCWA 2BCGY 4GDFA 1WBBA 4M1SA 3VR1A 3F8TA 3GJXC 4NPHA 4HUQB 1E9RA 1DOAA 2QRZA 4MQBA 4TZ6A 3SYKA 4FCVA 2OUKA 1H65A 4HB2A 2H57A 2Q3HA 3QVUA 1N6RA 1P75A 4Q9LA 4Q9JA 2ATVA 3B1XA 4TL7A 3MSXA 2VHCA 1KO7A 4DKXA 821PA 3LQRA 2J45A 2VP0A 1E2QA 5JFGA 1ZNYA 2E87A 4BFWA 4AY2A 1OT3A 1OXTA 1IY2A 2BKUA 2IXFA 4AURA 4TYYA 1NVVR 5DE3A 3UIEA 3O47A 4M0LA 5KSPA 2QI9C 3ZZUA 1DG3A 3QPUA 1P9RA 1EX7A 1ZNWA 3PCRB 3SS8A 2WHXA 1E9BA 4NYMR 2HLDD 2WVJA 4EPYA 1OB2A 3CONA 3NBYC 2OZEA 3LV8A 4KU4A 4NTZA 5JS8A 5L8VA 3B82A 4IXNA 5GJVC 2ZRFA 3LNCA 3NBZC 4DVGA 3IQWA 1PVOA 3KXKA 2CE2X 5AJYA 5LB4A 1PZNA 1UKEA 1XJCA 4EIWA 2JLXA 3NTUA 2IC5A 1W4RA 2ZJOA 4KJZA 3ADDA 4PAQA 1OH8A 4JVMA 4NL4H 2P0EA 3AM1A 4RZUA 1IM2A 2YC4C 4LC0A 3BB1A 4NYMQ 1L4YA 3NH9A 2Q3FA 4E07A 1TADA 3FTQA 3KTAB 1Z6GA 3CRRA 1GRRA 2NO1A 4AKHA 1TQ4A 5FL7D 2WWIA 3DM5A 1YZUA 2QORA 3DMDA 2QBYA 3L8YA 1SXJB 2DWQA 2J0QA 2VSXA 2FZ4A 4B76A 4R2HA 2OCBA 4D4MA 1A1VA 3MD0A 3QKTA 3U44B 5BW8A 4L8GA 2O8DA 1GSIA 3T1VA 4DWJA 1TF5A 2IHYA 4CGZA 2ZRAA 2ZRMA 1KI4A 3PUZA 4IFEA 3EIQA 5JI2E 4EPTA 1W36D 1E1RA 5FFMA 5JBQA 1XCGB 3DDCA 3HPQA 1U8ZA 1BMFD 2JLZA 3K9HA 3BK7A 5KOYA 2YWFA 3ETLA 3WNBA 2FEMA 1GKUB 2IXEA 2ZJ8A 4PQYA 2OXCA 3R9IA 4ASUD 1S2MA 2G77B 3R7WB 1DAKA 4Z8XA 2V8OA 1OJLA 5EXXA 1NN5A 1CJUC 5KHOC 2DYKA 1XBTA 1LB1B 4GRAA 4RD0A 3RWOA 5HTKA 4OHXA 4Q7LA 3EARA 4M1OA 2GKSA 5JI3E 4A9AA 1P62B 3KJHA 3ICQB 3A58B 2FMXA 1IXZA 3TGPA 4LJ5A 4HLDA 1C1YA 2N42A 1GUAA 3I8XA 2Z0MA 3QXJA 3PFIA 1MABA 3KDSE 2OFXA 5TVKA 1G5RA 4D4KA 3G0HA 3RLFA 2A5JA 2H92A 2YKGA 1IY0A 3AGQA 4NYJR 3ADCA 2J59A 2FA9A 1OW3B 2YHSA 1M1YE 4WAUA 4LYHA 2EFGA 4UJ5A 2C9OA 1YJ5A 3WXMA 3FMPB 4MUAA 5J40A 3EZ2A 4G0NA 2FX3A 4FN5A 1VCNA 4ACAA 2WV9A 2BJWA 3OEHA 4PC1A 3KL4A 1VPLA 4JVSB 4QNRA 4RKEA 4C0LA 4CEIB 5FTLA 4PAMA 4JKYA 4IDQA 4OQMA 3KQUA 3L43A 4A92A 2IWRA 1ZM7A 4KVGA 5GVRA 2OAP1 4QHYA 2V7QD 3C15C 4G5OA 3AKYA 3VNVA 3AVPA 4TQUS 4PR0A 1GFIA 1T9HA 3T1OA 1EFRD 2YOFA 5FL3A 3M6AA 4EDHA 4KBGA 4M9SA 1T8TA 4B73A 4JYCA 3L82B 2WIBA 3T5DA 1QRAA 1KMQA 2ZVQX 4W7SA 3BJIC 1CF4A 4ZV4A 1FL9A 3AH8A 4QXAA 1YQTA 4WIAA 5K8UA 1E9EA 2WSMA 3PUVA 2JLYA 4DT1A 4IVPA 5EZ5A 4YMUA 1OH6A 5F9FA 4HAUA 3WMGA 3CZPA 3T1TA 4TTQA 3I92A 4JL6A 5DN6A 1U2RA 4C30A 1UJ2A 2JAQA 4FW9A 4P4SB 5DHAA 3VR3A 5E7MA 1G3UA 3AF2A 3IBGA 4IFBA 1VG0B 2AL7A 2FFAA 4LJAA 2Z83A 3EIEA 2DR3A 4MKFA 1RRPA 4XD7A 3VR2A 4XVUA 3U7GA 2DFTA 2F1RA 3MWJA 5CITA 3IQXA 4A8JB 1QHHB 2I1QA 1ZBDA 2W2TA 4JLKA 1QDEA 5JEEA 2PH1A 3FMOB 4M1KA 3RHFA 4UNQA 5AJZA 2W0SA 1H8HA 2ZI4A 3I62A 1YR8A 2ZSDA 4M1YA 5EP3A 4B6EA 3U3RA 3DL0A 1JECA 3B2EA 2JA1A 2OFOA 4JKIA 3KQNA 2Y8EA 1DPFA 4KYUA 4B6FA 5EZ6B 2QPTA 4A6PA 1U0LA 1W44A 5HCNA 2OE2A 3CUEF 3CPEA 4UNRA 3NVAA 4KSCA 2XZLA 1ELOA 2W58A 5JWHA 2OXRA 3Q3JB 4B3CA 2XXAB 3GEIA 1UEJA 1FUUA 4MGKR 1DARA 2D74A 1KI2A 2AKAB 3QPWA 2ZRHA 1DAEA 3I4LA 5SZIA 1CR2A 3PIRA 3UMFA 2Q9BA 2GXQA 1W1WA 1W4BA 5IDVA 3KXIA 2ZUBA 5CIQA 2O0KA 5BXQC 4D0LB 1HTWA 2GAAA 2R62A 1P9NA 4Z1MA 2P6UA 3X1DA 1WA5A 3BH0A 1KOFA 3V4FA 4CEJB 1G9XA 1B0UA 5CK4A 4GOXA 2HT1A 1RKBA 4HAXA 3T35A 4FMCF 1NL3A 5TMPA 121PA 1ZD1A 4L15A 1WXQA 2NIPA 1FNNA 1Z3IX 1W0JA 3FE2A 2PT5A 5FPHA 5CYOA 3TIFA 1W49A 2VHQA 4RD6A 4GL2A 3LW7A 4S35A 2GZHA 3BIFA 2GEVA 3SYLA 4JJZA 1E2MA 1G5PA 1RJ9A 2CCKA 2EFDB 1SVOA 2FSHA 2VHJA 3ZS9A 4U7DA 2AFIE 4C0AC 1NBMD 4EPWA 2AWNA 5H8WA 1GL7A 2HV8A 2WPDA 2Z6VA 4NMMA 5EP2A 2IWHA 2NO9A 4RZ2A 1P6XA 1DAHA 5JSZB 3HYTA 3VX4A 2FFQA 1XTRA 5LD2B 2O8EB 2IEYA 3OE7D 4Q21A 2NOAA 5C4MA 1UF9A 3U2QA 1Q12A 1HEIA 4G5QA 1FZQA 4R71A 2J46A 4DSNA 3SFVA 2XZPA 4KAXA 4MYCA 5FOTA 1UBGA 2ZXUA 5JS7A 5KNBA 2J0UA 4NYIQ 4M2LA 5B30A 4MDEA 2ZI7A 3A4LA 4DEYA 1IN8A 3C16C 3T06B 2NGRA 4IDHA 1KZGB 5K8IA 5DO9A 2OSBA 4Q1FA 3P26A 3AF1A 3QBVA 2WTUA 2KE5A 1RRCA 2PEYA 1DADA 3DOFA 4PHGA 1BO6A 1A2KC 3B1WA 2IF2A 3FB4A 2Q21A 2IXGA 3KUDA 3HPRA 6Q21A 2PX3A 2FPLA 3TE6A 2YNMA 1CIPA 3CRMA 2BBSA 2GILA 1U9IA 4RFSB 3NIBA 5L3RA 1ZC4A 5E3HA 4U5XA 1XD2B 2V6IA 5AJVB 3K1JA 2ODNA 1ZUHA 2CHQA 3K9LA 4A0HA 2P6RA 4QOSA 3THYA 2CLDX 1MV5A 3GFOA 2NTYC 1AZTA 1LF5A 4GI7A 4LHVA 4HYYA 4LUCA 2YVUA 3OFND 4QGAA 1KI6A 4TL6A 1M8PA 1KGDA 3K0EA 1T0JB 4P33A 2WMNB 3NDPA 1G291 1E0KA 2WMOB 4B35A 4LYJA 5JMTA 1KO4A 4PO8A 3J81k 3QI2A 2Q9AA 2RMKA 4WZAE 4BLPA 5M04A 5CB8A 2FSFA 3THXB 3NH6A 1W46A 4LV5B 2IS4A 3B1VA 1G5TA 4PFSA 2YZ2A 4NZYA 4O25A 2ORIA 1ZINA 4EQ6B 2DCUA 3BB3A 4US2R 2W2XA 5FR1A 1FTNA 3GEHA 2IYLD 4US1R 1VG9B 3AVUA 3U7HB 4ABYA 3VKHA 2KJQA 5CLQA 2CJWA 3O8CA 1VYUA 1ZYUA 3QENA 2HXYA 3K0FA 3AKCA 1YVDA 2VP5A 1E2PA 4GT1A 3CF0A 5H70A 2WAYA 5F3WB 2F1IA 1KK2A 4GFDA 1TF7A 1D2MA 2QG6A 4O2LA 1N5JA 2QTFA 5FI1B 1US8B 2BEJA 1P2SA 1II8B 2ZJ2A 4DXAA 2EVWX 3DHWC 5G41A 3UG6A 4AKEA 2ORWA 1NRJB 2WZQA 1XEWY 1DAFA 4P3YA 1OIXA 4A4DA 3OESA 1WMSA 1Z6AA 2CLSA 4HZUB 4BFUA 1PLKA 3U5ZB 2F7SA 2B6HA 1XEXA 4JL8A 1Z07A 5D3QA 1S9HA 4L5BA 3W8RA 4AIIA 3WNDA 1CR0A 4BPBA 2ZS7A 4IDNA 5C1BA 2GA8A 4PC3A 4URWR 4JLPA 4Q1DA 1AKYA 1XWIA 1G20E 1N6OA 1W7AA 4URZR 3TMKA 5D3MB 1S4QA 3MRSA 4LGMA 3LW8A 3U4QB 2EFCB 3BBPA 3AF0A 4PXAA 2GJAA 1EXMA 2RGCA 4GP7A 1LTQA 2AN9A 3QJYA 3TW4A 1VMAA 2HJGA 1NVWQ 2QPOA 4KHZA 3WP0A 5KDOA 1X8LA 5L3VA 4HI0E 2LCFA 2ONKA 4NDZA 2YV5A 2QTVB 3W9YA 2EWVA 4MYHA 1U8YA 4RD1A 2WAXA 2F43A 5EP4A 2UZIR 3SDZA 3K53A 1VTKA 2AKYA 3RRMA 2J7PA 1RVDA 1T3HA 4CYMA 3MWLA 2REXB 1E79A 4Q1CA 3CNNA 2GZAA 3K0CA 2XEXA 5E4FA 4ERNA 3PITA 4GMDA 2OESA 1G21E 3WY9A 1JNYA 4YMTA 4QBGB 1U99A 4PAOA 1G3MA 2GTPA 3K70C 4DLSA 1IBRA 3MG9A 1TQDA 4RFVA 2F6RA 2W83A 1U9IC 2VA8A 1Q20A 3W5JA 2AFHE 4ZI2A 2GXAA 2XTNA 4MRVA 5DYIA 3ND8A 3ZD7A 5JJLA 4UXIA 4URVR 3ZYCA 1KNQA 4Z8YA 1SVLA 4Q4LA 1CXZA 4NH0A 1KSFX 1Q22A 2XGJA 2AD1A 1CS4C 4M4SA 1GVNB 1E1QD 1T0HB 4HDOB 5FUYA 2GVZC 3GFTA 3ICEA 1ESMA 4P32A 1L8QA 4Q48A 1II0A 1ZCAA 2ZRPA 3FGNA 2GBLA 1Z5ZA 3TNFA 1XPRA 1II9A 2VF7A 2H5EA 3DKPA 2ODWA 3KKMA 2DY1A 1KDPA 2I1VB 3OEEA 4OJKA 4RD2A 1TF2A 2CNWD 1UFQA 2PJRA 1COWD 1UKYA 2ZYWX 1R0XA 2ODBA 4N1AA 4BECA 1QHIA 4YC7A 4JBYA 3T15A 2YWHA 1Q3HA 3MGCA 2NMVA 2O0JA 1Q1QA 4EPXA 2AD5A 4OJQA 2JJ1A 4NONA 4ITRC 3KXLA 2D06A 2DWPA 3U6BA 2HXSA 1HH4A 2YINC 4A8JC 421PA 5EJEA 1XU4A 2JIZA 4QJ5A 1XZQA 2V1UA 1KIMA 1ZMXA 2O8DB 4BZPA 3PUXA 4AKGA 5KSYA 4HB0A 2HF8A 4JLMA 1GRQA 3FYHA 3P27A 3SR0A 3REFA 2IYSA 3LLUA 3NC1C 3IHWA 2NZ8A 3SJZA 3WBKA 4OI1A 2QROA 1TX4B 4N0EA 4AYXA 4DUGD 1OFHA 2FEOA 4DHEA 1S9DA 4L4UA 4DCTA 4KFRA 4PHHA 2ORVA 2ZE8A 1F2UA 3TQCA 2PT7A 4OKSA 4Q1BA 2EQBA 1J8YF 1G41A 3GLIA 2QAGA 1FW6A 4L9WA 5FTKA 2H1LA 2G88A 5JJKA 1D5CA 5FPSA 5IT5A 3LFUA 2HDNB 3Q8XB 3E70C 2R6DA 3QG1A 3W90A 1AN0A 1S3SA 3W34A 5JHHB 2QT0A 1RE0A 1G8HA 2C9CA 2RH5A 4P31A 3QUSA 4ZO4A 4MUBA 5C4GB 1TPZA 1IY1A 2JJ2D 3UANA 2C77A 2G1JA 4C7OA 5HZHA 2NZJA 521PA 1V5WA 2OCYC 2IUUA 1KY2A 2CHGA 1W36B 4PX9A 1GWNA 5FOSA 5AJXA 4IKEA 2ZU0C 4YONB 3P32A 5H68A 1MABB 4DEXA 2F55A 3GFPA 1S3GA 3X1XA 3LQQA 3WYAA 1IJEA 2QENA 4TYNA 1KTVA 2ERXA 1G3IA 3VHXA 2V3CC 3QQ5A 3LXRA 4D4JA 4NKRA 2BMFA 4OI0A 1JALA 1WQ1R 1P9WA 1BH2A 1Z2AA 3K0CC 2OG2A 3OAAD 1JR3D 4KFTA 4Q9KA 1Z8FA 4Q4AA 4KYIB 3PJRA 3KKQA 4MRRA 3C7KA 2D62A 1AM4D 2R44A 1U98A 5FOVA 4P4UA 4DLXA 4C0JA 4DSUA 4KO8A 2BM1A 2WJIA 3B5JA 1H8ED 5FOUA 5KNDA 2VP9A 1EFTA 2GF9A 4LBYA 5FBRB 2EYQA 4BFYA 4DDUA 1Z63A 1A5TA 3LVRE 2ZR0A 4LK2A 4AYWA 4YDHB 2XTZA 2R6GA 1DS6A 2ZJYA 4KFUA 3CIOA 1TUEA 2ONJA 4XSHA 5JCZA 4IVQA 1WP9A 3PEYA 1QG2A 1NMZA 4G5RA 1N5KA 2QM8A 2Z43A 2ZRCA 4KI0A 1NP6A 1D2EA 3VU9A 5IRCD 5BN5A 1ZNZA 2B7CA 2JLQA 2GETA 4LHXA 4M1TA 1HURA 3TSOA 5AUPB 2GBLC 1QVAA 3Q72A 2ODEA 3N2IA 4LBWA 4DT1B 2ZJAA 4XJXA 1E2LA 1XMSA 2BBOA 4OK5A 4JLBA 3L0OA 3SC3A 3IDQA 3T34A 1KSJA 2H7VA 1JPNA 2JLWA 1SHKA 2A5GA 2GK7A 2GRJA 5EE5B 1LS6A 1ODFA 4W5WA 3ZZTA 4D2IA 4CT5A 1AA9A 4JSTA 1TTTA 4PPNA 3SJAA 3QOFA 4IEEA 4BRWA 4OQXA 3FMIA 3GJ6A 3W3ZB 4CW7A 3SBEA 1NI3A 2WOJA 4HATA 2ZRLA 1NG9A 5EXPA 4OHZA 2ZVPX 4WZ6A 2W6JD 2J3EA 4JLOA 1HT2E 1G7TA 4TMWA 4AD8A 3R9XA 5J4LA 1KKLA 5KTYA 1E0AA 2O8BA 1DAIA 3CZQA 1NN1A 4DLZA 4Q1EA 4EFMA 3CRW1 2FSIA 1SVWA 1KDOA 3CF6R 2JDID 3QBTA 4B32A 4JVLA 4QNMA 2BKEA 3TLXA 4BASA 1YZKA 2CK3D 1M7HA 1NMXA 2QAGC 1KSGA 2HT6A 1HT1E 2GJ8A 4ESHA 4O2RA 1XXHE 2HLDA 3FMFA 1LNZA 4RCZA 4Q01A 4A82A 4NCJA 1MT0A 3ZQ6A 2JLUA 3EAQA 2ZJZA 1AQYA 4G5GA 2XZOA 3EPLA 5AR1A 5IF9A 3DKVA 5AUOB 1R2QA 5C18A 4R98A 4QM7A 1NF3A 4M8NE 5FOXA 4X8OA 3R8FA 4JIMA 5FUVA 2JLRA 2QP3A 5FH9A 4ZDWA 4QRHA 1OSNA 2FG5A 3Q9LA 3WMFA 4TQ9A 4K8OA 2ZSFA 3SHWA 3A1TA 1S1CA 3ND9A 3LA6A 1E2JA 2KI5A 4LJ6A 2A5DA 2WJHA 1ZUNB 1NKSA 4LHYA 2X2FA 4XWAA 3W6OA 4G3XA 4TT3D 5FL7A 3BRWD 2NPIA 2C5LA 3HU1A 4EJSA 3KB1A 2VLIA 5B64A 4OQNA 4PPFA 1A2BA 3QY0A 1XCMA 1E2IA 1MO6A 4HAYA 2QPAA 1OIVA 1SVKA 5G40A 4AKIA 1RJ9B 1A7JA 1G19A 2CE7A 3VHLB 4BFVA 3H84A 1LY1A 2A7QA 2EFHB 2VL7A 4OBEA 2D2EA 3VFDA 2KWIA 4JS0A 3EPHA 1XRJA 2A2ZA 2BWJA 1IN4A 1E4YA 4LPSA 5FI0B 4C9BA 1UKVY 1SGWA 1E99A 4K46A 2J7KA 2IA5A 1BMFA 4E03A 2ZSBA 1R0ZA 5JECA 2ZAOA 3G5UA 1HQYE 4I1SA 1HE1C 4FINA 3U3MA 3KQLA 3SNHA 4JLAA 1ZM2A 4ASUA 5E95A 1G8FA 3W5IA 3L0PA 4Q19A 221PA 1RRGA 1ZD9A 1IN5A 2FH5B 1GNRA 2J0UB 5JJIA 3LWNA 4CZ2A 3IPXA 4TT3A 3AF4A 2JLVA 4M1MA 3RS0A 3BGWA 2VP4A 5J4KA 1HQCA 3UWOA 2C03A 2QSZA 1EFHA 2CXXA 2DFKB 4UXHA 1NLZA 3NBFA 4Z51A 1Q3TA 4B3XA 2F1HA 3BERA 5HZKA 3AP2A 3F0TA 3B7GA 3RABA 3K70B 2AX4A 5FPKA 4GZLA 5EE1A 1OXXK 1CJTC 1JQJC 5ELXA 2Q6TA 1KK0A 2P6NA 4A1FA 3THYB 4I1VA 3W3AA 1JI0A 2JEOA 4B2LA 5HKKD 2WWGA 3BD9A 4AG5A 4IOJA 2GESA 1K8RA 1KI6B 2RCNA 2WBLC 3GPLA 3BE4A 2FPKA 3GEEA 3TSWA 3ZVRA 621PA 5KYKA 2XB4A 4URYR 4MKGA 4ILEA 5B2ZA 5EUMA 1PLJA 3GJ7A 4DDTA 1T3LA 1Z0IA 2DBYA 2IYUA 1FQJA 5IHPA 3CW2A 3UMSA 4B2PA 5AUQA 2WWXA 4DLWA 1X1RA 4O3MA 1QHNA 1YZLA 3RRYA 5C2JB 2FNAA 3CR8A 4V03A 4LHZA 2D4HA 3BFKA 3TKLA 4GNKA 2CMKA 2B8WA 4TMZA 3RS5A 4JL5A 5CB6A 1DEKA 3DM9B 1JB1A 4Y0AA 1GRNA 4ARZA 1X8JA 1K5GA 2V7QA 2WWFA 1ZIPA 4CRWB 3NEJA 2QMHA 5F2EA 2CJWB 1BS1A 4IDOA 1EFRA 3GCGA 4HLUA 3R8CA 1G16A 3K0FB 2UKDA 2NPFA 4FXPA 3ZJYA 2G1KA 4TLDA 4OYHA 1SXJD 4R2IA 1ANKA 4HLQB 1Q57A 1GP2A 4XTRA 4A6XA 3TQFA 1GDDA 3FKQA 2ZJ5A 2IS2A 3WHKA 1FTSA 2IT1A 3D7MA 4XTCS 2GEDA 5SZHB 3S1AA 1WRBA 1NLYA 4M9ZA 3WRYC 5HE9A 1ZU5A 2MMGA 3CRQA 3DOEA 3WMEA 1OPXA 3JZAA 3SJBA 3Q85A 4AG6A 5GVSA 3AVVA 2CL7X 1KI1A 5EUQB 1XEXB 1MH1A 2KB0A 4JLVA 2DWOA 2IS6A 1YRAA 2KBEA 2NG1A 3CNOA 2PEZA 4EJSC 1ZIOA 4I81A 2DHRA 3HU3A 4EAQA 1SVIA 2P5TB 2BEKA 5FBVB 2YOGA 3QEJA 4F4IA 3GLIE 3U60B 1FQKA 1NG1A 3PG5A 1G4AE 1RW4A 1UBCA 3VX3A 1NLFA 1GTVA 1AS3A 1CTQA 2QN6A 3CPJB 2OBLA 4BLTA 1MRSA 2RAPA 1KJYA 1W36C 4FWIB 4BLSA 1UPTA 1XTKA 2HEIA 3K0SA 1KYIA 2QNRA 5SZKB 1G8YA 5F9HA 3QXCA 1F5NA 3VQTA 1E9DA 2EWWA 2ZE6A 3A1VA 5FR2A 1CBUA 1NN0A 4OI4A 1R8QA 1DTSA 2F43B 1PJRA 1W2HA 2ZYTX 1HA3A 2QU8A 2R65A 3TVDA 4PPGA 5TARA 3PEUA 3AV0B 3K9GA 3KQHA 2UVQA 1E9CA 1I4DD 2NO7A 2LKCA 1E2HA 2QAJA 3UPUA 3ZIAD 4LJYA 1MRNA 4NYIR 1R0WA 1X8KA 2ZJBA 3K0AA 5CYPA 1G8PA 1N6HA 4K81B 3JVVA 4S2EA 1KAOA 5FUXA 1OKKD 2IYQA 4CDGA 4EKDA 2WSSD 1VCMA 4Q5IA 1ZW6A 4AI6A 2OM2A 3GJ5A 1MKYA 1W0KD 5B58C 2J0SA 2ZR9A 3ONWA 4WA7A 4LWZA 5KPDA 1J7KA 1Q44A 4WXPA 4EFLA 2WJJA 2IYVA 2H18A 2BBTA 2QUZA 4IJMA 4CEHB 2ZEJA 5J5CA 2EU8A 1P4SA 3NBXX 3K09A 2NO6A 3K9NA 1Z22A 3H86A 4U02A 4AWXA 1VYTA 3O8RA 1XJ0A 3H4MA 1VYVA 3IO5A 1MO5A 3EX7C 1R4AA 2GHIA 2C9YA 2HJVA 1KMHB 1NN3A 5DLQC 1NBMA 2GF0A 3CNLA 2QTHA 4UQOA 2A5FA 3MAAC 4DJTA 1JR3E 1RZ3A 4LSGA 3L8ZA 2PZFA 2X8AA 4M53A 3OE7A 1LV7A 2GCPA 2BM0A 2W00A 4X8HA 2ZR7A 3BS4A 1VECA 2FSGA 3UG7A 2RGDA 1OH7A 4BE7B 2XNDD 4JT4A 3NC0C 2X2EA 1J8MF 4HLUC 5CJPA 1G4UR 3TUZC 2YWEA 2VHUA 1JJ7A 1KHTA 2FOLA 3A6PC 4LBVA 1Z0DA 2BHRA 3EWAA 4Y0VA 3TJZA 3LAWA 3P4YA 4LI0A 3BC1A 4FCTA 3NWJA 1KI7A 2FWRA 1CRPA 1Q1BA 1VG8A 2CHVA 1UKZA 3ZQJA 2DFLA 3BXZA 3I72A 2PX0A 4JBWA 2QM7A 3BORA 3VMFA 3B8HA 2G6BA 2AHOA 2QP9X 4R9UC 1SVMA 4NCHA 1XXHA 4B3FX 1NVXQ 2IYTA 1F2UB 4BRUA 4A15A 3AVXA 3KJGA 1QF9A 4HB4A 5HCIA 1X86B 1P60A 1ZRHA 1G17A 2F1JA 2QAGB 3OIYA 5CLLA 5JRJA 1KJZA 3SFZA 2VRWA 1OLOA 3H0KA 2OAQ1 3P4XA 1F2TA 1F3OA 3GLFA 4GZMA 3DZ8A 3RC8A 4MKHA 4TQAA 2QEQA 3CX8A 3CWZA 3OFNA 5P21A 1JEEA 2IEZA 2R2AA 3Q7PA 4PSAA 4B74A 2K5UA 2SHKA 2A9KA 1ZJ6A 2OCPA 3HP1A 3GLHA 3OIUA 3QKRA 1AIPA 4C7OB 1CEEA 2HCJB 3SU8A 2WJVA 5GJBA 1XNJA 2ZITA 2BIFA 2XOKD 3H2YA 1FP7A 1GG2A 2OBNA 2DFNA 4LOAA 4TSFD 2AK3A 2PBRA 2IW3A 5EXTA 4XWKA 4F93B 3FHTA 1P7CA 4F7WA 1Z6XA 2HCBA 2IYXA 2GK6A 2W6ID 4YDSA 3QF4A 2O8FA 2CLCX 3SJCA 4YMWA 2PLRA 1XPOA 2OO7A 4Q4AB 2QMOA 5K8LA 3M4YA 3WRXC 4PANA 1XMJA 1ZVQA 4DLTA 3EXAA 4I4LA 3EC2A 3K8YA 2PCJA 4DB2A 4W5JA 2FN4A 4C0BA 2Q3MA 2Z5FA 3QSYA 1U8AA 3ZS8A 5BN3A 2XSZD 2QZ4A 2IS1A 4LCBA 3TR0A 3CR7A 1FX0A 4LX0A 1P73A 5EE9A 2J1LA 3HR7A 5C46F 2ANCA 2ZPTX 2QT1A 4AK9A 2VO1A 2CDNA 3NXSA 1ZM9A 4LJ4A 2AWOA 3KUCA 4LRWA 2ZTSA 3A4NA 1OHHD 3EA5A 3FFBA 3UK6A 1ESNA 3V00A 4LJ8A 5J4YA 4V02A 1WB9A 3PUWA 1JBKA 3VU9B 3TK1A 3SQWA 4TLBA 3SQXA 3E1SA 4E5UA 3SI7A 5JEDA 1Y63A 1E0SA 1N25A 1LF0A 2CL6X 3CO5A 3I1FA 4EUNA 5KDLA 4Q4HA 1OE0A 1QZXA 1FPMA 5FTNA 2R6CA 2WICA 1JEDA 1G3QA 2WOOA 1VIYA 2RGGA 2KSQA 1W5TA 2XAUA 3ZH9B 1ZNXA 2XSZA 3AVWA 1JQLB 1G1MA 5JWRA 4Q7KA 1OH5A 5CM9C 3SHFA 2E1RA 1VCIA 5DI3A 1T5IA 1R7RA 3WNCA 2BMEA 1S96A 2G0NA 3IGFA 1WBDA 3GD7A 1IN6A 4IHQA 4R7ZA 1N0WA 1G18A 4CF7A 5L3SA 5DNYB 2VSFA 3C5HA 2ZQ5A 4KLNA 5BWMA 1GOTA 2GAOA 2HUPA 4B3GA 1TNDA 1ZD8A 2V6JA 3BH7A 4DLVA 5KU1A 1YR9A 1CKEA 3RC3A 2ZIAA 2O8BB 1M34E 2FZLA 1N6NA 4AC9A 3THWA 2X77A 4XSGA 1KO8A 3RS7A 2ZRBA 1VHLA 1R8SA 1Q1EA 4KV9A 2PMDA 1D6JA 1ZU4A 1BOFA 2IYYA 1EWQA 2P2LA 3RS4A 1I2DA 2IF0A 4PSVA 2VEDA 4JYBA 2QBYB 2QA5A 3GMTA 3U3KA 3RS3A 4BGDA 3NHAA 1HE8B 4Q9HA 1P61B 2OLKA 3EZFA 3LDAA 5IK2D 2ZI3A 5GADl 2ANBA 2QMUA 3AVTA 3SEAA 2CL0X 1I4LD 1YU9A 1GIAA 3FKSD 4KXFB 1Q1ZA 3TRFA 1OFTA 1B23P 2OHFA 1P2UA 1E1QA 4RFSA 1PLLA 4PTLA 5FUWA 2DPXA 1KI8A 1RFLA 1KDTA 4TTRA 1GKIA 1EESA 1L2TA 1CJMA 1Z06A 1YE8A 3ADBA 2L0XA 4JSYA 2JGNA 3LXXA 2OFWA 4RZXA 1EK0A 1LW7A 2JJ8A 3N5CA 5HE8A 4DCUA 4QFMA 2CNWA 1COWA 1AK2A 2ZM5A 1K5DA 5TY0A 3FPAA 3UKDA 3REGA 4B33A 2ZI5A 3HJNA 4LJ7A 3CX6A 4YXWD 1X3SA 1WCV1 3B1ZA 1Y3AA 3ZVMA 5CJ2A 2ASEA 1KO5A 5HR5A 1OV4A 4DB4A 1S0UA 4Q7MB 4EJSB 3VR4A 2RB4A 2B7BA 3ZDQA 4B75A 5F98A 1SKYE 4YMVA 721PA 4KLZA 4N0DA 1Q21A 2ERYA 3FKSA 3TVTA 2O8CA 3EC1A 2PCLA 5DSZA 2GZDA 3C14C 3PQCA 4MA4A 4LV8B 2VP2A 5KSOA 4MKIA 3VKGA 2LWIA 1N3BA 1ETUA 2V4ZA 4Q4JA 1RC8A 1FNMA 2ZYVX 2RGBA 4P0TA 1VG1A 4TZ0A 1QVRA 4D0NA 3AP1A 5BYJA 5FBQB 1ZM3A 4QHSA 4DUGA 2ECKA 4URXR 1KJWA 1XFAA 1LFDB 1SXJE 1M2OB 4B43A 3PUYA 5FPTA 4HDQB 5E7IA 1TEVA 1GL9B 1YRBA 4KCGA 4B47A 1IXSB 1IJFA 1E2FA 2QE7D 1QBKC 3T1QA 4D6PA 1SVSA 4CVNA 1VIAA 1DELA 3GP8A 4HZUA 4B2IA 1C9KA 2GCOA 3CH4B 3CKLA 1AJEA 2OEPA 2HF9A 1N6PA 1TUIA 3LO5A 2RGEA 3DO6A 3PEVA 2JJ2A 4QGHA 5EQTA 4V0LA 3SOPA 2WJYA 3X2SA 2GXSA 1XDBA 1IAQA 1LS1A 5LDDC 3B1YA 4FMDB 4IVRA 4NCNA 4G01B 1W4CA 1G7CA 3TSZA 3ASYA 4WXRA 3NHBA 3ADKA 1JJVA 2WKPA 4ZKDA 1KY3A 2Z4SA 1OXSC 1GL6A 1Z83A 1NNEA 3PVSA 4GOJA 4IOLA 3OAAA 1JR3A 4QBHA 2VHTA 1CP2A 4FIDA 4WVFA 4Q00A 2D7CA 2FU5C 4MYTA 5ANRB 3KB2A 4OHYA 3QXXA 5FTJA 1GNPA 5AJWA 1I4TD 4UJ3A 1AGPA 4BFZA 5KDDA 4LYAA 2JLSA 4D81A 1EX6A 1QHYA 3HU2A 3CWQA 1NIPA 4V0OA 1CRQA 1GAJA 4C0HA 1VKJA 4V0KA 2AXPA 3LX8A 1H8EA 4ZCMA 1NBME 3UMRA 3EZ9A 4ARZB 3V9PA 1UM8A 2H17A 1R10A 3KFVA 1AS2A 1FP6A 3KZ1E 1LVGA 1X1SA 3TH5A 1E0JA 3D3QA 5EE3A 3LH5A 1OB5A 4IXMA 2V54A 4LDJA 1ZP6A 4NHOA 2W2VA 4IW3B 3IUYA 4JVNA 4RKFA 4US0R 4ZDKA 1EWRA 2ZRGA 2XB2A 3SBDA 3WYFA 2VSOA 4PZLA 1T6NA 1K6MA 3OZXA 4MGZR 4Q9IA 1E9SA 4BFXA 3R20A 1YZQA 3Q5DA 4KVAA 2ZUCA 5KO2A 1L4UA 3AEZA 4RVCA 4V0ME 4Z54A 3S1AB 2YYZA 2A78A 3QVVA 4Q7JB 3X1ZA 1KNXA 3IO3A 4FD2A 4G5SA 4GPTA 1N6IA 4C3ZA 2C8VA 1BKDR 1NVVQ 1Q0UA 2E9SA 1E1RD 2RGNA 1SKYB 4PPQA 4BZXA 3CRVA 3KKNA 2BDTA 2FV8A 1MO4A 3GJ3A 3EW9A 4KODA 4BLQA 2WWWA 4OHWA 2JCSA 3CM0A 3E2IA 4M21A 1AS0A 3AKEA 1YR7A 4PC2A 2JATA 2P3SA 3GLFE 2REOA 2F3TA 3A1WA 4RSGA 1KSHA 2IYZA 2W6JA 1CR4A 3RSOA 4QM6A 4POAA 3H1TA 3IIMA 3AGPA 3IEUA 5EXSA 2VF8A 3MUFA 2V9PA 2ZSAA 1CULC 1U81A 1W4AA 4OL0A 5KUTA 3THOA 1SZPA 1BYUA 2EFEB 3AB3A 3OIWA 4ZIRA 3GLHE 4IEIA 3RRZA 4I99A 2JDIA 2GXUA 2NQ2C 4XWOA 1G8GA 2ZANA 4IOKA 3LBIA 4HB3A 4MRSA 3QKSA 3IIKA 1NKTA 1W48A 2CK3A 1OIWA 2QQ0A 3NKVA 2ZRDA 3W6NA 4C0SA 1XTSA 1Z0FA 2MMCA 4BUJA 1DVRA 3JVUA 4OI2A 4OQLA 3VTKA 3GJ4A 1DO0A 2XJ9A 3DMNA 5TDHA 1OYWA 3K0AB 4E09A 1HY3A 1R5OA 1FFHA 4LV6A 2GJ9A 2V1XA 5AWFC 3MJHA 4MGIR 3TUIC 2VBCA 2WWYA 2JASA 2VTKA 2GNOA 2RKOA 4B44A 4B48A 4PZZA 2BV3A 2IBMA 4TMVA 3EASA 1GM5A 4TLCA 4QBIA 4NBSA 1P3JA 3C41J 2GEUA 1GZSA 3OEHD 3ZVLA 4HUTA 2ZU6A 2G3YA 3Q7QA 4HZIA 3KKPA 2F9LA 1F6BA 1BIFA 4BFTA 3FFAA 5LB2A 4C0QC 2IL1A 3Q5EA 3EIHA 2GJSA 3R9WA 3JZMA 1ZUIA 2N46A 5L3QA 4G1UC 3GLGA 1Z0KA 1JPJA 4YQFA 2BCJQ 1CR1A 2A3RA 4WZBE 4F91B 5A4JA 4ZDIA 3ZZ0A 3N70A 2VQSA 3P20A 4JT2A 5DGXA 3QG5A 4IDPA 5CM8B 2IK8A 4E22A 5H1YA 4WOPA 1W5SA 3NG1A 4PHFA 3U7EB 2C04A 4EPRA 3EWSA 4KBFA 1XX6A 3CF2A 4LY6A 4MGYR 4RY2A 3CX7A 3RSLA 4F4CA 3HWSA 3CH5A 2QGNA 1JR6A 2VH5R 3AUXA 3MJRA 1Z0AA 3ZD6A 4JMPA 5DN6D 1T8UA 2RGXA 4JLNA 4P4TA 1N5IA 1N2CE 4NCIA 4NYJQ 1E2NA 1NMYA 4ZDJA 2CEAA 4M1WA 2REBA 3G82C 3BFXA 3ASZA 4BEJA 2VIIA 2PMKA 4HUQA 4XD7D 3U3OA 2RHMA 3HYRA 4GOKA 3AVOA 2BMJA 3UWKA 1RYFA 2B21A 4L16A 5JLJA 3FOZA 4F92B 4J0QA 1HUQA 1G64A 1UBFA 1Z6TA 2AXNA 4ZI3A 1XXHB 3VR5A 4UKDA 1ZC3A 4H9GA 1H8HD 4ZCIA 1XPUA 3O8DA 2PZGA 2RGNC 1U0JA 1DO2A 1D9ZA 3L2OB 1TAGA 1AGRA 5JZVA 3QPVA 3OF5A 4XVQA 1KI9A 2WKQA 5FBLB 2P5SA 1W2GA 5KSZA 3VNUA 1F2TB 3FHOA 4UXJA 3GLFB 4F38A 5HKKA 2FGJA 5FPYA 4MDFA 1EFUA 1KK1A 3UXMA 2YJTD 1E6CA 2RHDA 4ESVA 3M1IA 2ATXA 3PXGA 3KQKA 3KFXA 3ZGXA 4A2WA 2BVNA 4A0FA 3QKRB 2XNSA 4HSEA 3GLHB 4PZYA 3D31A 3B9QA 2ZI6A 1IXRC 3AVYA 2FDCA 2OILA 1Z47A 3TAUA 4D80A 2IYWA 1J2JA 3A1SA 3RNLA 1QHXA 2IYRA 3WP1B 4B3BA 1E3MA 1YKSA 3U6KA 4Z1MD 2QGZA 4MRNA 2IUSA 2BOVA 1ONBA 1G7RA 3FVQA 5SZJA 3LY5A 2VP6A 1XB2A 1A4RA 4TYQA 4M9QA 2MSCB 2C96A 2CBZA 3QF4B 5DI9A 2O8FB 1J90A 3KJIA 3LVQE 1HV8A 3KTAA 4OK6A 3BOSA 2PL3A 1J99A 1E2GA 1NJFA 1W0JD 2IHBA 3DVLA 4HAVA 2FFHA 1TL7C 4O0MA 3HDTA 4U00A 1SXJA 4DDWA 2QMEA 2C78A 5UKDA 3QF7A 1E32A 5CDFA 3VAAA 4LHWA 3GJ8A 5BYKA 3MWKA 4XH9B 4A36A 3U44A 1OXUA 2O5VA 5A0FA 2QP4A 1RPZA 1FX0B 4H1VA 3I32A 2XTMA 5LPNA 5FTMA 1FMLA 1R5NA 1UBEA 2WPDD 1UDXA 2CVHA 3RANA 1G6OA 2GJKA 4ZPXA 1M7BA 1TU3A 5AUNB 1IONA 1JXOA 2ZREA 4WW0A 1IOZA 4ACBA 2C99A 4NE2A 4QJ4A 2R6FA 5TXGA 4DZZA 2ZRKA 1OXVA 1KZ7B 3BAFA 2W0MA 4RJLA 3LRPA 2FGKA 3R7WA 4V0NA 4Q4HB 3RYTC 1XTQA 3PENA 3BFVA 2WJGA 2BMDA 4DBLC 1UADA 1Z08A 3L0SA 1G7SA 5DIFA 1E2EA 5K8TA 4HEJA 3E5HA 1S1MA 4IRUB 2IX3A 3ZVNA 4LYFA 4A0GA 4BEBA 2WM9B 3AF3A 2XJ4A 1CLUA 4I1OA 1D8TA 3K70D 4GP6A 5DI3B 1YHNA 1JXMA 5J47A 2PLFA 3A36A 3B78A 2XITA 2ZE7A 5HPYB 3GJ0A 5FOWA 1E94E 1U94A 3OIVA 4HDCA 4CIDA 5L3SB 1MR3F 5EE0A 4UNSA 1N6LA 4QL3A 1GNQA 5G3YA 1M6NA 3ZIAA 4YLGA 3AVQA 1R5BA 3RVBA 3W6PA 1R0YA 4A2PA 3THWB 2BC9A 3LLMA 2AK2A 1XD9A 2A5YB 4QHTA 2MSDB 1OKKA 3SN6A 2WSSA 1NY6A 2ZS8A 3FDIA 1E2KA 1UDWA 2X19A 4QGGA 3U61B 3D6TB 1W0KA 3CBQA 5B57C 1XTIA 1BYIA 4A2QA 4TL8A 4GBMA 5JCPA 3EPJA 3C5CA 4H1UA 2C98A 2G83A 1T3SA 4CEIA 4Q1AA 3W8NA 4JLDA 4TMXA 2FE4A 3EPKA 2YWGA 4OHVA 4LZZA 4L9SA 2B92A 3AUYA 4TWZA 4JBXA 4V0MA 1GILA 4CT4B 4C4PA 1U0HC 2I3BA 1TQ6A 1E69A 1NVUQ 3WBJA 4C2TA 3X1WA 3BWDD 4QGFA 1N6KA 2ZI9A 3I61A 1KAGA 4D4LA 4URUR 2V55B 2XX3A 1XZPA 4TYPA 4DLYA 2P67A 3X1YA 1I2MA 1SHZA 1EGAA 1WE2A 4PO1A 4Q02A 4TLEA 3QE0A 4EFNA 4DRZA 2N1BA 1OFIA 5DYGA 1SKQA 1Z29A 3P1JA 5EP1A 5J4HA 3AQ4A 4DLRA 2J41A 4PO9A 1XEFA 2R8RA 2ZYUX 3KJEA 3IKJA 2XNDA 3T5GA 3EZ6A 3KX2A 2EYUA 4DCSA 2OCAA 4LBZA 4P4SA 3A4MA 4TLAA 3CB4A 2O8CB 2G0TA 4Q47A 1GITA 2QSYA 2ZRIA 3IHLA 4D0GA 3PV0A 1R6BX 1XP8A 3NDBB 1SXJC 2H8KA 4RD4A 1CJKC 4QG7A 4XOIA 4Q4JB 1NIJA 1G3RA 1YZNA 4BLRA 2B8TA 4MITA 2J5XA
chains in the Genus database with same CATH superfamily
3K92A 4P53A 3KLBA 1NP3A 2D7JA 2ZSEA 1RLIA 4Q93A 4L74A 4XQEA 5HKAA 1VHTA 1QP8A 4BCBA 1MX1A 1SKMA 5IYZA 3KYDA 4E51A 1JDNA 2NX2A 5BSRA 4HX2A 3BMCB 4N47A 1R6VA 1Z6YA 2JFHA 4NP6A 4GWKA 4WBSA 1QFZA 3B60A 2CHEA 4HNTA 3E84A 3B6EA 3LPAA 4YEDA 1SA0B 1EDOA 2PBLA 4ZKEA 3ONNA 1N9ZA 2F8LA 2XD4A 3C98A 5JPDA 1N0VC 1QRTA 1YA8A 1GA1A 5KNBH 2GWHA 4KQEA 3OEED 3ETJA 1ZVVA 4P0QB 5JSZA 3VC3A 4RPLA 4QDTA 5JWOA 2JKVA 1QHGA 2VJBA 2PUCA 1FUKA 3PSHA 3HFJA 5COGA 3N3AC 3PR1A 2YR0A 2Q1TA 3KTOA 3H9EO 1QHSA 2Q9CA 1KMHA 3RFFA 1K2WA 2WABA 2PJUA 2BUCA 3KZCA 3C6BA 4NMWA 4QOEA 3LVFO 1EFPA 3O2QB 4G5FA 4B3DA 5LZ4A 4E3ZA 2IUTA 1OLSA 5DCWA 2F3RA 4DSTA 2X0EA 4QQFA 1Z2CA 4F5DA 5J4VA 4CDMA 2YN2A 4PIPA 2P7IA 1D9XA 5BV2P 5TV2A 4FS8A 5BNWA 3W5SA 2RHLA 3HCDA 3BGIA 3P9RA 3HN7A 4DR1B 1QX3A 1MEJA 4X8MA 3FCUB 2EILC 1JMYA 5CVDA 1WWKA 4CV0A 4M22A 2FTKE 1O1YA 1EFCA 5AKEA 3PC8A 1J07A 4I50F 4ZN6A 2J3LA 2XV1A 1C4OA 5ES4B 5ALQA 5F4BA 1ORIA 2FPMA 2CJYA 4KYTA 2VJDA 1WBBA 2CJFA 1CNFA 2P77A 4HUQB 1I3CA 2IXNA 4XX0A 1WXEA 2BGJA 1H65A 5EJ6A 2WILA 1K4MA 821PA 1I0IA 3PQDA 2E87A 1Q3KA 2FK8A 1HQKA 1ZK4A 5BSFA 4S1TA 1MENA 3B2NA 5JNVA 1EX7A 1QIJA 1EVLA 5BQFA 3OOWA 1OB2A 2OPHA 4KU4A 5L8VA 1ZD2P 2GASA 2IP4A 2E4UA 5GJVC 4TLLB 4FFDA 5JQGF 3NTUA 2IC5A 3BYZA 3RK4A 1W2WB 1DIBA 1YB7A 3CMMA 4LJSA 1Y7IA 5THKA 1ISRA 2Y27A 3S2YA 1SXJB 4DL9A 4R2HA 1HFWA 2ZP1A 2FW1A 4ANFA 2I67A 3UQYS 3PI7A 1KI4A 4MLPA 4OYYA 1A41A 5U4XA 1A9SA 4B7AA 4OQZA 1NUQA 5AHWA 5FFMA 2H1CA 1VJTA 3S5JA 5EHXA 3UXEA 5CA1A 4KREA 4E13A 1G20A 3WBFA 1Z73A 4MA0A 1EP1B 5K20A 3SQLA 2H5JA 3EIFA 3DMRA 4HTFB 3TIIA 3W5HA 2CZGA 5IJXA 1IQRA 3OZ7A 3BICA 5BQGA 4U9EA 1D2HA 2EPLX 4ZLDA 1P62B 5EGSA 2PGIA 2P9CA 3KPWA 3CUVA 2CVOA 2I8BA 3KT0A 2I8LA 2HJRA 1Q15A 2AXEA 2PTHA 1W4ZA 4UJ5A 3WXMA 4JASB 3RYHB 1MFPA 4JQCA 5HK8A 3R0VA 2HB6A 3DMHA 3V8EA 4JJIA 5FTLA 4PAMA 3ODPA 4K9QA 5D00A 4N5LA 5JIBA 1GFIA 1EFRD 4PNHA 3WL8A 2ZVQX 2QD2A 2JLYA 5F9FA 2YRXA 3RCBA 4TZTA 3OLQA 3X2FA 1C7ZA 3M2PA 1KKUA 1SXPA 4QYMA 1MUUA 1ZMRA 2Z83A 5DTRA 1L5OA 1XF1A 4BQEA 3I34X 4DA4A 4NULA 4LQLA 1H8HA 1YJCA 1YR8A 3WLAA 2ZB4A 4IIGA 2Y8EA 1QIIA 4UNRA 1FUEA 3A31A 3S81A 1DFHA 1UL1X 3QU7A 4B3CA 3T4UA 1DZ3A 3OCUA 3UAYA 3JWEA 1Z33A 1N57A 3M2TA 3UMFA 5CIQA 3P19A 3HCWA 3PPIA 4WVLA 4XJTA 4COKA 3V4FA 4YIHA 4FOOA 2VUTA 3HP4A 3V2HA 1XR3A 4KQXA 3F2VA 2RIPA 4Y9SA 4DUYB 4JR0A 4Z86A 3MT9A 3WWEA 1ZGBA 1NX9A 5FPHA 4TYMA 2PYIA 3DZJA 4NBNA 3LW7A 2PUJA 4J0HA 3KJQA 1JQBA 2V7XA 1H23A 1NBMD 4MVRA 5KJ6A 2LP4Y 3G1WA 1AK9A 3QEKA 2X58A 4OGFA 5EKSA 1XTRA 2EJVA 3DEAA 1EA7A 3VZCA 1IWOA 3CLSD 3SHQA 4X00A 4MYCA 4RA9A 4G7ZF 5K8IA 1N32B 3P26A 3OKAA 5DB4A 3GT0A 4XXHA 4PHGA 1WNFA 1F9AA 3KZOA 4OIPF 5AJVB 2WVHA 1G98A 1BE8A 4JWKA 4D9CA 1LF5A 1PFYA 1I3NA 4TL6A 4DM3A 1KGDA 4LYJA 3J81k 1Y9JA 2P30A 4YRRA 2CYBA 3CZRA 3EFEA 3AOGA 1U6JA 2EGGA 5TPZA 1ZIDA 3OZAA 2WYIA 1Q50A 5FLKA 3CF0A 3OY2A 5F3WB 4RL6A 1PN3A 4O2LA 1AQJA 5FI1B 2ZJ2A 2A9QA 3EVGA 1MU0A 1M72A 4KPUA 3UG6A 4WNAA 1XEWY 4DAOA 5I7FA 2F7SA 4NE9A 3FWKA 3MJDA 3QUCA 4URWR 4Q1DA 1C1DA 3BT7A 5DBGA 3ADPA 3M34A 2JK0A 3TMKA 4NXNB 3CRNA 1NVWQ 3WP0A 2XUKA 2Y66A 2C59A 5E0OA 2LGJA 3ZWXA 2EDAA 2BFEB 3RRMA 5ALLA 4AFNA 3ZCSA 3RKRA 3CNNA 1TT5A 1YB6A 1XKLA 2HRDA 5JR3A 1DJNA 1RLMA 1BDHA 4R01A 3H4VA 2CCYA 2KLHA 2PXXA 5AI6A 2J3IA 5BURA 1V37A 4NH0A 1I9CA 5BQ3A 2FN7A 3EXEA 5KU7A 1II9A 3WZLA 3E5NA 1IBMB 3C6MA 5LLSA 1V6SA 2HQBA 2Y0PA 3C39A 1LDEA 2QRMA 5BWNA 2XGGA 1D2CA 1EKXA 3Q7SA 4JP2A 4A23A 1Z6PA 4PJJA 1TX4B 3WO0A 5MHTA 3WQBA 4D4NA 4BNFA 1X3LA 4YAKA 3AJAA 2XT0A 3JRNA 1G41A 1XQVA 1P1RA 2CFIA 1RXSA 3Q8XB 4DAEA 1PGQA 5AJHA 3DUWA 1JDUA 3GNTA 4K6FA 5LC1A 4ZCTA 4RTRA 2LD6A 1BC5A 4Y9RA 4PX9A 2RH8A 2P0NA 3WDSA 2V3CC 1GCOA 3QQ5A 4D4JA 4JOQA 2BMFA 4TV8B 3P2IA 1KIAA 1WQ1R 3HKCB 1NNLA 3OPYB 3HC7A 1QMGA 4BNIA 2ZR0A 4F9FA 1T01A 3ONEA 5JZOA 5DLYA 5CLFA 3ATPA 1MMGA 2NZ2A 1P6UA 4QX6A 1UBJS 1HE3A 1FYDA 1O4WA 4P2GA 4RK1A 4O8ZA 5J1SB 1YA6A 4W5QA 1MW9X 1TTTA 2P9FA 3BIWA 3QOFA 2PZAA 4BRWA 3FMIA 3KKKA 2P4UA 3AESB 4KIUA 4BO1A 5D2CA 5EXPA 2ZVPX 3G79A 4OLBA 3FSRA 1QK5A 1BA2A 1S8OA 4DNFA 2P3QA 3WLSA 3PNPA 1YV9A 4U9HS 3ECSA 2DYRC 3MX3A 4BVHA 2BKAA 2CK3D 1XHEA 1B3BA 2R7KA 3RFTA 3VR4H 2YJ6A 4DA9A 3HLTA 4ZDWA 2C3YA 3ILXA 3KKBA 3F1LA 4QXRA 1S1CA 5AHKA 3DQPA 4LJ6A 4IIFA 3TBFA 2BGUA 4DGQA 5LWHA 4JTDB 3JSEO 1QIDA 2QVYX 1E2IA 1EFVA 2J08A 5ALEA 1GN9A 1R0SA 1RJ9B 3LLIA 1I4WA 3BZWA 1UBLS 2WMYA 2C2XA 1SGWA 3GLQA 4I1SA 3KQLA 3PCTA 1G63A 3E7XA 5JJIA 1GNRA 2DTDA 3AF4A 5IJ0A 1IBCA 2C03A 3WV4A 5HF6A 5JNTA 3MGKA 3H1BA 3WYDA 5I3ZA 1U8EA 1RAGA 1CJTC 3VPBA 3LYAA 4I1VA 1KFCB 1UWCA 4B2LA 2EP8A 3SC2A 1QQTA 2RCNA 2WBLC 4OAOA 2D5LA 3IPRA 1TB4A 3RUCA 4AJJA 1ZH4A 3F3MA 3IQDB 1TVCA 2D4HA 4MMZB 3HV2A 5FBKA 1FSGA 3WWYA 1CNEA 4NATA 3EVDA 2B6NA 2E1PA 2VC9A 3TFQA 3DLCA 5LP6F 1D1CA 3DA8A 4K03A 4QDUA 2YL3A 3ODGA 3FKQA 5T57A 1P77A 3WO1A 2XR1A 1WGWA 2O48X 4M9ZA 1VRCA 4HH3C 4JLVA 4I81A 3HYNA 2DMRA 4MVSA 3C3BA 4TRJA 5ECWA 4PLTA 4TMYA 1KTMA 4MQFB 2QY6A 1CQJA 3WFJA 2HI0A 2G4LA 4BLTA 1MRSA 1ZKMA 2HXGA 3L4JA 4Z7NB 5SZKB 2ODTX 1Q74A 4IH9A 3RAEC 1M8FA 1AKQA 2UVQA 5FUQA 3F4KA 1CUJA 1HLPA 3AERB 1E2HA 2JGRA 4FBMA 4LJYA 1XVTA 1AUEA 4RACA 1OKKD 1FB5A 1BD3A 2D00A 4AI6A 2OEXA 5IG2A 2HA2A 1W0KD 4MPRA 5GAJA 3IJRA 4QLAA 5U9CA 3W77A 2UUIA 3G9ZA 1P45A 2AG0A 3EPRA 4RIGA 1VJGA 2PZFA 4M53A 3OE7A 3BS4A 1NUTA 3PE4A 1XTPA 3US6A 1N2ZA 5CJPA 1G4UR 2UAGA 2D4UA 4DMCA 3U37A 1U0SY 2FOLA 5BSTA 1VGRA 3WK4A 3N2LA 3BORA 2Y3IA 3P2KA 3PDIA 2P2NA 3SZ3A 4INOA 5EEHA 3F6SA 3EFOA 1ZRHA 1OLOA 4DZRA 4LE2A 3G8DA 3RC8A 2HJMA 2HCRA 4CQMB 3BMNB 4UTXA 2PS3A 2IEZA 2HSBA 4ZJUA 3CNHA 1I2ZA 1T2NA 4MV8A 3SU8A 1N36B 2ZUTA 1SK9A 5ADUS 1FP7A 4CIBA 3PEEA 4KNVA 1U0GA 4QFBA 1J0XO 4F93B 5CDTA 2VDWB 2XKJE 5KYWA 2ALJA 4ZYTA 3PTLA 3S7TA 1R6XA 1ZN9A 2H59A 1U7DA 3R40A 2QQFA 3TLAA 3OEWA 1K92A 3PZRA 2J6HA 1JWBB 4C0BA 4HWGA 5BQPA 2X0DA 2QZ4A 2IS1A 1USKA 5CT8A 5DVWA 2F9FA 5WRFA 4KRYA 3GRYA 1ZSNA 2A9FA 1CEYA 5A6VA 1BEEA 2CL6X 4ROTA 1QZXA 2ZIVB 3HNPA 3UHOA 1RZRA 3PRKE 1O08A 5TT1A 1EJBA 1R37A 1T5IA 2J3QA 3W9UA 2ZZKA 1X70A 3T9DA 4OGKA 2V6JA 4ARBA 4BJHB 5FWDA 4CCYB 1EWVA 4IY1A 3GK3A 1EX1A 3VOBA 3G89A 4BGDA 2VK2A 5IK2D 1SXHA 1T1RA 5K4GA 1OFTA 3FPGA 4HBGA 2Q8QA 4O2AF 1GYRA 2JJ8A 3ZN2A 1GZDA 5SYNA 2DUUA 2GM4A 4Q7MB 3H19A 3GORA 4GX5A 4XFKA 3EQ9A 1CR6A 3LT5A 5DSZA 5B1AC 1Y98A 3L7NA 3FFWA 3MXOA 3N6RA 1TM3E 1NYTA 1M10A 3MOSA 2UUAB 1ZVKA 1YDEA 4PSCA 1IJFA 3T1QA 2H2WA 4LVNA 4JXXA 4RHTA 1SU7A 2Z8ZA 4LLCA 4GNRA 2Z09A 3PEVA 3KR9A 1VYKA 1K5HA 2V74B 5LDDC 2VJPA 2WYHA 4EY8A 1L4NA 1GPYA 2NPUA 2NXEA 5EKXA 3ADKA 1G4WR 1JG3A 3VTAA 2VHTA 1UMDB 3AZPA 3T0GA 5T6MA 5K8VA 4TTIA 1NBME 2VDOB 1LVGA 4DDMA 2HNBA 1RQ2A 3P94A 4CMGA 4KQGA 5EZQA 3L7BA 2ZRGA 3CT4A 2VSOA 3ZU2A 4WHMA 1E9SA 4KDFA 1NQXA 1WU7A 3CZ9A 3GC6A 1NI4B 1YL6A 4EUKA 4PXYA 5LXTF 4MCIA 1FDIA 4OXQA 3V46A 1AS0A 3LPCA 1V7ZA 4OX9B 4QYIA 2DEUA 3SVZA 3IIMA 2C58A 4DCJA 2OBFA 5KUTA 4F21A 3CAXA 4WJZA 4I99A 4HB3A 4MRSA 1NAHA 3QKSA 3TJ6A 3M6UA 1BKSB 2MMCA 2AMVA 1MQSA 4YUYA 4RLSA 3REOA 2PX8A 1DO0A 3DMNA 3PHCA 4CLXA 1SJ9A 2VRCD 3U9LA 4IHJA 3TUIC 5HFJA 2WWYA 2GNOA 2JIBA 4EMBA 4F1KA 2ZTUA 3FNGA 3NJ8A 3RBXA 3O1LA 3V1KA 2V45A 3DNMA 1CK4A 1GA6A 4BKRA 2TS1A 2DFPA 1D0YA 1SUWA 3FI0A 5KNCH 4JBNA 4YAGA 2X9VA 4G5YA 2JGLA 2A6EF 3UMYA 3N0TA 2Q8PA 3HWSA 4WXMA 3AUXA 1Z0AA 1N5IA 3IEMA 4NYJQ 3L1UA 2Z30A 4I2VA 5L0IA 2RHMA 4L16A 5E6RA 4Z9YA 3OIDA 2AYYA 3BDIA 3O8DA 3UB4A 1L6IA 1PG0A 1W4LA 4F38A 3CSDA 1CDOA 2G5CA 4L0DA 2W71A 4A2WA 2QZPA 3ZOZA 3IPLA 3STTA 4URFA 1XDUA 1YU6A 3RNLA 1YKSA 1A7EA 2BTQA 4EW1A 1PZGA 4N49A 2VP6A 3LUTB 4UHEA 3OTWA 1D0IA 5G0SA 5KQPA 1W0JD 5JG7A 1RWOA 3IAEA 3L1VA 5E9AA 4I5FA 1Z6QA 1QIEA 5LPNA 1H05A 2XGMA 1TU3A 5K0CA 3BWCA 2FGYA 2PHZA 4RADA 4FNAA 1GFSA 3Q8MA 4UTVA 1ZITA 3R7LA 4B3RB 2C7BA 1NXSA 5KNBD 3BFVA 3NVMB 4REOA 4KBYA 3OX2A 4A0GA 5FADA 3ZG1A 4MW2A 5LP1A 4R5HA 3IR7A 2IM8A 5LQSA 4JI3B 2Q6LA 1GNQA 5COFA 4MLCA 3ASOC 3DV9A 1JRLA 3QBEA 2AK2A 2VTBB 4BBPA 3S55A 3BN3A 2RAUA 4JBXA 4NPCA 4F5YA 1SZJG 2O1XA 4AZTA 1E6KA 2R1VA 4AS2A 2BPOA 1I2MA 1Z29A 4D79A 3U62A 5AW4A 2L6HA 2WTAA 2XNDA 4BS9A 4DCSA 3HL0A 4D0GA 4D4IA 1CY0A 3EHNA 1T9BA 3EJNA 2H85A 1Y7LA 2GWWA 3WA7A 2M6LA 3E05A 2I7XA 5KX5F 2IU4A 1S2DA 4B3TB 2O07A 3A8TA 3RS2A 4AX2A 3G49A 1T1SA 4DV1B 2GX6A 3WYCA 4AP5A 1KY4A 1NUHA 3QELB 2P2SA 1TMKA 3EDRA 3WIVA 1Q6ZA 1UMCB 3RWMB 2D2FA 2NNWB 4UEWA 1DUIA 1XCOA 2W2KA 1MTOA 4GMXA 1J8FA 5I7EA 4GSYA 2HBQA 4ULVA 1A7DA 1A50B 4KC9A 1ZD5A 2PX4A 4CLOA 2JB9A 2MR6A 3W8HA 2NUAA 2KMLA 1X14A 2ZE5A 3IVXA 2H52A 3IV6A 4R40A 2EZ4A 3I9NA 5JHGB 2B5OA 5E33A 3RSCA 4JODA 4PJMA 2EGUA 4XPIA 2VDPB 1SB8A 2RGAA 3ROMA 4HL6A 5IUNC 3PHBE 4LOHA 4DSAA 4UTRA 3I9OA 3L3BA 4PBSA 2F1OA 1X80A 4FHEA 4LC1A 4YMSA 1I9GA 1EJ0A 3NPAA 3RYLA 1ZHFA 4IIHA 3WJ7A 1NSFA 1Q83A 4K9NA 3TW8B 4J2HA 4EQ6A 3VR6A 5CX1B 4EITA 3T7TA 3MUOA 1E85A 1YOBA 4H7KA 1ZN2A 4YN0B 4BP1A 4OQFA 3BVPA 3RBZA 1TYDE 4MUNA 4ZI7B 5B1DA 4H3SA 3COVA 2ZRNA 3GLGB 2NZYA 3P9SA 1AKEA 3H97A 2G7ZA 4KIWA 2FFBA 1JFTA 2FR8C 3RF7A 3IP1A 4DV6B 1XG5A 4LVUA 3MCAA 5BUCA 1NSTA 4M8LA 1WR8A 1GG9A 5DP2A 3TKYA 3N8KA 4B8YA 2YN4A 4MUMA 4Q0MA 1KVQA 3B8EA 1X7YA 3OD5A 4P1ZA 4K28A 3HKBA 4HQLA 1SIWA 4BFWA 2BKUA 1YUMA 4L4XA 1U11A 2I54A 4X7BA 2ADOA 2A1DD 3QPUA 4YJFB 7REQB 3TZBA 2OZEA 1PIWA 4U2DA 2NO4A 1YFJA 3OQ1A 4FW8A 2QLBA 3ZLVA 2NZWA 2P0EA 1QTQA 3OM0A 4BNNA 1K7YA 1VKRA 4PGHA 3G17A 4IJKA 5BVHB 5FL7D 1JEYB 5E0KB 3L8YA 3S2FA 4QFCA 3H3XA 4JP5A 5BVGB 1A1VA 1QO7A 3AM5A 1B6RA 1E3WB 3R76A 1TQ8A 1XTVA 4ZOCA 3RQGA 5ERGB 1SUDA 3IUSA 2IXEA 5ICCA 3H1AA 2CVPA 3FDZB 2C3MA 4KTVE 2G77B 3D6HA 2XUIA 2PX5A 3E5RA 4HVLA 3OQPA 2KW5A 1WJGA 2C82A 4RD0A 3VUEA 4MMYB 3EIWA 4KI7A 1E6WA 1C3OB 2PAFA 2Y9MB 3ZU6A 3DYIA 3ADCA 3C1AA 2YHSA 4DS3A 2YXEA 3I5UA 3O0TA 2IBSA 2V0NA 5IANA 3NM6B 4WACA 2WV9A 3B89A 5B1YA 1V1RB 5GM2A 1PL7A 2OZLB 5MF6A 1ZM7A 3PKIA 3QVJA 3AKYA 3LJBA 3OZUA 3VA7A 1S2IA 2BSXA 1L4EA 2YMLA 3T1OA 2OGSA 3ZWNA 2FUEA 1CF4A 1QOZA 4ZJYA 4GPD1 2ID8A 3KU1A 2XE8A 1E5VA 3CZPA 4TTQA 4KFCA 1E58A 2AC2A 3U9TA 4L8VA 5E7MA 4GVLA 3QUQA 3LWZA 5EQDA 4LJAA 3WLIA 1V11B 3LGXA 4BZZA 1AUVA 4CF3A 2DQKA 3ANLA 4EHIA 2XLOA 4NH4A 5EZ6B 3CUEF 4Q3DA 2XRFA 5EJ2A 1QCDA 1OWNA 1JG1A 2HU2A 3GQBB 3CZ5A 1HTWA 1UPAA 1LJUA 4QNNA 1G9XA 3AF5A 3NHYA 1PNQA 2ACWA 4RY8A 1U2EA 2PL5A 3QE4A 1AXRA 4GI2A 3NYMA 2QF7A 2VZ9A 4MQ5A 2YHIA 5A9TA 2QTCA 4NMHA 4IIDA 5EP2A 1KJNA 2NO9A 4NMMA 4RZ2A 3N6VA 2TMYA 1VZ2A 2P79A 2PEYA 4C1NA 1A2KC 4DQKA 4M36A 3BCSA 1VIVA 2Q49A 3HYCA 3HPRA 4N39A 4JC0A 1ZC4A 2NT3A 3OJCA 2HV9A 4HGYA 4KMSA 4UTOA 1E0KA 3EOBI 4LF6B 4PO8A 3QI2A 3UJ6A 2BFNA 5K6AC 1A1SA 4RK6A 1E7QA 1DKQA 1YYJA 1GDHA 1NPDA 2C7PA 3BB3A 1Z9BA 2IYLD 2VAVA 1K40A 2HX1A 5CLQA 3FOBA 4NE7A 5AOVA 3TZEA 4I3MA 1H5NA 2F1IA 2E2WA 1IMJA 4J0GA 4MV4A 2EVWX 5KYGA 1WMSA 1I6KA 4ZI5A 4AQYB 3FPKA 5TQVA 1J2RA 3SP1A 4JLPA 1F4PA 3SVLA 1EXMA 4J3FA 5L3VA 2BDUA 3M83A 3LG2A 3IT3A 1MA3A 4X1KA 5G1NA 3IV7A 2J7PA 5DIZA 1WABA 5AM3A 1B3RA 4B85A 4GX0A 2GBIA 1R6UA 1G21E 5IKOA 4Y6QA 3SKYA 1ISMA 4WPGA 2ZULA 2G5TA 2XQVA 5AW8A 2IYEA 2QN9A 1ZJ4A 1TO6A 1VKNA 1KNQA 2R3SA 2B94A 1CS4C 1GVNB 5HOEA 1RQPA 3AFIA 4LNUA 4DLKA 3BMXA 1H3FA 4EVQA 2J9ZB 1SOUA 4RKRA 4HAIA 4N1AA 4WUVA 2XZTA 2VCHA 2XRZA 2AD5A 1VDMA 4OJQA 2XCTB 3VR4D 4BVJA 3U6BA 5TQ0B 1QU2A 421PA 4GLLA 3AIIA 4IF6A 3GLRA 3PUXA 2H0QA 3ORQA 4HV4A 1YI0A 1AV7A 2I65A 2ZYGA 3G2LA 3E4CA 2EKZA 3WLHA 2XEDA 1D8AA 2QTTA 2P7VA 1A71A 1EK2A 2Q3DA 2EIJC 3K6SB 1W85B 5FPSA 3W2FA 2XDAA 3QG1A 2H11A 2I8CA 1SIOA 1QH0A 3Q0IA 3BQ9A 1TPZA 1IY1A 4XARA 3U13A 3FYUC 2ZOSA 1XYYA 3NT5A 2X0CA 1GWNA 5H68A 1Y1TA 1IJEA 2KK1A 3IMGA 1GCAA 4KMRA 4MP3A 1X42A 4H0FA 4AU1A 3PC3A 2W37A 2XQKA 3VC2A 4IIUA 2X2OA 4F8JA 2OD2A 4F04A 1N2GA 2BM1A 2I33A 4I4CA 1DS6A 1HE1A 1NBAA 4ZOBA 1N5KA 1P5FA 1PFWA 3O39A 2OCIA 4H6PA 1YQUA 3PX7A 5F5FA 2O2YA 1P6QA 4RXMA 5CB4B 1ZJZA 1DQYA 4OQXA 1LDBA 3K66A 3GJ6A 1BWRA 3UJ8A 5CVUA 1ZDMA 3N39C 4IDGA 5K3FA 4OHZA 5JAHA 1PL0A 4CMAA 1G7TA 1MBZA 2FRXA 3O4HA 5DXJA 1VL2A 3HTXA 3I12A 5FA5A 2GJ8A 2JANA 1AB6A 1Z4IA 4RCZA 3VC7A 4A82A 2NVOA 3IUEA 3EAQA 1AQYA 2XZOA 3RGGA 2XM4A 5GQSA 5AUOB 2O3SA 3O8QB 4NZZA 4EVRA 2ZXFA 1RKQA 2PNJA 3EGVA 2JA2A 3WRYA 2AEMA 3FCSB 3W6OA 5LYJF 4G3XA 2A92A 2GBPA 4BCDA 3BRWD 3N0XA 3LU1A 4RDIA 4MWBA 2VFAA 4R41A 1A2BA 2VTDA 2XKKA 4L50A 4I66A 4I6JA 2X6RA 2P9ZA 1WV0A 3VHLB 4HC4A 3KKLA 1E99A 4HFNA 1AUQA 2QI9F 4RVHA 5JECA 1QOQB 4YAIA 1XWWA 2VJMB 2QZJA 2R7SA 3KHTA 1PI3A 4J7XA 5HZKA 4LRSB 2AX4A 2Z15A 2WNHA 4UDYX 4JP3A 2Q6TA 1VE9A 1JZTA 4FWVA 1WF6A 1JI0A 4BWVA 2WWGA 4AG5A 1ILEA 4RD9A 2IE8A 3LK7A 621PA 2PGLA 4URYR 1BJKA 4TVBA 3I9KA 5GIPE 4E88A 4X0EA 3GARA 4TMZA 2QJRA 1H6CA 3PWTA 1G16A 4PX3A 1SUFA 5J23A 4HLQB 1SBQA 3EVBA 3F6EX 3EGXA 3JZAA 1MH1A 3W4YA 5JH7A 2DWOA 4I4TF 2DHRA 3TSAA 4KDEA 1CG6A 3IVCA 5FBVB 3MF4A 4LW8A 3QEJA 5E7QA 2ZT7A 2O7QA 1FQKA 2C2WA 4PZAA 3NOVA 1NLMA 4AO8A 2PZKA 1NC3A 2O5RA 3CPJB 1XTKA 3FYUB 2C2YA 4KO1S 3QXCA 3VQTA 2W6ZA 1P7WA 4ARAA 4R3NA 1JG7A 3RVKA 4UFPA 5JDCC 1W2HA 2ZYTX 1G2IA 2OO5C 4OAPA 4FDMA 2NO7A 5F1PA 3T5MA 4LHEA 4XB1A 1WXGA 2A86A 2RGYA 4ISCA 4ZVPA 5B6JA 1YL5A 3JWHA 3GJ5A 4EB8A 2J0SA 1ISHA 2VKQA 5AM2A 3GT7A 4GZ3A 3SIWA 2YW2A 1IUNA 3ITEA 4FJ0A 3FNRA 5AIBA 4B4VA 2R60A 3AR8A 5EWMA 2EBFX 2ZR7A 1TFOB 4QXOA 2JNWA 4YJ3F 2QTAA 2R1TB 3S2ZA 1KI7A 2HL6A 3I72A 4DRXB 2HS5A 2CC2A 1H1TA 3UOWA 4A6DA 1YHZA 2YL7A 3UGQA 4BRUA 1J20A 2DFVA 4CQLB 3M5DA 4M1EA 1U2GA 3ZTYA 1FXSA 1ZJ6A 3TNJA 3GLHA 1OLXB 3SC6A 3N2KB 4INJA 2D6FA 3L9WA 2ZBPA 2DFNA 4EP1A 1OOEA 4EUSA 1BX1A 3GRPA 1PS8A 2ZYRA 1Z6XA 1CEXA 2JD2A 5HUJA 5HQ3A 4N8DA 2FZEA 4DLTA 4AE4B 2VS1A 1GQSA 1A88A 1RWXA 2Z5FA 3QSYA 1LI7A 1KPGA 5BN3A 3WB1A 3TR0A 2IYAA 2QL9A 3CSUA 4IXDA 4TWRA 1GUBA 1QQAA 5H5JA 3EA5A 1DTWA 4KQJA 3DZFA 2OQIA 2Q8NA 4M37A 5CVEA 1VPWA 3VZRA 5ECYA 3DVRX 1TYEB 4GYKA 2WOOA 1SHJA 2XMCA 2VYVA 2NADA 2KSQA 3O1JC 5IT9A 3ZTWA 3EVTA 4R2XA 1IN6A 3DZCA 5LMZA 1B6SA 1UC8A 1QTIA 4RKYA 1PGOA 4MWTA 1KO8A 4DLNA 5BPHA 1TMGE 3RFVA 1V4VA 3LQ2A 4B6QA 4Q9HA 3QNMA 4N3CA 4JI2B 2ZBGA 4MVJP 1KYVA 4RVFA 1GTMA 2PD4A 4P7JA 3GWLA 5SYAA 4NU6A 1P4JA 1YS2X 2L0XA 1L1FA 4CM9D 1YARO 2BMWA 3CGWA 1NZDA 5HIJA 2ZM5A 3REGA 3VSAA 4B33A 3RYFA 3TTWA 4DB4A 1OV4A 4TROA 4JKOA 2RB4A 2W43A 1HETA 1D5WA 2PBFA 2LWIA 4KGXA 1SD1A 1QVRA 2ZQYA 3S4YA 1DNPA 2P1DA 3SMVA 1TIBA 4L28A 3OUZA 2ECFA 5JSFA 2AG1A 5C0OE 5KNCD 4HX9A 2QSJA 1SVSA 1PQPA 1RXVA 2GZRA 1C9KA 2IKSA 3ECAA 5EQTA 4E1BA 5J2UA 2FEWB 2YLDA 4IVRA 4L3OA 3PNBA 3DMPA 1GXSA 1NPTO 4DRJB 2XVZA 3IESA 1WCIB 2D7CA 3QUTA 5E1OA 3IUMA 3NS7A 3QXXA 4YASA 1B15A 3AXSA 4NNOA 3ZH2A 4V0KA 2Z3WA 5CDSA 1QDUA 4ARZB 3KFVA 5IKEA 2WR8A 3FY4A 4WKGA 1VLTA 1LDYA 1L1RA 1Y8RA 4CIHA 4LDJA 4CMKA 1PNVA 3N75A 3AF6A 4ZYYA 1E8MA 3WDLA 3OEYA 4OSOA 4II3A 4V0ME 3QZCA 4LJLA 4RUKA 2XMRA 3S1AB 1KBOA 1Z15A 1MAWA 3UAWA 4Q82A 2AMJA 3IR5A 3PQ6A 3PSAA 3A1FA 3KYBA 1VLSA 2JATA 5LNK6 4M0EA 1JLHA 4QM6A 3CE9A 5CM2Z 4ODIA 4OL0A 1SCDA 2EFYA 4HEA1 4HQKA 5KEIA 1AF7A 5D91A 1NKTA 2IOHA 4FKBA 1NVAA 3B6KA 4IWYA 3UMCA 5TDHA 2EATA 2R8EA 4E09A 2F00A 5AWFC 5HDQA 1FFDA 5B3JA 3ZWQA 4S12A 4TLCA 3OEHD 3P9ZA 3LKBA 3HXQA 4WGYA 4MDYA 4ARCA 4BO0A 3D81A 1OYOA 3AGUA 3AUJB 2Z6UA 2FR0A 3AJRA 2RH9B 3ZTZA 2ZZNA 1C9NA 4JT2A 3HEMA 4YS6A 3P0JA 6ABPA 5JXGA 2B0JA 3HSYA 1H4TA 1GQ2A 2OOSA 4AECA 3I09A 4F2DA 3KVRA 3WIOA 4C04A 3MTBA 2FHSA 4RANA 3S9OA 1XFDA 2B21A 5MGNA 2AXNA 4RDXA 1LC0A 3QLUC 1ZC3A 5E3JA 5KTOA 2WKQA 2C61A 1C8LA 3L1IA 4LFAB 4MB2A 2RGWA 3HJTA 1O95C 3KFXA 1AUXA 2ZI6A 3CURA 4EKGA 4JC8A 1NJ5A 3RREA 5BWBA 5KSWB 2REQA 2Y05A 2XUQA 4P84A 1DCTA 1XB2A 2HHAA 2ZUFA 2Q27A 1J56A 2JGDA 4KOEC 3OUUA 1ZEJA 1TL7C 1I32A 3W2HA 4JUBA 2C78A 4IQGA 1OMOA 1HSZA 4AMVA 4A36A 2A4KA 2Y0BA 3JRXA 4RH3A 1MOPA 1U3CA 3WA6A 4LQ4A 4HH0A 3BSYA 4OJMX 4Q3BA 3GW8A 4GM4A 1WSAA 2RH4A 1QANA 4CDVA 3ZDCA 4OB8A 4E5PA 4F3RA 1OI2A 3FYDA 1D04A 2ISSD 1T2UA 1YHNA 3G0BA 2PS9A 4Q24A 1O3UA 2WKWA 3SYTA 3NATA 4TKZA 3RVBA 2VJCA 4JH0A 5AJTA 4WOKA 5A9SA 3CSSA 1OJ7A 3OOHA 4PRZA 1E5XA 5P8WA 3EPKA 4RK5A 4ZYXA 4CT4B 2B92A 2Z56A 1BXKA 1QTRA 5TSDA 4G63A 3JATA 2XT6A 3FMSA 4CKWB 1SHZA 4PO1A 3MGAA 3AQ4A 5DK4A 4IS3A 1GS9A 4Z4QA 4HWSA 4CLRB 4CM3A 4YHBA 2XZDA 4QG7A 4UTNA 3RAFC 4NVRA 1H0RA 4X6XA 2OU6A 3MFYA 2Q7OE 4L72A 4N12A 2IUYA 2OD7A 2P9BA 4B4OA 2A9VA 3DBLB 1DRUA 2GCOB 2XXAA 3TIGA 2Q0SA 1OFUX 4IQFA 5IASA 3U3JA 1O6ZA 1WNTA 3CGGA 2RC5A 3DVSX 1VKHA 4IJQA 2WU3A 1M7GA 1QQ5A 5D5PA 4CEJA 3L7KA 4QQNA 2WFAA 4BX9A 1W8IA 3IILA 3LUBA 3MMZA 1Q0GA 3ZKWA 4RIHA 5LA6A 3QTBA 2ZJ4A 2QY9A 4S24A 4U2KA 4Y6RA 4NBTA 5CFNA 3ND6A 4QLOA 3T12A 3GOHA 2ZETA 4Y98A 1EKYA 3OPNA 3C8MA 3GCZA 1HMOA 1TEXA 2CJPA 3INNA 4II7A 1H6BA 2XYHA 5ALXA 4MJXA 5F7ZA 3A9CA 2OJQA 1XNRB 4EAAA 2H16A 3L0CA 1JLSA 4N40A 3ESZA 2YL0A 4Z7OB 2W2LA 3CQ9A 3UFBA 3BAZA 2QX8A 1X1EA 5CIYA 3DD1A 1QP4A 1AKTA 3AFMA 2PVPA 4ON9A 4RPJA 3T3IA 4GMKA 2AWCA 2D5BA 5E6SA 5EKUA 1ODCA 1UPXA 2QX7A 4JLJA 3A9SA 3PHIA 3N8IA 1Q5PA 3L0IB 4TYWA 3A6FA 3I64A 5T3TA 1O87A 4PRYA 2OKCA 3LL7A 5CH8A 1OY1A 1P72A 3MTIA 3PLAE 4QJ3A 1KS2A 1PK9A 4MW1A 3Q0EA 1KK3A 4GI3A 2OLJA 1IZZA 2XBUA 3BCUA 4W8OA 3X43A 1FFXA 5AVQA 3V4RA 1MX3A 4AN1A 1XAHA 2KQUA 5DXFA 4HNGA 3HFGA 4Q3CA 1K04A 3RTBA 3EB9A 5BMVA 4TL7A 3ZNNA 1KWGA 3WJAA 2QVGA 5CLGA 1YS6A 3FDFA 3DOHA 1P9RA 3ZE9A 4ZZIA 3T9CA 2ZIUB 5JS8A 2VAPA 4DVGA 3AJDA 5B7PA 2PD6A 1VLQA 1UKEA 3X1MA 1BRTA 2XW6A 2XGOA 3D4IA 1O9HA 1ISJA 4HJXA 4LC0A 2PD3A 1L5WA 1M6VB 1I7LA 1OTXA 2G07A 1XQ1A 2GDZA 4P36A 2ZIWB 4CGZA 1KVRA 1Z2PX 1XTBA 4OIOF 4QFDA 1XCGB 1LK0A 5AHOA 3V4VB 2Q9UA 4AJLA 3ITKA 1Z13A 2HA4A 4R9VA 4B31A 4NNPA 4UDXX 1NW7A 3Q8WA 4WKCA 3HA2A 1RAFA 2QJWA 2EFJA 4C5BA 5JI3E 4A9AA 1R66A 4CBEA 2JVIA 2N42A 3KAQA 2HCFA 4FLFA 3KDSE 4EG7A 5HRAA 4HDMA 3RTDA 1FJHA 2O14A 4WAUA 4LYHA 2A59A 4H7EA 3WGZA 4D8VA 1OUMA 4DV4B 4XQ1A 3AWDA 4B1FA 1FBNA 3T0FA 3H5NA 3NRBA 5ENVA 1NQTA 2QVBA 3GD5A 3L82B 4DLBA 2CXSA 2GTIA 1E9EA 2ZJFA 1YJBA 5FNZA 3KHUA 1Z4NA 3LWBA 3K15A 1PZFA 5DN6A 3ZWYA 3MIIA