3SYNA

Crystal structure of flhf in complex with its activator
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
258
structure length
258
Chain Sequence
b'PEPLRKAEKLLQETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVLFGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYRIAAVEQLKTYAELLQAPLEVCYTKEEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGFVRMLCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar biosynthesis protein flhF
publication title Structural basis for the molecular evolution of SRP-GTPase activation by protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Protein transport
total genus 92
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3synA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3synA02
4D2IA 1WRBA 2HXYA 2XZOA 4ABYA 1D8TA 2NZJA 4GOXA 2VF8A 4HEJA 2IT1A 1LFDB 2A9KA 3L8ZA 2V6JA 2BBOA 4GFDA 5K8UA 2VHCA 1UBGA 3AP3A 3VMFA 2MMCA 5JSZB 4BFVA 1EESA 1J8YF 1F48A 2IEZA 5AUPB 2EW1A 3CH4B 1NSFA 4B44A 1R8SA 4X8MA 4ACBA 1G3MA 3NEYA 2WWYA 3TUJC 3PUWA 3B8HA 1JAIA 1KY3A 3VR4A 3VX3A 2ODWA 3BFVA 4DKXA 3CM0A 4EFMA 4CEIA 4QOSA 3KB1A 4OHWA 1N6HA 1OFTA 3OEED 4YMWA 3KKQA 2ZI4A 3VR3A 3QSYA 3P26A 4LBVA 4TSFA 4PX9A 3AVXA 2E1RA 2QGZA 3ZVNA 4O3MA 4B3GA 3LAWA 1E2GA 4P4SB 4HUTA 4FMBB 1GDDA 4KFTA 4Q21A 4MRSA 4P4TA 3I72A 2B7CA 4TQ9A 1SVOA 2GVDC 2IF0A 1W4BA 3CNOA 1RJ9B 4G5SA 3KZ1E 5SZHB 1XCPA 4GNKA 2QMHA 1U8AA 4Q1AA 1PZNA 4N3NA 1AIPA 2WJJA 2WSSA 4Q4HA 2IYQA 4LUCA 1XPOA 1XRJA 4R71A 5HE9A 4F7WA 2BMDA 1OFIA 1GKYA 3KB2A 4TLCA 4NZYA 1RW4A 1G291 2ZJ8A 3RRMA 4HB3A 4Q4AB 2JIZD 3EZ9A 2G88A 2OSBA 2ZRMA 3ONWA 1QF9A 4UXIA 2O8BB 3B9PA 1DAFA 5HZKA 1W36B 3ZDQA 1NBME 4YONB 3NHBA 4A6XA 4HZUA 3GJXC 1H65A 1VHTA 3AF1A 1LVGA 4MGYR 1LF5A 3NWJA 5JWHA 5FBVB 2ATVA 5FUVA 1TADA 3DOEA 3R7WB 4F4IA 4FINA 4V0LA 2YKGA 4LGMA 2LKCA 3SBDA 2IEYA 4W5HA 2BM1A 5H1YA 2OCAA 2FGKA 2G3YA 2OFOA 4DJTA 2FWRA 2IK8A 1FP7A 3ZH9B 1Z6GA 1G6HA 4NU0A 3C5CA 1E9CA 2F9MA 3QENA 4RFSB 2WJIA 3GLFB 2PJZA 3RWMB 1Q1EA 1IY0A 1CR0A 3HYTA 1AGPA 1DO0A 2ZJOA 3THYA 1W46A 3H4MA 4MUBA 4TMKA 4KITB 2QQ0A 5IRCD 2CL7X 4PHHA 2X1VA 2ZUBA 2W6IA 1SKQA 1U99A 3WHLA 2LKDA 1ESNA 1IQPA 2VP4A 2R62A 4TQUS 2IHBA 3RABA 3WXMA 1G4AE 1NVVR 3EZ2A 1TF2A 1UBEA 1XEXB 2QPOA 3TH5A 1G16A 4G1UC 1SVKA 2Z0MA 4L16A 1OIXA 2FN4A 2HF8A 4R2HA 1IN8A 4PC6A 2BDTA 2BEKA 5GJCA 4QHSA 1GNQA 3AVQA 3ZVMA 4B3FX 2P3SA 3M4YA 1OH8A 3DM5A 2C99A 3ADKA 5KU1A 3DMDA 1E2LA 2NQ2C 1VIYA 4MKGA 1X86B 4V0KA 5FBRB 2ZEJA 2EWWA 4HAZA 4RY2A 4CIDA 1GTVA 4IHQA 1FP6A 3KJIA 3MWKA 3UWOA 2FPKA 3I4LA 4FWIB 4V0ME 3R9IA 1Z6TA 5KDLA 4QBHA 3B7GA 1RFLA 4LHYA 4TQAA 2F1JA 3Q7PA 4IEEA 4LSGA 1MOZA 2O8CA 1C9KA 3BFXA 2GK6A 4HAXA 1P4SA 2DFKB 1HQYE 2YWGA 3FKSA 3QG5A 3SQXA 4POAA 2QN6A 2REOA 2J5XA 2DFTA 4FMCF 2WKRA 2ZYTX 5CYPA 1E0AA 4Q01A 4IJMA 3LLMA 1E2PA 4NCHA 5AUQA 4EIWA 1TF5A 4L4UA 1T9HA 2MSEB 4M1MA 4BZQA 4XWOA 5ANRB 1G7RA 1OF1A 2OXCA 5FUYA 3T61A 2JLSA 2NZ8A 3QKTA 3W6NA 2JLWA 1Z0AA 4LX0A 3WNDA 3OHMA 2NO9A 4PHFA 5E7IA 1CXZA 1HT1E 2G83A 1W7AA 3NC0C 3IHWA 2FFAA 2JDIA 5EE5B 3SJCA 1RZ3A 3QOFA 3W5IA 2C96A 5AWFC 1TEXA 4LI0A 3U7GA 1Y3AA 3BOSA 3I8XA 2CLSA 4A0RA 3RS4A 3G0HA 5DI3B 2KI5A 5DNYB 1B23P 3GLHA 2YWHA 5TV2A 1FMLA 1RYHA 4LJYA 2OUKA 4Q1DA 1FUKA 3TAHA 4KO8A 1FQKA 1GL7A 2QMEA 4URWR 1E2HA 3WMFA 4G01B 2WWWA 4LBZA 5DYIA 2IYXA 5CDFE 4LV6A 4BFUA 2WJGA 5D3MA 3B78A 4RZ2A 1KYIA 1KGDA 2BBWA 4NP6A 1KI1A 3LW8A 4GT1A 1JR3D 1XNJA 1Z2CA 4S35A 3NDBB 5DLQC 4Q7KA 4M1WA 1KO7A 1KY2A 4HATA 3K70B 4FCTA 2WIAA 2NTYC 5FOUA 2YC2C 4XVUA 4BQSA 4HLUA 4CDGA 4YDHB 1R0WA 1AZTA 2H18A 1CULC 4LY6A 4D0NA 3IEUA 2CDNA 3IO5A 2B6HA 4IOLA 4TTQA 3GMTA 4KLNA 4MGIR 1DELA 4B74A 1E98A 3GLGE 5AJZA 2FSHA 3NH9A 5AJVB 4LC1A 4RVCA 2YZ2A 4TZ0A 1DPFA 1O87A 1OH7A 2FFHA 2QTVB 2VHUA 3LH5A 5DI9A 1Q3TA 3D7MA 4NL4H 1ZNYA 1EFHA 1GOTA 1YR6A 3TUIC 1Q22A 2X2EA 3SC3A 2XTNA 5IHPA 1P2UA 2D06A 4UNNA 5FTMA 1TNDA 1NLFA 5JSZA 1EX6A 2HJGA 2JJ2D 2O8DB 2XXAB 1OXTA 4W5WA 4PQYA 1NVXQ 1KAGA 1QHNA 2BIFA 4NYIR 3W34A 2JJ1A 4YXWD 1G1MA 4ILEA 2Y8EA 1H8ED 3QKUA 1HA3A 4MRNA 4D6PA 2QAGC 2XZLA 2RMKA 1UDXA 1D2EA 4DHEA 2GZAA 1EFTA 3DOFA 3NVAA 3TR5A 3HR8A 1CLUA 3DVLA 2O0HA 3PENA 4TT3D 1Z5ZA 2IWHA 1NIPA 1YZTA 2FE4A 4P4SA 1JJVA 1YZKA 1M6NA 4LJ5A 4LYHA 1A5TA 1SXJB 1ZW6A 2GZDA 5CJ2A 1RJ9A 3N70A 4I1OA 3WYGA 2F7SA 2QE7D 5HKKD 3B1VA 4KVAA 4OQNA 3BH7A 2GCOB 1KTVA 1UM8A 3BS4A 1Q12A 1SVWA 1VG0B 1QHIA 1UEJA 2GXAA 3N2IA 4DCUA 2GF0A 3KKMA 2XNSA 4K81B 4E09A 4WA7A 1JJ7A 1IJFA 2LWIA 1G8PA 4UNPA 1U8ZA 3B82A 1XTRA 2ORWA 1T0HB 2ERYA 2NOAA 2WAYA 4Q4AA 4EQ6B 5BYKA 4I99A 1KNQA 1FMJA 1LV7A 5FBQB 821PA 2O8BA 2XNDD 2Q3FA 3K0CA 1ZCAA 5FL3A 4DUGD 2CL6X 3QXJA 5FPTA 3MSXA 1WXQA 2WJHA 3LQQA 3AVTA 4P3YA 1YQTA 3R7WA 3A1UA 3WRYC 5L3SB 5LPNA 2GK7A 4GBMA 4Q7MB 2QM8A 1Z08A 4DB2A 1LNZA 1AN0A 1E32A 4EFNA 5BXQC 4IFBA 1P2SA 2BM0A 5DH9A 1S0UA 3OAAD 4F93B 4D0LB 4RFSA 4DZZA 1R10A 2ZRCA 1OW3B 3C8UA 3AF0A 2CK3D 1OH6A 2P67A 2PT7A 2JATA 2XTMA 2ZR9A 3AKYA 3CX6A 4BGDA 3F8TA 4M22A 2DBYA 1J2JA 3QIAA 5SZJA 4BEJA 1UKZA 4U7DA 3TE6A 1ZUNB 4M1SA 3EX7C 1R0YA 4Q47A 2WOJA 3A8TA 1HT2E 2ZU6A 5IF9A 1NKTA 1W48A 1NIJA 3EPKA 1G20E 4KJZA 4LC0A 3X2SA 2YOFA 3B13B 4ON9A 4F91B 2CL0X 3SJZA 1XEXA 1Q0UA 2FJUA 3AF3A 2IYWA 3RS7A 1N6LA 3ZZTA 1N5JA 1MH1A 4DLXA 3AKEA 4DVGA 4CYMA 1AGRA 3O8CA 1ZC3A 1JXMA 4PXAA 4LHXA 4TMVA 5EXTA 4OHVA 3EASA 2FX3A 3LWNA 2CCKA 4E07A 3B1YA 4RCZA 2EFGA 1H8HA 1IXSB 2YYZA 4XVRA 2VSOA 4OJKA 3EWAA 4KFRA 4Q03A 1JR6A 4I4LA 5SZIA 4JVSB 3D3QA 4UQOA 1JBKA 3C14C 2GJAA 1MRSA 3LXXA 3ND9A 3BBPA 4RD6A 4DCVA 3NHAA 1X6VA 4WW0A 3UIEA 1Q1BA 2RGNC 2DR3A 3GPLA 4XD7A 4LV5B 4AG6A 221PA 1TUEA 5E7MA 2FSFA 2H5EA 3IO3A 2FEMA 3M0EA 1SGWA 3FTQA 1TX4B 2JLUA 2MSDB 2VP5A 3AKCA 1RRPA 3BK7A 3LX8A 3B5JA 4DXAA 3JZMA 4KXFB 3NIBA 3QKSB 4A4DA 4PC3A 3DDCA 5TVKA 5IK2D 3OZXA 2FF7A 2A5YB 2XAUA 5J4HA 3IQWA 3LVRE 2J3EA 1IAQA 5TARA 3R20A 4ITRC 2QM7A 5FPKA 1SKYB 1VG8A 4TYYA 2WZQA 4NPHA 2CHQA 1EFCA 2C03A 2VRWA 4QL3A 2PMDA 4D81A 1NF3A 4Q1EA 1GL6A 1N6IA 1E2DA 1VCOA 3QXHA 3EIQA 4G3XA 4L15A 4W9MC 2BBSA 1CRPA 4HYYA 3DO6A 1AZSC 1TQ4A 2C9YA 3FFBA 3FB4A 1KSFX 2OZEA 3AVVA 5DN6A 3EC2A 2HDNB 5DI3A 4EJSC 4A8JB 2CNWD 2QROA 4A0HA 3CWZA 4YMVA 2IYZA 2GWHA 1E69A 4YMSA 3CKLA 4IDHA 3I92A 1I2MA 3V4FA 1KI2A 3TR0A 1V43A 2CHGA 1BH2A 1IM2A 4JLKA 1HV8A 1M7GA 4NBSA 3TSZA 1G41A 3QPUA 3OESA 3FOZA 3T5DA 2AXNA 2R6DA 3VNVA 1OKKA 1W49A 5JS7A 4BFYA 5H68A 2W2VA 5FUXA 4EPRA 4GL2A 2ODEA 2ZE7A 1Z07A 3PUVA 4NYIQ 5LD2C 3M1IA 1IY2A 1T8UA 4HUQB 5HR5A 2ANCA 4IDOA 1E1QD 1C1YA 3KQNA 3ADDA 2G1JA 2QNRA 1F3OA 4I1VA 1D2NA 1J99A 2BCJQ 2ZYVX 3NBZC 3VR6A 4OK5A 4R2IA 3CPEA 1XMVA 2DPXA 4XTRA 1XXHB 3QXSA 2FFBA 1U9IA 1KZGB 2CVFA 1MV5A 2ZS9A 3KUDA 4IEIA 3KQUA 1GP2A 3RNLA 5IT5A 1G3IA 1R6BX 5FBWB 3EXAA 3LBNA 1Z22A 1Z28A 2QRZA 1OXSC 4BE7B 3T1TA 4PHTA 4B3DA 4ZDWA 3THXB 4P32A 5HPYB 2BV3A 1ZRHA 3MD0A 2WSMA 4A15A 1PLLA 2WPDA 3IIMA 5AK0A 1A2KC 4QBFA 1DAKA 2PJRA 3RLFA 2O8DA 5AUOB 2XXAA 3U3OA 3A1TA 1JQJC 3L8YA 1E9SA 5FOTA 2R2AA 1IN6A 3CNLA 4LHWA 1YHNA 4NH0A 5CB8A 3SDZA 4B71A 1N6KA 2Z43A 4HAYA 4RD4A 2PCJA 1E0JA 2G1KA 3KXLA 1II0A 4OQFA 1W5TA 3QF4B 4Z1MA 4M9XA 2RGCA 2WMNB 4ZV4A 1UBFA 2Q0HA 4KSCA 5P21A 1E9DA 1YZUA 2ZANA 2WBLC 4GPTA 4KBGA 3SHWA 3IIJA 3ZZUA 4JYCA 4HAVA 4MRRA 3OE7A 1SXJA 1DVRA 1E79D 4UXJA 5EUQB 2HJVA 1HUQA 1ZD9A 3EIHA 2GCOA 5HCIA 1EFUA 1Z3IX 2RGAA 1S1MA 2F9LA 4OHXA 1FPMA 3NKVA 4DEXA 2Z6VA 4II7A 2A5DA 1OYYA 2ZRNA 5JWOA 1OJLA 2KJQA 2ZSEA 4TL8A 4MYTA 5GJBA 1QVAA 5JHGB 5JJIA 1ZIPA 3D31A 4FI3C 1BMFA 3ZD6A 2YOHA 2WAXA 5KPDA 3F3YA 4O2LA 3QUSA 4UKDA 2JLRA 4B48A 4EQ6A 5JZVA 4R9UC 5FUWA 4L8GA 2C2HA 2D4HA 3Q9LA 2NPIA 3MWLA 1I2DA 4LJ7A 4UNSA 5DO9A 2MSCB 4ZCLA 5DHFA 1KDRA 3BXZA 2QUZA 2D7DA 2ZJBA 1IN4A 4GDFA 5GJWC 5JI2E 3J81k 3L2OB 5L3SA 2PLFA 1KJYA 2DWPA 4JT2A 3CX8A 4PAQA 3UG6A 1BS1A 1M34E 1T4GA 3KJHA 2C04A 2R8RA 2DWQA 3OEHA 5LDDC 3ADBA 3CB4A 4PSAA 2AFIE 1CS4C 3IBGA 4D82A 4FWTA 1NMXA 4MH0R 1W47A 3P27A 4EUNA 2FFQA 2XOKA 3K53A 3VR2A 3R9XA 1VMAA 1NMYA 4QXAA 1I4DD 1ELOA 3QKRB 4EPWA 5B58C 3KJGA 2BVNA 2C98A 1CJUC 5BN3A 1XFAA 1SHZA 2XB4A 2OG2A 1N6OA 4RZUA 3CF0A 1KDPA 3T1OA 4A82A 4BLQA 3HR7A 1I4LD 1OHHA 1RRCA 3ECCA 4OHYA 1KO4A 1S4QA 2IBMA 1G19A 4DT1B 5KO2A 4MDFA 2WOOA 4GOJA 3UMSA 5KDOA 2C77A 1R5OA 3FVQA 4NTZA 3AQ4A 2VBCA 3QPVA 3FWYA 4LBWA 1YZGA 3RRZA 3KQHA 3RS5A 2ZRJA 1KAOA 3GEHA 2IXEA 4TL9A 5AR1A 1FOEB 3ZIAA 3LNCA 3HP1A 1UPTA 4KVGA 4OBEA 3SFZA 1XTJA 5J4KA 2QU8A 3PIRA 2GESA 3LLUA 1F6BA 1QHGA 4JYBA 1EFRD 1ZD8A 4LJ4A 4UXHA 4OI1A 4D0GA 3A6PC 3VKHA 3G5UA 1WA5A 1SQ5A 5CYOA 3AVUA 1UDWA 1F2TA 4NE2A 4DC9A 2OCBA 3VNUA 1KO1A 2IF2A 3DZ8A 1U8YA 1IONA 1VCIA 1IXRC 3QKSA 4PC2A 3AGPA 4JL6A 2F3TA 3SEAA 1GILA 1QDEA 2YC4C 1DOAA 2Q9AA 3VAAA 1GKUB 4EKDA 2QP4A 5DISB 3GLGB 1NJFA 2D74A 1CJMA 4DB4A 1L2TA 1T3HA 2GCPA 5IDVA 4IOJA 5KSPA 3K0EA 1RRFA 1GWNA 1GRQA 3KX2A 1XEFA 1E1RD 2WVJA 4RKEA 3R8FA 2H7VA 5B64A 4C3ZA 5KNCA 3BB4A 2C9OA 4WXPA 2J87A 2ONKA 2W58A 2BKEA 3MGCA 1TQ6A 2Z4SA 1ZUIA 2GETA 3SJBA 3SJAA 1S9DA 5KSZA 3OFND 1G5RA 5KSYA 1UAAA 4C7OB 1GNPA 4AYWA 2EFCB 1F2UB 3F0TA 3VR5A 1AS3A 3SFVA 4A8JA 4ZIRB 3K9LA 1I4TD 1LF0A 5JCZA 1KI3A 2ZI3A 3B1WA 5LB4A 1IBRA 1NN5A 4LRWA 4RD2A 3U3JA 4XTCS 2JGNA 2QBYB 5SZKB 1YE8A 3Q3JB 2WWHA 1G9XA 4M1YA 2FU5C 4LWZA 2HF9A 2FMXA 2ZI9A 1CJKC 1VG9B 1E2NA 3U44A 5J5CA 1CP2A 5FL7D 3EZ7A 1KMQA 1ZM4A 1Z47A 2ORIA 4AY2A 3X1XA 4HUQA 3S1AB 3A4MA 2Q3MA 3Q85A 1BOFA 5FH9A 2P0EA 1S2MA 3RC8A 3P32A 3AV0B 4QNRA 2IYTA 2P2LA 1BIFA 4C30A 1KKMA 1E99A 2KBFA 5BW8A 1XXHA 1G7CA 1Z29A 5JS8A 2P6RA 1WQ1R 1RYFA 2ZJ5A 3MRSA 1S3SA 2HLDD 2DFLA 2ZITA 3AH8A 5G40A 3GJ6A 2FA9A 4DDVA 3THXA 4YDSA 1Z6AA 4ZDKA 2J7PA 1MABB 1R0XA 3UANA 4ESHA 1MO3A 1NN1A 1PV4A 1C4OA 1D9XA 2O8FB 4FCWA 1DBSA 4IW3B 5KNDA 3R8CA 3TVTA 2IXGA 1JALA 1NN0A 1US8A 2K5UA 3CRW1 3UMRA 3LV8A 4QG7A 2QP9X 4BUJA 1AKEA 1N2CE 2GJ8A 3GJ8A 1JEEA 4F4JA 3CRQA 1E94E 5EP4A 4C2UA 3NBFA 1VPLA 3KTAB 2F3RA 4HB2A 2H16A 2GJSA 3I62A 3CRVA 3QF4A 1G8GA 2G77B 2AXPA 2WM9B 5CK5A 3NXSA 3AVOA 5B30A 3BH0A 1FX0B 1QZXA 3AVPA 4FN5A 4HLQB 5G41A 1RIFA 2ZI5A 1G17A 4US0R 3CIOA 2QORA 2YHSA 2QENA 1CU1A 1F60A 1OPXA 4HDOB 3TW4A 4M8NE 4LJ6A 1TL7C 2NGRA 1YU9A 3FMFA 3TRFA 2VHQA 2H8KA 5C18A 4YC7A 2GBLC 3WNBA 2RGDA 1TU4A 3BH6A 4HI0E 4IDPA 4AWXA 1P62B 1WMSA 2YWFA 3KL4A 5FR2A 2IL1A 4KODA 3JZAA 1W5SA 4ZDJA 1U0LA 1S8FA 5GADl 4U00A 5JEEA 3O8BA 1JEDA 2BKUA 3O47A 5BWMA 3Q5EA 5M04A 5B2ZA 1ZCBA 2F1IA 4MYCA 4X8HA 3WBJA 3TGPA 4ARZB 4JVMA 4BZXA 3AKDA 4Q18A 1TF7A 5KOYA 5H8WA 4MYHA 1E2FA 4K46A 1UF9A 1RRGA 2ANBA 2IHYA 2HXSA 1A1VA 3W3AA 3WY9A 3IEVA 4PPGA 1E2MA 1G64A 3RAPR 3IIKA 1EX7A 3VQTA 1GFIA 4LYFA 2ZROA 3FMOB 3LDAA 4TMTA 4DDWA 4PZLA 2QMOA 2VP6A 3K0AB 3ND8A 2IYSA 2V3CC 2HYIC 1VYUA 3U60B 3HJNA 3HPRA 3CZPA 4JLVA 3GFTA 2PEYA 3L0PA 2OILA 4Z8YA 2ZXUA 2IC5A 4QC2A 5AJXA 2UZIR 3ZVLA 4AYTA 3MMPA 2OAP1 1GAJA 1KJWA 1QRAA 1VDZA 3AP1A 3IQXA 3V9PA 4PO1A 5JMTA 3QKRA 4XSGA 4DRZA 5CLQA 2HT6A 5FOSA 1W2HA 5DN6D 4HDCA 2D2EA 4JLAA 1D9ZA 1Y63A 2GEVA 2XSZD 2ZETA 3THWB 4JLJA 4OKSA 3UKDA 2ZSBA 3I1FA 2XX3A 4QGFA 4WZAE 5KTYA 1KK2A 4JZKA 4JLOA 2R9VA 1JNYA 521PA 3PR1A 2A2ZA 2ZAMA 2ZSAA 1NVWQ 3BJIC 4BLRA 4DT1A 3Q5DA 3VKWA 3IPXA 2RGGA 121PA 3OEEA 4ERNA 1YZQA 2GEUA 4C0LA 2YOGA 4Q1FA 2ZRPA 5HCNA 4AD8A 3SYKA 4IOKA 4ZCMA 3RRNA 4C9BA 4A92A 2GXQA 4ASUD 4DCNA 5LB2A 3UWKA 3VU9A 5FTKA 3LVQE 4C0AC 5E3HA 5KSOA 2ZRKA 4GZMA 2BMJA 2VL7A 2QAGB 5CDFA 1RVDA 3K09C 4ZKDA 4OQXA 2IYUA 3E70C 1QHSA 2BCGY 1M7HA 1SZPA 1YR8A 1JI0A 2EU8A 1U94A 2X77A 4JVLA 2AD1A 4CEHB 1Z0IA 2NO1A 3CRRA 2A7QA 2B8WA 1RE0A 2J46A 1DARA 1Q57A 3B1ZA 4PC7A 1E3MA 1OYWA 2QG6A 1GRRA 5JI3E 2ZRIA 3DPUA 2FGJA 4TMWA 2JIZA 4YMTA 2C9CA 2O8EB 2J0UB 3PXGA 3VX4A 4PQRA 2H1LA 1ZMXA 2QY9A 4AC9A 4B35A 4ZI2A 1P5ZB 3GLGA 3KJEA 3GLFE 4TYPA 3X1YA 1ZINA 3IHLA 1II9A 4JKIA 2AK2A 2V7QD 3TJZA 5FTNA 2HCBA 2A30A 4RD1A 4NHOA 1HE1C 1GZSA 3WYAA 1LB1B 1L8QA 2D2FA 2G0NA 3GEEA 3V00A 1XBTA 4PSKA 4DWJA 1KNXA 2EFHB 1G5TA 4TL6A 1NVVQ 4DIEA 4MUAA 3I5XA 2FEOA 4AG5A 2XB2A 3RHFA 3FKQA 4J0QA 1E2JA 3U7EB 4H9GA 4D25A 4C7OA 2A3RA 1OFHA 2YNMA 1F2UA 4ZIRA 5L8VA 3VHXA 2IS1A 3FE2A 3L0SA 1MO4A 1DEKA 4JLPA 4PAMA 2ZSFA 3MCAA 5F3WB 1B0UA 2DFNA 1W0KD 2D3WA 4M4SA 4Q7LA 4CZ2A 2IA5A 1PJRA 1Z0FA 4WZ6A 1W2GA 4DCTA 3U4QB 4MQBA 5J4YA 2QBYA 2ZE6A 4B3BA 5JHHB 4WZBE 3T06B 1T91A 5KHOC 1KOFA 5A0FA 3RS2A 3SI7A 4WXRA 1P9NA 4M1TA 1E9BA 2EYUA 3X1WA 4B2IA 1RPZA 5TDHA 2CMKA 1KMHB 3EPLA 3R9WA 1KZ7B 3HPQA 4M9QA 2DY1A 2FV8A 1E2IA 2Q9CA 3CR7A 3P4XA 3S1AA 3THOA 2B92A 1COWD 4MKFA 2W6JD 3SBEA 4AKEA 2AL7A 2CHVA 1E4YA 4H1VA 2J0SA 1G8FA 3K8YA 1N5KA 5JCPA 1PLJA 1VIAA 2C8VA 2ZVPX 3NBXX 4URUR 2QPTA 3U5ZB 2H92A 1XJ0A 2W2XA 1XTQA 3H86A 5FBLB 1IXZA 2ASEA 1TEVA 2WWGA 2F6RA 1ZNZA 1QG2A 2ZJZA 2ZRFA 1MABA 1WP9A 1S3GA 1TUIA 1II8B 5GJVC 3I73A 4BLSA 2OESA 4G5GA 2O8FA 1JB1A 2OEPA 1ZM2A 3AF2A 3ICEA 4JJKA 2GAAA 2CE2X 3EPJA 3KDSE 5EE0A 3PJRA 1FZQA 3FGNA 2IYRA 2QEQA 5K8IA 3I8SA 5KNBA 4IXMA 4KSBA 1F2TB 1S1CA 4KFUA 5FI1B 4YQFA 1XPUA 1TU3A 3PITA 4Q00A 3M6AA 1GITA 1W0JD 1CR4A 4NONA 4BFWA 2ZU0C 3KTAA 4BFZA 1NI3A 1G3QA 3RRYA 5EXPA 5EJEA 3NH6A 5FPYA 4MGKR 5JFGA 3T34A 3GJ3A 1FX0A 3MWYW 1G7SA 2OFXA 4L9SA 4PO9A 2IXFA 1A4RA 3OF5A 4HLCA 4Q9HA 3OIYA 4KBFA 1KSHA 4TZ6A 4GP7A 4C2TA 4EPYA 3KXIA 5K8LA 1NSTA 1LS6A 4QRHA 721PA 3ASYA 1PLKA 2RGEA 4PPQA 3JVUA 2OT3B 4BLOA 3WYFA 3PEYA 1DAIA 4QHYA 4JBWA 2JEOA 1GM5A 1PUIA 1SVSA 2JAQA 3A4NA 2WTUA 3RSOA 5C1BA 1YZNA 4NYMR 1X8KA 1SULA 4UJ3A 3K9HA 1WE2A 4GP6A 4CGZA 3PVSA 4D4KA 5F9HA 5FOXA 5FOVA 2FDCA 3I3SR 4TMZA 1T5IA 4TSFD 3TQCA 4JMPA 2UKDA 3W9YA 2V55B 3B9QA 1JR3A 3BORA 4EJSB 5EQTA 2ZJ2A 2AN9A 2IX3A 3U3RA 1XMSA 3TIFA 4QFMA 2P6UA 3QF7A 2NIPA 1KK0A 2CE7A 4ARZA 3L0OA 3GP8A 5BQ5A 4D4MA 1HEIA 3EA0A 3HU3A 5DYGA 1T8TA 3GLIE 1ZM3A 2PT5A 3IILA 1EK0A 3DZDA 2WSSD 2RCNA 4M2LA 3LW7A 4ZPXA 4IVPA 2QL6A 4NCIA 4LPKA 4DBLC 3U44B 1IN7A 1YVDA 5L3QB 2R65A 3K0AA 4E03A 1E9FA 1U98A 3WHKA 2I1VB 1XMIA 3SNHA 1XD9A 4KFSA 5FTLA 3VTKA 1LTQA 1CR1A 1CRQA 3B85A 5K8TA 5LD2B 1OV4A 6Q21A 1EXMA 3QI2A 1ANKA 3ZZ0A 1GUAA 2ZI7A 2VEDA 2ZR7A 4RCYA 2AWNA 1OH5A 4Q5IA 1E0SA 3HYRA 2FNAA 2RGBA 1P60A 2QMUA 3U7FB 1Z0JA 1XTIA 2RKOA 2NPFA 2JJ2A 4EDHA 1P61B 2HEIA 1IHUA 1XF9A 2BWJA 3THWA 3CNNA 4YXWA 4A2PA 2VP0A 1H8EA 1AJEA 4OJQA 2F43A 3EA5A 3KFVA 5GVSA 2ZIAA 1VYVA 2IYLD 1MKYA 4HLDA 1R7RA 2FPLA 2QA5A 3QBVA 5KPJA 3DKVA 1NMZA 3QG1A 3V4RA 2KE5A 4TT3A 1QHYA 1ODFA 4KCGA 4D4LA 2R44A 2CJWB 1E6CA 1US8B 3UMFA 2RAPA 5LBIA 1NRJB 2YWEA 2W6ID 4LOAA 3AM1A 3MFYA 2V4ZA 3KQLA 2EWVA 1UADA 1ZNXA 4Y0AA 3BFKA 1KK3A 4KYUA 4BFSA 2ZRBA 2QT1A 2QAGA 1XCGB 2QE7A 4MRPA 1FUUA 5HKKA 4D26A 3EARA 1VCNA 2BMFA 1KO8A 4IXNA 1D6JA 1XWIA 5DGXA 1UJ2A 4PANA 4CEHA 4HAUA 4Y0VA 2PBRA 3SR0A 2JLQA 1GVNB 4CW7A 1VHLA 1XU4A 2BJWA 2J9RA 4TYQA 4TLDA 4WBSA 2IS6A 3PFIA 4QJ5A 4XVQA 4DLVA 2J0UA 1SHKA 2BOVA 5EXSA 2VO1A 2O8EA 2XNDA 1AS2A 4S2EA 4V02A 3FHOA 5CK4A 4KHZA 4DUGA 1G3UA 2W2TA 4LYJA 4Q4LA 1X8JA 2J0VA 1A7JA 2VA8A 1V5WA 1PVOA 3ZGXA 1JPJA 2KSQA 4HAWA 2FZ4A 4JVNA 1P3JA 3EZ6A 1XTKA 1Z83A 3EWSA 4FMDF 2C78A 2QAJA 2J7KA 1XZQA 3FKSD 2FSGA 5FFMA 3OAAA 4B3CA 1ZIOA 2W00A 2XEXA 2P5SA 1M74A 3AEZA 3ZLJA 2CK3A 3RYTC 1TPZA 1GIAA 4M1KA 3TUZC 3U7HB 1ZJ6A 4HDQB 3TVDA 3P4YA 4JIMA 1IJEA 5CM9C 5FPHA 5G3ZA 3ZVRA 1XEWX 1P7CA 4DLZA 4Q1CA 1Z8FA 3PEVA 1X1RA 4B6FA 3LRPA 4JS0A 3TK1A 3CW2A 3U4QA 1G8HA 1LY1A 2NO0A 3NDPA 5HTKA 3T15A 3W3ZB 3WNCA 1KI9A 1WDTA 4Q4JB 4OQMA 3NBYC 4GRAA 1CKEA 2ERXA 2GJ9A 3QQ5A 2VHJA 2JDID 1N3BA 1NY5A 2ONJA 1R5NA 4HB4A 4DSOA 1ESMA 1XP8A 2PZGA 3SQWA 3PUXA 4O0MA 3CF6R 1KMHA 4IRUB 1OXUA 5FPSA 1K5GA 4CVNA 2QRNA 3WMGA 2CVHA 4QM7A 1M7BA 3B60A 1XCMA 1A2BA 4HZIA 1DAHA 3AP2A 4Q66C 4HLUC 5AJWA 3EZFA 4ZDIA 3K1JA 3HWSA 5C4MA 3W6PA 4P0TA 1R8QA 2AKYA 4AYXA 1OXXK 2PCLA 1QBKC 3WRXC 4QM6A 2ZRHA 3L43A 1SKYE 3PG5A 3VU9B 3RDPA 3DHWC 1ZC4A 2W0MA 1DAGA 2JLZA 3LD9A 1II8A 3PCRB 1XB2A 3C16C 3IUYA 2V1XA 4AKHA 2H57A 2HYDA 1OT3A 2VP9A 5IK2A 3PUZA 4V03A 1KJZA 1XDBA 4NYMQ 3GJ0A 4RSGA 1Z06A 4CEJB 4ACAA 2RGNA 4PZZA 4XIGS 2AD5A 1P2TA 2BMEA 2NMVA 1E2KA 1JQLB 3EC1A 3N5CA 3ZD7A 2G6BA 3EG5A 1E4VA 1XTSA 5FOWA 2N1BA 3CPHA 1KIMA 1GSIA 1VYTA 1WF3A 3PEUA 2GXSA 2QQEA 2CLCX 3CRMA 1EG7A 4IFEA 2YV5A 1AKYA 3E1SA 3VKGA 3T12A 2ZRLA 4L5BA 1SVIA 2QTHA 1G7TA 3K9GA 4QJ4A 2W0SA 5JLJA 4PO8A 2RGXA 3BIFA 4GMXA 3ZS8A 2JLYA 5C2JB 2CNWA 2GAOA 3EIEA 3LQRA 1GNRA 2JJ1D 2GDJA 2B7BA 3A4LA 4A1FA 4B43A 1E9EA 2XTZA 3GEIA 1P9WA 3A58B 3CO5A 4GMDA 1GRNA 4RD0A 5EP1A 4M53A 1GG2A 4DSUA 3QNUA 4JT4A 3CF2A 1W4CA 4KU4A 3I61A 1E0KA 3KQKA 1QVRA 1JAHA 2ZJAA 2BBTA 2FH5B 2PLRA 3K0SA 4EJSA 1QHHB 2VSXA 1XXHE 4Z54A 4C4PA 3A37A 5DIFA 1UKEA 1E1QA 2XJ9A 3GD7A 2QTFA 1W36C 2ZE8A 4MKHA 3K0CC 4N0EA 2ZS7A 4A6PA 2B21A 2ODNA 2Q3HA 1HH4A 2WWXA 4O2RA 3RANA 2VQSA 3IKJA 4PPFA 5L3QA 5BN5A 1S9HA 3BRWD 1G4UR 1ZD1A 2ZRGA 3RS3A 2BC9A 5HZHA 2JLVA 1DG3A 1ZUHA 3C5HA 2BHRA 2FG5A 2GJKA 3IGFA 3MJHA 4LV8B 1Z6YA 3SYLA 1Z63A 1XX6A 2OAQ1 2Z83A 8OHMA 2GNOA 4TYWA 1W36D 3TSWA 4QBGB 3RS0A 5J47A 3VHLB 3QVUA 3LBHA 2ECKA 2GF9A 2OFWA 4I1SA 1K5DA 2OLJA 4AKGA 2IUTA 5EXXA 3O8DA 2J41A 2AK3A 1Z0KA 2OBMA 1IY1A 3PQCA 2B8TA 5JRZA 4EFLA 1NBMA 1WB9A 1EWQA 2ZTSA 2QPAA 3DM9B 3ZQJA 2IS4A 4IVRA 3IPYA 4N0DA 5JECA 1NY6A 3CZQA 1XZPA 3C7KA 4DEYA 2WV9A 3TKLA 3DKPA 1DO2A 1G3RA 2CJWA 2CBZA 3CH5A 4UNQA 5UKDA 4DLRA 2AX4A 4ZO4A 1CTQA 2DWOA 2ZAOA 5JWRA 2GTPA 1GL9B 1E79A 4F92B 1G6OA 3GLHE 4JLMA 3P20A 3CWQA 4C0BA 1FFHA 5L3RA 3LBIA 2G9NA 2ZREA 4B47A 5JEDA 1MO5A 421PA 4QBIA 2ODBA 2KWIA 2CXXA 4EPVA 4M9ZA 2I1QA 4E5UA 4E22A 4IOMA 1YJ5A 3ZYCA 1DTSA 4B3XA 4Q9KA 1OIWA 2O52A 1JPNA 1P73A 1H8HD 2VP2A 3B6EA 1KI7A 2V8OA 3LO5A 2QSYA 4FCVA 1X1SA 3E5HA 1K8RA 5FR1A 1G8YA 2ZRDA 1KDOA 2BJVA 1G5PA 2XJ4A 3QXCA 5CIWA 4A9AA 4BZPA 3LY5A 3SYNA 4QKQA 1XEWY 2XGJA 1JXOA 4Q48A 1N6PA 1YKSA 4XD7D 1NNEA 4BASA 2V54A 3HU2A 1AQYA 3ASZA 3U2QA 2VF7A 1XJCA 3BGWA 1YZLA 1XD8A 2F55A 3W8NA 5EE1A 4DIDA 4US2R 1KDTA 4I1UA 2P5TB 1NJGA 4P31A 4V0MA 2QP3A 4A0FA 3MLEA 3RWOA 4LJ8A 3EW9A 2IWRA 3KKNA 2R6CA 2WJVA 3T35A 1U0JA 4M0LA 4BFXA 1N25A 2ZM5A 4BRWA 4JSTA 4NCKA 3D6TB 4RZ3A 1UEIA 2FPMA 1WCV1 1NN3A 1ZP6A 4TTPA 3ICQB 5EZ6B 4A0GA 5JJKA 1NLYA 5D3QA 1E2QA 3GFOA 1Q20A 2OHFA 4IKEA 4LDJA 4FMDB 4OYHA 1OSNA 4KV9A 3TBKA 4PZYA 4RFVA 1P9RA 4CT4B 2N46A 4Q4JA 1KI8A 2VTKA 4M1OA 1LW7A 1Q3HA 3DL0A 4GOKA 4H1UA 2NO7A 5EZ5A 3U3MA 1FW6A 3FMIA 2WWIA 4IDNA 1U0HC 4PFSA 1IOZA 1ZM7A 5KUTA 4MDEA 3MAAC 3QY0A 4CRWB 3OIWA 1KI6A 2JJ8A 1W4AA 1TQDA 1YRAA 4O25A 4ZCIA 3O8RA 3CBQA 3IBYA 3K70C 3SN6A 4NCJA 4ZI3A 2DHRA 2GVZC 1VKJA 3A1SA 1Q21A 2A78A 2F43B 2A5JA 5EE3A 2ZQ5A 2Q21A 1XD2B 3RSLA 1NG1A 2JLXA 4D80A 2I3BA 1U81A 3BERA 4NYJR 2IW3A 4AURA 4G0NA 4L9WA 4A2WA 2V9PA 2OXRA 2CCJA 3FDIA 2JA1A 2PZFA 4C0SA 2PX3A 2WWFA 2QSZA 1U9IC 3VFDA 1EFRA 1OKKD 3QVVA 1IN5A 3UATA 3U61B 4HB0A 1NP6A 1ZVQA 2FZLA 1MRNA 4BECA 3K70D 4TN1A 4JL8A 3GLIB 2RH5A 3WP1B 1L7VC 2H17A 2WMOB 3GJ4A 5CITA 4PPNA 1K6MA 4LJAA 4XH9B 2VIIA 2GXUA 2UZ3A 2V6IA 4CEJA 4DLTA 2FOLA 3TMKA 3RVBA 1N6RA 3H2YA 4LZZA 4GSYA 1AK2A 1AM4D 3IDQA 1E1RA 3SS8A 2RHDA 4C0QC 1TMKA 2VH5R 4B6EA 1AQUA 2F1RA 2PX0A 2AKAB 1AS0A 4C0HA 1DAMA 3K0FB 1OIVA 1T0JB 3X1ZA 4FXPA 2CCGA 2WPDD 3AF4A 2IYVA 2O0KA 4P33A 3OFNA 1BYUA 2EFEB 2GRJA 5CIQA 5KDDA 2GKSA 4CT5A 4C0KA 2C95A 1NL3A 4DSTA 2V1UA 1SXJC 1GKIA 3WP0A 1ZAKA 5DE3A 2W83A 1J7KA 1TQ2A 1UKVY 5G53C 3REFA 4B2PA 1WBBA 1TAGA 5CM8B 2RHMA 1DG1G 1M8PA 2XITA 2AWOA 3C15C 3H0KA 4EPXA 4Q9JA 1U2RA 4Z1MD 5FL7A 2OE2A 4DLYA 3WMEA 1ZU5A 2E9SA 1M2OB 1QHHA 4NCNA 3T5GA 3JVVA 3C4JA 5DSZA 4URYR 4OI2A 4UNRA 1Z2AA 5KYKA 4OI0A 5DHAA 2REXB 3OE7D 1SXJD 3GFPA 1SVMA 5CB6A 4KLZA 4TLEA 2ZUCA 2JCSA 4JLNA 4V0NA 3RC3A 2Q9BA 4Z8XA 2X19A 4URVR 3BC1A 4EPTA 3FPAA 1NG9A 4PC1A 4IDQA 3DEFA 4G5QA 2X2FA 2ZVQX 4TL7A 2C5LA 4CF7A 2MMGA 2R6AA 2EQBA 2KB0A 1OB5A 3FYHA 2HLDA 2JASA 3Q7QA 1BMFD 5TMPA 1CEEA 2HCJB 3N2EA 1YR7A 1R5BA 4MRVA 1KSGA 4I81A 4NMMA 1CR2A 2F1HA 1BYIA 1FTNA 3AUXA 4A36A 1NVUQ 2YJTD 3SHFA 3AVYA 1N5LA 4PAOA 5FTJA 4G5OA 1HE8B 4RKFA 5JBQA 3GLFA 4B2LA 3E2IA 4DDUA 2UVQA 4RZXA 4B33A 4PQFA 4M21A 2P65A 5AUNB 1N6NA 4D4JA 3DMNA 5EUMA 5TXGA 1W44A 1G21E 2I4IA 3SU8A 4MYUA 5TY0A 3AB3A 1Q1ZA 1OXVA 3OIUA 3OEHD 2AHOA 5JRJA 3D8BA 3A1WA 2O5VA 2OM2A 2ZI6A 3BAFA 1OB2A 2PMKA 2PL3A 1DS6A 4U5XA 1TTTA 1HQCA 4MGZR 3GJ5A 4PHGA 1OLOA 4U02A 5E7JA 1HY3A 3BWDD 4LYAA 3ADCA 4TLBA 3GCGA 3GJ7A 4Q9IA 4URXR 2XOKD 3TSOA 3NTUA 3K9NA 4GI7A 2Q6TA 4XWAA 2GHIA 2EFDB 1RC8A 2QI9C 3PEWA 4V0OA 2J1LA 3U6BA 2GCNA 2PZEA 1D5CA 1JR3E 5EP3A 4BFTA 2VHTA 1R4AA 1F5NA 4JL5A 2KBEA 1XMJA 3G82C 4KAXA 1OHHD 5BYJA 2YINC 4LK2A 4RD3A 1FQJA 4CEIB 5J4LA 4Q9LA 1KHTA 1E2EA 2HUPA 5FI0B 1E9RA 1CJTC 4X8LA 4YLGA 2ZSDA 2GEDA 2J45A 1QHXA 2ZUDA 3Q8XB 4LHZA 1ZBDA 4LBYA 3QJYA 2WHXA 1D2MA 1EWRA 2VPPA 4FD2A 1L4YA 3FHTA 5J4VA 3L0IB 3QPWA 5CJPA 5C46F 4HSEA 4MA4A 2WICA 1KI4A 4QGAA 3TLXA 4Q7JB 2OLKA 3ZIAD 2GBLA 1Q44A 4Q4HB 1FTSA 3KKOA 3REGA 4P4UA 4FW9A 5E4FA 1FNNA 1J90A 1VTKA 2VLIA 3X1DA 1G18A 4B75A 1N5IA 2OCYC 3H84A 1CJVC 3UG7A 2NG1A 2FSIA 1KK1A 3UXMA 4NKRA 3I5YA 2BEJA 3QEOA 1UBCA 4R98A 1VG1A 4PR0A 3FMPB 1J8MF 3H1TA 3LFUA 1Z0DA 2WKQA 1ZU4A 3MG9A 4DLUA 4FMCB 4NYJQ 1T3LA 4HZUB 1CIPA 3CX7A 1LS1A 1RKBA 3A1VA 3T1VA 1ZM9A 2HT1A 4AKIA 4OHZA 1FL9A 3W5JA 3MJRA 1ETUA 2CLDX 3BB3A 4UJ5A 4A8JC 1QG4A 2QZ4A 3PUYA 2XSZA 5TB5A 2ZS8A 3ZS9A 3U3KA 4JLBA 2QT0A 4JBYA 5F2EA 4TYNA 4OQLA 1FNMA 1CBUA 2AR7A 4DLWA 4N1AA 1KKLA 4G5RA 1E9AA 1W1WA 2WKPA 2REBA 3THYB 2GILA 4LHVA 1O3YA 3TAUA 1UFQA 1HTWA 3HDTA 2N42A 3B1XA 1XPRA 3SE0A 4Q19A 1UKYA 3CUEF 4XOIA 2PEZA 4ESVA 4B32A 4TTRA 4ASUA 4MITA 2ZRAA 2ZR0A 3CLVA 2ZYUX 3KFXA 1JECA 1MO6A 4URZR 1BKDR 1XJQA 2DB3A 4DDTA 2TMKA 3KXKA 1XD2A 3T1QA 3W90A 1X8LA 1P75A 5H70A 4OI4A 2D7CA 1SXJE 3BD9A 1ZYUA 1T5LA 1VECA 4XSHA 4JBXA 3QXXA 4C0JA 5F9FA 3I32A 1VCMA 621PA 1EGAA 4LJ9A 2O0JA 5EP2A 2VSFA 4TWZA 2R6FA 4WAUA 4W7SA 3GLIA 1T3SA 2ZJYA 3EAQA 4DLSA 5JJLA 1N0UA 4B34A 1Z6XA 4B76A 3B2EA 5A4JA 2XZPA 4US1R 4AK9A 2ATXA 3K09A 3L82B 4EAQA 1OFUX 3A36A 3AVWA 4XWKA 1T6NA 4OK3A 2ZPTX 3ZJYA 1PUJA 3UPUA 4XJXA 2R6GA 3OIVA 4TMXA 3VR1A 2V7QA 2ORVA 1OE0A 2O8CB 4A2QA 4QNMA 3LA6A 4KI0A 2IS2A 3P1JA 2SHKA 2WIBA 3MUFA 4BRUA 1ZNWA 2G0TA 2EYQA 1NBMD 2IYYA 4BEBA 1CF4A 3LXRA 4Q1BA 3K0FA 2J7PD 1MR3F 2OCPA 1J70A 3W6OA 3EPHA 2OBNA 2A5GA 5A5GA 3CONA 1NKSA 3GQBA 4FIDA 3FFAA 3AUYA 2A5FA 4QGGA 5HE8A 1M1YE 3QE0A 3PV0A 3NC1C 4TLAA 4NDZA 4ZKEA 3U6KA 2P6NA 3WBKA 5C4GB 5E95A 5EE9A 5AJYA 4QJ3A 4JLDA 2LCFA 1MT0A 4B73A 2E87A 4Z51A 1W0KA 1Q1QA 4F4CA 2CEAA 1HYQA 4QGHA 4JKYA 5L3VA 3F5FA 1DADA 2DYKA 3C41J 2YVUA 3FHCB 3Q72A 1WBDA 4Q02A 1R0ZA 3LX5A 2VYFA 4OK6A 1L4UA 4BLTA 3KKPA 1BO6A 3KUCA 1YRBA 1SVLA 2DCUA 2X8AA 4BLPA 1ONBA 3SZRA 4IVQA 1AA9A 3GLHB 5F98A 3NG1A 1DE0A 4R7ZA 3MWJA 1A82A 2AFHE 2GZHA 2NO6A 1COWA 1X3SA 2Z4RA 2D62A 2W6JA 3W8RA 4DSNA 1NLZA 4OL0A 2IUUA 1DAEA 1KO5A 4LCBA 5J40A 1N0VC 4LPSA 1E96A 4AI6A 4K8OA 5G3YA 5ELXA 1P72A 1KI6B 5D3MB 4YMUA 4WOPA 4W5JA 1YR9A 4PSVA 3BB1A 1U90A 2J0QA 3AGQA 5CLLA 3TW8B 2EVWX 5GVRA 1P6XA 1HURA 2L0XA 3CPJB 4M9SA 1S96A 2OBLA 4BWYA 4GZLA 4X8OA 5B57C 3QEJA 2WJYA 2Z5FA 2IUSA 3ETLA 2ZYWX 3TNFA 5BN4A 4WVFA 4JSYA 4MKIA 2PH1A 4KYIB 2OV2A 2OO7A 1KSJA 2GA8A 4RJLA 4F38A 1P2VA 4BPBA 4AIIA 2J59A 4WIAA 4QHTA 3HU1A 4DCSA 3ZQ6A 2HV8A 2RB4A 1N0WA 3BE4A 3SOPA 3QBTA 1R2QA 3CR8A 4JJZA 4PTLA 3TQFA 1W4RA 2QGNA 2ZE5A 3NEJA 3UK6A 1W0JA
chains in the Genus database with same CATH superfamily
3IXMA 4GOXA 1SOAA 2DM6A 4MLPA 3H4VA 1R27A 5FAXA 4PFJA 1RLMA 4G4JA 4CN9A 5T1DB 3AEQA 2J30A 2B1QA 5HM6A 1FB5A 2X7HA 3DE9A 2Q5LA 3Q9SA 1NX6A 4LBVA 1PHRA 3T6JA 5H81A 4O3MA 2IJGX 3OETA 3GDWA 5SZHB 3PTAA 1XCPA 5DU2A 3IVAA 2Q5OA 2KMLA 1XTUA 5A9SA 3BWBA 5AW3A 3JQRA 1NYRA 4OXRA 3ONWA 2O8BB 1YCGA 2P4EA 3CSUA 3S5UA 4HZUA 1H65A 5FBVB 1UXIA 4DA0A 4HQ6A 4R3NA 3GCDA 3HDJA 3KLMX 3FSRA 4BN5A 3I42A 4CI9A 4RHXA 3H3XA 3NBQA 4KLAA 3THYA 3SJ7A 3IJRA 3EXEB 3UWSA 2HBZA 4NAUA 4Z4HA 1XZFA 4YVFA 1P77A 3NTOA 3D8SA 5I4KA 4GM4A 2JIRA 3TH5A 1X9GA 4XM1A 5CX1B 2O50A 1OH8A 5ETJA 2VJAA 3SCZA 1AO3A 2ZEJA 2I8AA 2I71A 4JJ4A 5LQAA 3KLOA 1PYGA 4WNAA 1LZLA 5TR9A 3AHDA 3SXUA 3PPYA 3IPRA 1GTJ1 4IJKA 4FYIA 3IOMA 3M33A 3QWFA 3PR2B 1QV6A 3L3BA 4NG5A 4Q01A 2V5UA 3A0RB 3ENKA 3W6NA 4JC8A 1Z0AA 1KYQA 3GRUA 3C3KA 3JD2A 5KCMA 4NBVA 3CNEA 1JKFA 2IYNA 1CRWG 5TV2A 1PF7E 3U4GA 1FQKA 4DV7B 4AMUA 1E2HA 1XV5A 3R2JA 3B78A 3R3JA 4S05A 1NPYA 5FZTA 4Q7KA 2WIAA 2UXCB 1D1TA 3BJEA 1T24A 3FHDA 2XRZA 1P8JA 3ETJA 1Z2NX 1YXMA 1DDIA 4TTQA 3DYIA 3T9BA 4RVCA 3REOA 2F17A 3C87A 5DSXA 5T57A 1Q3TA 4JB2A 5IHPA 4I2VA 2A9PA 4M76B 4ZMRA 3SICE 1VHDA 1QHNA 2JJ1A 2BELA 1HA3A 1VOTA 5HUJA 2RMKA 5A6VA 3TR5A 4JB0A 3OMXA 1Z5ZA 2FZGA 1YZTA 2FE4A 1MC1A 1RHQA 4ZXFA 2XDQA 4N0PA 1VJDA 1CNMA 4MVJH 2WD7A 3P9KA 1UM8A 2XKJE 3VH4A 4J90A 1LPNA 3KYDB 2H63A 5AKYA 1WPGA 2ORWA 2P7IA 1E7SA 3CUWA 1G8MA 3USES 1KETA 3PE4A 4QDOA 1MB2A 3ZZMA 5LPNA 3CZMA 3REQB 4FILA 2WYIA 1JPUA 1HQKA 4EFNA 3LGXA 1GADO 2GN2A 3GGDA 3TECE 3O55A 1M54A 4BQPA 2FQWA 1EVIA 3UOGA 1JZTA 1K8QA 1R0YA 3A8TA 3AGUA 1Z2DA 2QD4A 4EWLA 2CL0X 3SJZA 1Y6RA 4Z7JA 4OXQA 1W1UA 4PG4A 5FO1A 2FSVA 4RJJA 5FOQA 2IIBA 4I1MA 4M36A 4J16A 4JITA 4KFRA 4RVDA 1WASA 3C1TA 1CUUA 3ZDYB 2AG6A 4RD6A 3Q0EA 2E4XA 4NK5A 1XHEA 1Z4QA 2V59A 4N5IX 3FTQA 4FFOA 4HYEA 1QPUA 3I30X 3OCCA 3NIBA 3MTQA 3FNBA 3IQWA 1YC5A 1R9MA 3WB9A 4CM8A 5CHEA 3DTVA 3N0VA 5F78A 2GN1A 3RF6A 4BMSA 5EJ6A 4ZT4A 1E69A 5L4SA 1Z18A 1KI2A 2DT5A 1YBMA 3G85A 2JK0A 1G41A 2WM8A 2OQVA 2WK1A 2FQXA 1LSOA 3M1IA 5KYTA 4F5EA 1CEQA 3GJQA 2QG4A 3NDIA 1L5WA 3UB3A 4JC5A 2QVBA 4BB5A 4MWGA 1GUDA 4CLRA 3KQUA 3RNLA 3WKDA 5JYEA 4EY5A 4P32A 1NURA 2WPDA 1IUPA 2WNSA 5K3BA 5FOTA 1E2BA 3OZBA 5JZSA 1MMNA 3EDYA 4R51A 1HDYA 3A6LA 2HO4A 3H99A 4B71A 1II0A 2Q3TA 3QF4B 3EOAI 3U09A 3AFHA 2IPMA 2R05A 2X76A 3EZYA 2WBLC 4HAVA 1FIUA 4UXJA 2HJVA 3T9OA 3O95A 3N53A 3Q98A 4M63A 3LTNC 2B35A 1NF9A 1ZIPA 4FI3C 2AYYA 3ZD6A 13PKA 1YYJA 3F3YA 4EQ6A 3KG2A 1X7YB 1QTRA 2XB8A 2V6GA 4GPBA 4IDAA 4N5NA 4KVFA 1T4GA 3KJHA 1XNGA 3GNTA 2YV1A 4B83A 3AEKA 4PSAA 2AFIE 5ICFA 1JDSA 3D3KA 2PWBA 1SUIA 2C98A 4X6LA 1N1MA 1WM1A 1GA1A 1S4QA 5JG7A 3J81A 1POWA 3COSA 3DE2X 1X7XA 3RRZA 2BE5F 4TL9A 1LPOA 4DAOA 5A9RA 2XR1A 3OH8A 2FWPA 2R66A 3PS9A 3A4IA 1IPHA 3L7DA 2GN0A 3QZCA 1RHJA 2YC4C 2B25A 1DOAA 3DBIA 4IOJA 1WCYA 2DXIA 1GWNA 2R11A 1XEFA 4LZJA 4YEDA 1Q6YA 5HIMA 2D2VA 4D5EA 3R7NA 1U6IA 1TQ6A 1TJPB 4N7BA 4FEAA 4M7WA 4BN4A 1NP7A 3AEYA 3BXOA 2JGNA 4JEIA 4GC5A 2I4LA 1YIDA 2ORIA 3A25A 3PYXA 1V8BA 3HJHA 5LNK6 5YASA 4N8DA 3ET5A 2DFLA 3UV3A 5A6AA 5CDGA 5BMVA 3PFHA 1RP7A 1BROA 1GAXA 1QMGA 2F8MA 2GEFA 3VH1A 4DGSA 2H3EA 3TFWA 1NN0A 3NM4A 1XP5A 1PQYA 4YV2A 1YASA 3DTNA 1EGVB 5ERYA 2MINB 2ZG6A 2PYZA 5AVJA 2O1WA 4HDOB 4MB0A 4J29A 3K35A 1YU9A 3FMFA 2RKWA 1T2AA 4L4SA 2CFSA 2Q4BA 2YWFA 1O7JA 2ZTHA 2IL1A 2VTBB 3UGJA 3O47A 1E5XA 5BWMA 1SQ6A 3IESA 3ZU2A 1TIKA 4MYCA 3D7NA 3ZYZA 4D4XA 3M5CA 1C5KA 1E2MA 1E5TA 2ZOSA 2R00C 1YDMA 2CCYA 4C21A 1A9SA 2BFEA 4Q24A 2VXYA 2VNKA 2IC5A 3PSAA 4JI7B 4DRZA 4FR2A 2HT6A 4CIXA 1D9ZA 3K4QA 1KK2A 2O07A 2HMQA 2PMWB 4AP9A 3U9MA 3RSZA 2GXQA 5LB2A 3VU9A 1SC3A 1GRCA 1N1GA 3WLPA 5CW2A 2FN9A 2Y67A 4IZHA 5E3HA 4Y2PA 2BMJA 3K30A 3L7KA 4BMCA 4JR0A 1D0ZA 1IXYA 1FC0A 2BFPA 1RE0A 4GF5A 5JI3E 1FQWA 3VX4A 2ZB4A 2W93A 4MTCA 4B35A 3Q7LA 3MQFA 4JQCA 2WUEA 2AK2A 3WYAA 4MEJA 1BGXT 2G0NA 3RF3A 4OA8A 2GYWA 3F9IA 2H2IA 4U9DA 4QPJC 1VMDA 2A57A 4D3FA 2ZZNA 5I9MA 4J0QA 3OU7A 3SSMA 2GSDA 3JQBC 3MJVA 3U4CA 2C9ZA 5DTMA 1DEKA 5ENZA 4CZ2A 1GZHB 1Z0FA 1QCZA 4WZ6A 3U4QB 1VK5A 3I6QA 5AD1A 1PR3A 4B3BA 3T06B 4O2AA 5JCXA 4QDUA 1P9NA 3FUTA 2R6JA 4J32B 5FKJA 2VJLA 1H5QA 4JV5B 2GAJA 3WICA 1CJSA 3QUCA 4EHKA 4EUKB 3KT8A 5E0OA 4F2WA 3QW2A 4RELA 5IKXA 1DIHA 1J07A 2AFHB 2QPTA 1DHRA 1LGYA 2WWGA 1XRLA 1R37A 5BVGA 3IJ5A 1OBHA 4CKEB 2GAAA 3LPCA 4KSBA 5E8JA 4OKNA 4LXTA 3W4KA 1G3QA 1BJKA 2X9LA 3QVYA 4YN0B 1DT3A 1ECPA 4HFJA 3PEYA 3L8HA 1ZH6A 1Q3KA 1GRVA 3ELDA 4OF4A 1T5IA 4JMPA 3ZBTA 4PRLA 5KYUA 1KJIA 1DQNA 4RYLA 3IOCA 1T8TA 4TTIA 4OH1A 1TDJA 2P2CA 2WSSD 1D0YA 1K9SA 5KYGA 3DLCA 5FTLA 3ZTTA 3SNHA 2R25A 3FYCA 3B85A 3PVCA 4M37A 4RL6A 4RCYA 2AWNA 1CUJA 2N47A 1E0SA 2FNAA 4G24A 1FDUA 3ZI7A 3FZEA 4HRXA 1TE2A 1EJ2A 5JCOC 4XLTA 1ZEJA 2C7BA 4JP8A 4LVNA 2CJWB 1NRJB 4LOAA 3TBHA 2JAWA 3NTVA 4H4CA 1JLRA 5HKKA 5KJEA 3M4ZA 4PANA 1T4MA 1V39A 1XU4A 2Y99A 4KR3A 4B6OA 4S2EA 1XZDA 2HV7A 3ADOA 2DQKA 2R7VA 2G09A 3NCTA 5DWQA 3WWYA 1P91A 1M74A 3QYJA 5JO9A 5FWAA 2CVOA 4PG7A 5JLAA 3TLYA 1I7DA 1C1XA 3PQ3A 3TK1A 3Q6MA 1LY1A 3E22B 3T15A 4DOZA 1UFKA 3NBYC 4FFLA 1NY5A 3DWGA 4UU8A 5AFSA 3SQWA 1X19A 3CF6R 4I4NA 5GGYA 3FR7A 3R7SA 1XCMA 3COVA 4RUKA 3ZKWA 4R1OA 1D1PA 2W2QA 4H6PA 2C84A 4LFBB 1X77A 4KKVA 1U3VA 3NHKA 2ZIZA 4PGGA 3M4NA 2V1XA 4V03A 4HKTA 2AF4C 3CV3A 4P2GA 4PICA 4X54A 1E4VA 1IM5A 3C6YA 4I9GA 2HWKA 4YH1A 5DBGA 4IFEA 3PDHA 3T7SA 5EQJB 3DFZA 2ZRLA 4R40A 2YMPA 5I9SA 2YMQA 4QRDA 4NMWA 1TVKB 1XQXA 1ND6A 3DMTA 4KYTA 1IVSA 2G9ZA 4M0UA 4ND7A 4WLNA 4IGGA 2NO5A 3DUFB 4PG8A 4MKHA 2YHBA 2EILC 2UUOA 1A2OA 3SYRA 3A6JA 3SYLA 1EPUA 2V74B 3SWWA 3SXZA 4QUHA 4UFNA 5J47A 4AMBA 2GF9A 3NU1A 3S2UA 1BXRB 2YV4A 5EXXA 3KB8A 4X1OA 1U0SY 1NFFA 3RTAA 2O8VA 1PFKA 2AOUB 2X3YA 4BVLA 1NY6A 3DNPA 1K97A 3BREA 1P44A 5ENVA 2NUTA 1FDWA 3RG8A 2OD7A 1XIVA 2ZAOA 3W5CA 5F7ZA 2HSJA 3PNBA 1QAOA 1Z37A 1ZOIA 3C7TA 4B47A 2KWIA 3ODGA 4NZMA 4B3XA 3N8HA 3ORHA 1H8HD 2WQ6A 5BV7A 3KOZA 1GNVA 2PGOA 2H7CA 5KWVA 3TTXA 2XJ4A 4BZPA 4QKQA 4L28A 3HU2A 4W82A 2CBGA 4A3SA 1RJDA 3P0JA 3TTVA 2JFWA 3L8MA 5INTA 2O2EA 3KQQA 2WJVA 1AY0A 5DLJA 2XF8A 4R84A 5ENDA 1I8TA 1OC4A 1DRJA 1UEIA 1ZP6A 1NLYA 3UH1A 3AWIA 4W6QA 4K2AA 1QU2A 3U3MA 1Q95A 4F4HA 4GLLA 1C9NA 1U2TA 3G89A 4UBIA 3N59A 4AY4A 4N3AA 4J1TA 5KUTA 4MDEA 4IRUA 1W4AA 4NDAA 3CKKA 4BVHA 4M8LA 3T3PB 3F90A 3VU1A 2GFHA 4HDMB 2Q21A 3BSSA 3MCWA 4QPZA 1U81A 1X7ZA 5G4KA 3FDIA 2PX3A 3BM5A 1EFRA 2B37A 5G0WA 4LQLA 1HFKA 2BKAA 3DLPX 4K6HA 1ZI6A 4JC4A 5AOBA 5JXWA 5D3ZA 3AESA 2VH5R 3KPUA 4FHCA 1J1IA 1M1UA 3ZPXA 1SXJC 1GKIA 2V0GA 1TQ2A 4LOHA 5GOTA 1U2RA 1JV2B 1QIFA 4Q7QA 1Q14A 3O91A 4DJDC 4V0RA 4TTJA 4OI0A 5KYKA 2OY0A 1AF7A 4FK8A 3HSYA 3D6AA 4UDOA 2PV0A 2R6AA 3FYHA 5TMPA 2O5RA 4J91A 2WI8A 4GL4A 1KSGA 1YA4A 4FFNA 5JFOA 1PZHA 3KD2A 5HUHA 4CG0A 4HC4A 5JATA 2NUAB 3DMNA 3OIUA 4E5NA 4KUHA 3ZU4A 3JRMO 2ZI6A 1DS6A 1HQCA 1GAEO 2GZ2A 3GJ7A 1H2ZA 3WGMA 2GHIA 3RKSA 3PQEA 1XRSB 1CUHA 3U6BA 1JR3E 3ANNA 1R4AA 1V16B 2MT9A 2UZ1A 4ZI5A 5J4LA 2A33A 5A6BA 5E0KB 4LHZA 1M2JA 4P4UA 1EM6A 1VTKA 1W8IA 3SM3A 1KYVA 4R98A 1ENYA 3FMPB 2AQHA 1LS1A 5EEGA 2BFWA 1QTNA 2QQ5A 3E5RA 2NV6A 4D41A 4Y3UA 1B68A 4Q6WA 4LHVA 3P4UA 4H16A 4GD3Q 4MNDA 2PK3A 2JFUA 4U1RA 4URZR 2HKVA 4FYKA 1GGMA 3AGTA 1Q0TA 2F8LA 2IHNA 1X3LA 2CF6A 3T3IA 2R68A 4W8HA 3IKVA 1L7QA 1VP3A 3HK2A 1CETA 2RB5A 5KINB 2Z2XA 4QNMA 1FRQA 4EB6A 3MUFA 5A4IS 2EYQA 1CF4A 4ZT3A 4X1KA 3W6OA 4R54A 4GAEA 1V8ZA 2VTVA 4ZALA 5KNDD 1WOMA 3G7NA 3RUHA 1CQIB 2LCFA 1HE1A 1Q1QA 5DHSA 1P1BA 2NT4A 1DADA 3Q72A 4WCDA 3UFXA 2HAEA 4I4TF 4GU5A 2DCUA 4BLPA 1AA9A 1NBBA 2X8LA 4YT5A 4OL0A 1DAEA 1TRKA 4DJJA 1IMJA 1KI6B 2QZPA 4ALLA 3ZHBA 4YL1A 1HMYA 3BB1A 5KX5B 2I6UA 2OBLA 1ISPA 2WJYA 1YTLA 3O3OB 5AHKA 4MB2A 1UDAA 2QUBA 2OO5A 1RQ2A 5K0NA 3TQFA 4ZLCA 2IRWA 2GT1A 3H65A 2V6JA 3QUTA 3AC0A 1XKQA 4JLWA 4MR9A 1NZDA 2PGAA 3CT4A 3GGGA 3F96A 4UBJA 4CL8A 3VR4A 4F2GA 1WW2A 2P0AA 4DKXA 5JS1A 3JYYA 3HDVA 4HWKA 2KM1A 3HGMA 4FGSA 4A4AA 1Y6JA 4TQ9A 3L0IA 2PYDA 4YCDA 3PDIA 4BO7A 3NWEA 1ST3A 4UHBA 4RORA 1XVIA 3UHOA 1BD4A 1SU8A 5ALXA 5HE9A 4GOLD 3HMKA 5GPGB 4PVCA 2HMWA 4Q4AB 4O8CA 2PWAA 3PLNA 3NWOA 4W5HA 4G26A 2HJ9A 1HMPA 4OATA 3RWMB 1YRWA 1W85B 3HEMA 4DQUA 4B84A 1AGPA 1YK0A 3FI9A 2XL4A 4KGZA 1F2VA 2EV9A 1HWYA 1VL8A 1JNXX 4BDSA 1RQLA 4MKGA 3SYMA 3MWKA 3P9SA 3K1IC 3NV9A 3R6GA 4NY3A 4PJLA 4EYEA 3BFXA 3EF1A 1ZJZA 4B3RB 4OYYA 5COFA 1S3IA 1AV7A 4D0RA 3L7NA 2KYRA 3WLRA 3HN7A 3I2IA 2L6GA 1JT2A 3AQBA 4EIYA 1G7RA 1B8PA 5FUYA 2VPWA 3JRNA 4MVSA 3W5IA 1C9EA 1XLUA 3FR8A 1N2CA 4F8YA 3PX2A 2PBEA 4J3NA 3SPXA 3D3NA 2Q07A 5CDFE 4K6GA 3H5RA 4MW9A 1KGDA 1KI1A 3MTIA 5ADHA 4K88A 2X40A 5FOUA 2RG1A 2O6HA 4MGIR 3BMOA 3RYFA 4LC1A 4MV1A 2YZ2A 4ODIA 1NI5A 4Y2GA 4FFWA 4XVHA 2JJ2D 2O8DB 4ZVUA 2BIFA 1KFEB 1P1HA 4NZNA 2XZLA 2ZIXB 1D1AA 1UDXA 1H6BA 3HR8A 1CLUA 5BQ3A 1ORWA 2IP1A 3UPDA 1YU6A 5DXAA 2X41A 2PDAA 4CM6A 2L6FA 1A5TA 4I1OA 4KQCA 4YJ3F 1GUBA 4EHDA 1M1XB 2VDWB 1UBMS 1JJ7A 5CAEB 1BDMA 3CKYA 4Y2JA 3BICA 1XTRA 1A88A 5FBQB 2QX7A 3I12A 1RPJA 2Q3FA 4XGQA 1MH9A 4ZO7A 1C9MA 3V8MA 1TGYA 1YQTA 4P3YA 4YUXA 3V6MA 4YXFA 4ER9A 1L3BA 5JCJA 1PG2A 1Q7BA 4BGDA 4GBGA 2LUOA 2Q4TA 4QU0A 2TMVP 1VRWA 4Q47A 2ZU6A 3KBOA 1J6UA 3FPKA 2PQ2A 3OOSA 2C07A 1Q1GA 2FJUA 2C1EA 1OXBB 3O8CA 4PXAA 4ANJA 3DBVO 2NAFA 4CF5A 3O6VA 4QIHA 3NWBA 4CQMB 3HYLA 5T8KC 3PCVA 1IHOA 3O3NB 1ZHHA 4W1RA 4QDTA 2FSFA 1H1DA 1GG9A 2VAPA 4N49A 4H3VA 1CZNA 3NPAA 2ZDGA 3F9RA 5EJFA 4Y0NA 3FWNA 3BXGA 3RTEA 3ESDA 4Q1EA 3UHJA 1GL6A 3ZDEA 2ZATA 1YIOA 4JGIA 3P97A 2C9YA 1NTRA 3EC2A 2EGUA 5KJ6A 2IYZA 3QH4A 1C1DA 2HTFA 3V5XA 1PK9A 2CHGA 5JFTA 1HV8A 3SSNA 4YAGA 1MLDA 3IMKA 1Z5OA 4KWHA 3NKDA 3CQ9A 5FUXA 2EX4A 4UDVA 4UATA 5JZMA 3WAKA 2JFHA 5EYPB 1XXHB 2OV1A 2QMQA 4E4RA 5IT5A 4HH0A 2ZXFA 3QIVA 3THXB 3DA8A 3LGAA 2IHTA 1UCFA 1VSQA 3H16A 4MIOA 6REQB 2PJRA 1PR1A 1XLTC 2EKQA 2VSNA 4O6VA 4DVYP 1ZGAA 1CQXA 4V2UA 3GVPA 3V3KA 4NH0A 3RVYA 1N6KA 2Z43A 4JI3B 1PEKE 3OC6A 4BGIA 3FH0A 4GPTA 4G0YA 2IBFA 1WKCA 4GZ6A 4REOA 2XLOA 5MN6A 1V2HE 4I7EA 1B6TA 4CSAC 3L6RA 5JJIA 3OPYA 4IUBS 4CS8C 4R9UC 2WEKA 5L4NA 1KDRA 3MLBA 4WEOA 2ZJBA 3WAGA 5GJWC 4BNFA 2PLFA 5J59A 1NT2A 4MWEA 2WVAA 3OEHA 2I9KA 4CETA 1O94D 5ABPA 1C30B 4NE9A 3GDOA 4I44A 3P27A 4EUNA 2W5UA 2ZXEA 1LJ8A 4RTNA 1MIOA 3AZOA 1D0VA 1A04A 1I3MA 1GPH1 4ENPA 1DBPA 2BGRA 1USGA 3C3DA 4KVGA 2QU8A 3EGEA 4YCBA 1E1YA 2G7ZA 3HKEB 5ADVA 4RF3A 4FIZA 4JY7A 2PH5A 1U2DA 3UJAA 2EKPA 3ZWXA 4R41A 1JJAA 1UWCA 3LYAA 5CT5A 3FXHA 3GGJA 3FI0A 1Q2XA 4XW2A 4F85A 4IX9A 2JC3A 3WGVA 1KR5A 1WZEA 1OW7A 4CXMA 3UT5B 3B9RA 3ASUA 3FKJA 1X80A 4JROA 4GM1A 5AJUA 2XQIA 2WJWA 1CJKC 5BSRA 1XN4A 3W1VA 3L4BC 4IRMA 3F5MA 3P5BA 4J2TA 5FH9A 2HU8A 1S2MA 4EHPA 1FNSA 3ZWQA 4C4AA 4AUNA 4IWNA 1E99A 1ADBA 1A95A 5BW5A 2I2XB 3HWX1 2HPVA 1NFOA 2X5OA 2WF6A 2XCLA 5ECGC 1MABB 3MFNA 1ZD5A 3D4IA 5D5HA 1WCIB 1DBSA 4IW3B 1XQ1A 4XX1A 3HHEA 3LV8A 3KSDO 3KQSA 5LBUA 1T3TA 3IIIA 3QVWA 1GFWA 5K0ZA 1P74A 3ZWCA 3AJDA 4FLMA 1K5PA 3I62A 2AZTA 2Q99A 4Q9NA 2A4KA 4DILA 3Q11A 5JD3A 3CIOA 2XHZA 2I34A 3WIDA 2HIHA 4UPDA 4GI2A 4MXDA 2V45A 1BAPA 4F11A 3JZAA 3LDGA 1S8FA 2ZYIA 3QJ5A 5ICMA 3KTOA 1OPRA 5F7XA 2HQ1A 3PE6A 2XMPA 2BHTA 3TGWA 4KRXA 3T4PA 1F1MA 3RAPR 3QYAA 1IB0A 3U60B 4TUYB 3NUGA 3JQPA 4NNOA 2II6A 3LLIA 4MQEB 1PL6A 3ZVLA 2YY6A 4XSGA 2PZKA 1M6WA 2J3JA 3VI3B 1D2HA 1TUBB 2PV7A 3NRCA 1K3UB 4HWGA 3E8XA 4ZCMA 1T8RA 5AI0A 4YV7A 5LLTA 3E70C 2IYUA 2BCGY 1QGAA 4P5EA 4DDKA 3C48A 2B8WA 7ABPA 1DPGA 2QG6A 1RKUA 3VV2A 1JHUA 4H17A 4AC9A 1P5ZB 2BUCA 2XUDA 3QOWA 3TJZA 1ZK4A 4Z4FA 2HCBA 4X1IB 5KOHB 4EO7A 2VF5X 4DWJA 4IG4A 1G5TA 2O48X 1LU9A 5EVCA 2J3KA 1NXWA 1D8AA 3DXZA 1VKHA 1WW3A 2QG9A 1F2UA 1G6KA 1FTWA 2JAUA 4EHIA 1K05A 2AZMA 4PBTA 4Q7LA 1JZSA 3LCJA 5FULA 4YFVA 1P2GA 4DMRA 1KZ7B 5DCUA 1E2IA 2J07A 3P4XA 5K51A 3SFTA 4HXGA 1J2UA 2RBKA 3M5DA 5J2UA 5AW6A 3NAGA 1IOWA 4BWGA 5JMPA 5KVCA 4URUR 2H92A 3GZTB 1WUKS 3L8DA 2VJKA 1LDYA 2ZRFA 5G4LA 5BQIA 1TKNA 2G7MC 3NTQA 4NV0A 4BLSA 2C9DA 2V7XA 2BI7A 4TWRA 2C1ZA 3F4KA 5IM4A 4HDNA 1WXHA 1L4HA 3PITA 1GITA 3QLTA 2R1VB 1D0XA 5I7FA 3E6AA 3IPMO 4X20B 1G7SA 3ACDA 2RH8A 4KBFA 3EG9A 1P6QA 3LY9A 1N9KA 2QL9A 3RSOA 4NYMR 2JI8A 2X0IA 1D1CA 3I3SR 3S7ZA 1JHDA 1XL1A 1GTG1 1NNLA 4KK4A 1OOEA 2CE7A 1XZHA 4M46A 1ZM3A 3SKVA 1D07A 2I54A 4TTSA 2C83A 4IVPA 1KEPA 1L4LA 1WXXA 1P29A 1VMEA 1HYHA 3ZZ0A 2ZI7A 3RH0A 3DFFA 2IFTA 3LFTA 3F67A 1LLQA 1PDOA 3KSBC 3R3SA 1UOQA 2W2KA 1S6YA 1ZX1A 2Y39A 1H94A 3JAKA 1YA8A 2P9EA 3KLNA 3PT5A 1E6CA 1GGVA 2ID4A 4YK5A 3HGQA 3NVDA 3P2KA 2P9HA 1JSZA 1VSVA 1XWIA 4BO0A 3BMNB 4HAUA 1MOQA 2HBQA 1C8BA 2FE1A 3N6RA 3FDJA 2FWJA 4TYQA 5B55A 2O8EA 1SUPA 2BDUA 1AB6A 5KJCA 4H3KB 2P2GA 4IXDA 1H9AA 1BH6A 1DXHA 1QH8A 3ZLJA 2AVDA 3TVDA 3P4YA 5LOVF 2C92A 5FPHA 4PR3A 1W8DA 3Q1LA 4G9GA 2E2WA 1V0JA 1Y98A 3LRPA 2BGGA 4W6ZA 3IVRA 1PJSA 4IKPA 4L73A 2BH9A 3P2YA 2I22A 2GJ9A 3QQ5A 4J03A 3RC1A 4XOUA 1XP8A 1QIKA 4WOCA 1AH2A 1OXUA 4KI7A 5IZCA 1DCFA 3ZG1A 3AP2A 1KC3A 2RD2A 4X63A 5AT1A 3GFGA 2I87A 1R8QA 1O54A 1HLGA 1YOBA 1UT6A 1RWQA 1II8A 4NZ9A 2XUKA 4NYMQ 2VHEA 4ACAA 4IDCA 2G9VA 4LNUA 3OEOA 1A7KA 5ISMA 3IUQA 3PWTA 1XTSA 1GSIA 3DE4X 4QXRA 2C7QA 4EUHA 2JJ1D 4GG1A 2PGLA 4A73A 2BISA 1OX4B 1P9WA 4GMDA 3V8RA 1OX5A 2G36A 4RPKA 2K4MA 1J0XO 4MK4A 3H83A 4KPYA 4YRZA 5DIFA 2UUBB 2QTFA 1BMDA 3EVBA 5AJTA 3VDMA 5BURA 3U4AA 5L3QA 4FNAA 4YRIA 4HO1X 5HZHA 1E5QA 1SPBS 1ZUHA 3RVLA 3LCVB 2GNOA 4R69A 1Y37A 3LBHA 1OCCC 3MBOA 5JMWA 2D0IA 1SOWA 4H7HA 4K40A 1MX9A 1QO0A 4LZNA 3PQCA 2C58A 3M7IA 3FDXA 5JRZA 1H3EA 1EHIA 2ZTSA 2Q8PA 2UXBB 4HCJA 4IVRA 3IPYA 3S40A 4UREA 1O6FA 2HMYB 4JOSA 1Y81A 1G3RA 4H0NA 1TXGA 2ON6A 1R0BA 1GL9B 3CWQA 3W2IA 2WQ7A 4QBIA 2VQEB 3DXXA 3QWAA 1PL0A 5KTMA 4QXMA 2XADA 1KJJA 3I28A 4RBNA 4FCVA 5GP1A 3LY5A 2IV3A 2HFKA 2H5JA 2PUHA 1PSDA 2V54A 5EHHA 3EQ9A 4RS3A 4YAIA 1HLDA 4AJ9A 2XMRA 3PGA1 1S7GA 3T3NA 1QANA 1N2BA 1XYVA 3PA6A 1NQTA 3DTVD 1FW6A 1Q3HA 4D9HA 1JFSA 1QGED 1QB8A 3BTOA 1X9HA 3MAAC 1ZJYA 5DBHX 3BSWA 1A50B 3O8RA 1E6KA 4N47A 2GS9A 3EGDB 3RJTA 3VVMA 3WGHA 5D1NA 3BERA 3P8ZA 1ZYRF 4RK0A 5KNCH 3VH2A 3QE9Y 2CCJA 3VFDA 1A9QA 1YAJA 1I94B 3B12A 4O4LB 1RLIA 4M60A 2AG5A 3WK8A 2Y3IA 5HQ3B 5CITA 2VIIA 2V6IA 1ATZA 4DLTA 1LQTA 3Q3IA 4NS4A 1O95A 3UNGC 4GSYA 4WCFB 1ZGBA 2F1RA 3HU5A 2D5CA 4G7HF 4LZOA 2WPDD 2X23A 4Y30A 3WLNA 4QAQA 2Z4TA 3OTHA 3CURA 2GRJA 4NDNE 3B2QA 1YZHA 1ZL0A 5I9LA 1NL3A 3KSMA 4DSTA 4ZC8A 4TRNA 4Q1VA 4YCCA 1G0OA 3T7AA 2O59A 1M8PA 2OV4A 1ATIA 2FZCA 1XZLA 3CVOA 2M6SA 1DBVO 2CVPA 2BGJA 3A04A 3B6ZA 3BC1A 1HOTA 4PC1A 3HEBA 3WX0A 2GBCA 5IKPA 2XLWA 1GT6A 4OIMA 2F1HA 2P11A 3IPCA 3Q10A 1K7YA 5JDIA 2IYPA 4X7RA 5TXGA 4AJ4A 1ZMTA 3SU8A 4UCWA 1PJZA 1KIFA 1BMTA 1WY7A 3N8KA 2O5VA 3R40A 3M6UA 1M67A 3V4OA 1KXZA 1UIMA 3K9NA 4YQYA 1H9BA 2WJ4A 2HW8A 4K7JA 4V0OA 4CKYA 2LR0A 4GXRA 3IAUA 1XMJA 4LK2A 4PJJA 3Q87B 1W29A 4HWPA 1J8DA 2VAMA 2C9MA 1EWRA 4X1YA 2CJPA 4EKYA 2Y6VA 1L7MA 2LD4A 4Y9RA 5ITVA 4WESB 3UJNA 4YGYA 4FW9A 5IBCA 4II2A 1NZJA 4RC9A 5D85A 1VG1A 4MX8A 3IDSA 1T3LA 1SMYF 4UMEA 5JAIA 1I1OA 4CDRA 3H04A 2EG9A 3L8FA 3PUYA 3ZN2A 1GV0A 1HNNA 4CLOA 1K98A 3GBPA 3ONVA 5I7AA 4JBYA 1E9AA 1RI2A 1YRQA 4B32A 3RUEA 1O1YA 1R6VA 1T2DA 3K05A 4OQDA 4C5BA 4OI4A 1DCKA 4COKA 3NONA 1A8UA 2KLHA 2POQX 1YDFA 3RSCA 4HTAA 3NYIA 4WAUA 5BRAA 4DLSA 1C17M 4B76A 3UJ7A 5A4JA 2H07A 1T6NA 1GXSA 1PUJA 1J7JA 5ALUA 2RH9B 3QLUC 3B29A 1OE0A 1MJGM 4I1YA 2SHKA 2IU6A 1ZNWA 1ZQ1A 4AQYB 1PG0A 2HV6A 1E5LA 1MR3F 1SM4A 1QGYA 1SCNE 3RADC 1B42A 5CP8A 4QJ3A 3AYXB 2ISQA 3RGGA 3JR7A 4B79A 1N1EA 1CY7A 2VYFA 4OK6A 2O1XA 4P6VF 1QYVA 2WVOA 3EUWA 3GLHB 3Q2IA 5D87A 4QYMA 4OYLA 5CPFA 4DV3B 1OREA 5ELXA 5D3MB 1QRDA 4W5JA 4JZAA 1PQUA 3FPBA 5DYWA 5LWHA 1Q0LA 2JL1A 2A6PA 4WVFA 5FRDA 1QPZA 4M0EA 3QLEA 1P17A 2FN3A 1MNEA 1B16A 4CMCA 4KAJA 2IOQA 2VHCA 1DEXA 3SDBA 2PIAA 4HFKB 1BCRA 3L05A 4CKXA 1MA0A 2HHAA 3A9RA 2ODWA 1YS7A 5I9TA 3QSYA 4ZOLF 4PX9A 3AVXA 2O23A 1ZGZA 3D2LA 2C4WA 3EQZA 5FCDA 1LNSA 1W4BA 1THZA 4H7JA 4GICA 4NTBA 1GNLA 3ABSB 1N8NA 2G9QA 4TLCA 5C7IO 2ZJ8A 4OB7A 3RAJA 3MYIA 1VHTA 4MGYR 4NRDA 3U5SA 1TADA 2YNMC 3A26A 4D8WA 5EIXA 3WGYA 4BLVA 1BXGA 1EYZA 1E86A 1FP7A 4FQ8A 4JH0A 1PHPA 1LPAB 3QNMA 1ZHZA 3PXAA 3SEQA 1SUFA 3IIEA 4DBVO 3GT7A 4HX9A 3L7JA 2B1RA 2PUJA 4AZSA 4QUDA 1UOPA 2BEKA 1PJ3A 1ISRA 3D6UA 4J7XA 1XLTA 4MO2A 1EE9A 1L5RA 1ORSC 4UUPA 2P2SA 3WAJA 3KOUA 2CJYA 1PR9A 4LHYA 4QATA 1LDBA 2CSUA 2GK6A 1DWQA 2OGUA 4C6TA 4TV9B 3L7CA 1K7FB 2MSEB 1PZEA 4QQFA 4R83A 2BFDB 4UTNA 1NU9C 3SJCA 4OXKA 4YPVA 3ZEAA 3BOSA 2CLSA 2G25A 4KO8A 1O3UA 4BNGA 3WMFA 4G01B 2O1EA 4BFUA 2XD4A 3RSFA 3GPCA 2O0LA 2RIRA 4FCTA 4JASB 2NTYC 4I5DA 1X7HA 4C06A 1GZ6A 4CMIB 1W9MA 4NAHA 1I6MA 5FPQA 3CX3A 3G7UA 2WY2D 3B6JA 3FTEA 3EGVA 2VHUA 2RK4A 2DSTA 3GGSA 5B3JA 3D3WA 2YQZA 1P2BA 4ZN6A 1JQEA 4I50B 1NU8A 1X1AA 4K03A 5KYXA 2A67A 3K0KA 1X42A 3RK4A 2HY7A 4DRXB 1Q0FA 3ZJTA 4ER7A 2F7SA 5HKKD 5BVHB 2PLAA 1ADCA 3SXPA 3IT2A 2PUDA 2DBVO 1ECJA 5EZYB 3BRWA 2C2KA 2WB4A 2GKOA 4NFLA 3JZDA 4OO3A 1H1TA 4CU5A 4XWTA 1WHSB 3QXJA 5FPTA 1I6LA 2Z9CA 1SBHA 2BHSA 5CLIA 1EEXB 1JQKA 2ILTA 4KXVA 4EA7A 2IE8A 5E6SA 4IFBA 2LXNA 4LTDA 4GC9A 8AT1A 4P36A 5ADUS 3N58A 3FF4A 2JATA 4OKIA 1J2JA 5IF9A 5BN3B 3DJNB 3WJ2A 1WSDA 4LC0A 2WAOA 3OLZA 3R0VA 1JEAA 1EEHA 2J0EA 4RTLA 1MQAA 1CVLA 1OZGA 4AUEA 3W5SA 1N5OX 4XX0B 5H4HA 5T64A 4HDRB 3TQIA 4EGAA 4L8YA 2WD8A 5BNWA 3OWTA 1B3RA 5E7MA 3DMPA 1SGWA 1HMOA 1UJ4A 3PKIA 3A6ZA 4KXFB 1MD9A 4PC3A 4K3UA 2A5YB 3KJQA 3R20A 1SKYB 3G2NA 5CNJA 1NF3A 1E2DA 2NZUG 3BGVA 3EIQA 2KK1A 3UNXA 4W9MC 3VVCA 4LX8A 3V1LA 4MDHA 4A0HA 4OHRA 4BO2A 3MT8A 4B3JA 1VBMA 1C4KA 1KJ8A 1BH2A 4V0QA 2WT8A 2ZUVA 4EZEA 3L7LA 1VMIA 2XGMA 3LDHA 2Q27A 3FNEA 2QVYX 4TOIA 5B1IA 2YWXA 1DC8A 2ZE7A 1IY2A 4RF5A 1BHSA 2CZGA 4CKCB 1ZITA 2FHSA 2NSGA 2Q3BA 2QW8A 1NQ5A 1P4RA 1MGOA 3HKBB 1DSSG 3UAGA 1R6BX 2NZYA 1Z28A 3RTBA 4ZDWA 4BNZA 4PFKA 5HPYB 3MBIA 2WSMA 4YK7A 3TCNA 4YREA 1G5FA 3CW8X 1YI1A 1YQQA 1IN6A 3HUEA 2AOXA 2MSWA 4HAYA