3SYVA

Crystal structure of mpacsin 3 f-bar domain mutant
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
285
structure length
249
Chain Sequence
SFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADWARKWRGAVEKGPQYGTLEKAWHAFFTAAERLSELHLEVREKLHGPDSERVRTWQRGAFHRQVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHTARKDEKEAEKMKTQYEQTLAELNRYTPRYMEDMEQAFESCQAAERQRLLFFKDVLLTLHQHLDLSSSDKFHELHRDLQQSIEAASDEEDLRWWRSTHGPGMAQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C and casein kinase II substrate protein 3
publication title Rigidity of wedge loop in PACSIN 3 protein is a key factor in dictating diameters of tubules
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 106
structure length 249
sequence length 285
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3syvA01
2RAJA 3I2WA 3QNIA 2FICA 3HAHA 4I1QA 2D4CA 1I4TA 2Z0OA 2C08A 3HAIA 3HAJA 3M3WA 4NQIA 4FZSA 2Z0VA 2RAKA 2EFLA 3LLLA 4ATMA 2Q13A 2X3VA 3ACOA 2EFKA 2Q12A 1Y2OA 1X04A 2YKTA 3QWEA 3SYVA 2D1LA 4WPCA 3Q0KA 4WPEA 2X3WA 1I4DA 3PLTA 3Q84A 5C5BA 3SOGA 3G9GA 4AKVA 5C5BB 1I4LA 2X3XA 1URUA 4DCNC 4H8SA 4NSWA 3CAZA 4DYLA 2RAIA 1ZWWA 1I49A 3DYTA 3ABHA 3OK8A 4BNEA 1X03A 3QE6A 4AVMA 2Z0NA 2V0OA 2ELBA 1WDZA
chains in the Genus database with same CATH superfamily
2ND0A 2D4CA 4EZNA 3HAIA 3M3WA 3LVTA 3D2EA 3C7NA 3BUDA 2QXLA 1Y2OA 2F18A 2D1LA 3VEBA 2N3KA 1O7DC 4IM0A 4H8SA 1DKYA 3ERCC 4AZ7A 3HAJA 2GF4A 1GN9A 4IM2A 1OA1A 4R5KA 3EJRA 4AKVA 3T4AG 1R33A 4AZ5A 4EZRA 3RV1A 2V0OA 4JLCA 4D8JA 4IWQA 4R5JA 4EZZA 2GA9D 2Q12A 4UDXX 3BUIA 2YIBA 3BVWA 3I01A 3T47A 3CAZA 3VEAA 3CZSA 1U00A 2FICA 4NQIA 2Z0VA 2RT6A 3VKHA 3CV5A 3ACOA 2YIAA 4JWDA 2YKTA 1TQSA 4HY9A 3EJUA 4DYLA 2PY6A 3T49A 3L3PA 4UDYX 4F01A 3DPPA 5KBPA 3RPMA 2GAFD 2WYIA 3LLLA 1QWNA 3EJTA 1HWWA 1YWMA 1SU8A 5C5BA 1SUFA 2X3XA 3D51A 3BLBA 4KIKB 2RAJA 3QNIA 1I4TA 2JNKA 3B52X 1TQUA 3KDRA 2JNSA 3D4YA 3Q84A 3SOGA 1R34A 3FD9A 4HR1B 4M0MA 2X5CA 3DX3A 3D4ZA 3GI7A 2ELBA 2YI9A 3OHXM 1DKXA 3D50A 3DX0A 4AZIA 3I04A 2F7RA 3B53X 1OAOA 2WYHA 3L3OM 4FZPA 3O3OB 4FM3A 1HTYA 3QA8A 1TQTA 3DYTA 3OK8A 3I2WA 3HAHA 2Z0OA 4E3CA 2OBMA 2C08A 2F7QA 3F7WA 2PMRA 4IW0A 3DPOA 3RV0A 2O0I1 4WPEA 2YI8A 1I4LA 3BVUA 4DCNC 1JQKA 1R5EA 1ZYLA 3D2FA 2YL6A 2OO2A 4EZSA 2YLAA 4IWOA 2MI7A 2RAKA 3D52A 3LMFA 4EZTA 4EZQA 4JL9A 3DX4A 1QWUA 2ALWA 5FLEX 3ER9B 4JNEA 1X03A 1O7DB 1GNLA 4ATMA 3B51X 3BVVA 5TKYA 4WPCA 1E2UA 2X3WA 3DDGA 5E84A 3T46A 3BUQA 4H6IA 4AZCB 4EZXA 3BUBA 3QE6A 4G6QA 4EZWA 2F7OA 4JWIA 1SU6A 4EZPA 4I1QA 1DKZA 4HYBA 3CKDA 4PO2A 4FZSA 3ZEDA 2KHOA 2EFKA 1GNTA 4AZCA 2YL9A 1URUA 1HXKA 4KIKA 3BVXA 4R5LA 4EZUA 4JWCA 1MJGA 1W9MA 1QX1A 4EZOA 2X3VA 2OW7A 3SYVA 4HR1A 2NCZA 3UITA 4AZ6A 3BUPA 2ND1A 4BNEA 2OW6A 2QKWA 3KAWA 3ER8C 1TQVA 3CVRA 2EFLA 1TQWA 1I4DA 4FZOA 3G9GA 4AZBA 1PS3A 2EWFA 3T48A 1OA0A 2F1AA 4AVMA 2Z0NA 2F1BA 3A98A 2YLLA 2WINM 4E81A 4IM3A 2OBLA 3QWEA 2F7PA 3DX1A 2EX3B 1I49A 2ZXQA 2LXYA 3I39X 2QFFA 3EJQA 3KAVA 2FYVA 4JN4A 2LM0A 3O3MB 4EZVA 3DX2A 3DPQA 1X04A 5FIGA 3O3NB 2YIVX 3Q0KA 3PLTA 4JWEA 1E9VA 4F00A 3BVTA 1LQ7A 5C5BB 2RAIA 1ZWWA 4R5GA 3ABHA 4B9QA 4H6HA 1WDZA 4NPHA 2YL5A 4AZGA 3CZNA 3QNJA 4EZYA 2YL8A 1E1DA 2Q13A 3DDFA 4JNFA 1UPXA 4AZHA 4IWPA 3EJSA 4R5IA 2Z8YA 1SU7A 3OWGA 2OZNB 4NSWA 3EJPA
chains in the Genus database with same CATH topology
2RAJA 3I2WA 3QNIA 2FICA 3HAHA 4I1QA 2D4CA 1I4TA 2Z0OA 2C08A 3HAIA 3HAJA 3M3WA 4NQIA 4FZSA 2Z0VA 2RAKA 2EFLA 3LLLA 4ATMA 2Q13A 2X3VA 3ACOA 2EFKA 2Q12A 1Y2OA 1X04A 2YKTA 3QWEA 3SYVA 2D1LA 4WPCA 3Q0KA 4WPEA 2X3WA 1I4DA 3PLTA 3Q84A 5C5BA 3SOGA 3G9GA 4AKVA 5C5BB 1I4LA 2X3XA 1URUA 4DCNC 4H8SA 4NSWA 3CAZA 4DYLA 2RAIA 1ZWWA 1I49A 3DYTA 3ABHA 3OK8A 4BNEA 1X03A 3QE6A 4AVMA 2Z0NA 2V0OA 2ELBA 1WDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RAJ A;  3I2W A;  3QNI A;  2FIC A;  3HAH A;  4I1Q A;  2D4C A;  1I4T A;  2Z0O A;  2C08 A;  3HAI A;  3HAJ A;  3M3W A;  4NQI A;  4FZS A;  2Z0V A;  2RAK A;  2EFL A;  3LLL A;  4ATM A;  2Q13 A;  2X3V A;  3ACO A;  2EFK A;  2Q12 A;  1Y2O A;  1X04 A;  2YKT A;  3QWE A;  3SYV A;  2D1L A;  4WPC A;  3Q0K A;  4WPE A;  2X3W A;  1I4D A;  3PLT A;  3Q84 A;  5C5B A;  3SOG A;  3G9G A;  4AKV A;  5C5B B;  1I4L A;  2X3X A;  1URU A;  4DCN C;  4H8S A;  4NSW A;  3CAZ A;  4DYL A;  2RAI A;  1ZWW A;  1I49 A;  3DYT A;  3ABH A;  3OK8 A;  4BNE A;  1X03 A;  3QE6 A;  4AVM A;  2Z0N A;  2V0O A;  2ELB A;  1WDZ A; 
#chains in the Genus database with same CATH topology
 2ND0 A;  2D4C A;  4EZN A;  3HAI A;  3M3W A;  3LVT A;  3D2E A;  3C7N A;  3BUD A;  2QXL A;  1Y2O A;  2F18 A;  2D1L A;  3VEB A;  2N3K A;  1O7D C;  4IM0 A;  4H8S A;  1DKY A;  3ERC C;  4AZ7 A;  3HAJ A;  2GF4 A;  1GN9 A;  4IM2 A;  1OA1 A;  4R5K A;  3EJR A;  4AKV A;  3T4A G;  1R33 A;  4AZ5 A;  4EZR A;  3RV1 A;  2V0O A;  4JLC A;  4D8J A;  4IWQ A;  4R5J A;  4EZZ A;  2GA9 D;  2Q12 A;  4UDX X;  3BUI A;  2YIB A;  3BVW A;  3I01 A;  3T47 A;  3CAZ A;  3VEA A;  3CZS A;  1U00 A;  2FIC A;  4NQI A;  2Z0V A;  2RT6 A;  3VKH A;  3CV5 A;  3ACO A;  2YIA A;  4JWD A;  2YKT A;  1TQS A;  4HY9 A;  3EJU A;  4DYL A;  2PY6 A;  3T49 A;  3L3P A;  4UDY X;  4F01 A;  3DPP A;  5KBP A;  3RPM A;  2GAF D;  2WYI A;  3LLL A;  1QWN A;  3EJT A;  1HWW A;  1YWM A;  1SU8 A;  5C5B A;  1SUF A;  2X3X A;  3D51 A;  3BLB A;  4KIK B;  2RAJ A;  3QNI A;  1I4T A;  2JNK A;  3B52 X;  1TQU A;  3KDR A;  2JNS A;  3D4Y A;  3Q84 A;  3SOG A;  1R34 A;  3FD9 A;  4HR1 B;  4M0M A;  2X5C A;  3DX3 A;  3D4Z A;  3GI7 A;  2ELB A;  2YI9 A;  3OHX M;  1DKX A;  3D50 A;  3DX0 A;  4AZI A;  3I04 A;  2F7R A;  3B53 X;  1OAO A;  2WYH A;  3L3O M;  4FZP A;  3O3O B;  4FM3 A;  1HTY A;  3QA8 A;  1TQT A;  3DYT A;  3OK8 A;  3I2W A;  3HAH A;  2Z0O A;  4E3C A;  2OBM A;  2C08 A;  2F7Q A;  3F7W A;  2PMR A;  4IW0 A;  3DPO A;  3RV0 A;  2O0I 1;  4WPE A;  2YI8 A;  1I4L A;  3BVU A;  4DCN C;  1JQK A;  1R5E A;  1ZYL A;  3D2F A;  2YL6 A;  2OO2 A;  4EZS A;  2YLA A;  4IWO A;  2MI7 A;  2RAK A;  3D52 A;  3LMF A;  4EZT A;  4EZQ A;  4JL9 A;  3DX4 A;  1QWU A;  2ALW A;  5FLE X;  3ER9 B;  4JNE A;  1X03 A;  1O7D B;  1GNL A;  4ATM A;  3B51 X;  3BVV A;  5TKY A;  4WPC A;  1E2U A;  2X3W A;  3DDG A;  5E84 A;  3T46 A;  3BUQ A;  4H6I A;  4AZC B;  4EZX A;  3BUB A;  3QE6 A;  4G6Q A;  4EZW A;  2F7O A;  4JWI A;  1SU6 A;  4EZP A;  4I1Q A;  1DKZ A;  4HYB A;  3CKD A;  4PO2 A;  4FZS A;  3ZED A;  2KHO A;  2EFK A;  1GNT A;  4AZC A;  2YL9 A;  1URU A;  1HXK A;  4KIK A;  3BVX A;  4R5L A;  4EZU A;  4JWC A;  1MJG A;  1W9M A;  1QX1 A;  4EZO A;  2X3V A;  2OW7 A;  3SYV A;  4HR1 A;  2NCZ A;  3UIT A;  4AZ6 A;  3BUP A;  2ND1 A;  4BNE A;  2OW6 A;  2QKW A;  3KAW A;  3ER8 C;  1TQV A;  3CVR A;  2EFL A;  1TQW A;  1I4D A;  4FZO A;  3G9G A;  4AZB A;  1PS3 A;  2EWF A;  3T48 A;  1OA0 A;  2F1A A;  4AVM A;  2Z0N A;  2F1B A;  3A98 A;  2YLL A;  2WIN M;  4E81 A;  4IM3 A;  2OBL A;  3QWE A;  2F7P A;  3DX1 A;  2EX3 B;  1I49 A;  2ZXQ A;  2LXY A;  3I39 X;  2QFF A;  3EJQ A;  3KAV A;  2FYV A;  4JN4 A;  2LM0 A;  3O3M B;  4EZV A;  3DX2 A;  3DPQ A;  1X04 A;  5FIG A;  3O3N B;  2YIV X;  3Q0K A;  3PLT A;  4JWE A;  1E9V A;  4F00 A;  3BVT A;  1LQ7 A;  5C5B B;  2RAI A;  1ZWW A;  4R5G A;  3ABH A;  4B9Q A;  4H6H A;  1WDZ A;  4NPH A;  2YL5 A;  4AZG A;  3CZN A;  3QNJ A;  4EZY A;  2YL8 A;  1E1D A;  2Q13 A;  3DDF A;  4JNF A;  1UPX A;  4AZH A;  4IWP A;  3EJS A;  4R5I A;  2Z8Y A;  1SU7 A;  3OWG A;  2OZN B;  4NSW A;  3EJP A; 
#chains in the Genus database with same CATH homology
 2RAJ A;  3I2W A;  3QNI A;  2FIC A;  3HAH A;  4I1Q A;  2D4C A;  1I4T A;  2Z0O A;  2C08 A;  3HAI A;  3HAJ A;  3M3W A;  4NQI A;  4FZS A;  2Z0V A;  2RAK A;  2EFL A;  3LLL A;  4ATM A;  2Q13 A;  2X3V A;  3ACO A;  2EFK A;  2Q12 A;  1Y2O A;  1X04 A;  2YKT A;  3QWE A;  3SYV A;  2D1L A;  4WPC A;  3Q0K A;  4WPE A;  2X3W A;  1I4D A;  3PLT A;  3Q84 A;  5C5B A;  3SOG A;  3G9G A;  4AKV A;  5C5B B;  1I4L A;  2X3X A;  1URU A;  4DCN C;  4H8S A;  4NSW A;  3CAZ A;  4DYL A;  2RAI A;  1ZWW A;  1I49 A;  3DYT A;  3ABH A;  3OK8 A;  4BNE A;  1X03 A;  3QE6 A;  4AVM A;  2Z0N A;  2V0O A;  2ELB A;  1WDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...