3SZ3A

Crystal structure of tryptophanyl-trna synthetase from vibrio cholerae with an endogenous tryptophan
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
341
structure length
341
Chain Sequence
SNAMSKPIVLSGVQPSGELSIGNYLGALRQWQQMQDDYDCQYCVVDLHAITVRQDPQALHEATLDALAICLAVGVDPKKSTLFVQSHVPEHAQLGWVLNCYTQMGELSRMTQFKDKSARYANDVNAGLFGYPVLMAADILLYGAHQVPVGSDQKQHLELARDIATRFNNIYSPEQPIFTIPEPYIPTVNARVMSLQDATKKMSKSDDNRKNVITLLEDPKSIIKKINKAQTDAETPPRIAYDVENKAGIANLMGLYSAATGKTFAEIEAQYAGVEMYGPFKKDVGEAVVAMLEPVQAEYQRIRNDREYLNSVMRDGAEKASAKALQTLKKVYAAVGFVARP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophanyl-tRNA synthetase
publication title Crystal structure of Tryptophanyl-tRNA synthetase from Vibrio cholerae with an endogenous tryptophan
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Ligase
total genus 132
structure length 341
sequence length 341
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 3sz3A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3sz3A01
1OBHA 4MWDA 4PBRA 3RJZA 1N3LA 3L92A 2DETA 2QJTA 5H16A 3KT0A 1T6XA 1EFPA 3FH0A 1ZH6A 4RUKA 4U7JA 3CLTC 3F3MA 5BNZA 1V8FA 3ND7A 2YWCA 1EUQA 1IH8A 3H97A 1OWPA 4S1OA 1F4LA 3TZLA 2E0IA 3FOCA 2PZ8A 1ULHA 2QTMA 3DLAA 3AKZA 4ZCQA 1IFXA 1KORA 1YIDA 1OBCA 3DPIA 2DLCX 4GU5A 4MW5A 1GAXA 1R6UA 1O94C 2TS1A 4WSOA 2CFOA 2OQ2A 3CVWA 3N8HA 2Z08A 3CVYA 1J1UA 1R6TA 4AQ7A 1M8PA 2J08A 4EFKA 5HG0A 2NZ2A 3ND5A 3PXUA 1M8FA 1IQ0A 3RK1A 4KR7A 2V0GA 4YMIA 2O5RA 1EE1A 4NAHA 4DJAA 4MVCA 3SDBA 3FI0A 1G8HA 1PG0A 2CT8A 2QUKA 4DDHA 1MC1A 3AG5A 4ZT5A 1KP2A 3VU8A 5DASA 1IHOA 4MUNA 1PFWA 3QTTA 5TEVA 3IMEA 3UY4A 2QJFA 4R0NA 4PY2A 4DE5A 1JHDA 1J21A 2E21A 1QJCA 4MUJA 1WXIA 3INNA 5DEOA 4EG6A 3COVA 3FY4A 2IELA 4HK4A 1KH1A 4QREA 1KAMA 3CVXA 3PRHA 1N2BA 3NBAA 1KH2A 3COWA 1KKUA 3IMCA 4I6GA 1K4KA 4MW9A 3AIIA 4E1AA 3OP1A 1TYBE 2A86A 3ILVA 3PNVA 3TQOA 2DPLA 4KKVA 4YP5A 1KP3A 3ELBA 1BS2A 1N78A 2PFSA 4ZT3A 1JEEA 3CLTD 4RPIA 3HL4A 3G5AA 5HUHA 1I6MA 4HJRA 4U8HA 1M1ZA 3HZRA 1N2IA 4JYZA 2X3FA 3FG9A 1KQNA 2RE8A 4Q93A 1N1DA 5LFAA 4I6EA 1IVSA 2QUHA 1WOYA 3IDFA 2XRZA 1N2OA 1O94D 2JANA 4MWBA 2WSIA 3GMIA 1ZH0A 2J5BA 1Q77A 2G36A 5K0TA 1EFPB 1K4MA 1NUQA 2CV2A 1H3NA 4UZEA 3A04A 1RQGA 3UK2A 3K32A 1MJHA 4J76A 2YXNA 1J1ZA 3NBKA 1HYBA 1OWOA 1N2HA 1O95D 4G6ZA 2CV0A 3N05A 1K97A 2ZUEA 4MUGA 1LW7A 1XJQA 1S4MA 2A1TS 3FETA 5K0SA 3SZ3A 3X1KA 4BWVA 5LM3A 2QUJA 4EGAA 4EG8A 4NAUA 1QU2A 1WXEA 3HGMA 5J59A 4MUIA 1QNFA 4KR6A 2D54A 4CQNA 1F9AA 1GPMA 1TQ8A 1B6TA 1N75A 2DERA 1N2GA 2A1UB 3Q10A 2DR2A 3IH5A 1A8HA 1COZA 1WY5A 2JAXA 2PXHA 2B7LA 2YWBA 1UFVA 1WXHA 1N77A 1TYAE 1ILEA 3CLSD 3X1JA 4CDMA 3VGJA 3L93A 1G8FA 2DXIA 3FWKA 4NZPA 1T6YA 4MULA 4K03A 2WQ6A 3KT8A 5HUJA 1VBNA 1I2DA 5KCMA 3NV7A 4DDKA 1OWNA 4JXZA 2EJCA 3TNJA 4NX2A 4KPUA 1XNGA 2CYAA 1O95C 4NATA 1IRXA 2A1UA 4MWCA 1EUYA 4EG1A 2X1MA 4F3RA 4ARCA 1O5TA 3LOQA 1LI5A 1NSYA 3Q12A 3ND6A 4U63A 1GZUA 1G8GA 4DDMA 1SURA 1T9GS 1O97D 3RBAA 3AFHA 4UZFA 5KWVA 2X0KA 3COYA 3A2KA 3N9IA 1ZUNA 5LLTA 1DNPA 1M8KA 2A84A 3TZEA 4X0EA 1WJGA 4ZCRA 4HPWA 1MAUA 2J09A 4EG4A 1WKBA 3HV0A 1NUTA 3X1MA 4HJXA 1O96B 3ZUGA 3C8ZA 3D6UA 4TS1A 1YULA 3CLUC 4I6JA 3CLSC 3ZJUA 1H1TA 1TYDE 2VTBB 2Z3VA 2XRYA 2CV1A 1GLNA 3IUBA 3FIUA 3H9CA 3IVCA 3MUEA 4R2MA 4MW1A 3Q4GA 1J20A 1ZJWA 4J75A 3KFLA 1NUSA 4MUFA 3CA8A 1I6KA 4ZT6A 3UMVA 2Z09A 3CR8A 4YBRA 3QTBA 1GN8A 2PZAA 3IMGA 2WB2A 1WQ4A 3SP1A 3P52A 3SEQA 4ZT2A 1MRZA 4ZCTA 1O96A 3RFFA 4JZYA 1P7PA 5J5AA 3LCJA 1O6BA 1EXDA 3S3TA 2PIDA 1NURA 4PBSA 3E27A 1O97C 4MUHA 1QRTA 3MLBA 1JILA 2VTBA 1WZ2A 4MAFA 3A05A 1JIKA 1JECA 5JBNA 3RK0A 2HZ7A 1Y42X 3D6VA 3IOEA 1PFYA 1NUUA 4KR9A 1NUPA 4OUDB 4ARIA 1F7UA 4PBTA 3CVUA 1YI8A 3H05A 2VXOA 4G5FA 1JGTA 1XNJA 1WQ3A 3IVGA 1JMVA 1Q19A 2E18A 4MUKA 2R5WA 4EG3A 1MAWA 4A91A 4ZCSA 3OTWA 1X8XA 1X6VA 3H9BA 5TGTA 2C5SA 4QBTA 2CYBA 4EF6A 1MB2A 2HGZA 3TS1A 4OJMX 5IJXA 4MVXA 1VBKA 2DEUA 3K9WA 4KPUB 1QU3A 4MWEA 3IOBA 3RHSA 4OUDA 4JFAA 3P0IA 3U1VA 4MW0A 3UC5A 4QRDA 1NYLA 1VLHA 2ZUFA 3CLUD 3H99A 2PG3A 4Q16A 1OD6A 2J4DA 4K0RA 4ND6A 1M8JA 1MBZA 5IHXA 1JIJA 4H3SA 4L2IB 3ZIUA 1M83A 2D5BA 3ZGZA 1U7XA 4DNXA 4P2BA 2CSXA 4GRIA 3LE8A 4CT0A 3IUEA 1N2EA 4NDAA 4WNYA 3ZXSA 4G5YA 3FNRA 5J58A 2AG6A 1K92A 1O0BA 3PNBA 1EFVA 3IVXA 3A4IA 4XFDA 4ND7A 3G6KA 2NSYA 2EL7A 3HMQA 3MLAA 1WXGA 1JIIA 2CUZA 3JXEA 3IODA 3IOCA 1YUNA 2GOYA 4L2IA 2PZBA 2HMAA 4EG5A 1QTQA 2A4MA 4YP7A 3AG6A 3P0HA 2V0CA 1H3FA 2CYCA 3ZJTA 1OWLA 3FHJA 1T6ZA 2A7XA 2DUMA 3BL5A 2J07A 4JXXA 5DB4A 3SEZA 4ZCPA 1KAQA 2YY5A 1QRUA 3ZJVA 2AZXA 1R6XA 4XSVA 1FFYA 1JZQA 3COZA 2X1LA 1KR2A 2BTEA 1NZJA 2GM3A 2WQ7A 2IP1A 1J09A 1Q15A 5FO0A 1NI5A 3ZXIA 1YUMA 2AKEA 1IQUA 4MQ6A 3P0JA 1FYDA 3TQIA 5EKDA 2H2AA 4F4HA 4MW2A 1YIAA 3N2YA 4ZT7A 1QQTA 1TYCA 1V47A 2IJGX 2A1TR 1XNHA 2GKSA 2QTNA 3MMXA 3CLRD 1EJ2A 3DO8A 2E89A 1TEZA 1F7VA 1U0BB 4DLPA 1I6LA 1KH3A 2D13A 2JA2A 1GTSA 3AL0C 1VBMA 4XFJA 5H7XA 1VL2A 3CVVA 2RD2A 2A88A 2I1LA 5TS2A 1KQPA 4ZT4A 1N2JA 2H29A 1GTRA 5FNZA 4EG7A 3KT3A 1MB9A 3VRHA 2OV4A 1G59A 1Q11A 1PFVA 1D2RA 2O8VA 1JEDA 1LI7A 2ZP1A 5KHAA 3MXTA 1JZSA 1U7DA 1PG2A 1PFUA 3I05A 1QRSA 4CDNA 3QE4A 3PNYA 1CT9A 1TFUA 1H3EA 3M5WA 3GUZA 4YP6A 5F23A 3HFJA 1OWMA 3SYTA 5TEWA 1WXFA 2QTRA 1NP7A 3KT6A 5DK4A 3GLVA 4MVYA 4MW7A 2BYTA 3FDXA 3ISJA 1IQRA 1KQOA 4MW4A 5AHWA 4R2LA 1O0CA 1MOPA 1M8GA 2QJOA 3DV2A 2QUIA 4MW6A 3SZGA 1EFVB 3CLRC 1J70A 4MLPA 4AS1A 5FO1A 1T9GR 1U3CA 4FZJA 3UOWA 3G59A 4MUEA 1U3DA 4MVWA
chains in the Genus database with same CATH superfamily
4BZPA 2BUBA 3QPVA 2B3TA 4RIIA 1FDTA 4OQXA 1ZJ5A 3P26A 3PDHA 2W7TA 4OXXA 1X80A 4IJ5A 2WUFA 3GBSA 1NPYA 1QFZA 3KJZA 3F6YA 4H08A 1OXSC 4OGWA 3GFRA 3ROMA 4LWZA 4B7AA 4Q00A 3SDSA 1OAKA 10MHA 1GU7A 4OPMA 1KEZA 3V4OA 2PGAA 1F0KA 5AM3A 3TAHA 1O03A 3GXBA 2W8ZA 2NZJA 3ORYA 1LPSA 4FZVA 3ZGLA 4OEHA 4MS1A 3MYYA 5BN5B 2GN9A 2W2PA 4R01A 5KC8A 4XPIB 2XYGA 4HLNA 3UJ9A 3HA2A 5JIBA 3USZA 5E38A 5JROA 2P65A 4WE3A 1UMDB 4CIWA 3CVWA 2GZ3A 1FU7A 4HDCA 3CVYA 1E69A 1QHGA 2XB9A 4LRWA 1X7YA 2AZMA 3MVEA 2DB3A 1DQPA 1VLQA 5JJBA 3DDUA 4HY3A 5CVEA 2ECQA 2X7XA 1ZMTA 2MSDB 3PG5A 4EL0A 5HBGA 5KYWB 1SRQA 3TKAA 3FSJX 3GROA 1LH0A 2Y68A 4BMOB 2FPMA 2BFCB 2H4XA 2BGMA 4K6KA 3KPUA 1ECGA 1TLTA 2BGNA 3K9NA 2EZUA 2ATEA 1Z8DA 4B6JA 4YPVA 4LYEA 1Y98A 1MXHA 3PUVA 1N7GA 2WW8A 1PG0A 3L8ZA 4W8OA 1EPUA 4WN3A 3SDBA 1X8LA 2GN1A 4D42A 1KNQA 1RQRA 1WS6A 2B8EA 1P1KA 2N0SA 2XHZA 2ZJZA 4MRPA 5AJUA 1K2VN 4LOKA 1KOFA 1JB9A 1ZOLA 3E82A 2OLJA 4I2VA 4LRQA 3T7KA 3BUSA 4TVBA 4Y2HA 1S7CA 4I4CA 1U81A 3V46A 1MJFA 5DOVA 2I4OA 4FYHA 4MQEB 4HQFA 3TL6A 4B5LA 5CFOA 3LP5A 5DYYA 4DJJA 5IX8A 3WQHA 3S55A 1O08A 4WFKA 2XDAA 3LP8A 3DV9A 5EN4A 2GYWA 2PVPA 4PAOA 3VNRA 3IOYA 1Z26A 3LYAA 2PCJA 2QLTA 2YIDA 3HBAA 3L1VA 3WKEA 4LCBA 4TTJA 4N12A 3ZE1B 5HKOA 2EF1A 3PCTA 4FS8A 2YJ3A 1ST3A 1WSDA 1ONSA 3EMVA 2OHHA 3I4FA 1QHEA 1JJFA 3FWYA 3LM8A 1QHHA 3MD0A 4CQLB 1TECE 2QQ0A 1Z0FA 1KH1A 3NEYA 5IANA 4U3JA 4QUJA 1VLMA 5LXTF 3HU3A 3TRHA 4QGBA 4F45A 2GASA 2M1XA 2XUKA 4H60A 3RASA 1GPKA 2F3TA 5DGIA 1N8KA 3OP1A 1DWQA 3JQ9A 1PT8A 2D7CA 3K70C 2O6LA 3CR3C 3DE1X 3LS2A 2CN1A 1W46A 5IK2D 1V16A 2WJJA 3QNMA 4MV8A 4ZPJA 1MDFA 4MYRA 1KP3A 3GAAA 1SD2A 1ZA1A 4N3CA 5H3LA 3QFCA 3ZE7A 2BM1A 5ILGA 2WJAA 1Y7HA 5TF0A 2EQ5A 1A4RA 1ZGZA 3EGXA 2EZ9A 3I4LA 4B2PA 4Z4EA 1VIVA 3OTHA 4UM7A 5K0NA 2C8LA 1PT9A 2GCGA 1Z68A 4KB5A 2I7CA 3U7FB 1N36B 3AR4A 3W77A 5AHXA 4FQ7A 3CRZA 2ZBVA 4FT4A 3CX4A 2X2OA 2N75A 1T1JA 2WHEA 3VXKA 4QBHA 5HQTA 2BEWA 4A2QA 1MG5A 3D0RA 4NPCA 3TCXB 1EESA 1PQPA 2W2TA 2C3YA 4RAOA 2G36A 4BVJA 1W5BA 7MDHA 3CSUA 3AFGA 4NK5A 1ZH2A 1WNTA 4AK9A 4HFNA 1A5BB 2G40A 2I2DA 2GZHA 2PKWA 3R5HA 2EXXA 4FWBA 1UK7A 3UK2A 1WDKA 4G01B 1MJHA 1H2ZA 5COQA 1VMAA 3SHVA 3EARA 4MS3A 4FHCA 1NQAO 2WU4A 4EPYA 2A30A 2R8RA 2WM9B 3FDIA 1LNSA 1N57A 1N8SA 2AS0A 1H2YA 4F3TA 1ODTC 4MK4A 4O1HA 4FMBB 4D56A 1TT7A 6ADHA 1Y7LA 1R00A 1R0WA 1UM9B 2P4UA 2PD3A 4UUMA 4PYRA 3L04A 4ZFNA 5HFAA 5GJVC 4BWVA 3MEQA 1H2EA 1C9NA 4E22A 3TIVA 2NIPA 2P4SA 1FB5A 1N5LA 2GSWA 4G07A 4L8WB 4M4SA 2OCKA 2OFPA 1AKTA 4EJ2A 3BL6A 1NXXA 1PQYA 3ZCSA 4D82A 1J39A 4RPLA 1L5KA 4E5KA 2IF0A 4V1CI 2PXHA 5CK4A 3M1YA 3DWFA 4X64B 1OI3A 1DS6A 3ST7A 1V8DA 3T3DA 2DHCA 1G8SA 3GFOA 3MELA 2Y0PA 2WFZA 4P83A 1I0IA 2GJSA 3JALA 4UD6A 2R8XA 3OPVA 2MOKA 2VDJA 1WXXA 1IIBA 3A11A 4OQPA 5DTJA 3OF3A 5FWDA 3T7AA 4X6LA 5AHKA 3T5PA 4QM6A 2UDPA 3V4VB 3DDOA 4L27A 4D8WA 3QUTA 1FXSA 4OU5A 4HUQB 4QM7A 5AW2A 2Z8ZA 2AF3C 1PVVA 4X71A 3JTMA 2IZ0A 2PWPA 1PQUA 4CLRA 3K1AB 4HQLA 2R4UA 1ZD9A 1AJEA 3ESBA 2WG1A 4MICA 4NBLA 3C5EA 2QX9A 2R1TB 4ZGBA 4JT9A 5JJ5A 2GZAA 2KBFA 3DJYA 3OZAA 4RZXA 4U39A 2Q3LA 1OPRA 1KDVA 4AF8A 2GK3A 4JXZA 2GNOA 2MSEB 5KNLA 3CRRA 1SQFA 3PHIA 1UUFA 1X8KA 2A1UA 2P6PA 4V3BA 3V80A 3KZKA 5C32A 2YRFA 2FSUA 3LOQA 4Q39A 2NUAA 1JYFA 5F78A 3U7QA 4X24A 5IMSA 2D3TA 1DRUA 2BDTA 4EQ6B 1BDBA 3EY9A 4JENA 2PQMA 2O3TA 4TLDA 3T5TA 5B53A 4B40A 4IMRA 1C30A 1MX9A 2F8LA 3BWEA 4FDAA 4K9NA 4ZPXA 4P5PA 5DU2A 3RQSA 1N5IA 3FTPA 4DDMA 1O97D 3ZBPA 3RADC 5BV8A 3N7UA 3E5HA 2GAOA 3IAHA 2CW5A 3UUGA 3ZJ4A 2H1IA 4J3JA 5EUQB 2WHPA 3RHTA 2HLDD 2XOKD 4I0WB 4R8MA 3ZI4A 2E6UX 1LEHA 3GRZA 1DNPA 1TK2A 1L1RA 8GPBA 1X42A 4D41A 2KBEA 1ISPA 4K1LA 4OHRA 2CD7A 5AVUA 4RY0A 4LDAA 1ZGJA 4ZTUB 2OZKA 1OVGA 3TTVA 1NXPA 4A8JC 1E2BA 5EIHA 3F7TA 3IAFA 3K05A 4GQAA 5CT4A 1PZFA 1U1FA 2X58A 4ZZ2A 5IM5A 4GSLA 2M98A 4AL4A 1D4OA 1TYDE 1EB9A 2VP4A 1CW2B 4V02A 2CLHB 4TMFA 3IAXA 5HQ3A 2VDQB 4FGWA 4JVLA 1BWSA 2LV8A 2HQBA 2V8OA 3TCKA 3ZNQA 3GIWA 1RAHA 5EWJA 4IVNA 3CPSA 4C4YA 5T7BA 3K4HA 1I6KA 3O74A 4Z1MA 2AK2A 2ZDQA 4UUPA 1LU9A 3V2HA 4X66B 4QUIA 1GTL1 3PDUA 4PWYA 5D3ZA 3H84A 2BIFA 5FI5A 2WB2A 5HHTA 1QR6A 2JH8A 2ZWIA 1H65A 2CBXA 5JNTA 4NOMA 4R9SA 2VN8A 5B4VA 2B37A 4G24A 1Z73A 2ONYA 4PCAA 3M5PA 5D2CA 5ARDA 4ENTA 2UV8A 3LXRA 1T9ZA 5J5AA 3T1OA 2X0RA 1WP4A 1OIWA 3ESRA 5DIZA 5DHAA 1ORHA 4GBMA 1O97C 1CNFA 2IEBA 3WL7A 5CFPA 1SUCA 3AW8A 3NAMA 3OX4A 4D3SA 1NZDA 1CUHA 4ILKA 4BQIA 3SQXA 1QGED 2Y0BA 3DAYA 3AJ9A 4JSRA 3ENVA 4L3VA 5LZ2A 2A5FA 3EIWA 2V3VA 3IOEA 2P77A 4UU8A 2HAEA 3T06B 4GMHA 3FYCA 1EB8A 2TSYB 2QZSA 1YS6A 3BXPA 3N5CA 4II7A 4YASA 3Q9UA 3VPFA 1MOQA 1A7KA 2BTOA 2CDBA 3EVFA 3ZNOA 3A25A 3LW8A 3JQ8A 3W9BA 3I5UA 4Q4CA 4OHPA 1QQBA 3CXUA 2V7QA 2O8CB 4CE6A 4ZAGA 2JIBA 5AVYA 3W6ZA 1E7YA 3SFTA 3UCFA 4I3HA 3IP5A 4P31A 1NKVA 3CKLA 3RREA 2AKYA 3FDZA 2I3GA 1V45E 4DNPA 4EYKA 4IDGA 3N53A 3FGNA 5EJFA 5A3VA 3GDWA 4A73A 1DC4A 2RGDA 5DW0A 4C0XA 3UICA 1IZ0A 2P6MA 3NLLA 5CD1A 4MVXA 1HEUA 3CQ9A 3K9WA 4KPUB 4YWJA 5LL6P 1P2VA 3N58A 3FMVA 1YB7A 2VTVA 5EHGA 4YHHB 4ZIRA 4G1UC 4MP8A 1TKCA 4W5RA 4P9NA 3B1ZA 1IY1A 2PYDA 2DTDA 5EIOA 5TPZA 1WQ1R 4ADSG 1KS2A 4FEGA 1FLAA 4I9FA 2AEMA 4E03A 1SHUX 3R9XB 1Y3BE 2W2VA 4FXPA 1T9DA 2QL7A 4ZREA 5JYBA 4P33A 4URVR 4WL0A 1M8JA 3LQ2A 3ZC3A 1JSZA 3CUWA 4EM6A 2D7DA 1R8SA 3ZUPA 1JHQA 2COKA 4OGKA 5FFMA 3MJCA 4MMXB 1IZ8A 1QYRA 3HNPA 2ZYWX 1PLJA 3NT5A 3O4FA 2C2ZA 4IXWA 3ZHZA 4BNUA 4MDEA 3ZGZA 3LGSA 5F9FA 4HZUB 2RHCA 3LE8A 5EXDA 4XVCA 1S8OA 4W9MC 2XF8A 2MWMA 1GUAA 3JSXA 3V32A 1HNXB 4UTOA 1UJNA 1G2QA 4LWOA 1GPH1 1JQAA 3N28A 1U7HA 3R3YA 3ZCRA 3UGJA 2PX8A 3ONDA 1W36D 4NFHA 1PG5A 4R68A 4W9NA 2DPGA 1GGEA 3V4LA 1NJ1A 5EP1A 3QOXA 3W1EA 3ZJYA 5JAOA 3AKEA 1E1QA 3IVMA 3QLVA 4GOOD 3PXBA 4KP7A 5FOUA 1JJBA 2YHIB 5IBQA 3WLPA 5IS2A 3D4BA 5TR9A 3T3GA 4P3PA 1WXGA 4P8RA 1JS1X 3GEMA 2OYSA 3GLKA 3JVUA 2FZCA 4NZNA 5COBA 4BRUA 4DBZA 4I1UA 3SGLA 3GT0A 4ND5A 3VUFA 5FEMA 1DHTA 1O6GA 1DOZA 3CTPA 4P4SA 5K03A 1DINA 2ZU0C 4G0NA 3VJKA 1BTOA 2QY9A 4YBZA 5G40A 4CR6A 2L18A 1KAEA 1OWLA 3G2NA 3DXZA 3ICCA 2J07A 3QBJA 1F2TA 1V71A 2HSWA 1UC4B 2OM6A 5IJAA 4B6GA 4CMIB 5FAXA 1MORA 1WY7A 4BCCA 1RAGA 1Z4KA 5IC6A 4G4JA 5HW0A 1JZQA 2OAQ1 1XLUA 4XGQA 4G5RA 2HT6A 4UE2A 4EHKA 2B78A 2P2GA 2JIZD 5GQSA 1Z0UA 5KWSA 4FT2A 4DMLA 2IP1A 1JFFB 2C4NA 1T2FA 1OB5A 2C31A 2YJTD 4DBLE 1IDOA 4RULA 3EGCA 2AKEA 1NF2A 5DNAA 3PPWA 2OHIA 3EEOA 2IHKA 1UDAA 2OK8A 3EGDA 1OFHA 4GPZA 4MW2A 2OZLA 4AJNA 1O9GA 2D8MA 2I2FA 3N2YA 5H5JA 1V3TA 4L4ZA 4OLAA 5M34A 2QD4A 3M1IA 2VG8A 5T67A 9LDTA 1YT5A 1E59A 2A1TR 1E7MA 1X7XB 4KZKA 2QTNA 4KODA 2I2XB 2ZJ6A 4WIAA 4ZOEA 3SU8A 3IQZA 4E2YA 6ABPA 4ZVVA 4DR5B 1QYCA 4FYMA 5BNIA 1AKUA 1OZAA 5C37A 3G9TA 4FDMA 2JA2A 4RV4A 3W9YA 1DAMA 2A9RA 3FJYA 3A3OA 3D3QA 2WIDA 1T8RA 2Q6VA 5JE8A 2F6RA 4NYJR 4TV8A 4KUGA 1I4EB 2DH6A 5L4LA 2ZR0A 1JFTA 3TPCA 3C6QA 1JFLA 1KQPA 1SPXA 1ULAA 4R6XA 2G0AA 1U7ZA 1VIMA 3QX3A 5IT9A 2H7YA 2Z98A 1GT6A 4F97A 4RY8A 2JHPA 5GWXA 2QZJA 3QXGA 4HLQB 4C3ZA 4FX2A 4TN1A 3JAWA 5DCWA 2CXXA 2ZSBA 1A9SA 1EU1A 4UARA 2XT0A 4KOAA 5BMVF 2X86A 2BFWA 4EY6A 1FDWA 1UEJA 4OHVA 5JQGF 1LI7A 3GJ0A 4XYGA 4ENWA 2EX4A 4IRUB 1EFCA 2EKBA 1BE0A 4GYKA 1GV1A 4Z0NA 3AR8A 2WWRA 2YWFA 2WUGA 3AERB 2FPPA 1UMBB 3MRSA 2NN3C 3VTAA 4F7WA 3WLMA 3QBVA 3P9NA 1C3OA 3E3MA 3BZBA 4PANA 3BRCA 2QG6A 2ZIXB 1QHFA 1S2NA 1SCUB 2R48A 3L1UA 4K6GA 1MT0A 4W7IA 5F4ZA 3AVQA 4BHTA 5TEWA 3K0SA 2QSZA 3C6KA 3FOFC 4OB7A 2WPDA 1K88A 1KO4A 1YSCA 3ZK8A 5EZSA 4EELA 2ESRA 1O4VA 2PZGA 3JYHA 4CDGA 3O3CA 4WCFC 5H80A 1NM5A 3AI2A 5TY0A 1S2OA 2Z5VA 3IRUA 2GXQA 2UZ3A 3PUZA 2V3CC 4Z2YA 2BRUA 1JLMA 3DV2A 1V5GA 4ZO7A 1MOZA 4TWBA 4AS1A 4ZC8A 1RJDA 2O2ZA 3FVTA 3KHTA 2VSQA 3NRJA 5BV1A 4D3DA 4FZJA 4LI0A 3AUFA 3PIDA 4V0RA 1ZLYA 2W6QA 3VPHA 3UAYA 4DG9A 3NORA 4BCBA 5LDDC 4JI0B 4OYYA 3IIMA 3VR6D 5B4UA 3A4TA 4C4OA 3MUFA 3VBCA 4PR0A 1YA4A 3B6JA 4MJLA 3V4FA 2TYSB 1J00A 5H16A 4OBWA 1ZK1A 4JDUA 4OG2A 4PCUA 1YE8A 4CKCA 1TZBA 3OLQA 3LOUA 4RD1A 5AMXA 3NWEA 5JANA 4G85A 2AN5A 1EUQA 3H97A 2ODAA 3QY0A 1E8DA 4I9UA 3PVCA 4UHBA 4NZYA 1AKWA 4BZZA 1T8PA 4X20A 2I78A 1NMSA 3AKZA 2NPIA 4LBWA 3PT9A 2WF6A 4TLLB 2VHEA 3L2OB 4FILA 4Q3NA 5DBEX 3GCXA 5CT8A 3RVLA 5CB4F 5I7VA 5J4KA 5CCDA 2QA5A 4GM0A 4WSOA 5DLYA 5I7SA 1OIXA 1XD2A 4UULA 1JSCA 3DZBA 4RH0A 1KBQA 1NLFA 1EX7A 1J1UA 2GWHA 1J4AA 4C7JA 3HDTA 4LNAA 1ADJA 3P9SA 2I91A 2AJDA 4HXEB 3KJIA 4YI3A 4CNBA 2NP7A 5DOZA 2NZ2A 2VHZA 3L02A 4MZXA 2LNDA 2JK1A 2OE2A 1B1CA 3GJ6A 2YMQA 3TRJA 2O5RA 3UTDA 4J49A 1N6RA 3RG2A 3H11B 1P9WA 4DJAA 1HDEA 1M0EA 2D2XA 1AXRA 2GN0A 2O8FB 4A1FA 5K0FA 4KV7A 4Z2AA 1EGAA 2C97A 4K8OA 2BZ0A 4Q1EA 1PVDA 1P2GA 1W59A 3HVKA 1XZAA 4PTLA 4DF3A 1E3MA 2ZI4A 2J6CA 5DASA 1SUSA 3TSOA 1JXQA 1Y3HA 5CEJA 4L28A 4KGZA 1IHOA 2C9ZA 2ZWVA 4LE1A 3TNDA 4BGDA 3B2QA 2VJNA 5HM6A 4UHKA 3V8VA 4L16A 4WLUA 4CKBB 1JIXA 5KJCA 2QVGA 3NDPA 3BE5A 2WWXA 4TXHA 1A96A 1LUAA 3CH4B 3AEQA 5DISB 3WNZA 2IL1A 5JCJA 1UPUA 2V1XA 1YR9A 4JBHA 4RZ3A 4XAQA 5AVKA 3RFTA 1P2BA 1AH2A 2ORYA 3A9VA 1I13A 2R87A 1E9BA 3TB6A 1U4NA 1NVAA 4MIOA 4N0MA 4YP0A 5KWJA 2A7QA 3EVNA 4J1SA 5EZ5A 5C0OE 1QP8A 3HB5X 2NM0A 4I55B 4GI1A 1PJRA 1BE8A 3LI2A 3HGQA 4QREA 4K9RA 4R7GA 1FDVA 3RYFA 4QQFA 4DR3B 3L84A 2WRZA 2DPMA 2X9LA 3HCAA 1UR5A 4O4HF 9ATCA 2B1RA 3I37X 4C7OB 2VRNA 4JLNA 5CCEA 2D8AA 1OLUB 1G5FA 2DKNA 3EFHA 5DP2A 1HYHA 4AWAA 4WLEA 3ACBA 4KKVA 1OBVA 1XZLA 3D7MA 1PNOA 1RAFA 4KMRA 4R9NA 4RYLA 4IDPA 3OFNA 3LBIA 4XB2A 2CB0A 4BZXA 4AMGA 4HZIA 4KMSA 3QV1A 3KRTA 5CUQA 2HA7A 4AW9A 4BMNA 2XMQA 5C3UA 3GJXC 1K5PA 2RJ3A 3SKXA 5FFFA 4DAOA 3DTTA 1N2ZA 1SPBS 1E7QA 1TTPB 1XZCA 1YJXA 2NUTA 3VZRA 5I7WA 1KK0A 1N5KA 2CGEA 4DLYA 3L9XA 4YRFA 4ZTBA 4EGCB 3N5KA 1RZUA 2RGAA 1BHO1 2WSIA 2FPGA 3EXHC 3A1TA 2X0IA 1AF7A 3PP8A 5FNVF 1FZTA 4RK5A 3RYHB 1X1DA 4PFQA 1GFIA 1RHUA 4X7RA 4DCVA 3R40A 1Y6ZA 1AVTA 4YRTA 4YO8A 3JTEA 1USKA 2FPKA 4R9VA 3BMOB 4FINA 5MHTA 4HV4A 3FLAA 1E66A 3LDUA 2C3OA 3PC2A 4OGFA 1YFKA 2HRZA 4JR2A 3CMCO 4ERNA 3GLSA 4DAEA 3ZD7A 1M6HA 1TQ4A 2IYWA 5TMPA 5A6SA 3F4KA 1WVMA 2HMWA 3KAQA 2WNSA 1EX1A 1TM5E 2VBGA 4B79A 3N2KB 2GD6A 2R6GA 3GUYA 3QI2A 4MUGA 3RWOA 1OI4A 1S4MA 3SC2B 4CCYA 1J06A 3HCPA 3M4XA 4QDOA 3P2YA 2DTEA 4MRNA 3HE3A 3JQBC 3RI3A 4UC0A 4B35A 1X39A 1J8DA 3LUBA 3P4UA 3OHMA 2FJUA 1R9GA 3RS5A 5EXXA 1VGQA 3VPAA 4HATA 1HNWB 2NZVG 4CV0A 1ZHOA 3AILA 1NFFA 4JOBA 3G2IA 4P98A 4F6LA 3DE2X 3F73A 2X8BA 1W6UA 3H6GA 1FP6A 4R2XA 3TZBA 3H0CA 1VA5A 5C3MA 1A8IA 2ZAIA 4R05A 2JI7A 3HJHA 2FF7A 5IM4F 2FG6C 2H2HA 1P60A 3UK7A 3FI9A 4WZBA 1Z7BA 2ZDHA 2VZ8A 3X1JA 1TEHA 3AF6A 1OYWA 4OP1A 3VR5D 4LA4A 4YJ3F 2XBMA 1G8FA 2AG1A 2JFWA 3X44A 3JV7A 3RC9A 1XL0A 3LV8A 1VE7A 2XRMA 1R4NA 1ZIYA 2DFDA 3R3HA 4LYYA 3EVZA 4NEGA 4KLNA 2I4TA 4TLCA 3K9BA 3GJQA 3L01A 2FB9A 2P6RA 4CBVA 4FSHA 1AQ6A 5KB3A 3IP8A 1A9PA 1U5BA 2C95A 1YQWA 3HJNA 2PWBA 2V7TA 3I9FA 3OD5A 3PQ6A 3UMFA 1GVNB 1N32B 1T5HX 5KVVA 5GZ6A 1OWNA 2RAPA 2SICE 3RTAA 4Z6KA 2OVFA 5DMHA 1JYSA 1OE0A 2FHPA 3GWZA 5C51B 1FLVA 2GCNA 3O2SB 4OJYA 1OX4A 2XCLA 4GVPA 1XTTA 4WINA 1FTYA 4D8YA 4F3KA 2II6A 1VJCA 1K89A 2ZWAA 1U9YA 3AJDA 1R3UA 1EYZA 1X7WA 2ZZMA 2Q6KA 3ND6A 2PSDA 2QT9A 5B1SA 3AP3A 1NJSA 1D6SA 3DO5A 3BX1A 3ODPA 4LTDA 4MS4A 4QZVA 3GJ4A 1Z5OA 4R71A 1GIAA 1YB6A 3PR2B 2C00A 2BC9A 4FYJA 4Q6WA 4XCQA 5EZ6B 1PNVA 4ZQGA 4Y1FA 4CQMB 3DYVA 2GYUA 2Q8PA 4E88A 1KO7A 3WMXA 4EW2A 1DEKA 4TL7A 2C03A 5JMPA 2XKAA 2BKXA 3U26A 3SX4A 4FFWA 4BNNA 3P8ZA 1WKBA 5JD4A 3WS7A 5CM2Z 4HJXA 1PR1A 3JD3A 5KZMB 1GJRA 5FV4A 1Z2NX 1DRWA 1A4IA 1K98A 4M0LA 3N2GB 2FAXA 3THYA 4J1TA 1Y1RA 1JPVA 3NM6B 3K09C 4AJEA 3W5CA 2H08A 4L8VA 4TVKA 2LCIA 2GEUA 5A71A 5DIFA 2FEOA 4BO1A 2O0LA 2WM2A 1UPTA 1RQPA 1Z2AA 3MPOA 2O4CA 5E6SB 4ZAZA 2X0DA 4B7UA 3K7EA 3W2EA 5CFLA 2JH3A 1DCFA 4RKRA 2X3UA 3IUBA 4ETWA 2YKGA 2AF4C 3NGLA 3QEJA 1SC4A 2Q6LA 4K6MA 1QGUB 4PCLA 2ZI5A 1ENPA 2Z56A 4TZKA 3BJIC 3M89A 5EUBA 4U4AA 3TMAA 1Y5LA 3P9XA 3ED1A 4RFLA 5BUQA 2ID9A 4OYLA 1JLKA 1RI1A 1NG1A 2C5HA 3UV7A 1NBMA 4ZA2A 2B7CA 1NOIA 5BWMA 2O5EA 1LWNA 3AHJA 2O8EB 3D8UA 5JLJA 1NU8A 4LC0A 4TS3A 4PLCA 3TVYA 4F96A 5KSWB 3X0DA 2QN6A 2BTQA 3AM4A 2FUG1 4J90A 3HP1A 2REQA 1X9HA 4KFTA 3PXXA 4UCWA 3BGSA 4FGSA 3EVCA 3S3TA 5ARCA 1MQ8B 2OWDA 1R64A 4GPTA 2IV3A 4MUHA 2OXTA 2QR3A 4KLAA 5FCDA 2I9KA 2Q5JA 1L5SA 4HMOA 2CJWA 3D6JA 1VJTA 1HG1A 4MAFA 3GRUA 3A05A 3CONA 3VC3A 3ZGOA 1JECA 4UREA 1KI9A 4ECAA 4PNZA 2IH5A 4PC6A 2ZQYA 1KFKB 1TW2A 4WN9B 3HYCA 3F1KA 3G7NA 3BFJA 3TR5A 3W6PA 5CDSA 1R12A 3IV9A 1NA5A 3TNLA 3KYBA 4WGGA 3DE7X 4U2KA 1SUAA 1HE5A 1VI5A 3LX8A 1PAUA 2PMEA 4QNMA 4OXRA 2WU1A 4E5NA 1TMYA 1PW7A 2R5WA 2QZZA 4HMPA 3GOQA 1TCCA 1FYFA 3H4MA 3U6BA 4C05A 3HLKA 4B32A 3UCEA 2DBZA 5EMLA 3CO5A 3I45A 1F0NA 4H1VA 5FXMA 5BYJA 1WHTB 1VHQA 4BV8A 3KTDA 3FYSA 3QKSB 3UGTA 3U31A 2FQYA 4C3OB 4TYWA 4FNOA 5LKRA 3VJRA 2PT5A 4R84A 1GNPA 4JLWA 1X9IA 3R0XA 4N54A 2I62A 3PRKE 4F5DA 4PXYA 2F3RA 1CZNA 2QN9A 3QF4B 4RU1A 4BLWA 2RH8A 4NFLA 2ODNA 1BX0A 4TQAA 4FZ3A 4U02A 3P0IA 4K0KB 3RIHA 1OGJA 3UC5A 2H07A 3H1GA 2V6JA 3AR7A 1UM8A 4BJ5A 2C2BA 2NSLA 3ETLA 1WSAA 1ULBA 2R96A 1Z45A 3M9WA 3O93A 4HDKB 4BQOA 1L5FA 3B13B 4DWOA 4RKFA 2X15A 2XSZD 4KIUA 5LYJB 1R6VA 2NTJA 1RE1A 4DUZB 1NBOA 4EUNA 2DPHA 3EZ9A 5F21A 3RRXA 4M38A 1IPEA 2C9DA 1MEEA 1PW5A 4ND8A 2QIPA 4ND4A 3MWKA 5CLLA 3RT9A 3ZWKA 1N33B 3GRPA 5A5DA 4PHFA 5JSQA 4MQ5A 3E7XA 5ADHA 5LQMA 1X1SA 1VPLA 4FI3C 5K8TA 1NNSA 3AI1A 4RH3A 4DLTA 4DR2B 5J2UF 4IDCA 1Z8FA 3HKCB 4U7HA 4CDRA 3QFRA 3OZBA 4V3CA 4M53A 5DBIA 4J4BA 2PTGA 2VDWB 2VYVD 2AXQA 3ZW9A 2JGKA 4GP9A 2G4LA 4BE9A 4ND7A 2ZCVA 2Q28A 5TMDA 3FCCA 4RS3A 2OAGA 4F4DA 3EJWA 1IY9A 3H16A 4HB2A 4YJFB 3UOAB 4WPGA 1QIGA 4XIIA 1TJYA 1B4DA 1AQNA 3NPMA 3VNAA 2P11A 1KBZA 2JFQA 4JP8A 1JDVA 4DMHA 3U4MA 5ALRA 1RIIA 1TUBB 2BBSA 3T0GA 3ZWBA 3HVRA 4K9DA 3ENKA 1EMDA 1NNLA 3AB7A 3PYMA 5EJ6A 3SYNA 4B75A 3PR3A 2F48A 1H6BA 5SYNA 1T0BA 2G4VA 4L73A 1CLEA 5GZ3A 1DQYA 3IP9A 1ZI6A 2VQFB 2BGJA 2ZREA 4OXNA 1TUGA 5DLQC 3A6GA 4PYIA 4Y2VA 3TI7A 2GARA 4XM1A 5EHIA 3NHSA 3EVDA 2OM2A 3EC1A 4Q03A 3U61B 4JSYA 2AW3A 3D6TB 1BN7A 1JZTA 1JT2A 3W34A 2ZTVA 4IHJB 4RLQA 4N5NA 3HXQA 1OX6A 5DHRA 3ZBQA 1NVBA 4RELA 4NZOA 4DVGA 1XTPA 2CHVA 5DI9A 1S96A 4NPAA 1NMEA 3KSZO 4HLCA 4KQ6A 5FI0B 5T8KC 3ESCA 1G17A 1OV6A 1EP2B 2WJYA 2HMTA 4FSDA 1GZ4A 2IJGX 3WP0A 2CC2A 1E6WA 2V55B 4Y3UA 1DBWA 2VHUA 2Z9DA 3JZIA 4A16A 4CHGA 1UBNA 2HRCA 1HOTA 1NY5A 5JWHA 1G63A 1PL6A 2TECE 1PI3A 4L76A 2JFBA 1LLFA 3BIWA 1KO8A 1R0RE 1IY2A 5H7XA 3RU3A 2Q62A 1QTRA 2PS1A 1ZSNA 2P9FA 4MUMA 2CDCA 3OQJA 4B3BA 2L69A 3S99A 3K5HA 1XZEA 3QSYA 1KOJA 1BWPA 1CUCA 4JYPA 4RVCA 3V7FA 5FA5A 1JBEA 1FXUA 2XNCA 3I12A 3AI3A 4IF6A 3K72B 5KDOA 4AKIA 1B0ZA 1RPJA 4IH1A 2OV4A 3NVAA 3ROZA 3GRKA 5CDFA 1Q11A 4YCDA 4LOHA 5IC5A 1IY0A 2IIBA 3UWOA 1HDIA 3ZHSA 3SQOA 2YNMD 4TQUS 3DMFA 3MXTA 4CI0B 4EUSA 5IAAA 3A2NA 3HO6A 4PX5A 2ZIWB 1XMIA 4YXWD 3IEMA 2OD7A 3TIGA 4XWTA 5A1TA 1NT4A 2HDHA 2A9QA 3E9ZA 3GZTB 3LVQE 4I9NA 4M8LA 5C5EA 2FZVA 3FTNA 2OQIA 3KOMA 4NYJQ 2V7BA 1L6RA 5LZ4A 3PSHA 3BHNA 4ZU6X 2A5JA 4CIVA 2VLBA 1W4AA 1HNNA 1CRZA 3JZAA 3GLVA 4MVYA 3ZW7A 4IMIB 1XRPA 2WYHA 3FYDA 3UHOA 1XTUA 3QEBZ 4C0SA 2ZE6A 3U6KA 1TX4B 4X91A 1CE8B 3FZQA 3QXJA 4XVUA 4OQYA 2FN8A 2KW5A 1EWYA 1N0VC 3QE2A 4YR7A 3HGTA 3MJDA 2I54A 1C1HA 3JATB 3L7YA 3KSBC 2AR0A 3RGGA 4WI1A 3FZGA 5CNMA 3AFNA 2B1QA 1E6LA 3HI4A 5H70A 2W2XA 4KN6A 3RG8A 3LBYA 4DQLA 3B3JA 3R8CA 1Z5WA 3O26A 1SELA 3A32A 4KDEA 5K3CA 2FWBA 3THSA 2LPMA 3ACDA 3G0GA 3Q15C 2Z4SA 4UUBA 4ZO6A 3RVOA 3WL3A 4JJGA 2PUBA 2ENWA 2ZTLA 3VKFA 4AJOA 4Z4GA 3DKRA 4LRTB 4TGLA 2UYYA 4DV4B 4DMFA 4M1QA 2Q1WA 1BDJA 1E2LA 2BZSA 2QRUA 1XLTC 1SVOA 4K5QA 4CM4B 1ZNZA 3PX2A 4HLUA 3TZLA 1M6EX 2I29A 4IUBS 4XWYA 3FOCA 3B3AA 2G3YA 5IXJA 5BMVA 1RCUA 3DEYX 7GPBA 3WG9A 5IJZA 3UH0A 4NG4A 4I1YA 4JC0A 2DLCX 4YV1A 5JQGA 4DXDA 4CXMA 1NF3A 3PGXA 3O03A 1BQ4A 3JASB 1LFDB 1Y8RA 3A27A 4KWIA 1VI6A 1P0FA 4DMKA 2IRWA 1S3FA 2Y1FA 2ZAYA 3I52A 4S0XA 3U62A 4J1QA 1CIVA 1GO2A 1ZBQA 2R00A 3O0TA 5IAJA 3ZE8A 1RWNA 2J08A 3M6XA 4YCNA 2C2YA 3PXUA 2DUNA 1VG9B 4NCBA 4Y6RA 4LF5B 7AT1A 4C4SA 2W0MA 3KYDB 2ATVA 4PLYA 1YRQA 1UIRA 4HQKA 4OCZA 4KXNA 4NAHA 2ZI6A 4YJHA 3UXHA 1MB3A 1M1NB 1GNLA 5LQAA 4FE4A 4MVJG 2OBNA 3MB5A 2O8DA 4LHSA 2ZYDA 3CIFA 2RHBA 5AVJA 2Z5FA 3ZQJA 4MO9A 3UUFA 2O14A 1CF4A 5BT9A 2LCQA 4OREX 4M46A 1SU7A 2VSNA 1M1YB 521PA 2ZBRA 4HNGA 5H3HA 4PO8A 5FKJA 3VVLA 4EENA 5LOVA 2DBYA 3EXEA 4XVHA 1A7AA 3QTTA 4NE9A 5DNWA 5BSGA 5K6RA 1FLNA 2MMGA 5JNUA 1L4UA 4LDJA 3RSFA 1KMHA 3AVXA 2MR6A 2ZT7A 3B9PA 3E8XA 3OT1A 2L82A 2GR9A 4X8MA 3TXYA 1E1YA 4EPXA 1B0PA 4C43A 4ANFA 1HY3A 3QU5A 3GJZA 2WLTA 2WY2D 3FBWA 1KDPA 4DZTA 3ZTTA 2SKCA 4WVFA 1TNDA 1AZLA 2GFHA 3UXYA 1D1SA 2F62A 2ZIGA 2Q5IA 4IIXA 2ORIA 2PEYA 4KWTA 2OZPA 3F5MA 1ISSA 3L6BA 4BVAA 1XQVA 1EVEA 1HMYA 2AFHB 3A26A 1EDDA 5HMLA 2JFPA 1TYBE 2P3LA 1ECCA 5CB4A 3G49A 1ZOSA 3EVTA 4PQGA 5JDIA 4QPZA 4D8TA 1ITZA 4YP5A 2NPFA 3ELBA 1BS2A 1M0SA 4OGGA 2PFSA 3R5JA 3JQAD 1C81A 3FR7A 3NXKA 4RPIA 3HL4A 2G04A 4F04A 3WYEA 1Y80A 1UAAA 4NZZA 3H2ZA 4IXDA 1SXPA 3VHRA 2V0NA 4UM9B 1EIZA 4JYBA 4RBNA 3FPGA 2NU8A 2Q8QA 5JVDF 4K87A 2O2EA 2ZSIA 3PDCA 4GW3A 1SVIA 1P74A 2O0MA 5GV7A 3VZPA 1P9RA 4WXPA 2J0QA 1GPNA 2XRZA 3LCRA 4X7PA 1SFRA 1J99A 3UHFA 4HP8A 4B44A 1SA0A 3WIOA 2DFNA 1SUFA 1TM7E 2OXRA 3OZ7A 2QUAA 3NHLA 4P0TA 3JQEA 3LX4A 1AGNA 1QOZA 1MV8A 1ISHA 1QHYA 2JGDB 1J1ZA 1QWOA 3NBKA 5ER6A 3OAAA 4TT3A 4J0JA 4N5LA 4AX4A 5EUCA 3S2YA 1TI7A 1XB2A 3U4IA 2B98A 2EFJA 4RACA 5LVAA 1OZFA 4X54A 5SV2A 1HDZA 3TLCA 1R9NA 5FTWA 5E2AA 1YZGA 3ZHYA 2ZUEA 2Q2WA 1RYDA 3G6WA 3W6UA 3EFOA 4KGXA 4YQFA 5CLFA 3LHKA 3RT1A 4C7MA 3QYPA 5B58T 3VOSA 3SZ3A 4RM2A 3ZWOA 1TA0A 2VT3A 5I7AA 3B1VA 1I32A 3UHJA 4D9HA 3EWNA 3NAQA 1X7ZB 4O4HA 1A5ZA 5IEBA 3WY9A 4D6PA 2YUTA 2ARKA 3G2HA 5BSUA 1O8BA 5SY6A 2Y0EA 5F64A 2FPIA 3V4ZA 4AQDA 1T5LA 5C4IA 2BDUA 1PTJA 2HBRA 5DNDA 2P79A 4DNOA 1J2YA 1QP7A 4Y2YA 3LKZA 4NULA 3MD9A 2YZ7A 3QXSA 4HKTA 4G5OA 3L5OA 1P72A 1QYVA 1WD7A 1Z0SA 1FFGA 3R5SA 2D74A 1TPYA 2O3SA 5AO9A 1MP0A 2H2WA 1SY7A 1CHDA 2F9FA 4CDMA 4BASA 1ECBA 4PX3A 1Y3FE 3L6CA 2H4FA 2H7XA 1QAQA 1FTNA 1S5PA 5JOQA 4Q3KA 4C29A 5C1OA 4TMVA 4LFCB 3KWJA 3IDAA 3NG1A 3U9TA 1VMDA 5FNVA 1XZJA 2E2WA 3N3BC 1MAVA 2R8EA 4DG5A 3EW7A 1VBNA 4R69A 2HU5A 5KCMA 3WWDA 3QWIA 1Z06A 1C7RA 4IEIA 3M6FA 1ZDMA 2EJCA 5JV5A 2P6UA 5AXAA 2PGOA 2BI8A 3DKIA 5T4EA 2ZJYA 2I2CA 1UXGA 4RKQA 3QKWA 3AB3A 1QORA 1SU4A 3VKWA 3QBEA 3ZY4A 3AIOA 4JUBA 2XMZA 4FGUA 5K05A 1N0IA 2VQSA 2YHBA 4BVEA 5CT9A 3D7NA 4F4FA 1GZUA 3M6AA 3GAZA 1FP4B 3ZWYA 2VPWA 5EYPA 5BVGB 5MFPA 4M87A 4AZVA 3DA8A 2CLFB 3L9WA 3LKDA 3ROPA 4BKRA 3KCNA 4XSGA 4KG7A 4DMUB 4GQBA 5LQRA 3AKDA 3BDIA 3UA4A 3CT6A 3VAAA 5AUOB 2FLVA 3A2KA 2CJYA 1ZUNA 2EVWX 4W1RA 2JARA 2V5UA 3DO6A 5FL3A 3N2LA 1REQB 1V9SA 4OAPA 3RFUA 4HI0E 3ZDXB 2VIIA 4OMDA 3ZHCA 2LRHA 1ZPDA 3OLZA 1U6JA 5A05A 3N70A 1YIOA 3WB9A 4L0CA 3QU4A 3X1MA 2DFPA 1HYEA 4E15A 2IIVA 5IAOA 3FA2A 1KMMA 1VCIA 4UEQA 4DJ5X 1LPNA 2PH3A 3DE6X 1UXIA 4DMRA 1VSBA 3FAKA 4C08A 1G0OA 1YULA 4UHDA 3GI1A 3Q0EA 2XE7A 2RGGA 1L6IA 2ISQA 2V9PA 1CY7A 4BCDA 4UOQA 4B09A 2AOUB 3OURA 5BRJA 4R2JA 1S2GA 1HH4A 1GLNA 5HIAA 1K3UB 5H59A 3FIJA 4YJ3A 3GZNB 3MJ4A 3T5MA 1HORA 4PYMA 4Y0VA 4TROA 2ONKA 4BJHB 1G291 4ACAA 4EHNA 1GHTA 5A5VA 1ISFA 1LCIA 3DOFA 3G9UA 2C78A 2HWXA 2E6KA 2AC4A 2VPTA 2H3HA 4NEHB 1NATA 5DXAA 2I87A 3OIYA 4EG0A 4QEKA 1X2BA 1MENA 4NBWA 4IRXA 4B7CA 5CPBA 1E0JA 4NS4A 1MPXA 1E2UA 2UKDA 4TSFD 5ALLA 1EBUA 2Z9CA 1U1GA 5KSYA 5KYXB 2ADMA 4HF7A 4GH5A 5IYZF 4WCVA 2E9SA 3NH9A 2G0NA 3H2IA 3BREA 4EI9A 2VJOA 4JZYA 3T3EA 1Z18A 2BR4A 4B48A 2BKLA 3SIXA 5HZHA 1IBLB 2GRJA 1Q0SA 2FRDA 3PPXA 4JV5B 2VRBA 5K4HA 1C3XA 3WNBA 1E79A 3MMZA 2LDBA 1ZMOA 2NU7A 1QHXA 1NJ2A 2ILTA 3ITKA 3R0QA 2H48A 2QW8A 2R5FA 3S8EA 2WDPA 1P7CA 3NI2A 1CZKA 3GFTA 3IKMB 4HX2A 1RWMA 5AI6A 3DT8A 3DBVO 3R24A 4I1SA 2IH2A 1L7EA 1P73A 4XQCA 3KYIB 2IF2A 4KR9A 4R2KA 3WX0A 1FYVA 3CC8A 4HL6A 2PA0A 2VDVE 1P4SA 1X19A 3K9HA 5JZBA 4AF6A 2XOEA 3BGWA 5FHQA 3C1OA 5CFQA 5E7QA 1XNJA 2FMUA 3WB2A 1QX4A 1KVSA 3CUVA 1Q0PA 4LSGA 4IWNA 3K6SA 4WADA 1LPPA 3DLPX 4ARZB 2J48A 3KJFA 3C8HA 1U90A 1ESZA 3GLQA 1SIOA 3I04A 3ONNA 3BHMA 4MJ7A 3GLFA 2O3QA 4R83A 3FHTA 1FUIA 1MQ9A 2PZJA 1W5EA 3KCQA 1IONA 5JBQA 4LSWA 2PL1A 5JS1A 1MEJA 1VPTA 4QEDA 2ABWA 2IUFA 3K2QA 2VPYA 3EOZA 3L4SO 2NU9B 4B7ZA 5HTOA 5IJXA 3K8ZA 3G0DA 2I4LA 1OLSA 1XK7A 2BOVA 3FFAA 3RNOA 1SKBA 1Z0ZA 4NBRA 3WL6A 3ZS8A 4XWGA 3REFA 1NE2A 2H65A 4AJ9A 4LHYA 4IDFA 4F91B 1UOOA 3ZD9A 2H1WA 1FDRA 3KX2A 1JYEA 4LBZA 5IBCA 2ZJ3A 1PR2A 2C4UA 1SKMA 3OCJA 4R6WA 3KV3O 4LOAA 3WYAA 2C8VA 4RTPA 4TWAA 1MBZA 4PG7A 1KDOA 3FOBA 4GT1A 4ZP1A 3RE1A 1BYUA 2AUMA 1I3NA 3I2JA 4WEOA 1JSXA 2Z04A 3QXCA 2JBHA 4YMHA 4Z7QB 3GG2A 5DKFA 3ZWPA 5IRCD 3EGWA 1DEOA 4DNXA 5J5VA 5LZ9A 3F6SA 1LA2A 3GW8A 3M4YA 3OQVA 1FMJA 1PK7A 2PVSA 3F2VA 1RIFA 3EEBA 13PKA 2OMEA 4V1CB 5GIPE 1K92A 3DM5A 4UXJA 3M82A 4CKWA 2ZXUA 1KEKA 1EFVA 3WWEA 3B6MA 3UBTA 3HO8A 2ZSAA 3HMQA 3RV4A 2HCJB 4QSMA 3TOVA 1MXFA 2QN8A 1WPXA 4QL3A 1YDFA 4NJEB 2G63A 3O8CA 2B92A 2PSSA 3RLIA 2BMVA 2F90A 4D99A 4ZMRA 3MSCA 5DBGA 1RHRA 3C6XA 4U6QA 4PZ0A 1KC1A 5A04A 1PJTA 3OZXA 3Q88A 4ALIA 4G63A 4EUEA 3FYHA 2CE2X 3L0DA 1VG1A 2AOTA 2GCPA 2V0CA 5EE9A 4KQ1A 4DCNA 5TQ2A 2ZYVX 2D2IA 2F59A 3HRHA 2BM9A 3B1XA 5T6BA 1OA0A 4OLHA 5TT1A 3X2EA 3KHUA 3ZHQA 5DB4A 2WABA 1WXQA 3IEXA 4WNAA 4EY3A 3BIFA 5J9FA 5KNDA 3ZU5A 2GF9A 4RXMA 3L4BA 1SQSA 4B9AA 5LJLA 4RCVA 5CA1B 3RU2A 4HNAA 3EF3A 3GLHB 5FWYB 1HM5A 1VA4A 5B2EA 3DB2A 5AVXA 1U2DA 4DA9A 4P84A 3HKBA 2GM3A 3GIDA 2VZ0A 3CKKA 4KK3A 2PS3A 3CF4A 4IIJF 3F8SA 1K7XB 3U3KA 1IN7A 3AF2A 3QYJA 3IQHX 4FBMA 4WBSA 4YRQA 4Q7LA 2BR3A 2QVBA 1YNSA 3ESAA 3DZDA 4YRRA 4UNRA 2QTVA 3QKRB 5FYQA 4A5OA 3GCDA 2IP2A 3HY6A 2O0HA 3LY9A 3RF7A 1KTIA 4QT4A 1IAQA 1XOIA 3I8OA 3R76A 2X4GA 1GADO 2R1VB 2XX3A 2E49A 3N76A 4FGJA 1JDBC 1U9ZA 3MWLA 1H9AA 1Y34E 2QMEA 5CR9A 1SCQA 1VJ0A 4G25A 5EEGA 4F9FA 1TCVA 3IBTA 4LYFA 4PONA 2VP0A 4C7KA 1GCGA 2A5GA 3EZLA 3JVIA 5DO9A 3CE9A 2F1KA 4JUDX 3MINA 4QGAA 4EQZA 1IB6A 2QAJA 3EHEA 2R60A 1THGA 3CV3A 2C94A 2HSJA 4G1VA 5FPPA 3LWNA 4ZOLB 3HHEA 1XZFA 2GDZA 1GTRA 4Q9JA 1NV9A 2IXEA 2V7VA 4LV5B 3SR3A 1MB4A 1YMVA 4AS2A 1WZUA 1D4AA 2W70A 2YCLA 3KQYA 1QIIA 2QYSA 4MUAA 1KI3A 2PRYA 1KDYA 4N5MA 1HR0B 1E99A 3W8FA 3T9AA 4HDOB 1ODIA 2K4MA 4DDWA 3C43A 1NJ5A 1K3FA 1L1QA 2H2GA 4MLDA 2XCRB 1PP4A 1WKCA 1NHWA 3U7EB 1BS1A 5KVCA 3ESZA 3HBMA 1U3UA 1CUUA 4YP6A 2JLQA 1BCSA 2B35A 3AMVA 3BE4A 5JHGB 1FMFA 2CE7A 2BFDA 2XYPA 2CDAA 4KQHA 4CM8A 4DL9A 2NXEA 2ZJFA 4PLZA 4FYPA 1NV8A 2IXBA 5DVZA 3BEDA 4A26A 1Y5IA 4M89A 3TMKA 1GQSA 2AG0A 3EDCA 1VIYA 2PMBA 3KKLA 5DK4A 5E7JA 4N6NA 2IXGA 3FDXA 1L4YA 3ETJA 4PQRA 4ZO8A 2QUBA 1DBIA 3FTEA 3PKZA 2A8YA 3KB6A 1E7RA 1GTZA 1WMFA 3GLUA 4HQNA 3RVPA 5JXWA 1ZESA 1VKOA 2R8OA 3R4CA 1BROA 2FN7A 3NB0A 4HFMA 2EDCA 2HLHA 2IXDA 4ZDWA 3U9SA 4Z5XA 2RBKA 2JVKA 1XEFA 2SCUB 4BFSA 4B3SB 4TS9A 1S8NA 3SHQA 5HOQA 1BGXT 2J7KA 4QTTB 2HK7A 2Y4NA 2BFEA 4TQGA 4MUEA 2PWYA 5CYPA 3TTYA 2WU8A 2QN1A 3I8SA 3AF1A 5IT5A 3EMBA 3AHEA 3BXEA 3GRVA 3V34A 3ZZ1A 4EI7A 3D7KA 2R7MA 1CUEA 2XPCA 1E1NA 4QPPA 4UW9A 1U5AA 1GZ3A 3ZXYA 1T6XA 4XTCS 1EFPA 5M7EA 5K2OA 5BNZA 3IPCA 2P2CA 1WV1A 3GRAA 5ALHA 3H7AA 4J2HA 3ET4A 4LJLA 1AKNA 3X1WA 1OWPA 4B3JA 1P0MA 2RKBA 1JR3A 2HXYA 5K6AA 3P1JA 2H7CA 4H6WA 2EEZA 2IU0A 4NNOA 3DD5A 1GPDG 4XARA 5E1OA 2OV3A 3QEMA 3C3CA 3KZCA 3HU2A 1BFUA 4ZCQA 1IFXA 2H63A 1DWOA 1RPNA 4XH9B 9MHTA 4U2DA 1E18A 5DNUA 1F6BA 3G89A 3OZFA 3VO1A 1O94C 1CRQA 1MO4A 3G2OA 3RYIA 2IDZA 1UEXC 2TS1A 3ZE9A 4C0QC 4CODB 4DVJA 5FI3A 4NCAA 1K0UA 1VL5A 3CSSA 3E0QA 2FXIA 3FCUB 3H13A 3O73A 4HQRA 4AD8A 3BSSA 4C7VA 2DLDA 3I9MA 2DE0X 3ANYB 2J4CA 3KQSA 3VC2A 2AMLA 4K9MA 4XIJA 1Y4AE 2ZUSA 3LHSA 1RJFA 2CLLB 3ND5A 3OLXA 1RZRD 1X8JA 2CVPA 3RC2A 2AD1A 2I1VB 3RK1A 3ABRB 2G6BA 2IZ1A 4JLDA 2K5UA 4JOCA 2QM7A 3MUNA 4W63A 4BDSA 4AB1A 1UBSB 2I7TA 3BJMA 4MVCA 3OIGA 4GWKA 4N39A 3FVQA 3FF4A 3PLRA 4U0JA 2R3SA 4QFCA 3ZLUA 3C74A 3DUWA 4UEWA 3K0BA 4U1RA 4RXUA 1GGHA 4H3HB 1Y5RA 4LYJA 3TLEA 2FUKA 4BRZA 3A4YA 4MGYR 2H8GA 4ZT5A 1KP2A 2F9MA 2HRRA 1N6LA 2B4TO 3ZHTA 3WBKA 1ZI8A 1IUKA 1QCDA 3BCRA 4PE5B 2IQ5A 1PFWA 4UPVA 4D26A 1RI3A 2W11A 1F1BA 1BHQ1 1G8YA 1ODFA 2JLAA 1IIRA 4N6GA 4PTZA 3OICA 3KYCA 4BQEA 2VJDA 4FB4A 1XRQA 4KJXA 2Y66A 3KZVA 1LTKA 1H8EA 1UZMA 1Q5PA 1FFXB 1WZCA 3JAKB 4JJFA 4Q4LA 3TR0A 5JCOC 1E3WB 5KVAA 4C1BA 2Z2KA 3KZNA 3TLMA 1I7LA 2GEJA 2H8KA 2XTJA 4KE6A 5B12A 5KSZA 3T9DA 1KR5A 1OXUA 1PGNA 1VRCA 3ANTA 5NULA 2OY0A 3TD9A 2JGNA 4ILEA 4FI3F 4K86A 1CUIA 2NO4A 1MD9A 3OQIA 4AJLA 2QR5A 1TCAA 2B3DA 3AY3A 3ZNNA 1N2BA 4KR3A 3EDMA 2Q1XA 3PFHA 1GU1A 1YAJA 1GPYA 2VAXA 3AKYA 3T15A 2I8LA 1J0XO 3CX7A 3D3KA 4WKNA 1B23P 8MHTA 1W4RA 2ICAA 3DV0A 4BEBA 2BGKA 2BF7A 2A0FA 2A86A 3PRJA 3PXEA 2D0OB 4I50F 3REGA 1QO7A 3KL4A 4WXMA 1J24A 3N7AA 5BN4A 1T0HB 1I3OA 3JQ7B 2IYQA 1C1YA 1IPFA 1GQQA 1RXIA 1SXJD 4O63O 1QMPA 2VT7A 2G9RA 1O5IA 1SKAA 3O3OB 4QAQA 1XJ0A 4TSKA 5KU1A 3FVRA 4BJ6A 5AXDA 4U8HA 4HWTA 4YVFA 3ROQA 4HRAA 1NJGA 2OCBA 1VG8A 3QMWA 4D0LB 4YRIA 2NO0A 2O2DA 3H9EO 1EXNA 3OJOA 2GPWA 3Q11A 3ESXA 3LUGA 1QH1A 5F2OA 5E9QA 1FRVA 3A31A 2RAUA 4BN5A 2J67A 2GAIA 1ZH0A 3SLRA 2ZZNA 1Q77A 3TW0A 1X80B 3ORHA 4XEUA 1JEQA 4PW0A 2R7KA 3AESB 3GLGA 4UZEA 1FFEA 5EP4A 2FCRA 3LNTA 3OMLA 3GJTA 1JJVA 2GFIA 3MNFA 3ADKA 2VDPB 3OF2A 1E5XA 4IXTA 4JOQA 2OHVA 1ZGAA 4YDQA 3OIFA 2K7ZA 2PQ2A 3GT4A 4YJ2F 5K3DA 1TEXA 4ZO9A 4BQSA 3VDRA 1VSUA 4TTRA 6REQA 3NMUF 1HFKA 2A92A 3BMCA 3DNPA 3P0RA 4C0LA 2C9YA 3RU9A 2W2LD 3U49A 1RBZA 2A1TS 1CUXA 2C98A 1L5MA 3ETNA 4R1MA 3O92A 4JVOA 3OA0A 4H7IA 4IXMA 4BJ1A 4CYMA 4EW1A 5AIBA 2IS6A 1M1YE 1OXMA 5J59A 4EA6A 1TT5B 1E1LA 3DLBA 2RONA 3GVCA 4AXXA 3OMWA 2SKEA 1WBBA 3TCNA 1SXJC 4ARUA 2O4UX 4LQLA 3IBFA 2OFWA 1K3TA 2D00A 3K8YA 1NBWB 3NONA 3V9PA 1KY3A 3PNOA 4FOOA 5E4JA 2I8CA 4ARAA 2C4KA 2DR2A 3TNYA 1A8HA 1S1CA 2IYUA 3RUPA 1T91A 1I8TA 5MN4A 2O50A 5B3KA 3T1HB 3VTFA 1JMYA 3R7NA 2PV7A 3FCOA 3OJXA 3WR5A 1VHDA 4EJ0A 3TF5A 3PTAA 3CZ5A 5AWFC 2PGLA 1U0HC 5EKXA 3ZHBA 3CFYA 2OBYA 2ZULA 2Z6UA 5JVDA 3GPIA 1S1MA 1IN6A 4RFSA 4BNGA 5JWRA 1X7HA 4DKXA 2DFLA 4MB2A 5EJ5A 2WYUA 4TKLA 3W5VA 2YYZA 3ME5A 2AFHE 4DUGA 4F9TA 5HKKD 2VCHA 1CP2A 2BL4A 4K03A 3UMYA 4JLOA 2F1HA 1ULUA 2EG9A 3WRXC 3AM5A 3LT2A 5GVSA 1C0PA 3QHQA 1MR3F 3W5DA 1Y1QA 2JGJA 2PL9A 3TX6A 3UTCA 4KC0A 4LCJA 4PG4A 1UBCA 1T4GA 4QODA 3LO8A 1PSZA 1IRXA 3MJSA 4RXTA 2ACKA 2CL5A 4U3JB 2NXWA 3RTBA 4ARCA 3NKVA 6PFKA 3Q8XB 2OHOA 2RGEA 1E3IA 4LDRA 2XITA 1GPWB 5AM1A 2H1OA 2RGUA 4EEKA 3QIAA 3DBHA 2RJOA 4WTOA 1ZIDA 2ZKLA 5ALUA 4BXOA 4BKMA 4PZEA 2BEUB 1UP7A 2AQHA 1F17A 2DWUA 3TEMA 2FSVC 1P6UA 1T5DX 4F2DA 1Q0RA 5DW3A 4EPRA 1ZIXA 4HVTA 1DO0A 4RIGA 2X0KA 3EEQA 4G1CA 1PGQA 4OLBA 1T5TA 4C5AA 1HT1E 5BV0A 4LSZA 3OSUA 4OHMA 2JJYA 2XDQB 5BSHA 2BW0A 1HZZC 4AG5A 1N3YA 2JGFA 3DBIA 4RVOA 3AGQA 2CWWA 2WWIA 3QTLA 2PJRA 3ACCA 4LECA 2PDAA 3TNFA 1J6UA 1ZD1A 3WFIA 2ODBA 1DVRA 1Q6ZA 3C8ZA 1A1SA 4RA6B 4C01A 3HB7A 3OZIA 4FCVA 3TQCA 3E5NA 2BEWB 2WTXA 3MG9A 4CM3A 5CMLA 4EY8A 3ADDA 3OMXA 2FRXA 4JL6A 2XRYA 3IT2A 2WJWA 1FX0B 1PT5A 3BRSA 2J87A 3DQQA 5KSPA 1I7DA 2GHRA 1WUHS 4D4JA 1EQ2A 2QT1A 4ZI3A 1KJ9A 3LIPA 4INZA 1FP2A 3K5IA 3ONVA 2Q29A 5DXFA 5GM1A 2FSHA 3OO0A 4JBNA 3FYUB 1KVQA 1GN8A 1H85A 4CM7A 1V11B 2G83A 2IPMA 4IDNA 4C21A 4PWZA 1UDWA 1WR8A 5DGCA 4PYOA 3OU7A 1JKIA 4R1SA 3V8MA 1V2HE 1BH2A 2FDRA 3I0NA 2CVFA 3WNVA 4K9LA 2WZDA 5F12A 4KRGA 3BERA 3MW8A 2WAMA 4Z0PA 4E3ZA 2H06A 1Z88A 5AVQA 5IKOA 2Q1SA 2GPYA 2I33A 5CM9C 5F7XA 5HZGA 2CXNA 3I73A 1X13A 5DYIA 2R44A 3G8AA 4CKEA 2YWGA 3WQQA 3ZVNA 2AZDA 5DNCA 1L3BA 2HHAA 5GONB 5LQJA 3DHNA 3WLQA 5CGZA 1NQOA 3C3EA 2G72A 1Y42X 3DL0A 1U1DA 4WD3A 5FOSA 4KW7A 3DMTC 4PZ9A 3AONB 2P62A 4HH0A 1E9DA 2QL6A 4MCJA 4YC7A 5DYWA 3CX3A 1JHXA 1CY4A 3C39A 3K6JA 5ALEA 5FUWA 4BU1A 4DZRA 1WQ3A 2C7VA 3HEMA 4NZMA 4DA6A 5IXSA 4URWR 1X2EA 3IAEA 3JQPA 4DLZA 3UM9A 3KETA 3RW9A 1Z5GA 2G08A 4YPOA 1PEAA 6AT1A 4Q1AA 5CT5A 1UIMA 4XRGA 4X7MA 2GCEA 1J9ZA 1PE0A 4IGIA 3H9BA 1E9SA 3U44B 3A6JA 3WBJA 5DWVA 3QWAA 4JNCA 3SVLA 5KTPA 4JU9A 4QUHA 3RANA 1PT7A 5DYTA 5ITVA 1N8NA 2CYBA 3CUYA 5L7WA 3HB0A 1AQYA 2REXB 4UEKA 4CLHA 1J5XA 2CXOA 2VOJA 3WNCA 5JADA 3GB9A 3QRWA 2J3KA 3HWRA 4MINA 3VMMA 1WPRA 1KE2A 4JFAA 3U7QB 3U1VA 3QKUA 1MFZA 2NUAB 3RU7A 4AS3A 3N7TA 5ITWA 5HZMA 5IKPA 2NYAA 3JQQA 1M2NA 2JGIA 4JH0A 5E4TA 4RA9B 2W42A 3PHHA 2ZSFA 4D0RA 1C30B 1GG5A 2LUOA 4OBBA 2ZRMA 4G86A 5FLKA 5TVKA 3SNKA 4BEJA 3U4QB 3A2LA 5IVHA 4L2IB 5HMMA 3ID6C 2HU2A 3F7NA 5B57C 1FXWF 1M83A 5L3RA 1MJGA 4EVSA 3KQTA 3CRNA 3U40A 1JEAA 4YJGA 1TGVA 4K40A 5JH7B 4W5WA 4H4CA 2KLBA 4PN7A 5JRDS 1U8AA 4WBNB 4B3TB 3WJ7A 4R4JA 2QM8A 2H9IA 1H4VB 5BN3B 1UDCA 1PR0A 1RW4A 2CK3A 3R6WA 2DCUA 4RGQA 4YAOA 1KFCB 3H1AA 1A71A 1F20A 2XUAA 3NHYA 5F98A 3DVQX 4G1FA 1BXZA 4F8EA 3U3ZA 1TLLA 2NSYA 3QI7A 3UVEA 2ZRAA 3FPAA 4WOPA 2IV7A 1J7KA 5ALTA 5JARA 4OHYA 1ZXBA 3A9UA 3HKEB 2JLCA 3JXEA 4QVGA 1CUBA 4ZVRA 2H5EA 1D5WA 1XDSA 1RRVA 3KQPA 4JCOA 4QBKA 3GT3A 4H1UA 1QVAA 1BXRB 1KEUA 1JQ5A 3V42A 4S2EA 1TD9A 4RGBA 1R4AA 5LQKA 3W3AD 1CJCA 4E6PA 2PX5A 3RVNA 1P1IA 2B2XA 1BGWA 3QFSA 4FFMA 3KP1A 2XXAB 3BMQB 3TW8B 4NBSA 1QRRA 2J3DA 4RQBA 4F5ZA 3PNQA 1VJ5A 1MZPA 2BDEA 3ABQB 3DOIA 2RH4A 2YY6A 3VHLB 3PUIA 2P9TA 4A10A 1LNQA 3CINA 1Q15A 3LBFA 3PV0A 5L9AA 1C3JA 4KQKA 5AXBA 2V65A 3OPYI 5CFZA 3P0JA 4F4HA 5DI3B 1QZTA 2C4TA 2FWAA 1F2VA 1NC1A 3AU9A 4ZODA 3CPEA 5E6UB 2IPAB 2MSNA 4OBEA 5IZCC 4BFTA 1OHHD 3RARA 4EJSB 3D1VA 3R7WB 1SCIA 2HA2A 2J59A 3JQ8B 1T2CA 2ADFA 4F72A 3C5HA 4PRYA 2VEOA 5KS2A 4LJSA 2ZRBA 1DKRA 2ORWA 3DM9B 1T9CA 4XX1A 3SE0A 1J2EA 2FTKE 2FZGA 1ZHFA 3HG7A 3OX2A 3QVUA 1C9KA 4Y1RA 1KI8A 4HB4A 2ILVA 2RD2A 3SYRA 3OIDA 3FCSB 4LXGA 4EHJA 4IVPA 3W6NA 4O4LA 4H16A 4HAVA 1X38A 3E03A 2FX5A 3CF6R 3EQ7A 3R20A 1JX6A 1W0JD 1J33A 2C3MA 2JZNA 2WSMA 4PHGA 5FWXA 4DXHA 4CEHB 2RB4A 1D2EA 2JD0A 3G79A 3UMJA 2ODEA 1RYMA 4Z7OB 2N47A 3DTVB 3IP3A 3Q0TA 1XBTA 3R1IA 3MFQA 1FP7A 1GYQA 3U7GA 4INJA 2HNAA 4P38A 1Q16A 1SGWA 4NAVA 3D81A 1Z6AA 1Z33A 2HV9A 3OTGA 4UDXX 2FZKA 5FPQA 5IJ9A 5KQLA 3WNDA 2QMHA 1DI0A 3L6UA 1W2GA 4RPCA 1FSZA 4DC0A 4E5VA 4ENRA 3AR2A 1K6JA 4PQFA 2I2BA 2YMPA 1QK3A 4OI1A 3UMRA 5FQOA 1WZEA 3IDOA 1OMOA 4HC4A 1MC5A 2WJ6A 1DWPA 1BS9A 5ALOA 1FY2A 1Y4SA 4MCHA 3KVNA 5AVOA 1E6KA 2PR7A 1HK7A 4HXFB 4MVJE 2QTRA 4FGKA 2FPLA 3KT6A 1LGYA 1T2VA 2BBWA 3BDVA 3AZOA 2V1UA 3DVAA 1IJBA 2WNIA 4IIJA 5KQSA 2Q9CA 1ZMXA 3KD2A 1SXHA 1Q1AA 2H0RA 5EG5A 4JJ4A 3GCWA 3RK4A 1GPBA 3O84A 1CU1A 4E12A 4JITA 4BAZA 2RAVA 2DPXA 3SZGA 3V7UA 2CXPA 1YTLA 2QLBA 1ISIA 3RFVA 2BT4A 2Y6UA 3VYRB 1SCNE 3HY3A 4DANA 3P2OA 4EUHA 1P91A 1EWKA 5FLYA 2ZRIA 2GEBA 4QG3A 1N34B 2GM4A 2PJUA 3KR0A 2GPAA 3PUWA 1BWRA 2C9MA 4G2NA 1S3GA 2FF5A 1M67A 4M1OA 3G23A 3RJZA 2P1DA 2RBEA 3SX0A 2BEVB 3BQNB 1TIPA 1B74A 3KT0A 4DYVA 4TKVA 1C1DB 3FPEA 3TBKA 3ND7A 3MWDB 5BSMA 2YWCA 1YOVB 1SC3A 5BQPA 4X1YB 4E2WA 2ZSDA 2P35A 1JPUA 1K8ZB 4H27A 4S1OA 4V0SA 2FWJA 2VT6A 4GYJA 1KI7A 3T52A 1JTVA 4LMPA 1KFBB 2QTMA 3GA5A 4QPCA 1GDTA 1IPHA 3AVVA 1GYPA 1LQUA 4XYLA 2QHXA 2Q41A 1IMJA 4G81A 4LQCA 2HJVA 1E2NA 2ZYIA 2VTEA 3OTOB 5JC1A 1T43A 3LTNC 3NHAA 4Q3LA 3KUKA 4BATA 4QDJA 4UVDA 1PVOA 1BN6A 5CVVA 3UPUA 1HQCA 2HPHA 3HPRA 4E1VA 4MHOA 3E0XA 2PNFA 3EVEA 1PGOA 4E94A 4F85A 3DTYA 3WLLA 2D0PB 5FOVA 3UYKA 4BE4A 3CMMA 3O3NB 1Y4ZA 4P53A 4LIPD 4XQ9A 4Y2JA 5EJIA 4ZAVA 4C03A 4TL8A 2X3YA 4O25A 1PJAA 3VM6A 3PITA 3QPBA 5LD2B 4WCDA 3K16A 1XDGA 1OPXA 1U28A 1U9CA 2ZPTX 2ZRJA 4ZDJA 3MMSA 2WAYA 3KJNA 3PHGA 3OECA 1C80A 1NLUA 2CT8A 4ZV7A 4G4IA 1CJSA 3TRFA 1N9ZA 4DV2B 2WM8A 3MJTA 4PRZA 4UQOA 1NW5A 5B64A 2ANCA 3FWHA 3B3GA 3KKPA 1V1MA 3BVPA 4D8UA 1P17A 1A4XA 1LRLA 3KVOA 4WJZA 1B2LA 1YRWA 2IE8A 1NVMB 4MTLA 4AMUA 3NP9A 2WM3A 4HUJA 5IH3A 4EY4A 4GI3A 1GU0A 3NX4A 4NOJA 1AN0A 3QYFA 4Q7KA 1Q0UA 3TX2A 4F06A 3IMEA 4YCMA 1L4KA 3O91A 3ZX5A 1I33A 2A3RA 2OCPA 3DXYA 3OEYA 3OE1A 3QELB 4PY2A 4Z4CA 3DMRA 1GRVA 1KY4A 1W19A 3P2JA 3OLWA 4PO1A 3OZEA 4IWYA 1RXEA 2W5UA 4MUJA 1OW3B 2ZSHA 4O4JF 3PXAA 2A78A 4YI5A 3ZIDA 2C8KA 2XNJA 4U0KA 3CZ9A 1BDMA 2FPPB 1KAMA 4CVNA 3QVSA 2J0EA 4ETNA 2FW8A 5J1TB 3GCGA 4N65A 3ZWVA 4UAGA 1IWPB 1DT5A 1X74A 1K4KA 1Y3DE 2HCRA 3AIIA 3C4VA 3NTVA 4YV7A 4E1AA 5L6LB 5A4FS 2JVJA 1GARA 1KQ3A 1ISJA 1UKBA 1KRHA 4IXNA 4FQ8A 4JU8A 4P2GA 5HIJA 4S2UA 1P5FA 4L08A 1WXWA 5A2GA 5LUAA 1RVV1 3EQ2A 4G5QA 3ZEAA 1O3YA 3HY4A 4AN0A 3F9IA 4K9OA 2JIMA 3STHA 5I4IA 1II8A 2C42A 3I6MA 4HJRA 3TFWA 3LGXA 2E4XA 4JBWA 2NQ2C 2MIIA 4F1JA 4ER3A 4Q93A 2VLIA 3KS9A 2QB5A 3GUVA 3V00A 2XTZA 1UQRA 5TSDA 4I6EA 4DQXA 1G21B 2JAHA 1C9DB 1UK9A 1Y0BA 3HDGA 3O7WA 3R0ZA 2D3WA 3AY7A 5D1NA 3MRVA 3D54D 1C4KA 1K0FA 1S02A 2WF7A 4NVRA 4O02B 2G09A 3VU9B 1A95A 5CVDA 3IJ5A 1ZITA 1LX7A 3G13A 4CEJA 4RD4A 4MYTA 2LGJA 3AEXA 4BMXA 3TL2A 4L9AA 1XC7A 2IDMA 2NVBA 4KLRA 3USES 5EQDA 3MC1A 1QO0D 4PYQA 4UUAA 5K3FA 5JD6A 1MABB 3R2JA 4HDSA 4PS0A 2RHRA 4FC6A 4W1PA 5DCLA 5AXCA 3W5UA 4OQLA 3AEKB 2VDLB 5K8CA 4AJIA 5AKKA 1WB4A 2QF7A 3JQ9C 4PFKA 3L7BA 3PI7A 2OORA 4NICA 4Q4HA 2CJFA 5F52A 1IMOA 1H9BA 2G17A 2BHLA 2VUUA 3IUPA 3QENA 5H0IA 3CVJA 4AU1A 1ADGA 2HU7A 1U4SA 3SAJA 1XPUA 4DA7A 2ECKA 3RHFA 1U3FA 4HAIA 4MR8B 4ZI7B 5AVTA 4DWWA 3MWEA 3TLJA 4Z7NB 2JATA 2O7QA 4YYEA 4TLMB 4IO0A 3OX3A 4LGCA 1BMTA 1JHMA 3R3WA 4D02A 1T9HA 4ID9A 2PWAA 3S44A 5JAQA 3E4DA 1LPOA 4Q9KA 1W0CA 3IV7A 5KOHB 2GO7A 1PHPA 4YIKA 1Z35A 3UMSA 4MA0A 3A6FA 1QFSA 1ZRSA 1KI4A 2HKIA 4YR9A 1W4LA 3LPAA 5A06A 1KF0A 1R74A 2WKPA 3M2TA 4Q12A 2E87A 3IH5A 2ZDGA 4X1KA 4ALKA 4BRWA 4LF6B 1NF8A 1AV6A 2AI2A 1WY5A 2EFEB 3IT3A 4AZ0B 1EHCA 2JFXA 1GKIA 2O7SA 1L3IA 1PZEA 2QTCA 3D43A 3TB4A 4G36A 2JEYA 2O52A 1UFVA 2QRNA 2X5JO 3VSAA 5KQGA 3BWVA 1EFDN 3QVLA 3WJAA 2HBQA 5DM60 4EW6A 1XZNA 3DBLB 3F2IA 4L4YA 5AHOA 1PJBA 4UNSA 4A6DA 1KY2A 5KX5F 2XDYA 4ZAXA 2Q27A 3QA3E 1BDIA 3TGPA 2Y1DA 2C2OA 3MAAC 4NS1A 4TMKA 1GA1A 5AW9A 1GR1A 2AEFA 2AX3A 5TMEA 1E8NA 2D1SA 3AEQB 4Z4FA 4RX1A 3KZ1E 5THKA 4G8DA 4B84A 5KOJA 3NO4A 1D3AA 2ZM6B 1JG2A 4DT1A 2XSZA 2DT5A 3QX8A 1KYTA 4P81A 2VK8A 3CZ4A 2G5GX 4UTXA 3C5CA 4EMSA 4OHCA 4LFBB 2R66A 721PA 4YY3B 4IJKA 1JEOA 3TM5A 4EG1A 1DIBA 1A2BA 1AKMA 1QG4A 5JS8A 1ZGHA 2B6NA 2FR1A 5AI8A 4A0SA 3FWPA 5BUCA 4YJ2A 4B3MB 1ZVKA 1XV5A 1GAEO 5L3QA 1IEWA 2JL1A 3UT6A 1M1UA 4ZOQI 4DDUA 2PKCA 5HZKA 2G9UA 2R9VA 3KXPA 1ZRHA 3QW2A 3LL7A 4AICA 3N9IA 3TO5A 4C76A 1P7ZA 3G8BA 1SEVA 1VB5A 1RC8A 4W5NA 3H5VA 2QR2A 3ZGVA 1QIDA 2FPWA 4LZLA 5ICGA 2PCLA 1G7CA 2IYVA 3BGDA 1EGQA 1IULA 1DJOA 1O96B 5JDCC 2HF7A 4A3SA 3KQHA 4GMDA 2DWPA 1MX1A 5BR7A 4TS1A 2Z9BA 2P5SA 4E30A 4HAOA 2KLHA 4JLKA 1YBAA 5K0ZA 3C3PA 2Z1NA 4W5QA 4Z1MD 4WLNA 5D6OA 3FMOB 3F71A 4A6PA 5LWHA 3F7MA 3CRQA 1NF9A 1DKQA 3FIUA 5EJGA 1KYWA 2J3JA 1LW6E 4OHXA 3P7MA 3IQXA 4W7SA 5EWMB 3BBLA 5SZJA 3L4JA 1JEYA 4JASB 2B25A 1LY1A 3QVWA 4CLOA 1NUSA 1RAIA 3N0RA 4JZKA 3V4PB 1OTHA 2Q1TA 2V58A 5CU7A 5LPNA 3WGOA 5IVIA 5KJEA 1XCOA 5CX1A 1SBIA 2XNSA 2JGLA 3CUSA 1T13A 4H2DA 3I61A 1UJCA 4YQEA 1DBRA 2PA3A 3BXXA 3GUCA 3H3JA 3CUKA 2P3QA 1AUQA 2YJGA 3UFXB 5LXTB 4JROA 4P7KA 3DHWC 4HCJA 2GTPA 1SQ6A 1OASA 1QH9A 2VUTA 1F2DA 1ZEJA 2O9JA 1KMCA 2QTWB 1D0VA 3UK0A 3HBFA 5LC1A 2G9ZA 1E89A 3EIFA 5E3HA 4Z54A 2F3PA 1OZ0A 3E81A 2G1JA 3NEPX 3I09A 4RZ2A 3UAZA 1LSJA 3R3JA 3V55A 3A9CA 5T4FA 3RBZA 4PBTA 5DN6D 5JATA 1G7TA 3KZXA 5JJLA 1H23A 1JHYA 1CY0A 1KO5A 5CLHA 5DWQA 3ZZNA 5B7PA 2FVXA 4GYWA 2Z5GA 4HR7A 3LW7A 4WZBB 4XPZA 3VISA 4EY5A 5HM8A 1DJNA 1WUYA 5AK6A 1R15A 1GA6A 4DBVO 3WIUA 3QA9A 3TQHA 5AJHA 4UTVA 4KTTE 1Y89A 5HCUA 1KZ7B 2PU5A 3PC8A 3EBLA 1CQJA 4M0CA 5AJTA 4JI1B 1XZPA 1KVUA 1X8XA 1ZINA 2QL9A 1T3GA 2I03A 3AEUA 2YNMA 5CNKA 4J0GA 4YAWA 3TZKA 1ZHHA 4XEHA 3H86A 3LPNA 3QLJA 3T12A 4AUMA 4QFBA 4QJIA 4YAFA 5BWLA 4GWGA 4II3A 1C8BA 2A14A 4KJZA 1XAJA 4N4AA 4U00A 4L5IA 5TPZD 4D7AA 1Y3AA 1BFKA 3KEQA 1XFDA 2PLNA 3K0CA 2QLFA 1QU3A 3SZRA 1HDRA 2B99A 3ABZA 4G0QA 1I0LA 1THMA 3IOBA 3OCUA 1XMSA 5AKZA 1S9DA 4WOJA 3A4VA 3TPZA 5FAKA 2AI3A 2QD1A 3FFTA 1OX5A 3H3XA 3MCVA 1M73E 3LHDA 3UFBA 3FMGA 5CBPB 5JU6A 3AUXA 4COOA 5ER9A 2A33A 5EE0A 1PFQA