3SZ4A

Crystal structure of lhk-exo in complex with damp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
202
structure length
195
Chain Sequence
TEEWFAARLGKVTASRVADVMTKAASRQNYMAELICQRLTGTQEISNAAMQRGTELEPHARARYIIETGEIVTEVGLIDHPTIAGFGASPDGLVGDTGLIEIKCPNTWTHIETIKTGKPKPEYIKQMQTQMACTGRQWCDFVSYDDRLPDDMQYFCTRIERDDALIAEIETEVSAFLAELEAEIEYLKRKAAKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insight into the mechanism of an alkaline exonuclease from Laribacter hongkongensis.
pubmed doi rcsb
source organism Laribacter hongkongensis
molecule tags Hydrolase
molecule keywords Exonuclease
total genus 70
structure length 195
sequence length 202
ec nomenclature
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09588 YqaJ YqaJ-like viral recombinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.320.10 Alpha Beta Alpha-Beta Complex Lambda Exonuclease; Chain A Lambda Exonuclease; Chain A 3sz4A00
3SZ4A 3K70B 3SYYA 4R5QA 1AVQA 5LD2B 4CEHA 4CEJA 3U44A 4CEIA 4IC1A 3SZ5A 3SLPA 3H4RA 1W36B 3L0AA 3U4QA 4WUZA 3K93A 3SM4A
chains in the Genus database with same CATH superfamily
3SZ4A 5A0YC 4CEHA 5G0RC 4CEIA 4IC1A 3SZ5A 3SQGC 1MROC 4WUZA 3M2UC 1HBNC 3K70B 3SYYA 4R5QA 1AVQA 1HBOC 3M2VC 3POTC 1HBMC 5A8WC 3M30C 3SM4A 3M1VC 3M2RC 5LD2B 5A8KC 3M32C 5A8RC 3U44A 3SLPA 3K93A 1E6VC 4CEJA 1HBUC 3H4RA 1W36B 3L0AA 1E6YC 3U4QA
chains in the Genus database with same CATH topology
3SZ4A 3K70B 3SYYA 4R5QA 1AVQA 5LD2B 4CEHA 4CEJA 3U44A 4CEIA 4IC1A 3SZ5A 3SLPA 3H4RA 1W36B 3L0AA 3U4QA 4WUZA 3K93A 3SM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZ4 A;  3K70 B;  3SYY A;  4R5Q A;  1AVQ A;  5LD2 B;  4CEH A;  4CEJ A;  3U44 A;  4CEI A;  4IC1 A;  3SZ5 A;  3SLP A;  3H4R A;  1W36 B;  3L0A A;  3U4Q A;  4WUZ A;  3K93 A;  3SM4 A; 
#chains in the Genus database with same CATH topology
 3SZ4 A;  5A0Y C;  4CEH A;  5G0R C;  4CEI A;  4IC1 A;  3SZ5 A;  3SQG C;  1MRO C;  4WUZ A;  3M2U C;  1HBN C;  3K70 B;  3SYY A;  4R5Q A;  1AVQ A;  1HBO C;  3M2V C;  3POT C;  1HBM C;  5A8W C;  3M30 C;  3SM4 A;  3M1V C;  3M2R C;  5LD2 B;  5A8K C;  3M32 C;  5A8R C;  3U44 A;  3SLP A;  3K93 A;  1E6V C;  4CEJ A;  1HBU C;  3H4R A;  1W36 B;  3L0A A;  1E6Y C;  3U4Q A; 
#chains in the Genus database with same CATH homology
 3SZ4 A;  3K70 B;  3SYY A;  4R5Q A;  1AVQ A;  5LD2 B;  4CEH A;  4CEJ A;  3U44 A;  4CEI A;  4IC1 A;  3SZ5 A;  3SLP A;  3H4R A;  1W36 B;  3L0A A;  3U4Q A;  4WUZ A;  3K93 A;  3SM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...