3SZ6A

Isdx1, an anthrax hemophore
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
b'TKLADGKYNIAFTVWKGDKDESSRMNRYFESPATLTVKNGKQYVSFKVKDSTSIKSFQVEKDGQFVETTVLSENKKDNTRVVEFEVADLSKKLNGKVKINIPIINYNASYDIRFVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved domain protein
publication title Differential function of lip residues in the mechanism and biology of an anthrax hemophore.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Heme-binding protein
total genus 24
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3sz6A00
3QZNA 2MOQA 2E7DA 3VUAA 3VTMA 2Q7AA 3RURA 2K78A 3QUGA 5D1QE 3QZMA 2ITEA 4H8QA 4WJG3 3S48A 4MYPA 3QUHA 3QZOA 4H8PA 3QZPA 3SIKA 2H3KA 3SZKC 3OVUB 3QZLA 2O1AA 2ITFA 3RTLA 3SZ6A 4YMPA 4FC3E 2Z6FA 4NLAA 2O6PA 5D1XE 5D1ZI
chains in the Genus database with same CATH superfamily
4H7VA 1AGCA 4N28A 2V3FA 3C5ZC 2IWGA 1B9ZA 2H3NA 3X3GH 4WK4B 1UZ6F 3FYIB 1QEWA 1WHPA 2ODIA 1R9FA 1RURH 2XXCB 4R26H 3GDBA 5FYJU 5HDBF 2LTQC 5D4JA 3C6LB 3OJMB 4OKDA 3SJVB 1MHCB 2Y9RT 5B21A 5C0AE 3RDTA 4Z3FA 4CL7A 1SUHA 1WZ1L 5AKRA 3QZLA 4AQAA 4NQDA 4B60A 2E7CA 3BVTA 4KO6A 5EO9B 4GO8A 4WY7L 1RHHA 4XCFH 3OKNB 2WD0A 2AXWA 2XQBH 1B0GA 1OW0C 4H8UA 5CILH 1T22B 5EEYA 5ICYA 3GUTA 4D0DA 3BUPA 4A7UA 1IEAB 4LFHG 1PZBA 1UGNA 4NQEA 1FNSL 3LOWA 4QRQA 4Y9GA 5JIDA 3QIUA 1AZZC 5LO7A 1UWEH 4F20A 5HHOA 5KS9B 2HJLB 3CU7A 1YQ2A 2BOLA 4S1SH 2EDOA 4NC1C 2WPGA 4YUEL 5AAPA 5B3JF 4ONFH 1BDYA 4XWGL 3L6FA 3ZYOA 4MZIA 4J7RA 3V2AR 4P2RD 4L4VA 3KPMA 4L9LA 1VACB 4LVOC 2GEEA 1ZAGA 4PCTA 1CXKA 4YDKL 5CBAB 5J12B 1IEHA 3FRUB 1N5AA 2R9HC 3NJKA 5LG1A 2LVEA 2VDNH 4JKWA 4JY5H 2HRGA 4LQFH 4I4WA 4IJ3C 1MNUL 1R3LB 1B4JH 3A21A 1CFNA 2AK4A 5EZJB 1DEDA 2AQNA 2EECA 2XTJC 1BZOA 3CSTA 4KUZH 3T0WA 3RVVC 2A9MH 4MA8H 2I24N 5DUML 5EPMA 2HVKB 3NP4A 4FFVD 2ESVB 2PO6C 4U6XA 1PY9A 5AZEH 1M7UA 4HC1A 2VJXA 5I76B 3S5YA 1LWHA 3I6LD 3LQZA 1NSNL 2UY7B 1BXAA 5FCUL 2CJSA 3OHXA 4CGTA 1DQKA 4U2YA 3TBTB 1GRWA 1JGEA 2FRGP 3HS0B 4GUPB 5IBUG 3Q5OA 4JFED 1U8IB 2VH5H 4JCLA 4O2EA 4PWGA 3HJEA 4YHZL 1MCKA 5L4IA 1MW0A 2G0LA 3P9MB 1R17A 5I1AB 3P3TA 4N0RA 4D9RE 5F6IB 1PX4A 1IBFA 4P2QD 1XCXA 1CQKA 1Z9OA 1Z3GL 3V6ZB 1BLNA 1KIUA 1X7SA 4GH7B 2DEXX 3ENEA 3H6JA 3IJYB 1HEHC 1BZ7A 1RK7A 2ZCKH 1NCAL 1J8KA 4X4XB 3T5WA 1RI8A 2J20A 4ELDA 4Y4KA 3I2CH 2VUYA 2JLLA 3LQAH 4G42A 4X7SH 2EDNA 3VGHA 1XB8A 3QNFA 2Z8VC 4U6HA 2WO3B 3HEIB 4JAMB 4BBWA 3EGDA 4ZZKA 3GSVB 2EH7L 3DX8B 4ONGH 2FLMA 4Y5XC 3DROB 4M5YL 1TR7A 3GB7A 2VIRA 4D8PB 2QTEA 5FFOA 3TTYA 1HAWA 2ZKYA 3NACL 3MTRA 4IQHA 4AT6A 4G8IB 4L23A 2XNAB 5C07B 2W91A 1QLFB 4FG6D 1XSKA 1PZ3A 5B22A 1JWUB 4POZC 1V05A 5ERWB 4RMUA 2WB7A 2ZCLH 1UQSA 2ZXAA 1KJ2H 2V9TA 1H8NA 3T8XB 5D6CA 5DJYA 2IMMA 4AVJA 1WGOA 5T33L 4YIQA 1KCRL 3D85A 4NBYB 4DGYL 3UC0L 4HMEA 3RZCA 4OJAA 4X42A 4Y2DB 4A39A 1GXEA 1QP1A 4HIJB 2XYCA 1ORSA 1DUYA 3PWPB 4Z8FL 2Y7QB 3U1PA 1I7TA 4OLYH 1NMCC 5E8OB 4E5XB 2PWFA 3T6ZA 5SWZB 1IAIM 4YLBA 2KLRA 1I1FA 4KGLA 4N0UE 1AMYA 1FJ1A 2XXGA 3FT2A 1KLGB 3DOHA 2K4AA 4HUKB 3UGEA 1RJLB 5JZ7C 3F7VA 1IE4A 5GGSY 2JMRA 3CFDA 4YHPA 3MBEA 4KQ3L 4WY7H 1KMGA 5HHXL 3GXUB 3MGOA 3DX9A 2GY7B 4XO9A 2CK0L 1OTTC 4XBGA 2A9AA 1QQDA 1TZOA 3FT3A 2F74B 2YMOA 3LNFA 3ALXA 1H15B 1OAZH 5AVRB 2OJZH 5A2CA 5CEXA 1J8RA 2YC1A 3VCLA 5BS0B 4RSYA 1H3TA 4RMVA 4P3CL 2Q8BL 4YUEH 4JFDA 3FQUB 2N56A 3QUZA 4PJAF 4XWGH 1EFXA 5TF0A 1FWXA 2UWEE 1T66C 1MWAL 2HFFB 2NSQA 3MV9B 5DF0A 4GKLA 4FQXC 4XCCL 1L0QA 4XVUC 5KBLA 2DV6A 4NAQA 3S7GA 2QVIA 4LDLB 1LP9B 3GO1L 1V7NH 3HJ0A 1AGFB 4JY4A 2V2TA 4ZFOL 3UG3A 4FI6A 3V8CA 3VWJC 1BFVL 1MNUH 5TDOA 1RVFL 2A9CA 1GZQB 4NGHL 2X41A 3OKOA 1S7QA 2CIIB 3MRIB 1JXDA 3QXAB 4KU1A 1JYWA 3SBPA 4BKLA 3L48A 4QRBA 5DUMH 5CKGA 4UT6A 4OB5H 4N2LA 4WAFA 1AZVA 3B4NA 1KCLA 1EZVY 2AP2A 3HG0A 5T1LD 4MXVF 5FCUH 1A66A 2GHZA 3LNEA 1RMFL 3QZOA 5E8EA 3CVHL 2NY5C 1S7UB 3CHRA 4PVLA 2YAEA 1EGJA 5IMLB 4W6YB 3LKPB 1IVLA 1JWSB 5DHVB 1JUFB 2LU7A 1FZKB 4YHZH 1MCJA 2QKIC 1HU8A 4QRUA 1WFIA 4KKCC 4GUOA 2VDPL 1IKNA 2OMUA 3FB5B 3O3DA 1ACZA 4JFFB 4N2AA 1MFVA 4WO4D 2VKXA 2XC8A 3HTLX 1CU4L 4DVRH 4P23D 3PCYA 5GS0L 5HI5C 1OE1A 1Z3GH 5FYJD 4AIZB 2VZTA 4RQQA 5DUBB 5HXMA 1Z3RA 5B8CC 1KPRA 2ZOKB 2P1YA 3QXDA 4YZWA 2ZG1A 1NCAH 1E4KC 1G7PA 4F37K 2EYRB 4HKXB 4CA4A 4LSRH 1JDAA 5CP3A 5IBLD 2NPLX 3V5HB 5EF0A 2E9JA 4L2LA 1EHLL 2NY6D 4QHUB 5JLZA 2ZXCA 5EUKB 4BCZA 5J6HB 1MEXL 4GW4A 1J8SA 4X6DF 4N2HA 1DSFL 3S3SA 1IMHC 2QZ5A 3BPOB 3P4MB 4OLUL 5FW6A 2HLAB 3RWGA 2EH7H 4ONOA 4UZSA 5GGQL 1JZ2A 4L0YA 4M5YH 3SGDH 5B7FA 4U1GB 5L0QB 5IVZB 3NACH 5H35B 1MLBB 1ZVYA 4OLVL 3LIZL 3Q2CA 2HUHA 2KERA 2OMTB 3L17A 4K7PX 4QCIB 5JW3H 5E5RB 5LDUA 4KDTC 1WSST 2KLSA 2JI2A 4XI5D 5I1IL 3SY6A 4BQ8A 5FXCH 4JFHD 5T33H 1OQOA 2JLPA 4DGYH 4NQQA 1W72B 1WC7B 1Y1UA 2CDFB 2A38A 5BXFA 4FD0A 1RZQA 2KYIA 4G6JL 5D1ZB 2HT4D 5TDNA 5EO0B 5I1CL 5EBWA 4HWZB 4Z8FH 2YGQA 2WWNA 5EBLA 1TLMA 2VDOB 5C0EB 1GS6X 3UDWA 3ZHDA 1F1DA 5F6HJ 4Z78A 4V2BA 2ZX9A 5DJAB 5F3BA 5JXED 4F2ME 3WUZA 2XLLA 3QEUA 1CICC 1CGYA 3FU3A 4JPIB 4GO9A 3FCTB 5KOVC 4KQ3H 4DGIL 2A73B 5HHXH 1NJ9A 1N6UA 5HYSB 3L5IA 4F7CA 3BIKA 2CK0H 2ZOOA 2N01B 2W59A 2ADJB 3H55A 4KX8A 3MGTB 2OTUB 4APQA 1GGCH 2QPUA 4E41D 1OSEA 3ILQD 4YBLB 3ME0B 4BE6A 4LLDB 4FGMA 3B2DC 3FTXA 3RTLA 4P3CH 2Q8BH 3WI9A 5JDSB 1FGNL 4ALAL 3KYMA 2P46B 4GKZB 1ZVSB 3D9AL 4CMMA 4G7SB 3X11A 3AU0A 1MWAH 5ECGA 3SKMA 4ZMWA 4XCCH 4KKNA 4F8OA 3F7KA 1OE3A 4HWBA 4ZXBC 1FFNA 2VR6A 3ULUD 1HZHL 1NWPA 4J4PD 4LPVA 4GW5B 1XGUA 4HIHA 1NICA 1BFVH 3WD5L 4G9DA 4NGHH 1FQ9C 2R0KH 3GQFA 3JWNG 3RJQB 1A4JA 1BAGA 3GSNL 4R4ND 3HG1E 2ERJB 2GQHA 3TEWA 3TBBA 3VWKD 2ZF9A 4IBVA 5E1AA 1I3VA 4IDJL 1DJGA 2KKQA 3SKOB 2G9HB 2X6CA 4FFZL 2DMHA 3RY5A 4OZGE 1WTLA 3QNXA 1B9KA 4LGPB 3O9WC 5D6DC 1CS6A 3DX7A 4HIIA 1F6FB 3CVHH 4AI7A 4U3CA 5DJ2B 5FF6A 3VB8A 4HG4K 2K9UA 5DVNA 1DN0B 2JB5L 4NYLB 1SOXA 4F8QA 4ZMTA 4YX2L 1BXVA 2Y2WA 3CSBA 1WCBA 5DC4B 1MCQA 1LO3L 4WTZG 2VDPH 1TVBB 2AANA 2ICES 3V95A 1CE1L 4G83A 3MRBA 5HVWA 1CU4H 2GSIB 3UGUA 1YVLA 3MR9A 3VRLF 4QEGA 5GS0H 4QYOA 4QKTA 5KEZA 1KFGA 2YPKA 4TSBL 5TJWK 2OSLB 4IK6A 1RPKA 4PV9A 2WQRA 1AO7B 2PO6A 1I3RA 4G6FD 2ICEB 2VAAB 5TQ0L 5KSBF 4HDIB 3IJ9A 4JEGB 4NN6B 2OMZB 2Z8RA 3OB8A 3DPBA 4N1EA 4YHLL 2J2ZB 1IGCL 5D55A 1MEXH 4L1HA 3UCRA 3NSXA 4ZMVA 1KV3A 2LE9A 3QQXA 4OLUH 1U8PA 1TTAA 3K6OA 4OCRL 5HYJB 2R1WA 3HBGA 3R0MA 3I3EA 5DA0B 4ADIA 4HKZB 4UIMA 4NUQA 4F8LA 1XSOA 4MS8D 3B1UA 3IAPA 4F2EA 4OLVH 1SJEB 4UYPA 1K5WA 3RWCA 1JWMA 1J5DA 1CFTA 3F2LA 3HKFA 4AX3A 5KVDH 5MENE 5J13C 1QW8A 5MEQA 1CQYA 2BP3A 4W9DC 5EDXA 1YN7A 1KTCA 2FLRT 2VDLL 4Y4FC 5E6ID 3STLA 1QSEB 5I1IH 3FAWA 3GTNA 4OZGA 2FBJL 5CP7B 3BE1L 5KS9F 1ET7A 1G7HA 5J1AA 3ARVA 4J3OD 2D7NA 3IGLA 3L2NA 4FJYA 1JK9A 2Q9OA 1TCRB 2SODB 4G6JH 4IHBA 3ZKMD 2B14A 3A0OA 1YN6A 4QTHA 1FIEA 5F1KC 1ZV9A 3BWUC 3PUCA 4AC4A 3CD4A 1QPXA 3LTVA 4JRYB 1QI3A 4HK3J 2HJKB 2KQMA 3PL6A 3MFFA 4YSQA 1FF5A 4LLUA 3EOYG 4EO5A 4LSTH 5DRWA 5JW4M 3MRGA 2HT2D 5BV7L 5FUCE 2FX8H 3UZVA 1UVQB 5I18H 3ZHLA 4IKNA 2C1PA 3THML 4GI8A 2O6PA 4N68A 4RAUB 1C7TA 2NY4B 2V2WA 1WFTA 3MLVL 4DGIH 5ADPL 3JV4A 5DLML 2BNQD 1NCHA 3HC4L 1A64A 1FYTD 3DRQB 3EFOB 4WI5A 4Z7WF 3MNWB 1KJMB 2FYYB 2WBWB 2W5PA 1I7RA 3DIFB 3ECQA 3L16A 3LXCA 4PS4L 4JHVA 5FAAA 1M7DB 4TLKA 2QQQA 4GS7C 4MB5A 1FGNH 4HFUL 4ALAH 4E5XG 1TMQA 3ECUA 5L2KA 4X5XB 3D9AH 1ASQA 2K8MA 3Q2LA 4HC1L 3NZHL 4QRPE 3QNYA 5LNDA 4AGNA 3X1BA 4JG0L 1P4LB 4PJCB 3LV3B 3OAWA 4UANA 4JKNA 5IEHB 1N4XH 4C83B 2NDGA 5I73C 5DD3L 3WKYA 5BRZB 2CUHA 3EH5B 3MV01 5MENA 4YE4L 4PJHB 1AIZA 3WD5H 5KSAB 3SE8L 1KBGL 1HQ4A 1BX2A 1CL7L 2HH0L 2PXYC 3GSNH 4OQ1A 2HSIA 2P5WD 5IV2A 3FYEB 3H9ZA 5E4OA 5JQHC 4J8RB 1KV7A 3TYGL 5BUPA 5AENA 1T5WA 3B7TA 2O1AA 4IDJH 4WKZA 4X7TB 5AW8B 2FWSA 4NDMB 3L7EA 1CXEA 2NRDA 2EXWC 1MCWW 2J57A 3K8LA 4I2XE 4W9ZA 3VSVA 3LKOB 5HGGS 1QRNE 1A5FL 4IKJA 1A1NB 2DIBA 2NY0B 4R8WH 1D9KC 2EUVA 2JB5H 3M7FB 5EMYA 4YX2H 1SXSA 4HSCX 5H4ZA 3NVQA 4NN7B 2J8UE 3KWXA 1XTMA 4IW4C 3SGKC 1NA8A 3ELQA 2VMCA 3NZ8A 3T0BA 4EN3D 1CC3A 1FNAA 3IWVA 3VWJA 4PWHA 4QHMA 4G6ML 1S78C 1CE1H 2RALA 1M7XA 3P73A 1DQQB 1WBZA 3JTSB 3MA7B 2EQDA 4JRXB 4TNVF 1U42A 2B5IB 1QSFD 4Q9RL 1IGYB 4GXVL 4TSBH 1ZHBA 4YNYA 1N3NA 3NJHA 3WTVA 5FV2A 1E9OA 1U33A 5DFVD 1JGVL 3FFDB 3GZQA 4XCYA 5TQ0H 4E9TA 1HDMB 4HUXB 4OV6F 2YN3A 4AZ8A 4TOYL 4ELMB 3CE1A 3B9KC 1OZTG 5GGRB 5ESQB 4IBYA 4XO3A 2W8CA 4YHLH 5IQ9A 5CCHE 4PRAA 2X9YA 1IGCH 1FL6A 2XA3A 2EC9T 2QKIA 4QRPA 3ZTCC 2NXZD 4ZW5A 3AGVA 1HIML 3N41B 4FTVB 4MD5A 4JFYB 4GRLC 4X4ME 3KPRB 1AHWC 1I9JL 3IFLL 4WJ5B 1FNHA 4D0BB 1XVSA 4KMTL 4OCRH 3D4CA 3CX5J 4YHMH 2QTVA 4HW6A 3L3DB 4PTTA 1QZNA 1V7ML 4JO2L 3QCVL 2OYMA 3VX1A 1N8ZA 1XGRA 3MGAA 5B8CA 3NCJL 4U1IB 5F7WC 1L9PA 1OTUD 2VDLH 2ZXGA 35C8L 5BZZA 1Y07A 1I9RL 2OMVA 1GZHC 3PWLA 5FA4B 2FBJH 4I2XA 5DHXB 1G9MC 1QRNA 2VR7A 3BE1H 1EUTA 4PGJA 5AVTB 1OT4A 3OZ9H 3VFPA 4WW2A 1JAEA 2J8UA 2HXAA 3SDXB 2WLJA 5TGBB 4HULB 5T1MA 1K8DA 4IEFB 3V6FA 4ZG1A 3DGDA 3M1BB 4LVEA 4PN6A 4WDIB 3KPSA 1EAOA 2H2PC 2ZWYA 5KANI 3UEZA 5BV7H 5KJ4A 3U0PB 1NCTA 3QIBC 3THMH 3D18A 2B39A 5ADPH 3MLVH 4HAKA 4HKBB 4TVSa 5FO8B 5DLMH 1WFOA 4L3AA 3HC4H 2A83A 1EXHA 4W9EC 4JGJA 2EKSB 3SQBB 4PS4H 2CRYA 4KXDA 3ZHNA 3U6XA 1WTGT 5FFLA 1G7IB 2B1OA 1L0PA 4X5LA 1MCDA 2Y2TA 1Q94A 3C09B 4HFUH 3DK2A 1UWGH 4X4MA 3DVGA 1FV1A 4H88L 4NRZA 4UT6L 2FZ3B 3IMUA 4UCFA 1OF2B 4HC1H 1E8WA 1MJ7L 3TCXA 2CRMA 2DLFL 2IDCA 4N3TA 4JG0H 5J9PA 4OU3A 2ZUQB 1H9DA 1CICA 4NKOB 2Y7OA 2Y1VA 3HZVB 1KWKA 2H1LM 2UY6B 2MTAA 1VAHA 1EGJL 4PW3A 5HYSG 3S37L 4M6NH 3WUWA 2WJ5A 4YE4H 4JPKL 4AL8L 5HJ3A 1DANU 3SE8H 3CPLB 1KBGH 5I28A 4DP7X 1CL7H 2HH0H 1F90L 3CQQA 4FG0A 4ELKA 2I32A 4R4BB 4FNUA 4P2CG 2FHFA 3D39D 4FRWA 4K7FA 3VE0B 2X4SB 2VKWA 1A6UL 3TYGH 2ENJA 4PS7A 3ABZA 3DV4A 1I85A 3EXJA 1TQTA 2DQTL 3ESVF 2CJTA 2GCYA 3VQMA 1WDAA 3QW9A 4MGXA 5AWNL 2HX9A 1A5FH 1QSZA 4OD2A 5HHVL 3KYKH 4ICXA 5C2BH 3KPNA 5FYKE 3T04D 3D25B 2GC7C 4MNQB 3U9WA 1PL3A 1JHLL 4M3JA 5MEPA 4JG5A 1KEGL 5C9KA 3X3FL 4UAHA 3MKKA 4LLQB 3COOA 4G6MH 2IF7A 4P5TC 4QWWD 1MOEA 4JFXA 4F7EB 4RSVA 4FKEA 4JLRA 2VZOA 4PW9A 4LNRB 4FQPA 2ZOWA 4Z7QE 1TJHL 2WK2A 3HW7A 3LEVL 1QASA 4Q9RH 4FZ8L 4GXVH 1SGKA 4KK6D 4FLQA 4TNWF 5DJDA 1JHTB 1NCCL 32C2A 4CC0A 1DVXA 5IFJB 2VLKA 3KXFE 1OARL 3O9WA 4NQCB 4TOYH 1J5CA 1BFSA 4UM9B 1LEGB 4WWKB 5HYIA 3OLGA 3QBTB 1GZPB 4O51A 3D8MA 3BD5A 1HIMH 5KUMA 4QRRE 3BEWB 4AGLA 1I9JH 3O8XC 1B88A 4KMTH 2WV3A 1OAKL 3FULA 3BH9B 3FTYA 3LPPA 2TAAA 4UINL 3HG5A 1V7MH 3DWTA 1IBYA 4JO2H 3QCVH 2QADD 1AP2B 3EGSB 4L1DA 3TVMD 3EYVB 4B9FA 4LAJH 3NCJH 1RUKL 3P0GB 5DS1A 3RTQC 1L7IL 4ZOBA 4KKZA 4KHTH 3ZZ1A 2D2OA 4F24A 3U83A 1I9RH 4O2CB 3V0HA 2XQYK 3GBEA 3AMLA 5B39A 3K71A 5LBGA 4N22A 1C1EL 1AD9B 1WAEA 2ZXDA 3LRKA 3T6XA 4H26A 3QUKB 3IN0A 2D9QB 2E7LA 4IRZA 5C0CD 1F41A 3L4TA 5ACLA 1HXYA 3IMSA 3D7PA 3MA9H 1XX9C 1VFAB 2W95A 3R7RA 1FVCB 4ACPA 4PJBA 5D1XD 2UZXA 1NUFA 3QFJE 3P11L 5HHMB 1TKWA 3ZO0A 5DMKB 1VFOA 3REVA 3HI1A 4QHPA 2VWEE 4BFFA 4Y4FA 2E3VA 4HWBL 1CLVA 3F84A 5B1JC 2EIKB 3QFGA 2V2XA 4XP6H 4W9KC 3KXFA 2F54A 4QMEA 2AXFA 4XPGH 3EUDA 5F93C 3L9EA 1TTGA 1KJ2B 4GMTL 3STZA 4UQIM 2EYTB 4L29A 4I0PC 2F7RA 4ZXBB 1M2VA 3KYAA 4QRRA 2CJ3A 2QELA 4PJEE 4AJYV 3K2UL 1FL3A 1IAOB 2YQ3A 2YD1A 2R56L 1MJ7H 3VFSB 4B0MB 1AYRA 2DLFH 3CZSA 1E9PB 3OR6A 3LSOB 5DC9B 4BEIA 1LWRA 1GHFL 2XWCA 4XOBA 3S37H 2IWKA 4YSRA 1FPTL 3SPCA 5IW6A 1JZ4A 2V4LA 1TF4A 3B6SB 5K9JL 4AL8H 1QBBA 1RPUA 3UFIA 5HGBA 1R24B 3MI6A 4U1SA 1F90H 3NIFF 5KTEL 3GC3A 2Y6SC 4MB4A 1KY6A 1A6UH 2VJ8A 2DYPA 3WHXA 2BVYA 4HIPA 4UQCA 1Z7JA 4W93A 2DQTH 1GCFA 3ZIYA 4H2AA 5ISZB 1ILSA 4ES9A 5AWNH 1M9SA 3JVGC 3O4LD 1T1ZB 5HHVH 5BZDB 2DLIA 1TEYA 5DUPL 2H6OA 4KH9A 4ODXA 1PIGA 4FXKB 4S1QL 3ULVD 4PJGA 5CP3H 5GSRB 3EJRA 1EO7A 2BS9A 4PJ6A 4UZUA 1P1ZB 1ZT1B 1F2XK 3CSGA 4YMPA 1KEGH 1SMOA 3RWIA 1LTXA 4S1DD 3X3FH 4DEPC 2NXYC 3PIQB 4G8EB 4HIEA 4Y7OC 3SDDD 4LPCA 1TJHH 3LEVH 2PXYA 3CN4A 3JT2A 4FZ8H 3H9HB 4R5VA 2IGFH 3WTTA 3F8UB 2XHNA 1SJHA 1NCCH 43CAB 3QDGE 2VXQA 3W56A 3FT9A 1QVOA 4MDIA 3K4DA 4A66A 3MODH 4EI5C 1YG9A 1OSPL 4TULL 4X9FA 2BNRB 4BFRA 1NBQA 4PJEA 2XPGB 1G0DA 1D9KA 1LXMA 1ZLWK 1IZJA 3C12A 1MCFA 4KC3B 2DY2A 3U36A 2WBJC 3QK0A 4WUKH 2Y3NA 1YA5A 2NT1A 1WFNA 4N2FA 1IM3A 1QFUL 2XUWA 3V0DA 1FFTB 4JDEB 1OAKH 1RK0B 3KYNB 1PQZB 3L13A 4PJDB 4UINH 5ALCL 3SPIA 4DF9A 3A24A 3TH4T 3RG1C 3HE7B 3K0YA 1CDHA 4KZDL 4HV8B 6PAZA 4A68A 1NCWL 3BH8A 1RUKH 3QHFH 5GS1C 1L7IH 1S5HB 1PG7L 1ZWIB 4AQOA 1H3GA 3SOTA 4HU8A 2N0KA 2VSKB 3KCWA 2UVEA 3TP4A 5CNHA 3UTTE 4ZX3A 1JN6A 2OSYA 2YHGA 3VA6A 1M71B 4ZMZA 4LCYA 4M02A 2E6PA 2EUWA 3F01A 4Y16C 1M6UA 3AM8C 5F7EL 4FFYA 4HKJB 4XN5A 2LGNA 3BWZA 4GRLA 2BIQA 4OJFL 4WU7B 1AHWA 1CI5A 1XL4A 3D05A 2XFXA 3VXPB 1X5JA 1IV8A 2H26A 4AQEB 1TETL 4PJCF 2R0LL 4FYSA 3B2UC 1FFPA 1NFDB 2CCWA 4JY6B 4M61A 1IFGA 3L9BA 3P11H 2GKIA 5JIHA 4PJHF 3PNWA 3A6CL 4PRHE 2OQJA 4HWBH 4NKIL 4ZNCD 2Z92B 2GJPA 3QDGA 2X40A 1ZANL 3NCXA 3KGTA 4F93B 2W0PA 1A4BA 3BQUC 1G7LA 5I23A 1DQJB 4OIIL 3JTBA 1HH6B 1YMMD 2Q6WA 3UAEA 4XAWL 2PR4L 4FHJA 3TO4D 1HXMB 5I0XA 2OMYB 5DQ9B 4EI0A 2EXYC 3T0DA 3NG5A 3B7RL 2C3HA 5CKAA 1GMIA 3V4PA 3CQPA 3VXME 1ZGLA 1MCNA 1EO8L 3K2UH 3DX6B 4B0MM 2R56H 4BK5C 1JPSL 3CN1A 4MXQC 1WAAA 3R4DA 3ZKND 2YO3A 3QIBA 2R0WL 1TYEB 2WMPB 1GHFH 3KLLA 3MV8D 5DVLA 2GJRA 4J1UB 3RWJA 1FPTH 4OF3A 3E9TA 3GSOB 2IAMB 1N0LA 1A1OB 5CJOL 3V0WL 1XGTA 2X70B 4Y2NA 3FOMB 3JQOB 5C92A 1HXKA 4PLKD 1TQVA 2BY3A 2AQ2A 5E2TL 3SPHA 3KWWA 1OB1B 4CMHC 2DQJH 1A6TB 3C2SA 1PLCA 2ZKHL 4NXSA 4RMRA 1KULA 4Q0XL 3OM3B 4JQIA 5HPMA 5D7LB 2LQRA 1VRSA 1NLBL 4XN8A 4X7FC 3VXSA 3N41F 3I3DA 5DVOA 3EJZD 2VLJB 5DUPH 1AOHA 1NC2A 3BDYH 3IJHA 4S1QH 3QIWB 1MXGA 3QUYD 4GXUN 3E6HA 1D5BA 1R5IA 1MWAB 4Y4HB 2WLIB 5EUOB 3Q6GL 5IJBC 4J5VA 5FCSH 3IJEB 1ADQA 4JO4L 4LPTA 4A37A 4JVWA 3KD4A 1IT9L 3IF1B 5J4MA 1CJYA 2ICWJ 4BE5A 3BIAX 3B9KB 3QP3A 2CJUH 2FUTA 5FDYA 1MREL 5BJTA 4ZFGL 4Q14A 4MJID 3HRZB 3X14A 4EZLA 2R23B 3O6ML 2VLMD 4JQVC 4MAYC 1OSPH 4TULH 1LD9A 1NOLA 3PQYE 2UZYB 3VXMA 4G70B 3ZO9A 3SDXF 5IW1B 1H5BB 4KKAD 5AUMB 1I1CA 4OCMC 3BCDA 2BSEA 2I27N 4G80A 3MRRB 2XQ0A 4EPSA 4UUJA 4LPYA 5ALCH 2IALA 5KSUA 2X1QA 3DO3A 2BWIA 1EHNA 3LN4B 4ZS6C 5IREA 3TT1L 4KZDH 2QEJA 4M6OL 1JNJA 1NCWH 1RJZA 3BN3B 4WEEA 1PG7H 5CD5D 5F7AA 2AQTA 1K2DB 2JJVA 1DUZA 3T2NH 5EIIA 2R29A 3B2XA 4UM8A 5D4IA 1HYRC 4P4RB 3GS4A 2IDFA 4U31A 2NX5D 4X8JA 3VI4B 4IGBD 1OZUA 5SX5H 2IPTH 4ZQKA 5CD3B 3OPUA 1EEZB 2CDEB 1N59A 3HNVL 4OJFH 3WE6A 3C6LD 3SJVD 2JKNA 3N85L 1MCRA 1CT8A 1TETH 4ZMPA 1NGXB 2R0LH 2IBBA 2W0LA 4HXBL 4XODA 1EBAA 4P9HL 1PEWA 5DWPA 3RPKA 4I0KA 1X7TA 2BOBA 5BOJA 3FW6A 4KNQA 5FK9B 4NHUA 4Y1AE 3T4AA 4CVWA 1HESA 1S2EA 3TBVA 2VC2L 3DVFA 5F89A 2E59A 3HPLA 4NKIH 4PRIA 5E99L 1XIWC 3ML8A 1IARB 1ZANH 1G7JB 1DVSA 4Q74A 3SGJC 2C4FT 1MAKA 2HFGL 4HCRA 4JJOA 4OIIH 2APFA 4WHTB 5GGVL 3L3IA 4OM1L 3RGVB 3HZYA 4XAWH 3PQYA 1Z1WA 2PR4H 3HZKA 3INOA 5GS2H 1A25A 4Y1TA 3VTMA 2FO1A 2C9RA 3DOSB 5IOPA 1T2QH 3PABA 1XH0A 1B2YA 2G5BB 3H42L 1FZOB 3OKEB 3QZMA 1EO8H 3D2TA 4YK4C 1BQLL 1J0KA 1U8NA 4HWNA 4MRBA 2MH4A 1R3HA 3CNKA 3L3KA 1P7KA 3H2PA 1XGPB 3NZSA 5ITFB 1AKJA 1C5DB 1GJUA 3MBXL 4FQHB 2D2CC 2R0WH 5K9QI 4HK3N 2H6UA 3QQ3A 2GBVA 1U58A 3CQFA 4Q6IA 4O00A 5CHNB 5B1JA 3VXUB 3O3EA 4XPBL 2PTTA 1KCSL 2ESVD 5CJOH 1P0SE 1K4DB 3V0WH 3RVXC 2AC0A 1NFAA 1TOXA 4NEHB 1VENA 1HS6A 1OCRB 4K3GA 2ZKHH 3KBEA 1U95A 4Q0XH 3KZ8A 1KXQE 1ACYL 1P4IH 3FZUC 5FKAB 2CKBB 1GY2A 1NLBH 3EJPA 3PWNA 1X5HA 3TF7C 2P42B 5BZWB 4P5TB 4DFIA 4Q6KA 3EDKA 3DETC 1BPLB 4LLVB 5CZXD 3SDCD 3IS1X 3KPTA 3B83A 4L3EE 4TV3A 1UB5A 4ZO8A 4Y1AA 2IG2L 2DIEA 3Q6GH 5DZVA 3K2KA 4R0LC 3D50A 2QV2A 4WNQB 4G8GB 2XN0A 3MRNA 3W0WD 3TF4A 1OHZA 4KZ0A 4LSQL 5IROA 2HKFL 3KGRA 3CFJA 2COQA 3DTXA 4HCIA 2FYVA 4XPFH 1MREH 3PWJB 3NJFA 4ZFZB 1HOEA 4Y9EA 4L4TA 4NCC2 4ZFGH 1KDIA 2JK5A 3S5LB 4AWJC 1CF8L 2BXYA 3O6MH 3VGEA 4AXWB 5D71L 3MREA 3OGCB 3LAFA 3PGDB 1A6ZB 2KDYA 3OAUH 5L6YL 4JDTL 3DIDA 4PD4J 4CW1A 2XN9B 1HHKB 1INDL 3JYCA 5FDWA 3IDMA 4AQ1B 1CXFA 2X4UB 1QHPA 5E0FA 1FZMB 1YY9C 5AYUL 1LE9A 4ETQB 3JWDL 5C07D 3U7AA 2F7QA 2QPEB 3KS0H 2X4TB 3MRLB 2EDMA 4KKBC 5ID1A 3F7LA 5FYKL 1B4RA 5IQLA 3REWA 1FSKC 2XG4A 2ARJQ 4GUQA 1DQTA 4OT1H 5I71B 3BW9A 3HN3A 3SGEI 4IRZL 3TT1H 1U8LB 3H56A 5FGCE 3WL9A 3ASOB 4JL2A 3KBFA 3GSRB 4EBQH 1M2OA 3AT0A 4PLOB 2QLYA 3T0EB 3MV7E 2XBZA 4IRSC 4PJXB 1N6QL 1KXQA 3I50L 4Y2DD 4EI5A 1NOAA 4OZFA 4LLAA 2NZ9D 3UAJD 3PWPD 4KFZC 3MXVL 3ZQ9A 3LQMA 4HIXH 3ZGIA 4ZOEA 5G2NA 3HMXH 4NJ9L 4OGXL 5GRUL 3HNVH 1RLWA 2IC2A 3N85H 4R3SB 1S7RB 2ADFL 3FRPA 2YA1A 3NA9H 5GSVA 5AD0B 1YMHB 1VB9A 5LVEA 4HXBH 4P9HH 2Z8SA 4UQAA 3K8KA 4B3EA 1H8OA 5LAPA 3RVUC 1AGCB 3MZGB 3S97C 5ID0A 1YY8A 5F0LB 4BXSV 3T0AA 2XX1A 4LSSL 1VKXB 2H3NB 2F68X 3CDYA 2VC2H 4L5FE 5EZPA 1JV2A 4I0PB 5E99H 1VSCA 2LAGB 2WLLA 2BVEA 5BS0D 3R18A 1DCEA 2B4CC 1SYVB 2PKDA 4L8DB 4MTMA 1YEWA 2HFGH 3W11C 2XVLA 4OM1H 5GGVH 4YZFF 4BFJA 1TZAA 3TH3T 4Y16A 5ICXB 4RRPM 1KB9J 1SY6A 1YPZB 1Z9LA 3KJ4C 3KW8A 2CLZA 3WMSA 2IGTA 3HB3C 3DX4A 3AITA 2YPLB 1OALA 3BAYA 5DYFA 3QJZA 2OJEA 1B0GB 5I6PA 3H42H 1J9RA 4KJQD 1RAMA 1DCLA 4D0DB 4RISL 3FJTA 4NO2A 3GKZA 4NQEB 4DO4A 1BMWA 1JD7A 3TJHD 2XTLA 3X13A 2ZUXA 5ANHA 3MBXH 4Y4KD 5CXPA 2IXQB 4OY9A 1YYCA 4AH2A 1T0NB 1G7MA 2QGCA 5BV7B 3MV7A 5F1NB 1LNUA 1UWXK 1CZ8L 5C0BE 3HN8A 5F21B 3WNIA 1PYWA 3OJDB 4D9QD 1ODUA 1WZAA 1MQ8A 3QORB 2P43B 4WFGE 5KBDA 4GG6B 1UURA 3ZE2E 1KTDB 4P99A 2VUOA 4HEMA 5GGVY 3JBG7 2VM9A 4P4KB 1ACYH 2X4RB 4OLWL 5EU3A 3KLDA 5DFTA 1CFNB 2NY3C 3U7YL 2AK4B 2BP0B 4N20A 2CGZA 1ORQA 3NRQA 4DK5A 2VXQL 4PWKA 5CIPA 4JFFD 1KB5A 3FPXA 4YPGB 3DI2B 3TT3L 3QXWA 5IWLC 6FABL 4DEWA 1RSFA 2IG2H 3CZUB 4KK5D 1PZ5B 4NI3A 1YYML 1ZIBA 2XCMC 3FO9B 5E2WL 4M93B 5I15H 2FJGA 4LSQH 4PG9B 2HKFH 4ZMLA 5I74C 1J86A 2A0LD 1E6JH 2M1KA 4LCVA 1C12A 4MNGA 1UACH 4N5ED 3L5WA 3CUPA 5C0AB 4JZJA 1FO0A 3GBML 4GSQA 4LF3B 4MSWA 4WHCA 1AG6A 4OJEH 4MXWH 1CF8H 2D9CA 3FK3A 3BKCH 4RMSA 2YZ1A 4XB8A 2TSBA 1G43A 4ZUUB 5IK3A 4D2NA 2V8LA 2CUAA 1LE5B 3AREC 3P69A 4FNRA 2I07A 5L6YH 1KIUB 4JDTH 2C7UB 4PJAE 4FXGC 4UWQB 1INDH 4K8RL 4Q58C 5AYUH 5A40E 5DJCA 3JWDH 1MRCL 2BSTB 4V33A 5D2LB 5GS1B 2RTTA 3T8MA 2Q7NA 1IVTA 4FFYL 2AERT 1E6OH 1ETZB 4IIQB 3CDZA 5FYKH 1AQKL 3FF7A 3ZYIA 4GRMA 3CN3A 3RVTD 1RP8A 4WZ9A 5KYWA 1CDJA 4IRZH 5C0BA 2MKWA 4WTQA 1MCBA 3BUQA 1MFEL 2XWTB 5HI3D 3HNSL 1ZDSA 3Q5YA 1BW8A 3EGDB 2BSBA 1DJWA 3K6FA 3OKMB 4GYBA 3AG3B 2DWYA 1XEDA 2QMJA 3MRJB 5EDSA 1S8DA 4ADGA 3UG5A 2WKOA 1R33A 4MAYA 3I50H 5AB1A 3RHWF 3O3UN 1N6QH 3W9EA 5C08E 5BQDA 5D1ZD 3ZZSA 3CWGA 4AT6B 1GH7A 4CVZB 4OCYH 2FQGA 4F57L 4TRPL 3ZBMA 3EO1B 3R06A 4CN4A 3AS0A 4IRJB 3BAEH 2PW1B 5E4EB 4JO3L 1J05B 5EO1B 4PJ5E 4QHLB 5GRUH 3A4DA 4R96B 1YECH 2APSA 4H8VA 4WV1C 5L88L 1KOAA 2D7TL 1F02I 1ZSDA 4Z7VE 3SKUD 3L5JA 4NP4L 3WKQA 1KXTA 2KBGA 2P5EE 3VRJA 1E5YA 3V4PL 3V52L 1TO4A 2WWKO 3HAEB 4EXPX 4WWOA 4IOIA 3BZDA 3WFZA 4TXVB 5E6RB 3WEXA 1XCTA 1WT5A 2G3NA 7FABL 4ZUTB 4CN1A 1MFBL 4ZRGA 4AZUA 3QJQB 3PY9A 4QNPF 1FRGL 1EA9C 4QUOA 4U0RC 1HL4A 2Z7WA 3J07A 4Z77B 1IFHL 3IGAB 2QVKA 4JQXC 4NENA 1BD2E 4XMUA 1ETB1 5DI8B 4PJ9A 4N6RA 1D5ZB 5CLTA 2DWEA 3CFDB 1JTTA 1P53A 1T1XB 1IX2A 2A74C 4JM2B 1EIBA 2HFTA 4HF5L 1YNTA 5I6OA 2BJMH 4QGTA 3O3BB 5GJTL 3KMDA 4JQIL 4RISH 5CEXB 5ESAA 3QXUA 3VXNB 2E7DA 1AQDA 1EFQA 4I18C 4LGRB 5DEJA 2DQFB 3CLEL 2HKAA 4N2EA 4LSUL 4AV5A 5D7JB 2EYSB 3UAFA 4PRPE 1WWAX 1YZZA 2BZCA 5CN3A 3SGJA 1CZ8H 4X4ZA 4HHWA 3CXDL 3HHMA 1JNHB 4WU5A 1ADQL 5C08A 2AEOA 4RRPG 5IB4A 4TUOB 1YEEL 3DURB 3FQRB 4MMXA 1NAMA 3D06A 5D5ME 4OLWH 1WD9A 2MWCA 1Z0NA 1PMYA 2E4TA 4PJ5A 3CFBB 2AABL 2FB4L 3T4YB 3WKML 3MNVB 3I74A 4KUCF 1QR1B 3U7YH 1MNNA 1JK8B 2KDGA 1S3RA 2EP6A 3IFOA 2O6FA 1YNLL 1OT2A 3TBCA 5GHWL 3AW5A 1X4ZA 4AG4L 3TT3H 1O9VA 2P5EA 2WY3B 3LZFL 4WRLA 4B9CA 4W4OC 4OV5B 4N2KA 1E2ZA 1S9WA 4JG9A 3U4EA 1AO7D 1AACA 2VR8A 1VDGA 2IDUA 1S9VA 4URTB 2P8MA 4M5SA 1A6VL 4HAGA 4G59C 4KVCH 4IOFC 4N0UB 5FFGA 5LWYH 2BSDA 1O75A 2DQEL 2I5YL 3GBMH 1UXSA 3NDYE 3T3PE 3GJFK 3WFHA 3VI4F 1AVAA 2YD7A 1BD2A 1BIHA 2BFVH 4G1EA 3EO0A 5F7DA 4PU2A 2OMUB 3QQDA 4RGNC 5D8JL 1NKRA 2WBXA 4JGUA 4FE9A 3SCMC 3QWRD 1G0XA 2AJVL 4U6VL 5HTSA 2BNUB 2F0CA 4AV4A 2R29L 2Z7UA 5FOBA 3QXVA 2XBDA 4K8RH 3LZNA 5J11C 3QXDB 3KPPA 4JW3A 3Q8FA 1G7PB 2AAAA 2W60B 5DRXB 1MRCH 4YSTA 4R0LA 1RJCA 1O6TA 2DLEA 3DUUB 4FFYH 4Y88A 4ZX6A 2XKNA 1SVBA 4AKPA 1AQKH 1VFBA 4FG6C 4ZT1A 4X4YA 1MHEA 4PRPA 4GQRA 1IJ9A 2UWEB 2IQ9L 3C5ZD 2BDNL 1QSED 2X4NB 1MFEH 2F15A 4G9FE 4L1BA 4WFHE 3S5LG 1IUZA 4B9JA 3CFNA 3RPIA 3RWGB 3SHSA 5KZCB 1WA0X 3B9AA 4GY4A 1U3NA 4FLHA 4JRLA 3FSWA 3O6FB 3U2IA 5JR1H 4WLCA 5D5MA 3CHQA 1NL0L 1MZYA 3LXUX 5KYUA 4F57H 1VF5C 5I0ZA 4TRPH 1OGAE 5DK3A 3HPJB 1S3KL 3GXPA 3POHA 5I8CA 4HS8L 1A1MA 2AGJH 3LKNA 3JTTB 4JO3H 3MOAL 5I8OL 3FH7A 1MRFL 3CHSA 2DIJA 4HCRL 3MBWA 3EDJA 4IHOA 5L88H 4LBEB 1ZVHA 3AFLA 2XBTA 4WFEE 2D7TH 4E9WA 3FQ2A 4NP4H 1A4KB 1CIDA 1ZA3B 3DSFL 2NY4D 4BM7A 1KN2L 3BZ4A 2YZ8A 3V4PH 3V52H 1YJDC 1HCZA 3H7LA 3IB4A 2IBZX 3P0VL 4XAKE 1B6DA 3MN8A 4U1LB 4J6RL 1MCSA 1PZ2A 3IDIB 7FABH 1BBDL 1MFBH 4IRSA 3Q44A 5D93C 5F3HB 4KXBA 3UZEC 1FRGH 1WP6A 3NEXA 4N9GA 1D5MB 4PI2A 4Z78B 3EJYD 1Q90A 3O41B 5AB9A 1IFHH 2R9HD 4UDTA 1K5NA 1KTRL 5DEFA 3QEUB 2F5BL 4YR6B 2VABB 3TBSA 1JPTL 3MKGA 2ZPKH 4JANA 4FA8A 4UNVA 1WWCA 4Q4IA 3NK4A 4CBPA 5I6NA 1I1AC 1WYJA 5T5FA 1P84J 5ETUB 3RIAK 2XTJD 3QUXA 4FJZA 4HVBA 3BIKB 3AXIA 1DJYA 5GJTH 1YEHH 5HHPB 3C9NA 3RBSA 4JQIH 3US1A 1QR4A 3FSAA 4N8CL 2NLJA 3U25A 5KSAD 3VFVA 3FFCE 1HKLL 2ZCZA 2WXMA 2APWA 2Z65C 5KJ7E 1HJCA 3IWUA 3CLEH 2I7SA 4G9FA 4JO1L 5A1AA 1KCWA 1KZQA 4N90D 3ZZLA 1OLZA 4J8QA 4HFWB 2GBTA 4YBHA 3X12A 4PRNA 4BELD 2X09A 4TM9A 5CGYD 2EE0A 3CXDH 5IHBA 2DQIL 4GJTB 1F4WH 1YEEH 3VXRB 2IV9A 2XG5B 2NY0D 4HS3A 5DD6B 3QSKB 2R2HA 4W9IC 3BP5B 1F11B 3OLEA 5EEVA 4LPXA 2AABH 2DJUA 2FB4H 3IBOA 3WKMH 2XWZA 1UCBH 1RZIB 1QSVA 1CGTA 1FC2D 2IQAB 4JMNA 1A4JB 2OV0A 1D6EB 1T0PB 1W0VB 2BERA 3MJGX 4BFIB 3OKDB 1YNLH 2Z9TA 4LKCA 1O5DT 5INCB 4HJEA 3X1NA 3OB0H 4YDLB 2YLHA 2J1XA 4XE5B 2A6JB 3GLZA 3LZFH 3SGEH 3WYRA 3B5HA 4M7ZB 5IW3A 3QH3A 5CN2A 2OTWA 2OI9B 3CFEB 4PTUA 1ASPA 4A55A 1G94A 3NIDF 3WNJA 2CXKA 4HD9A 3GLEA 3LZOA 3S3CB 2CR3A 1ZEAL 4X9YA 1ZHNA 1FIGH 1EDYA 4F2MB 2EDLA 1I8KA 2DQEH 4NFDA 4PJXF 5DGQA 2O72A 5D8JH 5DHDA 1BZ9A 3WFBH 4MX7B 4FTVD 3R8QA 1Y6NR 4ANXA 1U91B 3KPRD 3EDEA 2AJVH 2H4EA 4QYOB 4U6VH 3D07A 1TSHA 3ISWA 2R29H 3U0TB 4PV9B 5LGJA 2F53B 1E4XI 2YJLA 3CLWA 2CRIA 5HHQA 3VD9A 4ZUWA 1I3RB 1DLFL 5HGAB 3FFCA 4XOEA 3UPRA 4BRVA 2GI7A 3JZYA 3PHQA 3Q13A 1KLFB 2RH0A 4JFUA 1CGUA 3H3KA 3L4YA 2E4FA 1JL8A 4LSVL 3ZSTA 1ZLUK 2BH0A 2CD0A 2ENSA 2JTYA 2AKRA 5L2KD 2BY0A 5A6LA 2IOMA 3FSOA 4PV1C 4C57C 1N68A 1NL0H 1ZLDA 4X7CC 2ZUTA 1UH4A 3AREA 2BMKA 2Y5QA 2CA3A 2Z4TA 1SEQL 5CR8A 2HT4C 1DN2A 4FXGA 4A7GA 3HG1B 4HS8H 4X0NA 3LDBC 5HDOA 4NCC1 3MOAH 1TTBA 2LW3A 4P2RE 5GZOA 4H25B 2ED9A 3WEOA 3KCPA 1OTTD 2DLHA 2JFCA 2X1WL 3HCVA 5KWYC 5D2NC 1SY6L 4TVUA 4Z7NF 1JF1B 3DSFH 4TLTA 4XTRD 4NI6A 1KN2H 1OL0A 3Q8BA 4F1SA 5J1AB 5L8LB 2YQGA 4K7PY 1N5YL 3P0VH 2Q8AL 2AK1L 4XMZA 1CD0A 1A9EA 2X4PA 5A2KH 5JPNC 2GABA 4L3FA 4J6RH 4XE0A 4LEEA 1T66D 4FOMA 1BBDH 4M1DL 1MPAL 4I8DA 3U2SB 4FQXD 1HINL 3PL6B 2PP8A 4PWJA 5E5UB 5JA9A 1L9TA 3DJSA 4LLUB 1OP3H 4GG6F 5C09B 4EDXB 3JYBA 2L7QA 5GGTA 3I6LE 3RQ3A 3MRGB 1MFNA 3IDNA 2F5BH 1JPTH 4DP6X 2VXVL 1NBCA 1IQWL 4U1HA 4F80A 4L9DA 2X44D 3NP3A 1A7QL 4JFEE 5IMOB 3MLRL 1I9EA 4EE2A 2JXMB 1CBVL 5DK2A 5AAMC 3H4HA 4KROB 4HCGA 2W0FA 3LZPA 2Q3AA 1T20A 3BUBA 3FUNA 3L95A 5AVZB 5HVGB 3UBXI 2J71A 3ZL1A 3HAEG 3RIFK 3ULUC 4J4PC 1OLLA 4P2QE 5IHHA 1EJFA 3ARGC 5E1QA 2GSGA 4N8CH 1O7DE 3HG3A 1HKLH 3ABMB 3WFDL 5H37G 1IBZA 2VQTA 2QZQA 3HKZA 2OMBA 3VG9B 3A6BL 5EOQL 2C1OB 1KB5L 3RNQA 3ARDC 1A7BA 4CADA 2H2SC 2NMSA 3WMQA 1F4AA 2X89D 3GM8A 5I26A 2X2IA 1BG9A 2ZSWA 1W8EA 2DQIH 4L5FL 2OSXA 4MA1B 4YDZA 3CU1A 4F5CA 1QA9A 2NW2B 2A74A 2BHUA 1I8UA 3LNDA 3NCYS 4DH2A 3VO0A 1XF4B 4P2RA 1JZEA 1BQUA 1FO0L 4MNQD 2DWSA 4ZYKA 5I16B 2OULB 3NCFB 4PJ7E 2AHIA 1NANI 3BT2L 4K5NA 4H5SB 1AQHA 4ZUSB 3RKPA 1MDTA 4CC1A 2G3ZA 4GBXB 3GNML 4FKHA 1W16A 2ARJB 3D3VE 3OF6D 2GK2A 3FUEA 4LDEB 1NIAA 1P4BL 1PLAA 4P57B 1D5RA 3GMOB 3IKCA 3MRPA 2BVTA 5TH2B 4NQCD 5ANME 4HPYL 4NPYB 1YEGL 2VW7A 5BVPL 1KYDA 1E5UI 4CSZA 1EAPA 4FZEL 4DTGL 1BVOA 4JFEA 3DSNB 1C16B 4GI6A 5DDHB 3U0WL 2PABA 5DJ8A 3OKKB 3ECBB 3EJCA 2VQ1B 2WIIB 3AACA 3CSYA 1N3NB 3ZTJH 1KBVA 4OZFH 4P2QA 1HSBB 3RLSA 3BFWA 3HZMA 3MNZB 1GCYA 5DCCA 5FHBL 4XCYB 3T71A 3LEXB 4IKIA 2Q7YB 1TTUA 2WZPD 4MS8C 5IESL 4JPVH 5IQ9B 2XA8H 4DN4L 3MQIA 2WJ7A 1S6NA 5TF1L 4LSVH 5KG9A 3KBPA 4LIQE 4Z76A 1UM6L 4MD5B 5E6IC 3ESUF 1AGDA 4ZUVB 3FB8A 4NO5A 4RNRB 2DQMA 4DKEH 1BPVA 1D5XB 3C87A 3N06B 3LN5A 3O0LA 2P45B 4P04A 2K70A 4CVXA 2AW2A 4DUXA 1E9QB 1XGZA 3PJSB 2I9LB 5DEZA 2R2CA 1SEQH 2D4DA 2L7EA 3WIIL 2NUTA 3ZKMC 4ZFFB 1S9XA 4BRJA 5L9DL 3ISYA 4PJ7A 1HHJA 4X2UA 1E65A 5CLWA 2IV8A 4IBSA 1JHKH 1GIGL 1S4IA 2IFFL 5HHMD 1FUNA 1XMEB 3P4OB 3M86A 1KCUL 2OMWB 2OMVB 1V3LA 2HT2C 1UHVA 5CCKH 1HHIA 4I2XB 3SKNA 4U0RB 2V5MA 5E70A 3GRBA 1N5YH 1INQA 2AK1H 2X3AA 3A5VA 2Q8AH 3TN0B 3VFPB 4WW2B 2AZAA 3IMRA 5FM5M 1OO2A 5ACZA 3BISA 2JCCB 5K9OA 4M1DH 1CLYL 5E94A 1MPAH 2K9FB 2HJFA 1HINH 5EULV 4TUJA 3ULSB 4MYWB 3MRCB 4ZXBD 3MMEB 3FQNB 1A7NL 1NCGA 4XOAA 1I4FA 2RCSL 2VXVH 2YUXA 4F15B 1GKOA 1L9NA 4HK0B 3GI8L 4MHHI 1A7QH 3IPEA 1NGWA 4ZSOA 1OVZA 4I18B 4FL4B 2Z34A 4ATWA 3EYSL 4UBDD 2GEQA 1CDIA 1NAML 2YD8A 4ONHB 3B3IA 1RZJL 4Q7DA 3PWUB 5B3SB 2BIOA 3OLIA 3WFDH 5CJ8A 3MRHA 4AYMC 1UOKA 1HWHB 1C8PA 2YOAA 4Z7UB 4RX4A 5FYJE 1Q94B 2PWEA 3A6BH 4LKXA 3M17A 5EOQH 1KB5H 3HUJE 3DVGB 3U1SH 1J0YA 1IGML 2JWYA 1H6FA 3UZEA 2JJUA 4LEOB 2B8OT 2HLFD 1IILE 2NNAA 2VC2B 2VR9A 2XDHA 5J9PB 4L5FH 4XBMA 4HJ0C 3CC1A 3V0VB 2J1WA 4KHXL 4B3VA 5JXAL 1AGEA 1KYOJ 3O3AA 2EIBA 4WI0A 5LAXA 5EU4B 5E00A 1E4XL 2FSEA 4GXFA 1JBJA 1EWHA 1BEYL 5HJ3B 1FO0H 2XPZA 2MNWA 1WUNT 2A1WL 3AXLB 1HK6A 4J27A 1I8MB 3ML9A 2F7PA 2YRZA 2Z31C 2WINA 2DEYX 2IMNA 3BT2H 3F04A 4X80L 4MCYA 4CGUB 2AXGA 3IDJA 3L3HA 1U4EA 3W3BA 5L2JB 4OZIE 4NT6A 2YEZB 4DO6A 3HBZA 3NFPA 5DK0A 5DD1L 3ROOA 2UWEF 5AW0B 5C7ZA 2R1XA 1QLEL 1P4BH 3G6AB 4KWUA 4KDWA 3SCMB 3Q0HA 1TTFA 4Q97A 1D7BA 2ADGA 2BNRD 1YEGH 5T1LA 1FNEA 5CF3A 2V5YA 3F5WB 1REIA 3QRBA 2RACA 4JFHE 4YLQT 3TA3B 4KNUA 3CXFA 4FZEH 4XPAH 3ZKXB 3DMMC 4DTGH 1LJMA 2QPFA 4IU3B 1KYUA 2WIMA 1FP5A 3UOAB 1AS6A 5DZLA 2YAPA 5B7EA 1DBBH 4U1NB 1J8HD 4NBZB 4FQ1L 1RUQL 4K73A 3CFIC 5C9JA 2MNUA 2Y2YA 2Y36L 3BP7A 4WO4A 3LVTA 2UXTA 1ZPUA 4LOVA 4MQ7B 5AFAA 1DQIA 5C6PB 5FHBH 1QUNA 4ANUA 3WOVA 4P23A 5IIEB 2F54D 4YO0A 2K6ZA 1S7TA 2WXHA 4EOWL 5D1QB 2VQUA 1KEML 2ZSVA 1T5XB 4L1LA 4DN4H 2FH8A 3FH8A 4M6AA 4N0CD 2ZD0A 1EEQA 2XQYA 1BFOA 5CGBA 5TF1H 3BXNA 4ZD3L 3LPOA 3CXHJ 4BZ2H 1OTUC 1UM6H 43C9A 4GP8B 4AYSA 1GPOL 1MXDA 4E41E 4WUUE 3T77B 4C58B 3CGTA 1GOHA 1NFIB 3VXQA 1E5BA 5DGRA 4GIAA 2AVGA 4NFCA 1LEIA 1A6AA 4OW6A 5DMGD 3WIIH 2XVGA 1L9RA 1G1YA 2QV4A 2WLYA 1I53A 2K7QA 4IBQA 5D9SB 1GIGH 1FAIH 3WTUA 2IFFH 3BP6A 3K72A 3PAYA 3ULUE 4OZIA 3AY2A 1KCUH 4TYUA 1SXNA 5D93B 5T5FL 4UAOC 4F8NA 1XH3A 5B39B 3T65A 2XWBB 5I0WA 2KQNA 1UJ3C 4H8WC 2DEWX 2YPVA 2GTWA 3WN5A 5G5DB 5DU7A 3PJLA 5IQNA 2EE2A 1PCXA 3TNMB 1CLYH 1T4WA 1I1AB 4TF4A 2MQ3A 4B9IA 1MG2C 1HXYB 4RESB 4JKKA 4WWID 1A7NH 3I84A 4Z7QB 2F1AA 5KYYB 5I0DA 2RCSH 5FKPA 2B4CL 5CWSB 3PP4L 1PDKA 3HI1B 4PQXA 3NJXA 3HLAB 2R7EB 3KM1A 1KIPA 4QHKI 3GI9L 4DT2A 4ZMAT 4AQ8C 1M05B 1TVHB 5KANG 5JXEA 3EYSH 7CGTA 2CDGB 2ZNXA 1FGVL 1F18A 2E7BA 2ZCHL 2PWGA 3S4SA 1ANUA 5I1KL 1RZJH 3Q7JA 5D7HA 3RP1A 4M7JL 2IAMD 2OX5B 4CJ0A 1Q72H 3STZB 1I7UB 2BP8B 4JPWL 2LFGA 4L29B 4AKOA 2EXWD 5JPNA 4BWWA 1OHQA 3VFNA 4G1MA 1AH1A 1F1AA 1D9KD 2C34A 5F9WC 4E41A 3S96A 1IGMH 3UXFA 1GYAA 1MVYA 5BPPA 2I85A 2FO4B 1TNMA 4PR5A 3QI9C 2BC4A 5J3HD 2CHNA 2ZF8A 1DFXA 5T3ZL 3JV6A 1B2WL 3ARBC 5D7LD 3UL4A 4JDZA 5CBEB 2I7OA 4KHXH 1KT2A 1XGYH 4NQSB 3ZUNC 1S78D 2CBQA 2CUIA 3X2QB 3EBHA 4LB8A 4DAGL 1H0DB 5I5JA 1E4XH 3QIWD 5AAMA 3FCUB 1BEYH 4HGWB 4EUPA 3FU7A 3WGUB 2A1WH 3WFCL 4Y4HD 5I1EH 2FEEI 3OLDA 2SEBA 3QEGL 3B7UX 2FATL 3NDZE 4J4PA 1KNOA 2EEDA 4X80H 2VE6B 2P8PB 1FZJB 5AL8A 4DZ8B 4D94A 1U3ZA 5EN2B 2DYPB 2WXGA 3RWEB 4I48A 2ZT9C 4EKJA 3B9KD 5C7XL 7PCYA 2CNYA 3VD7A 4E0RB 5DD1H 1BOGB 3GIVA 4J3SA 1OPOA 5I66A 1QLEH 3VWKA 2GIYA 5DZNA 1M7IB 1UKSA 3PUUA 2EVIA 3FO2A 4LCCC 3NPSC 1RJYA 1X5YA 2IH3B 5C0RH 4XC1L 2KL6A 3WS6C 3QFJB 3G5YA 3JVFC 3RWIB 3UH8A 3KEDA 1HEZA 4HX1A 1AXTH 4LHJB 4RA0C 1UH2A 4HPOL 2VZ1A 1A3LL 4HIEB 3SYPA 4MCMA 5BRQA 1DLHA 4QO1B 5I9QC 3ECVA 4FQ1H 3AWFA 2QKSA 2ENQA 4EQ2A 2Y36H 3TCLA 3C60B 1CFBA 4OZGF 2FK9A 1GMEA 2EEXA 4K9JA 5IQMA 4LCUA 4DP2X 4EOWH 2KZ1B 3CBRA 4N2GA 3TVMC 1KEMH 5KN5A 2Z6FA 2A6DA 1KTLB 2ARWA 2D0HA 5SWQA 5IMKB 2FEDD 1P5UB 2BNQE 2HRPH 1NEUA 1MN4A 3RB7A 2RA1A 1HWWA 1GPOH 3MLZL 1MH5B 3TBWB 3W9DA 4IK7A 4LPWA 1KPUA 3GMQA 1AJ7L 3O2DH 2V5RA 5DHYB 4NUJA 2BY1A 5D2NB 4PMEA 1DQLL 1IFRA 3X1GA 3PGCB 1MFCH 3UYPA 2P44B 1ZT7B 4P06A 1J5HA 5IVXB 5GGTL 4QRTB 4QXTA 4XNUL 3TONA 1KYOK 2AS5M 5BVJA 5DMIL 1JN6B 5KYXB 3S3DB 1ID2A 4KRNA 5E9AA 1R5VA 1KJVA 5E6IA 4L8BA 3VFOB 1OP9A 2MTPA 3QJHB 1VESA 2PCYA 3MACL 2P5WE 3RGVD 1HYSC 5PCYA 3S48A 4YOKA 3SPVB 1DBML 5KSVB 4OD3H 2PCXA 4PIBA 4H1LA 3SB3A 3AUWB 2VXUL 3TNNA 4DO5A 2B4CH 4JHBA 3QZBA 3ARGB 4FYRA 3WEBA 1JERA 5ILTL 4OF5A 3HS8A 4XO8A 3GI9H 4PB9L 2MRYA 2R83A 3DTDA 3W39A 5HJBA 2E74C 1G7LB 1NMAH 2RJMA 3VXUD 5I1KH 3EH2A 2D8KA 3ZL4H 3MRKB 4M7JH 2ENYA 4Y5VC 3VI3E 2H32A 3QWOA 1DE4A 5DEGA 4JPWH 4RFOL 3V0IA 3VGBA 2NW3B 4PW4A 1N8OE 2J5LC 3QRGL 4AENB 2BNQA 4HMCA 3O2VL 1QSFE 2OMXB 4XCNA 3OVUB 2X88A 3ZR5A 1FYTA 1KFAL 4I5BB 4X6BA 2BVOA 2D03H 2Q3XA 5DTFB 4K23L 2A6IB 1P6FA 4J3VA 3UTZB 3E80A 1PKQE 1B2WH 4OFPA 1SYSA 2WOBA 3VFMB 5DYOB 4P5TD 2D0GA 1XR9B 3EYOB 4FI8A 4DAGH 4ZPVA 5IUSA 4X9GA 2BHFA 2Q76A 3UGXA 1MHHA 4A2GA 3LN9A 2W92A 2Y22A 4GOSA 1T0MB 3DGGB 5EHFA 3DYOA 1Q9KB 1XR8B 2FATH 1YNKL 1QTPA 4MMZB 3UTTB 1ZS8A 2E0PA 4G8GD 4AMXA 2F5AL 5I5MA 3SDDC 1QLRB 1RIUL 2DBLL 1EZSA 3CZGA 2P5WA 2HVJB 3SE3A 4U1JB 1HN1A 2K3TA 3UYRH 4HOMA 5C0JA 4X6CE 5BUGA 4AGOA 4HJSA 1A3ZA 3MO1A 1ET8A 3O8XD 5FEBA 1I75A 2V37A 3E6HB 3PRZA 1R5IB 3QVAA 1JS4A 3ARZA 5IR1A 5F44A 4YHNA 2XN9D 4MJHA 4HPOH 5IJVB 4PRHB 3NIGB 1GJIA 4HZAA 3UZQB 3ZT6A 1NCBH 2R4SH 3MDJA 4LRIA 4ZX4A 2Z31A 1GGTA 3VFWA 3L2MA 3RTQD 3S3JA 1RULL 3N50A 1CCZA 2NT0A 3QO0B 4BUHA 2B9BA 2BVPA 2XV2A 3NQIA 3VI3A 1HOCA 2Q3ZA 1CFVL 4M6ML 2GTZB 3V5DA 4M8VA 4LBAA 3SYAA 5T3XE 2FR4A 5GRWA 1QX1A 1QSFA 3HLKA 4LLYB 4QD2E 3VXMB 3T0ED 4LDCA 2AQRA 3Q1SL 5I17A 2VT0A 4WW2F 3KJ6L 3PLYA 4QGYA 3L81A 2QT6A 2J8UF 1Y6KR 1HSAA 4NFBA 2O61B 1WBXA 1PKQA 3EYQC 4I77L 4N26A 2XIIA 3MLZH 3LY6A 2GIMA 2QSQA 4A7VA 1V3MA 2A4ZA 3KWUA 2FT8A 1SF5A 1AJ7H 4GG8A 3SBWA 3GGWB 3HHSA 4WEBL 3SDYL 3ASWA 4L8SC 3QJOA 4XNXH 1DQLH 3MPCA 2ZX5A 2MOGA 2OXGA 4G5ZL 5I1GL 1OSZA 4HA1A 4G72B 2OR8A 3FQXA 3T2PA 5GGTH 4L37B 5ENWA 1R3IL 4F58L 1UT2A 1J88A 2ATPB 4XNUH 2Z35A 4L2YA 5DMIH 4S2SB 4AE1A 4WWPA 3K4AA 2CLRB 4P5MB 5CZKA 3E6FA 4I0PD 4ZQKB 1MUJB 2OL3A 3WE6B 2DB8A 1ZHLA 4RAVB 3MACH 4KJYA 5DD0L 3QHZL 4EDWL 1CE6A 2IFGA 3D39E 3MLSL 2AFNA 1DBMH 1KYAA 5SX4I 3VXOA 2YPLD 2WWOA 1DJHA 2FBOJ 3CHPA 4JN2B 3CIAA 4P5KB 5EFIA 3VFRA 2MIZA 4O5LL 3FH5A 1EANA 1W9XA 2G4EA 1KGJA 3T4AB 2VXUH 4YAQA 4ZQTA 4P48A 5CINL 4LVNC 1OK0A 5F89B 2PMZA 3TA4D 1TEGA 4PB9H 1XXFC 4N8VA 1H6EA 2BOCA 3GRWH 4Q89A 5B39G 5I1LB 4IBLT 4E68A 5JOFB 3WKNA 3ZKNC 5ABDE 4L4TD 1LK3L 4F7PA 1KBBA 3FQTB 3HZKB 3PQYB 5CS7A 4AYID 1UJ3A 4PH8A 1DQML 4LMQE 3RWFA 2PNDA 3QRGH 2JKIS 4QJ4B 2GK0A 3WTWA 3O2VH 5IOPB 3QORD 1KFAH 4YDJA 4KVNL 1QPKA 1Z9NA 4NNPL 4GAAA 4M4RA 3FO1B 4B9GA 2ZWNA 3L3KB 5LQBL 4P4KD 1P7KB 2YKKA 3DA0A 2D4FA 3QYCA 5JUEL 2X9WA 3IJSB 1VEOA 1AKJB 2CO2A 4M00A 4R84A 3QQ3B 4AQ8A 2C3GA 4RZCA 3EJZC 12E8L 2ZX7A 2AQ1A 4IS6B 5EA0L 2WXOA 1ULVA 4P3DA 5FM4A 5EU5B 1YNKH 1E2VA 1GOFA 2XPYA 3FSVA 3QYMA 5D96C 4KXAA 3CMGA 4RGMC 3PFUA 5DQDH 1UT1A 2VN7A 2XZQH 3ES6A 1A6WL 1OGTB 1DVTA 1SOQA 2DBLH 3IVKA 4OR1A 5IB1B 5C0AD 5GISH 3D39A 1XCQB 2PLTA 2WBJD 1B4TA 1PAZA 4LHUD 2CBTA 3DNKA 2VNCA 5FYJL 1HL9A 1N64L 3UADA 4WQOA 3L2LA 1U8JA 2YD6A 4F3FA 3ECWA 4PJFB 4R2GB 4BFNA 4PJ8C 1JGDA 4DUWA 1KGUA 3RL1A 2WVVA 5T1DL 3DTXB 3P02A 2XVBA 4ISVB 4KPHL 4GP5B 5C0CE 2E5EA 4ZDHB 3US0A 1AR1B 5LN8A 4KKLC 1CFVH 1X5AA 2ALAA 3QUMA 4M6MH 1DVZA 4CNIA 5D1XE 5DHEA 1CFQA 2P8LB 1U2HA 4IOSD 5JOPD 2R2EB 4QAWA 4Y19B 4C4UA 5GGSA 3MLTA 4NNYB 5DJZB 5I24A 1UA6L 2OLDA 2X28A 3KJ6H 1T7YA 1ID5I 4OKVB 1J1OL 3QFDA 2VISB 1W6LA 5CD5C 2D31A 1RK1A 2FQFA 2JKWA 4I77H 4D0CA 1LE9B 3GFUA 1A8ZA 2H5UA 3KPOA 4IRJD 5ID1B 4Z7QF 4PJBF 3SDYH 4WEBH 2P80D 3REWB 1CMOA 1T1YA 1NDMB 4U7KA 5EORL 2VERA 5I1GH 4G5ZH 2Q20A 3WL9B 2ED6A 4A7SA 2NQCA 2B1HL 3CFTA 4OF8A 2H6PB 5C0DB 3QQNA 4F8TA 4F58H 3BQUD 1RIHH 4Z7OE 5EEZA 8PAZA 1DVQA 8CGTA 4OZFB 3C8KB 2AI0L 6TAAA 3ARFC 3KPLB 3TVMA 1FFOB 3S35L 4U1MA 3U2JA 1F6AA 3TYFA 1U8MB 2EXYD 3MHZA 2WHVA 3JWNC 4KOBA 3LH2L 2BSSA 4L3EB 5DD0H 4GMSL 4EDWH 2W88A 3BPCB 5HDBB 5HYQB 1J9TA 5GSVB 4BFKA 2W81C 3IMVA 1BVKB 3OPZL 4GO6B 4LIQH 4E36A 1LO2L 2X3CA 2XICA 3CSFA 3DK0A 2X4OA 4MWFA 4QF1A 5H94A 5F88B 1HL8A 3F12B 4JM2D 3MRMB 3BKYL 4O5LH 4R6UA 2C3WA 1PD0A 3IETA 2NCMA 5ID0B 5JYMA 3AT8A 1DO5A 3FC8A 3O4LE 4P05A 5CINH 1T21B 5HY9A 5J12C 3GSXB 3FOLB 5C0CA 1PW3A 4YSDA 5AOLA 2R27A 1E7UA 4L8CA 3ULVE 3APNA 4B97A 3ZQWA 5GRVK 1BSIA 2PPAA 3W81A 5D1XA 1JZ5A 4HSQA 3WBDA 3L08A 3CZLA 3MCLL 4HQQH 3KYOB 2VN5A 1LK3H 5D7JD 3F3HA 1ND0B 4AEHL 1T4KB 1NEPA 3QCUL 3ARBB 1AZRA 5FUOL 3ULUL 1S7SB 1MKFA 4LCWD 4OUUB 3DRTA 3IE4A 3K80A 2DL9A 5IGXL 4KVNH 4X6FA 3DXAB 4NNPH 5AKTA 2DM3A 3BVNA 3FQ4A 5CJXC 3ZE1E 3OKLA 5IZ7A 5LQBH 4XPHL 1G9EA 3UIYA 4A7TA 3HS0C 5T1KB 3RNKB 5MEOA 3PDOA 1TZHA 3BUTA 5FGCB 1J7VR 4F7MA 3AQYA 4U1KA 4PJIE 4FLSA 5F6IC 4NZJA 4PLJC 3WJMA 12E8H 3K2IA 3B8YA 1KPVB 3Q43A 3FL7A 1B0RB 3NYKA 5EA0H 1RZGA 5K9QG 2HN7B 2WO4A 5LDSA 4Y5VA 3PXJA 2WXNA 1HQRA 5TK4A 1L9SA 4IMLB 1FL5A 5K1JA 1A6WH 4M8QB 3AS2A 4PJEF 4RBPK 1JZ3A 3BRDA 3C8HA 1EQWA 1SUJA 1IC1A 4Z18A 1PLBA 1JPGA 2MFNA 1XT5A 1JNLL 4G7YL 5JDJA 1CDGA 5FYJH 4ZPTA 4G6KL 3I6SA 1N64H 3KDMA 5JQ6L 4PY8J 3F6IA 5I9QB 3T0VA 5I5RA 4JO5A 5IM7A 1NGYB 3O4LA 1A21A 4GRWE 3I9AA 3TH2T 4OVVA 4B53A 4QJ5B 1W0WA 3AADB 2FJGB 3QT2A 4ZS6D 3HE6C 3VD0A 2DH3A 4JFVA 4LDOB 4MD4B 1AD0B 2VLRB 4AITA 5T1DH 3D0VB 4JR9L 3TZVB 4KPHH 1WGVA 4BKSC 3L5WB 5IBTL 3TU6A 2YD9A 1S9YA 4QJ3B 1TZ8A 2W65A 5JYLA 3QJRB 3SDDA 1UUNA 3KLAA 4AMKL 2OP4L 5A2LH 3T1FB 4JREB 1LMKA 5IK3B 5BO0D 1VHPA 3ZUCA 5KZCD 5ECJE 4FNPA 1UA6H 1FCGA 3BX7C 2A6KA 3O6FD 1J1OH 4KRLB 3Q6FB 2RFXA 2IAAC 3OTTA 3LS4L 4RMTA 5DJCB 1YMME 4OUOA 1WBYA 3GZPA 2NZ9C 4LMQI 5DSCA 2OKMA 2G5UA 2YPVH 3CDZB 4I85A 4PJIA 3NH7L 5E6ZA 5EU7E 3N3EA 5AW1B 3WY4A 1E8XA 5IKCA 2IH9A 4AYFB 4MLIA 1W8NA 3WJLC 1GW6A 3ZYJA 1KWGA 5I2IB 3A3YB 5A16B 2CE6A 3JXAA 1XIWD 4BH8A 2EVFA 1YUHB 2VMFA 3M6DA 4APXA 4A2MA 3C6SA 5IY5B 1WEJL 3MCKA 1JVLA 1WWBX 3LNIA 2WKLA 3S35H 2MHAA 4O2FB 5JPMB 4ANWA 4YC2C 1TT6A 3I02B 3LEYL 1PD1A 4JFPA 1T04A 3H0TA 3K6SA 4KQ4H 3LH2H 1XB6A 1HWGB 3IU4L 4GMSH 4TQEL 4MJ6A 2PCFB 5ACMA 1QBML 1T0OA 1T6VN 1YDPB 3OPZH 4UMSA 3EFFA 1LO2H 1KXTB 4L8SA 2IPKA 3VRJB 4HLZH 1JF6A 4W9CC 3G5ZA 3ZDZE 3II3A 1XF5B 3FCSB 3ZHFA 2R69H 1XCTB 4N2OA 4BIKA 2NUPA 3E0GA 2DD8L 4K15A 2FQEA 4RCAA 2ICWI 4LGSB 1F3JA 1A2YB 1GR7A 1S7XA 3ZKQD 1IRAY 3D33A 3HBQA 4AOFA 2XOTA 4CC4C 1ZHKB 4LE8A 1NQBA 3TJHC 2ATKB 3MCLH 2YAFA 4KBPA 1I8LC 1NDGB 4EUPH 4AEHH 3FZUD 1U36A 4BFOA 4F92B 3QCUH 4GEIA 3BZEA 2FX7L 2DWTA 1IJNA 3ALPA 2WZ5A 3LKSA 4PJAB 5FUOH 4X6EB 3SIKA 3ULUH 4O58L 3IM1A 3SQRA 2JQMA 4XMKL 4CVUA 2R51A 2VN3A 3VXRD 5IGXH 5J7CC 4OZHE 4OZ4A 3MRQB 4M03A 1M6OB 4MJIE 4NKMB 5IJKC 4JE0A 2VLME 1XF1A 4JDVB 4KK9C 1AQDB 5D7IE 2JJSC 1QW9A 2OAAA 4MCZA 2A3TA 5JHDD 3N1QC 5CEZD 1ZLWH 5E95B 2Q1EA 3P4NA 2VDQB 3OXSB 4N2CA 1J9QA 1I7ZA 4EI6B 3RA7L 3MV8A 5IB4B 4JCMA 2DJSA 4G7RB 3WNPA 1D5IL 1M9WA 5TE4L 5LLIC 1WO2A 4UIKL 4XP9L 1XGQB 3SBRA 4NUGL 4NHCL 1A65A 1RU9L 2C26A 4LQ1A 1FE8L 2DDQL 1S7VA 5AW2B 3UJIH 4MRCA 3I6GA 3Q2NA 1UB6A 3IFOB 1NCUA 3GD1C 1JNLH 4G7YH 4N5EC 5H2BA 2Z7YA 3IDGB 4Z7VB 4ZOAA 4O4YL 4G6KH 3W0WE 4ABUA 2P5EB 2NX5E 1WD8A 5JQ6H 3CCHA 1NGPH 1U93A 2ZYRA 3F6LA 1BP3B 3IFPB 3P40A 1FVEB 3BPOC 1O6SA 1MIEH 2F53D 1SMDA 1S9VB 4FC3E 4XBPA 3SJVE 3QUYA 4U1GC 5L0QC 5F9AC 1IKOP 2VM4A 4JR9H 1E27B 1Q8MA 2PYEB 5LNEA 4X9IA 5BQ7A 1GC1C 1UXSB 5AVSB 4IRSD 3WFHB 1BD2B 1DQVA 4G1EB 4QOKB 4I3RL 4XNQB 4AMKH 1OD9A 1XZ0B 5JMOC 3RVTC 2OP4H 5IMMA 1GL4B 3QYNA 3QPQC 3V4VB 5AG8A 3IBEA 4OZHA 4X6DB 3APFA 3JWNE 2L7UA 4PY7A 1YEKH 4MJIA 1I1YB 3LIZA 3VA2C 2GT9A 3S88L 1QLEB 1OAJA 2AJZA 2Y07L 4K71B 5D7IA 2G3MA 3HG1D 1HE8A 1IQDA 4M1GL 4PJ8A 2OL3L 3RVUD 3NH7H 1VFBB 3K6IA 1MHEB 1QTYT 2IIJA 3WJJA 3GMNB 5F7FA 3EBIA 3K81A 3OC5A 3L1EA 1CG9B 3OMAB 3AC0A 4J3OH 2P7TA 4GP4B 3V8OA 2UYLA 2TRHA 4H1LH 4BZ1A 5IB3A 3FTGA 2DICA 4MQXD 2AV1B 1WEJH 2NY2B 3W11D 1U2YA 4UQ2A 4YH6A 2YD4A 2CKNA 2DWDB 3T6WA 4UOJA 3JWOC 1Q9WB 4XP1H 2ZYSA 1P1VA 5TK2A 1IE5A 1P7QB 5B1BB 1OQXA 3LEYH 3EHBB 4YBLC 4JHAL 3LRMA 5C09D 4CSSA 3MBWB 1QFWL 1TUPA 2NX5A 1T7ZA 4TQEH 5IG7B 1MJJA 4M9PA 2VXTL 2NYKA 2H32H 2Q7AA 1QBMH 1K3IA 4XCEB 5JMRA 4RVBA 4K9EC 5EZLB 3C6LA 3OWRA 3SJVA 4UV7L 3CFCL 4W9GC 4X83A 2X3BA 1UA3A 1KIRB 9PCYA 5JNYA 2DD8H 2WQUA 3ZTJG 1ZY9A 3T3PB 5EO9A 4OZFG 3UBXB 5DUJA 4MBOA 3OKNA 4DSYA 1T22A 1GYVA 3RE0A 4OSUL 4KOCA 3LVEA 3OXRA 5AOJA 2FHBA 1IEAA 1SEBB 2P48B 1VGEL 2E9IA 2ERJC 1R3JB 2YD2A 4LU5L 1KN4H 5F7YC 5AVYB 3VD2A 3U79A 2VXSL 2NY3D 3AU1A 2X1PA 3KLHC 1PZUB 3QULB 2HJLA 2N4IA 5KS9A 4XMKH 1KBKA 4XNMB 2VAJA 5DJXB 5K9KB 1L6XA 1OCZB 5F7UA 1I1RA 4UMGA 1VACA 1KELL 2LU4A 3KE0A 4I88A 2B1AL 3G6JE 5GS2D 3NK3A 1GTFA 1TZIB 3FRUA 4RGMB 5ES4B 8FABB 1K4CA 3KR3L 1FG2B 5EU6B 3CVIL 1CPUA 3HI6H 1H19A 4G11A 1R3LA 4WEMB 3X12B 2ALWA 2B08A 2WW8A 3NTCH 4GBXD 5C07E 5ITBL 5EZJA 4A38A 3BD4A 4BSVA 3RA7H 3TA3A 3VTTA 3IXTB 2ADYA 2F7OA 4BSWB 1OGAB 5TE4H 4UIKH 4XP9H 2ESVA 2R2HB 4NUGH 1RU9H 2WOYA 3MSPA 1FE8H 2DDQH 2ICEC 2UY7A 4K3JL 3M1OA 4JFZL 4Y89A 1T6WA 3ILPB 3CSPA 5DMJB 3QUML 2E46A 1F00I 3FFOA 3TBTA 3GTVA 4XZUB 3HS0A 1NUDA 3K6NA 4O4YH 4L4VE 2J88H 3SYCA 4UOW1 1HVXA 1U41A 4OM0H 4HPHA 1HCFX 4ZAKB 1ZK9A 3Q5TA 3P9MA 5FECA 5I1AA 2OTWB 4LOUC 2MCPL 2ED7A 2KZBA 2ZOLB 4OFKA 3LZRA 3SDCA 4XT1C 4Z5RB 4Q9QH 3KL0A 2O6DA 1J0JA 3HNTH 3V6ZA 2QMKA 1B4LA 1OWRM 3NGBB 2CIKB 5KSBB 4UTAH 2VZUA 3Q8AA 3IJYA 5C0NC 4MFHA 3W0WA 5B38B 4X4XA 5DT1L 5HPOA 1BZ9B 4ZK8A 1A3QA 5I8KL 2KS0A 1WWWX 4A6YB 4KDVA 1CGSL 4WK0B 4OGZA 3GKWL 4JGNA 2XETA 1NGZA 2JKLA 2VDRL 5BS0E 3CDGB 1DJSA 3GLDA 2DQUH 5FHAL 3UC2A 5C3IA 3S88H 3NPZB 1Z5YD 1HI6B 2Y07H 5DJ6B 3WIFB 4JAMA 4GB9A 4XC3H 3QNZB 4OLXH 3G6JA 3S3PA 3DX8A 3F65A 1OXYA 3NRFA 4M1GH 5CGTA 1UZ8A 3DROA 5E9NA 1ZE3C 4GPVA 4XX1G 4D8PA 4LVHB 3D69B 3VFTB 1G7QB 5E1HB 4G8IA 3ARFB 1LP9E 2XNAA 5C07A 3UPAA 2Y1YA 3ZOAA 3H3PL 5I1HL 1QLFA 4BDVB 3CHXA 4TLUA 3QGVA 4XZ4A 2ITCB 1OM3L 1JWUA 3WXWL 2QQNH 3UEQA 5ERWA 3TN0D 1Q9LB 2NY4C 2HTKD 1Q0EA 1LYQA 2Y6TE 3T8XA 1NPJA 1LO5A 2JF1A 1TJGL 2D3NA 3KH4A 5T3XH 1WCQA 3HBPA 3QISA 4Y2DA 4XN2A 4D9QE 1QFWH 1MCPH 4HIJA 3UAJA 1TEFA 3K3QA 3EJYC 3PWPA 4QRSA 3UG4A 2EDXA 2Y7QA 3WY1A 3CFKB 1MLCB 3VD5A 1ZLVK 2YD0A 2CSPA 1MF2L 3VGAB 2G5RA 4E5XA 5KAQF 3WJLA 5DVPA 4UV7H 4HJGB 2X4QB 2O5NA 2AJUL 1KLGA 3TO2A 3BFQG 1RJLA 4P5SA 4X9BA 2FQDA 5JHLA 1L0XA 3SDAC 2YD3A 5EB9A 4Z7WB 3VG0L 4DIXA 1QYGL 5KSAC 2IBZY 1E7VA 4HISA 4XO4A 2GAZB 4UQBA 3LB6C 2F74A 1MSPA 1LM8V 1VGEH 3FTVA 1H15A 4LU5H 4UTCA 3CZFB 3TIDB 4Z3EA 2VXSH 4MAZA 5BS0A 1VA9A 3AY4A 4LLWB 5AKVA 2QQLH 1PY0A 5CGYC 4V1DD 3L95B 2WXIA 1JFQL 3WO3B 1QATA 2VMEA 3AAZA 2K6WA 2NY0C 3G5VB 5FWQA 1C5CL 3A4EA 4ODSL 2B1AH 5A2AA 4C56B 3TS8A 1CDUA 1LP9A 3HI5L 4NN7C 1AGFA 1GAFL 5HGHB 2Q5BA 3H8NA 3KR3H 1RFDL 3CVIH 4CC4A 2G60L 1P4UA 5FW8A 4ORGB 4IOFD 4NS0A 1GZQA 5ITBH 3KPQB 1DJZA 4W9LC 3TC9A 2UUDK 3QXAA 3H7BB 3ROLB 2B5IC 4DKAA 3ULVL 1AI1L 1Q38A 4RGND 1IC4L 4RGOL 1G84A 3CH1B 4L48A 2X2HA 4WHYG 3SCMD 1YEIH 4OBSA 5F72S 2N7BA 4P2RB 4Y9BA 4JFDE 5B1AB 5BW7C 4K3JH 4ZYKB 3UMTA 4JFZH 1MVUA 1YEDB 4Q8BA 3TA3D 3ESOA 5IJKA 3HE6B 5IMLA 2NSMA 4FXLA 3LKPA 2XKUA 2VQ4A 1JWSA 1TDQA 1JUFA 5DHVA 3QDJD 1FZKA 2V7HA 2JJSA 4PRBB 3ZKSD 2HTLC 4WK2B 3F7RA 5IHZB 5KUKA 3O45A 4S1RL 1W91A 4JFFA 5G55A 1G5GA 1HCYA 2IH1B 2M83A 4PUBH 1TFHA 4BINA 3IKCB 4F9LC 3ZE2F 4HG4J 2E9BA 4AIZA 4K2UL 5DUBA 2WKOF 2QR0B 5D1QD 1ZKAA 2ZOKA 5SWSB 3RVWD 3VYOA 1TLKA 1EAPB 4JFEB 4LOFA 2EYRA 4HKXA 4ETYA 1CGSH 3GKWH 3V5HA 4YSAA 1XF3B 3T6QC 1A14L 4MLSA 4QHUA 3KGUA 3QQ4B 1JJUA 4P2QB 5EUKA 4DCQB 5J6HA 5FHAH 1JV5B 3GLAA 1PX8A 2FSDA 3P4MA 3OR7B 1WZ1H 3N6YA 2HLAA 4X7EC 5TDPB 1JZFA 2VGLM 1B3JA 4OGAC 1NEZB 2ZE0A 3LZQA 4ZMXA 2EIZB 5IVZA 4AIEA 1AXSB 4HU2A 1MLBA 1H9VA 2ISDA 4RX4D 1WH0A 4RMQA 3H3PH 5I1HH 1CFMA 3A4FA 4YC2B 4V2CB 4TQPA 4NO5B 1OM3H 3C08L 3LXAA 1YC8A 1IC0A 3WXWH 1FNSH 2OMTA 2I60L 4QCIA 1BWMA 1N0XL 4XTRC 3IXAB 4EJ1C 2GITA 1SLUA 2IJ0C 3LRSB 3MJ8A 3UYOD 3IAGC 1I1AD 5T8IA 4DHLA 3QEQD 5E5MB 2J72A 1W72A 1HHJB 1TJGH 1WC7A 3NCYP 4L3CB 2F19L 3GHEL 3BGMB 4HCFA 5CSZB 4YJZL 1UWXH 4M48L 1OF0A 5D1ZA 5EO0A 4YDKH 4OIBA 3GMMB 1DHKA 2I9TB 1EHKB 1Z2KA 3C09C 4HWZA 3G04B 5C86A 3D3VB 2O26U 1LLAA 1MF2H 1V8HA 2IBGA