3SZ6A

Isdx1, an anthrax hemophore
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
TKLADGKYNIAFTVWKGDKDESSRMNRYFESPATLTVKNGKQYVSFKVKDSTSIKSFQVEKDGQFVETTVLSENKKDNTRVVEFEVADLSKKLNGKVKINIPIINYNASYDIRFVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved domain protein
publication title Differential function of lip residues in the mechanism and biology of an anthrax hemophore.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Heme-binding protein
total genus 24
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3sz6A00
5D1QE 3SZKC 3QZMA 2MOQA 3SIKA 3QUHA 3QZNA 2Z6FA 4H8PA 3QZOA 3RTLA 4FC3E 3VUAA 2O1AA 2H3KA 4YMPA 3SZ6A 5D1XE 4NLAA 3RURA 2Q7AA 3QZPA 4WJG3 3QUGA 5D1ZI 3VTMA 2E7DA 2ITFA 2O6PA 2K78A 3QZLA 3S48A 2ITEA 3OVUB 4H8QA 4MYPA
chains in the Genus database with same CATH superfamily
2YD4A 1MXGA 1NCDH 4P46C 3KBHE 1Z9PA 1FYTB 2CAKA 2GABA 3KLDA 5IIEB 3IXTA 3WLBB 1OD7A 5IUCA 2ADGA 1CFQA 2JCWA 3UBXI 4ORZC 3V0VB 3FPYA 1ZV2A 1LQBC 3LV3B 1GA2A 1WAPA 3SE9L 2D3NA 3QQXA 1RURL 4XMPL 2X9ZA 4WRLA 5DR5L 2FE0A 5AOLA 5FYJD 1DEEA 3SDXA 4HJUA 4EJ1C 5T1LB 3FT3B 4N20A 1VEPA 1ZRUA 1TPXC 4UYPA 1NMAL 1ZGLM 1FFRA 3FCTA 4YZFE 2BP0B 3MCYA 4NO0B 4Q9QH 5EO0B 1QX1A 2MRYA 1WWBX 4BK8A 1X44A 2GK2A 2HRGA 5KANI 2YQGA 4A55A 4KJWD 2PNDA 2WQXA 2BOCA 2EIBA 4UNTA 5AL8A 2F18A 4LSPH 1LXMA 2R2CA 3ZE0E 4AK2A 4MMZA 3ARFB 3MOBL 4AL8H 2RB8A 3UL4A 4BCXA 1OTSD 2VRQA 3MNDA 3SBQA 2AMGA 2Z93B 3AJ7A 1OK8A 3NBNA 1ZHKA 1HHGB 4X50A 5C6TH 5C2UB 3QXTA 1C1EH 1H5BB 5ADOH 3ORJA 4LVEA 1AYOA 4NQDA 1HHJB 4XBPA 3VRJB 4F9LC 4OSUL 4KGJA 5AVVB 1UGKA 5G4NA 1B3JA 1Q1JL 3DV4A 2MFNA 1G7MB 1MFMA 4JZOA 3GJFB 1V7NL 2H0EA 3RWDA 5IGXH 5IHZA 1D7BA 1NCDL 4XXWA 3KPLA 1QTSA 4YSAA 5GHWL 3IMUA 3Q7JA 5HYJD 5JW5A 1QLFA 3IMSA 5T3XH 1CF1A 2WXFA 2B8OT 2D3VA 3VD9A 1N68A 3OKLB 3QDMD 3L9EA 1R5VA 3II2A 4DEWA 1LDSA 5D93B 4LHUA 1TO5A 4OLWH 3T3MF 3V6FA 1W8NA 3OR6A 2J8UE 2K8MA 3QIBC 5CEYA 5M95B 4P46A 2XIIA 2CJ3A 3KNBB 5KSVA 4Q9CA 3PHAA 2R83A 4GKZA 4KQ4L 1I4FA 3SDAD 1ORQB 1MREH 1KENH 1ZK9A 2Y69B 3V0DA 4FQXA 4FG0A 4PGEB 5DS8A 5E1GA 4P2QD 1NPJA 1QPKA 2JCCA 4Q9QL 4X4XB 1E0OB 3KL5A 4QLWA 1S3KH 3KLQA 5C9JA 2Z6FA 4GUCA 4XX5A 4RGOH 4OI7A 4JREC 2E8ZA 4YK4C 2EDXA 3CH8A 4Z7QF 1ZKAA 4KKCD 3SO5A 1Q9WB 4WTZA 2C9RA 1UFUA 4APXB 4PJ5D 4JQIH 2FHBA 3PP4H 5EU6E 3F62A 4PSPA 3IFPB 3MRPB 4P9HC 3MFGB 2PWEA 4L0PB 1XF4B 4YSTA 1KYAA 3TTSA 5C6TL 1AI1H 3RWIB 3Q6FB 2WGXA 4F7KA 3VCLB 5DLLA 1C1EL 35C8H 3ARGD 1MI5E 1MJUH 2FB4H 5GZOD 1A7PH 3VXUA 1T7XA 1UA7A 1Z7JA 2GB2A 2Y36H 4FCHA 2Z7YA 4N0UE 2A7BA 4XNYH 2WWMC 3NABL 4YWGH 1TTUA 4R7LA 5I23A 2IH3A 2F7RA 4GQ9H 3JV4B 3ISWA 3VWJC 2DJUA 3L3DB 2AJSH 5T3XL 2XBZA 3GK8H 3OAZK 1P4BL 1LNUA 4OGAD 4F9LA 2HN7A 3WN5B 6CGTA 5IJBC 1GYVA 1TQVA 1ZK5A 2CK0H 1RIVH 1KC5H 3KH3A 4MJHA 2VC2H 2P49B 5KSBA 3BAXA 3L45A 3FRUB 1DDTA 2OULB 4OLWL 4UQIM 3GUTA 4BRJA 3F7QA 1RHFA 3ECWA 1I85A 2F7OA 3I3BA 5EBGA 2QADC 3K8LA 4NIYE 2WZPD 1SVBA 2QPSA 3AY4A 3CQFA 4L1TA 1M05B 4BWTA 1MREL 1E8XA 2NTFA 3LKNB 3QEGL 4AUUA 2I07A 4IIQC 4PJDB 2X28A 4LDOB 4MQTB 4P2RD 4RRPG 3QWOB 4YLCA 3X2QB 4PLJC 4CDHA 2VDLB 3OKKB 2LTQB 3LRSA 4X0KB 5IVOA 3WMSA 2FJFA 5KVFH 2G5BB 1L5GB 5FFLA 3KPNB 4ZO8A 3S9DB 4MXVF 2F68X 5CP7B 2YQ2A 3JQOB 1XX9C 5F7LB 2PN5A 2ODHA 3CBKB 3CUPB 5EFIB 4BH7B 4FXTA 4V1DA 1T4WA 3O0RH 4L4TD 3FFDA 5I17B 4TQEL 3SDYH 1C5BH 3QUHA 3X17A 1E4WH 5IMOB 1O7DE 1I9JH 2OMBA 2YSSB 4R0LC 2QLYA 3DOSB 3PP4L 1NC4D 1UATA 1AKJB 2XWDA 3QJFB 4MX7B 2XRAL 1AI1L 4N4YB 2CG9X 4W68A 5C0BB 4PUBH 3WIHH 3R4RA 1E9PB 4JFZH 4NUPA 1S9YB 4P5MB 35C8L 1DQQA 1CL7L 1MJUL 5EZJA 4QXTB 5FO8B 4FKHA 2FB4L 1A7PL 4DW2L 3EDJA 2GEQA 3KYAA 2Z34A 2JI1A 4RISH 2Y36L 2PW2B 5D2LB 4AYFA 1X4XA 1DCEA 2I9LA 4YWGL 1CMOA 3F7PC 3FN3A 1BZ7B 4GQ9L 4OLXL 4JHAH 3QUKB 5L2KE 1PKQB 5HDWA 2XG4B 2EUWA 4BZ1A 2AJSL 4R97B 4TTDD 1A3RH 4R7DA 3MRRB 4OBSA 2QVKA 3V9EA 4HLZG 3AXLA 2I9TA 5EA0L 1OCWL 3OKEB 4PJHE 1J5HA 2I60H 3MLVL 4Z77B 2CK0L 1KC5L 4RMRA 2VC2L 3WY2A 1FAIH 1EJ6A 1DUZB 4DVBB 3PGDA 5J0BA 1L3NA 3CHRA 2JB5H 4NPKA 4Z18A 2PXYD 3MV9B 1CGUA 5E8PA 3VWJA 3ME0B 5CNHA 1JPGA 1F4YL 1A5FH 4QYAA 2CLRB 2CLVB 4FFZH 2OCCB 3VSTA 4JKPH 1P5VB 5FA3B 2ODIA 5E08L 1SYVA 4U1HB 3RDJA 1HAUA 1U8HA 1IAII 3H7BA 3GJEB 5EEUA 4KRLB 1R3IH 1NGZB 3S37H 2H1PH 4TNEA 1R5WA 1PX4A 4DZ8A 1WWAX 3QAZC 2FRGP 3WY3A 1ZMYA 4NYLB 1X5MA 1H8OA 5LQBH 3NYKA 2JKTM 1HNGA 1UXLA 3O0RL 2MKWA 4LOUD 1KLFA 4N1CA 5DHDA 5MERB 3SGKC 1ZS2A 3L17A 3SDYL 2BXYA 4KHTH 3BOVA 4RGNE 4IIQA 4X6BA 3V7MA 1YMME 4QWWC 1ZLDA 4IU3A 3GFUA 3A47A 5FAAA 3ULUF 3SZKC 4ZFGL 3VM7A 5EORH 3B3IA 1P7BA 4JFZL 2Q76A 3WIHL 1XAUA 2BH0A 3LRMA 3TO4B 1NCBH 2ZZUT 1L9MA 2RBLA 4RISL 4AX3A 2C9PA 3RVXC 4A7SA 1AXIB 1PW3A 5D1ZC 4X6DB 1IEBA 1SEBB 4R0LA 2X3AA 4GW5B 4JHAL 4G9FD 4LSQL 4U6XB 2YA1A 3UAEA 3MZGB 1CD8A 3CDGB 2XV3A 3NSJA 5AVZB 4HVBA 3FB7B 2AMUA 3KJ4C 4PRDB 4KHXL 3V7AG 1I7TA 5CKGA 5DJXA 3T1FB 2JQZA 5CEXA 3LXUX 4NQCD 2WZ0A 1CYWA 1FAIL 2Y06L 3WL9B 4IJTA 3BQUB 5IVXF 4QXUH 4ZMWA 2JB5L 4A66A 2IPUG 3EW3B 5JMOC 1EEZA 3P4NB 3PL6B 3TF7C 1J05A 4FQIH 4NQVA 4PBVC 3GSRB 4G9DB 4W1TA 4J4PD 3RI5F 3V79C 1A5FL 1AQHA 1FVEA 4F58H 1XD1A 3FFCE 1Q72H 2PW1A 4FFZL 4QAWA 4JKPL 3GRWA 4D0BB 3Q9QA 1NLBH 5GGSA 3SPCA 1WA2X 3ZYIA 3LSOB 3K4DA 1R3IL 4BQ8A 3FOMA 3S37L 3W82A 4MYWB 3VQ1C 3MVSA 4AIZB 4EOWL 1DJZA 1AACA 3DURB 1C16B 3LJ3A 1ACXA 4AEFA 3H9SE 5H4YA 1JWMB 3L3KB 4PJ7A 1ZVNA 3WEMA 2PTTA 4KHTL 2YXWA 5LGKA 3LXAA 5DMKA 4M5ZH 1MXDA 1DJGA 3HE6D 1JZDC 1VADA 3C6LA 3NA9L 5JOFA 4KJWC 5EU3B 4QRTB 5CSZA 3LZOA 5CHNB 1K5WA 3M17B 3DX1A 1B0IA 4W9JC 3H9YA 5D2NE 1OTSC 2VE6A 3SGKA 4F7CA 4MJJA 3FT9A 4X99A 5MHSD 5J11B 1QTYT 1U4EA 4Y2OA 5GS2D 1PX3A 1FO0A 1KNOA 1CGTA 4YOKA 4YDKH 2GCYA 5C0CE 3T4AB 5D7KD 3CH1B 4XCNB 5C3LD 1Z9MA 2OMUA 3A22A 1UG9A 1GZPA 3MROA 2FBJH 2Z92B 4A67A 1MVUA 2H6OA 3H7LA 3GSNH 4U1IA 1QNIA 2VZVA 2X41A 5D1ZA 2WLYA 3I75A 3EJCA 4LKXA 1BYPA 3VFNB 5J6GB 1A22B 4I48B 1OGPA 4MCMA 3NEEA 4LESA 4EI5B 4MASA 1LEIB 4F58L 1J8SA 4NKDA 4WI0A 3L7FA 3KPRB 3I9PA 3GZPA 4LLUB 5DK2A 1QPPA 3B9KA 3MRHB 4KKQA 1WWWX 3SKMA 1V27A 4KRPB 3AADB 3MJGX 5BVPH 3TXAA 1EIBA 2KLRA 1ES0A 2D0FA 2Z3FA 1TFHA 3Q0HA 4XMZA 4R4FH 3NP4A 4YHPB 4Y16C 2UXTA 4E2OA 1D5RA 2R1XA 1HL4A 4H0LC 4JRWA 4AYGA 3UBFA 4FG4A 4U6YA 4BXSV 4CMMA 1YMHA 3V4PH 3WTSA 2EADA 3RZCB 5E5MB 5DHVB 3MFFB 4JRXA 4ONFL 4NT6B 4NZUH 4IRZH 4OBRA 4JRYD 4E42B 3LKRB 1F3DJ 3I6KA 4WFGE 5FXCH 4UM9B 4I3RH 4AENB 2QDWA 1UXMA 3EDEA 3ZIYA 1CD1B 3HS9A 4YDKL 1QG3A 1BLNA 3ARGC 1D5XA 4DPBX 1PQZB 1P1ZA 4OV6F 1WO2A 3W56A 5GZOC 4MZRA 4FI6A 5F97E 2ESVD 4FTVE 1A6AA 1A66A 2GUYA 1TEYA 1LYQA 4YFEA 3B34A 1JHTA 1MRDH 4WGKA 1RZ8A 3BUQA 1M2OA 2DQIH 3T8XA 4OD1L 2Q20A 5BZDA 3G6JB 2F6AA 2PWHA 1CD0A 5DZJA 4OGAC 1BEYL 3RPKA 4XPBL 3MLRH 1FG2A 2VIRB 3OM3B 4HJ0D 2Z35B 5E8OA 2DI7A 5EZOL 2F1EA 4RBPH 1GS8A 5JZ7D 3O8XD 3LPPA 2F54B 4KRMB 3E6HB 3IM1A 1KGYE 4HFUH 3UBXG 4ZD3H 5HYJA 1CFSA 1TCRB 1VGKB 1TETL 1A6UH 5JHLA 3T09A 2AC0A 3D25A 1EXUA 3JWDH 4BRVA 3S8FB 1A9BB 2VCOA 3QDMA 4XTRD 1IFGA 4PJGF 2BVYA 5DZLA 3NSCA 1TYJA 3HBZA 1IGYA 3NIFB 2EEDA 5I6PA 4G8GE 4L3CB 4CVUA 3D4ZA 2P5EE 3N5AA 1BECA 1QSFD 1I8KB 2ZYIA 3CQQA 3MTXA 3T3PE 5FF6A 4S1SL 3V4PL 4EXPX 5KTEL 3W39A 5SWZA 2ZWZA 2QQQA 4BQ9A 3LZQA 3TIEB 1K85A 1AE6L 1UASA 4AI7A 3UPAA 3WELA 4I3RL 3QWQB 4Y16A 4P2QA 1BXUA 3GD1C 1JPTL 4OCNC 3MRIA 1P6AB 3ARBB 1F6AA 4EN3D 3QFGA 4XN4A 3TNNB 3TV3H 3CFEA 5FO7A 3SDDD 5F7FA 1JOIA 3BX7C 4YHYB 1E5CA 2YD9A 5FR3A 2HJKA 2EXYD 2ZOWA 3MV8D 4HKZA 1AD9B 5E2JA 2SODB 3VJ6A 4LLYB 1H3GA 2P8PB 3QXVA 2AI0H 2B15A 3GBMH 3O3AB 5EF0A 2W1NA 1KOAA 4YHKH 1BYOA 1MRDL 5IVZB 4EI0A 1XCTA 2Q1EA 2ZUQC 4TUKH 2DQIL 1JWUB 1FYTE 3G5YA 1BM7A 1JV2B 4TTDC 3ARGA 4L2YA 1MZYA 3UZQA 5GZOA 3O4OC 3CX5J 3MLRL 4K9EL 4OFYD 4QAMB 1E9OA 2WYTA 1HCZA 3T0AA 4IMKC 4CKVX 1T5WB 3BVVA 7PCYA 5LLIC 4HHAA 4NJ9H 2B4CC 4HBQA 4QHMB 1E4XI 3BH9B 3BXNB 2PXYC 4DP8X 1QFWM 1VESA 1ZA6A 2L7EA 2G60H 1RZKH 2PCFB 4ZD3L 2OMTA 3P0VL 5IWLC 1MCSA 3GSOA 4L3ED 4WSJA 4X9GA 4MNHA 1J0ZA 3JWDL 3WENA 5FDWA 3BVNA 2M83A 2V5RA 1MEXL 3EO0B 3D18B 5MEND 4E9RA 1PD1A 1WYJA 2M26A 4GEJA 2D4FA 1IAIH 2KZKA 4G8FA 4L9LC 5FUOH 1EEQA 4JM2D 4Y9CA 2X9YA 4GSRA 3SY0B 4LOUC 3K3QA 2GSMB 3U4EA 2PCYA 1KGIA 3QSKB 2ARJB 4P2RA 3P11H 5SWQA 1KCUH 1XIWB 3B6SA 1JZEA 4NNXB 4XO9A 2D9CA 2R2HB 5A2KH 3Q8CA 5LGJA 3HAEH 4WO4D 5J3HD 4X4YB 5D1QD 5B22A 4JDVB 4GKOA 3TV3L 4ZX3A 3R19A 3REWB 4N2FA 4ZBJA 4OTXH 3NCEB 3OC5A 1BQHB 3WY1A 2I69A 3IE4A 2CALA 3KWTA 3BP5B 3F00A 1MCWM 3CFBB 4TUUA 4JZNB 2AI0L 4QGTA 1NC4A 3CPLB 4YHKL 1FH5H 3ZHDA 4TUKL 3W9DA 1FORL 3DROB 4AJVA 2Y7NA 1FZMB 2BIIA 4U1MA 3NCJH 2AJUH 2C9XA 2HPOA 3B1TA 4NJ9L 1PJ9A 2OTWA 2DLHA 3ZTDC 4ONHB 5KYXB 4WU5A 3N9GH 3CZKA 4GMSH 2OBGA 3C5JB 3HG2A 3QQ4B 4ATWA 1EWHA 4AQ8A 3QT2A 3EGSB 5BS0B 5J8OA 3C6EA 1XGYL 4IMKA 1FRGH 5EO9B 1ZGLP 3U1SL 4HPOH 2O5YL 4PJ6A 2F53E 1IAIL 3VFTA 1XGQA 4BZ2A 4HX1A 3TPUB 4TNVF 4XBEH 1I3UA 1PX8A 5AWNH 1RUQH 5B1CA 1XHHA 3EUDA 2FHFA 1A1NA 2ZE0A 4IYKA 3DO7A 1KY6A 5CN2A 3UAJC 4EDXA 3P11L 2IWKA 1B2YA 1K8IA 1T83C 2FBRA 2V7NA 2X38A 2X10A 4L9LA 3B9EA 2OR9H 2VSKB 2ZXDA 5GGTA 1KUMA 1HIMH 4V2CB 5JHDD 1BWMA 5DK0B 3VM5A 4MNQB 2RALA 2A74C 4ZXBD 5EU7E 1AQ8A 1CT8B 2DQUH 1AR2A 4R7NB 3US1A 1EMTH 1G6RH 2JKWA 5FECB 3RL1B 1FH5L 3EYSL 1GGBH 1G87A 3FSOA 3X13B 5IMMA 4U1SB 3WIFA 1T03L 2VXSH 5DTFB 2F8XC 1X5AA 4DN3L 1YEIH 4QTFA 4HU2A 4N2DA 2H0JA 2WXRA 4PB0H 4Z95H 3NCJL 2AJUL 3W0WA 1SY6A 2JI3A 3B9VA 4MD5B 4F7TA 3V5HB 1T22B 2B1AL 3KLKA 5E7FA 4FHKA 1LMIA 5I0DA 1NEUA 3X14B 1FLRL 2AFNA 2VTFA 3N9GL 5DVKA 1WBXB 1T1YB 1BIIB 3JTBA 5ERWB 3SPIA 4N8VA 3TU6A 2L0DA 1P9MA 1PBYA 4H44C 4LLVA 5EMYA 3I6GA 4RQQA 1L4IA 4PJ9D 1V7MH 2JLLA 2ZAIA 4W9DC 4XCCH 4H26A 2QZ5A 4WWOA 4Q14A 3PHOA 4AM0B 5CJBA 4BJLA 4GKLA 3ESVF 5GJSH 1BV8A 4Y88A 3ZQ9A 4NN5C 5F3HA 3F7YA 2CR3A 1IUZA 3MJ9A 1A64A 4NP9A 3NCYS 1MFNA 5BV7B 3CDYA 3CK0H 1FH2A 3U9PL 1JF6A 2FL5A 5I9QC 5ISZE 3UO1H 2QPDB 4LO9A 4AY0A 2Y6SD 1WAAF 3QUML 3CSGA 4H25A 2NLJB 3OPZH 1OSPH 5C0BE 1O7VA 5EULV 3WNPA 2YMXH 5AZ2L 2WKOF 1DN0A 5TQ2H 2YAHA 4F3FB 3GGWB 3FB6B 3DLQR 2R69H 3PGCA 2J5WA 2VDPB 1MJ8L 4QI3A 5LXVA 3BZ4A 3ULVE 3BKMH 5DJ2A 3UAJA 2I7SA 3FU0A 1D9KD 2WBJD 1G6RL 4X5WB 2EUVA 3A6OA 3PS6A 4L8CA 4I9XA 4J3XA 1FFOB 2CO3A 1WVZA 2J8OA 1GGBL 1P4IH 2YD2A 1NGYB 2VXSL 4WNSA 2YGNA 4PREA 1YEIL 3BLKA 3NCWA 4WI6A 3ULSB 3IDYB 3VH8A 4NPYB 4Z95L 4GIAA 4TN9A 5EU4B 1PG7L 4OU3A 5CD5D 4PJ8A 1SJEB 2OP4H 3ZTJH 5EN3A 2VAJA 4XODA 4YSPA 3O2DA 2VABB 3M1BA 4UM8A 3QI9B 3KXFB 4ODHL 2NY2B 1GSKA 5BCAA 4YZFF 2YFNA 3B2VH 1GCYA 3WD5L 1J9TA 4UAOB 4HJ0C 3ARTA 4WKXA 1V7ML 3POHA 4U6VL 3K6NA 1QTPA 3CD4A 2E9WA 3O45B 4XCCL 3O8XC 2NPLX 3WE1A 5GS1C 3UABA 4PJCF 2EYRA 3MRMB 5TDNB 3BKJH 3GHBL 2H1LM 3L6FB 2A83B 3ULAB 3QR2A 3L7EA 1YNKH 1Z5LB 3MRNA 2VR3A 3GS4A 3S96B 3N1MC 3NQIA 3M45A 3GJFH 1LO4H 4ZFOL 3U0TA 4YSRA 3NMEA 4XTRC 1A1MA 4S1DD 1IFHH 2WPGA 2X4SB 3C60D 4B9FA 5D7EA 4Z7NB 5D6CB 2R2BB 3D9AH 3HFMH 4NSKA 5I75C 1AQKH 1A6ZB 2YR3A 2G30A 3IU3B 5C0AB 5F1IB 1MCWW 1JNLH 4OD3H 1EFXB 1RAMA 3GIZL 1WC7B 2JI2A 3IJYA 5ILTH 4OV5A 5JPMC 4X6DE 5SV4A 1QW8A 4LSVH 3AQDA 3VXQB 3JV0A 4EN3C 2UZYA 5E99H 3WS3A 43CAB 4R9HA 3KAAA 2CUIA 2W88A 4P3CL 9CGTA 3QIWB 3S88H 2A9DA 2WIIB 1E9QA 2EXYC 4ELKB 4UMGA 5I1IH 3GXMA 5H8DA 2LLNA 4H1LG 4JJOA 4JRYA 4LCCC 1XR9A 5DQ9B 1OGTA 1VACB 2OP4L 3DETD 3N40F 3P9MA 2CO4A 3BPOB 3L1GA 4QRSA 1UUNA 2OCFD 1H3XA 2PKDA 3BE1H 5E95B 1PY4A 4HT1H 4F9PC 1AGEB 1AQMA 3OHXC 4FQHB 4NRXB 5AW1B 4D0DB 3H55A 5BO0D 4RMTA 1G7JB 5T3ZE 4IJ3B 4KO5A 3P9LA 5A6MA 2ESVA 4I77L 1R5IB 4FKEA 2FWUA 3E3QE 3NPZB 3BKJL 4ZFZA 2XQBH 1JZGA 2H6PB 1H15B 4FFWD 4HWEH 4JN1H 4EMZA 4XX1E 3KDMB 2WXLA 2O6EA 3QH3A 1DQJB 5E5RB 3T0EE 3UPCA 3ARYA 1E4XH 1YNKL 4HGKC 4WFHD 1QLRA 5ID0B 4QRPA 5IB3A 4WUKH 3WHE0 2VMCA 4I2XE 4AEEA 2YAEA 4GKNA 1IFHL 4JLRA 1E43A 3BFOA 2YKLH 5C0EB 5I2IA 2NCMA 3EGDB 2A6JB 2VDNL 3KPSD 5GS1A 1D5MA 4NS0A 3HFML 4WHTA 5AUMA 1BQSA 2CRYA 5I5IA 2X89D 4UT9H 3VXNB 3FU9A 4JFYA 4S0SD 1AQKL 4JL1A 3VFUB 5C08E 4OD3L 4B41A 4ODTL 1ZHBB 5EV7A 1KIUA 4P4RB 3VXSA 1IBDA 5ILTL 3O0LA 2YQ3A 4HXBH 5J3HC 3DECA 4WO4C 4W9GC 5D1QC 1DQDH 2OMNA 3MUGA 4A7QA 4LRNH 4MLIA 3QZWG 1TG8A 2VSDA 4G6JH 2NNCA 1HXYB 4FFYL 3MTRA 3MV01 4P0DA 3AW5A 4K8RH 4I89A 5K93A 5I1IL 2VLJB 2CHXA 2VDLH 1MUJB 4K7PH 1PLGH 2MNUA 3UTTA 4DEUA 4QYOA 2NW3A 5I18L 3RVVD 1GJIA 1JGUL 4MJ4A 1W16A 2E46A 1U8MB 2CHDA 5HHVH 5DJ6B 4HT1L 3QDGA 4LSSH 2AEWA 2A9NH 4JDTH 1HQ4A 3MREB 5DO2D 2XX1A 5DD6B 5HGAB 3DHUA 2PR4H 2FLBT 3NA4A 2CNZA 3AWGA 3ES6A 3KPRE 2VLRB 4HMCA 4XHQA 3QQDB 4Y4FC 4EQ2A 1A4AA 1RZIA 5D4HA 1BWWA 2XQBL 3WE6A 2X4UA 4APQB 4GQRA 4JN1L 4NKOA 2HFEB 1U21A 5J4MA 4NHUB 2P43B 4FXLA 4NC2B 1E4XL 4DAGL 3SDCD 2G9KA 2Y25A 5L6YL 5I82A 2OL3B 1OE3A 4NO3B 4AC4A 5IP4A 4GBXC 4KX7A 2FD6H 4M3JA 5BMFH 1N18A 5IQ7L 1GMEA 1LHZA 2PP8A 4R96A 5B7FA 4N87A 3NDYE 4FTDA 4ETYA 3G7TA 3IBOA 3MLYL 3FSWA 2BERA 4G6KH 4UT9L 2BNRE 5FV2A 1L7IH 2EABA 3ML8A 1WT5C 5FM5O 4XNBA 4WQOA 3ILDA 2V7HB 4BHUA 1VDGA 4HS8H 4FXGC 4YL9A 3F58L 4LZKA 2BSTA 4I3SH 4H8PA 4KZEH 2QPEB 1RJLA 5LG6A 5HHMD 4HXBL 1T7YA 2X4OB 4JQVA 2VDOB 5IK3B 1DQDL 1VZGA 1R24A 2EO7A 4X8JB 4XMUA 5DSCA 4AW4A 2OAAA 2NX5D 1BP3B 4LRNL 1XBRA 3F12A 4AXWA 4Y0GA 1FJ1B 4KU1A 4K8RL 2ZUXA 4MZ3A 2FLMA 1D5BB 1FL6B 2BO0A 4MAYB 4JO4H 2DYPD 4NN6C 5DDHA 1AH1A 2YOCA 4K7PL 3NZ8B 1FFQA 3CG8A 4M7LT 2BNUB 3SJVB 1MHCA 4ZG1A 4WO4A 2LLLA 3EGXA 3U4AA 2VM4A 3KWVA 4LSSL 3VB8A 1M71A 4JJ5A 5C3IA 2YLKA 1U8CA 3X1BA 1WV7T 3KWXA 1B4JH 3P4OB 4A1RA 5LCVH 1HEZA 4WFFD 4YAQB 4JGUA 3PQYB 3RIAF 1IBGH 3IJHB 5I6XC 1CI3M 4WI9A 1GGTA 2GJ6D 4N5UA 4HJTA 2F54E 5AKTA 4F8LA 1NFDA 1IBHA 2BSED 4LLDB 3JT0A 1ZANH 2XKNA 1DBAL 3ARPA 3MYZA 1OAUH 2K78A 5JA8B 3NK4A 5IB1B 3BT0A 1ZLVH 1MLBB 4PJ9C 3WXWH 2M2DA 3BPLC 4K2UL 3NCXA 4UBDC 3BPCB 5BMFL 3OG6B 3L16A 3C08L 5JIKA 4Y4FA 4LSTL 2EEFA 4KKAD 1DBML 4WKZA 5J9PB 5D1XA 5E4EC 3NIFE 1Q9OA 4ANWA 4G6KL 1B3IA 5DHEA 2J7LA 1COBA 3FQNB 4HU8A 3BRGC 2V9RA 1O7SA 3BO8B 1U8PA 2BW4A 2KL6A 4GNKB 4BFFA 3LN9A 5E94B 4GBXA 4KZEL 4ZUWA 2BOBB 2BFGA 5CEZH 2J71A 4KC3B 3S48A 2Y6SC 5K69A 3SHSA 5DVNA 1F3RB 2P24A 2OI9B 4JN2A 2WWKT 4LBEB 5TGBA 5DMGD 3VD7A 3WIHA 3V6OA 5IOPA 2C4FT 3ARDB 1WT5A 2R0WL 3PWPB 4PVBA 4K23H 5IESL 4JO4L 2B16A 1C5CH 2EECA 3BQVA 3VA6A 4FXGA 2YA2A 3WFEH 5AB9A 3WIIH 2GJZA 4H4NA 2WBJC 5HP5A 1ACZA 5MP6H 4YO0A 3L9YA 1JVKA 1NJ9B 1Q1PA 5FIEA 1LWRA 1TQBC 2PCXA 1JF1A 1PLAA 2C3VA 5JUEL 3H2QA 3GO1H 4L8SC 4AJWA 5JHDA 3AU1A 1IBGL 5CD5C 2UY7B 2NY0B 3VFRA 1OAQL 4BIKA 1RSFA 2ED7A 2NDGA 4P2YA 4K5OA 4P23A 1U8LA 2FX8L 1BGXH 2NY6D 3N6YA 5E8EA 3MRCA 5TK4A 3FHQA 1HH9A 5K1JA 1G4RA 3OKMB 2VLKB 4WWNA 5ENWA 3I02B 5J12C 3WXWL 2QQKH 1PMYA 2V0AA 2LR4A 3GMOA 4FFZA 1NCHA 2P8LA 5E8NA 5EIIB 5TPWL 3GM8A 2R51A 5AVQB 3FB8A 3PUUA 5KSAB 5HYSA 1W8OA 1QD0A 1MFUA 1R9FA 4NN7B 2KBGA 3EZ8A 1PSKH 3K6SB 3O3EB 3GIVA 5L7XH 1NFKA 2X4PA 3QNXB 2W0FB 4KQ3H 1WHOA 2F08A 4Q6YA 2E6QA 1DR9A 4AV0A 4Y4KB 1ZS8B 3ZQWA 3LRKA 2LABA 4S1DC 3C60C 4M48H 3UYPA 1QQDB 1IAKB 3DSFH 3OKDA 4HLEA 2GTWB 1OQXA 4MCYA 5CEZL 4DGVL 3DIVA 3WFHA 5HDRA 3VFMB 2Z0UA 3BVDB 1KJ2L 5C8JA 1S9VA 2XWXA 1QUNB 1GKEA 2EIDA 2WHVA 3GB7B 1PCXA 1BPVA 3VMPA 1HSBA 3P0YL 4XMVA 4YQXH 5DJ0A 2ITCA 3S34H 2DWDA 4Z7WA 4ORGB 3VXRD 5BNXD 2BSCA 1P1VA 4CC0A 3TO2B 5DJYB 4TNVK 1BREA 1JZ8A 1G5AA 1NUGA 3VFPB 3FJTA 5I1EH 3B1UA 5CFAA 3GO1L 2YOAA 3VXME 4AG4H 4J3OH 1AQDB 3LN5B 1XCQB 3MRDA 4FYSA 4WJ5A 3DETC 4FLRA 2A0LD 2QQLH 4LLAA 1UM4L 1T7VA 5TE6H 1BGXL 2D31B 1AZZC 1SQ2N 4FL4B 5FGBC 4PP2A 5DHVH 5EH1A 1JHKL 3IKCB 4OZFG 4G3YH 1H6TA 2YAPA 2I27N 4PCSA 2ADFH 4TKWA 2HJFA 4KQ0A 2R59A 3FZUD 2E56A 2XKSA 4HWUA 1FQ9C 2DDQH 5BS0E 4AT6A 4FRWA 5JXED 3GXUB 4GRLD 2WN2A 4FFWC 5DJAB 4Y4HD 2IALB 3ASNB 2E7DA 2XA8L 2R9HD 2XXMB 3WUZA 5JNYB 1EERB 1MI5A 4U4BA 4G1EB 3OGCB 3CFQA 4LE8A 1C5DA 4XAKD 4KQ3L 2DTSA 2EDMA 3UBGA 1N6VA 5IW1A 1UKTA 1B0RA 3MX0A 3LRGA 2COQA 2XHNA 5DEFA 3IN2A 2ALAA 2Y23A 4RFNC 1BW8A 3MBEB 4RDQF 5GRXG 5I30L 1K3IA 3PJSA 2EDLA 1QR4A 2BK8A 1FZJA 4G6FB 3C09C 3QIUB 1N8OE 4IRSA 5CBEB 4NUJA 1BD2D 3KWWB 1LILA 1UGNA 2IPUK 3D4CA 4YQXL 1UWEL 2ZOOA 4ZMXA 4E9SA 5AENA 1VENA 1GR7A 4NCC1 1BVZA 3I74A 5HI3C 3ZE2B 3WKNA 3H54A 5HPMB 5ABZA 2NXYD 4HC1L 2BZ7A 3VWKD 4JL2A 4WWID 4Y1AB 5I8CA 5F21B 4K9EC 2CO1A 1KTLA 3QFJA 4JANB 1QSED 1NBCA 3RVVC 5CR1A 4MJ5A 1G4MA 2QQLL 4PPTA 4AZ8B 4PJIA 2VGLM 3DJRA 4WW1A 5TE6L 4XNXL 4FF9A 3PFQA 3DVNB 4F7EA 1MFDH 4ICXA 5DO2C 2EAEA 1HOEA 1JGIA 4KOCA 4L4VB 1WFUA 2ADFL 4XP1L 4GKSB 5IEKB 3JWDC 4ZUTA 3W37A 1HE7A 1U2YA 5HJDA 2GFBB 4JFDA 1N2RB 3D09A 3PWNA 1UC6A 2AEPH 3F04A 4OKVB 1GOGA 3SDCC 2B1HH 2H0FA 2IWGA 3PWVB 4XBMA 3VFVA 5INCA 1MWAB 3EXLA 3DTDA 3UBHA 4NQSA 4WW2B 1TEGA 5IM7A 1O6SB 3L9RB 3RWCA 4IRJB 4MYPA 3KVQA 2A1WH 2R8SH 1K2DB 2ICCA 4AEIH 1MFBL 5EHFA 4OFPA 3OB8A 4D9QE 3IN0A 3D39D 4EIGB 1UUSA 3QEQD 2VZSA 2BW5A 2APSA 4PJHA 25C8H 3IDXH 3V4PA 2XZAH 2E7LC 1FIGL 3O4LD 3BDBA 1N7ML 4MDIB 4H8UA 3KPSA 1KEGL 1Q9LA 2PWDA 1N59A 1RK1B 2DM3A 2ICES 3MR9A 4YS4A 5IREA 2X89A 1J1PH 2L8AA 3O6LH 8FABA 4LLQB 5FKPA 3TEUA 4UAHA 1BMWA 3NEOA 3VNYA 4NZRH 5EEWA 1J0KA 3L3JA 1GGIH 4FNLL 4M62L 4DIXA 3BIKB 5K33A 5B7MA 3IJSB 2C1PA 1MFDL 2R0ZH 4GI9A 4WI3A 3ZY7A 3KXFE 5L8LB 2J21A 2AQTA 2XYBA 3M86A 2AXWA 1CI5A 2RACA 3BAJA 4DEPB 5FA4A 4JR9L 4OZIB 1LWHA 2J5LC 2IBZY 3KYNB 4M8UA 2O5XH 2IIJA 4PJFB 5I74C 1E28A 3ZKND 2G5UA 3EFFB 3DK2A 1CFBA 4X6CA 2AQNA 1ODAA 1J8HB 1A9VA 5JO5B 1G7IB 3CN4A 2DM4A 4F8QA 2OPCA 1ID2A 2XI9A 3ULUD 3FUIA 4Q0XL 4DERA 1BBJB 1RHHB 4PGCB 2LAAA 3U4BH 3BW9B 3EF4A 3KL0A 1SJMA 3RWJA 1RMFH 4HZLA 3MA7A 3QRLA 5F0MB 4ISVA 4KZCA 4Z7NE 2VDRB 3DX6B 4KKAC 5DRNA 3PNRB 1UWXH 1YEKL 1KY7A 2R8SL 3OXSB 2PYFB 1V8HA 2ITDB 1PDKA 2C1OB 3BUYA 1FDLH 1DL7L 5DI8B 4U3HA 1FLTX 4JFEB 5C0AE 4L37A 5DFWH 2MMXA 4NERA 2J1KA 2ZXAA 1EX0A 1CR9H 2GJPA 2XZAL 3OV6A 1TMQA 4FP8H 2IXQA 5CMAA 4AC2A 3SO3B 1IM9D 5GZNC 1KPVA 3IFOB 5B21A 5KJ4A 1E27A 1OT2A 2WXQA 1IM3A 2A4CA 2OMZA 5D7JB 5DMGC 5EDXA 3DIFA 3O6LL 3OB0K 2FATH 5F3FA 1J5OL 2APVA 5BVJB 3IBEA 3K71B 2ATAA 3ZRFC 1ZPLA 2E7LA 5ANMA 4X9YA 2GSIB 4LSRL 1GGIL 2EP6A 3IXTB 3S35L 3KPOA 2ADGB 1CFQB 5DC2A 1QATA 2ZWNA 3TYFA 1N4XH 2NX5A 1WICA 2ZOUA 4QXGH 2W81C 4JO2H 3DARA 3E8UL 4UINH 2WMPA 3BZDA 3KLHD 4F8PA 1TZHA 4BDVA 4U49A 2OJZL 1G9EA 2W9DH 4X4ME 3HZKB 4HJGA 2X7LA 2O5XL 2DM7A 2NY6C 3FAXA 3KW7A 3SDXB 3WAKA 4S2SA 3TTYA 32C2A 5DMJB 4H2CA 4K07A 1YRKA 4P2CG 4ETQA 4PRPA 1CXIA 4X9BA 5D5MB 1RMFL 3DI3B 4AE0A 5I8EA 5D71H 3EBAA 5C0CA 2AJZB 2BSEA 3ZL4L 2F1BA 4GW4A 3IF1A 5DZOA 4E68A 4J1UA 4MMZB 4QRRD 4RETB 1PZ3A 4PW9A 1ETZB 2AV1A 3LKSA 2C7UB 4AGOA 4LF3B 1OTUD 1DUYA 4I4WA 3C6SB 3CVDA 3FB5B 1CR9L 3TT1L 3B7RL 2QL1A 3L2LA 2DTMH 3NRQA 1MH5A 1JTOA 5E2TH 2K3TA 1G0XA 3MQIA 5MI0C 3HTLX 4PJAE 1SJHB 2JQMA 4XBPB 4RWYH 5EOTA 4RX4D 1CB4A 3HC0A 2DQCH 2XKUA 5TDPA 2FATL 4G8AC 2VMDA 2BIOA 2JJSA 3RWDB 5IHZB 1WGOA 1S7WA 3PPSA 1HHKB 2D3JA 1A1OA 4LSDA 2I85A 4BSJA 1FNEA 2JV6A 2FQGA 5GZNA 3DBSA 4M3KB 5E9DA 5BV7H 1N4XL 3BUPA 1UTDA 4DVRL 4JZJB 4FABH 1DVXA 4JO2L 1AD0B 4MHHI 2JTDA 5LJYH 1BX2A 1VKXA 2HLEB 1HU8A 4I18A 3OR6B 2MCPH 1JZ7A 5CEYB 2NNAA 2VLRE 2WLLB 3MJ6A 4HJ1A 5KSVB 4U7SA 4NO5B 1XFPA 3FQXB 1WIOA 4P9MH 3UOAB 5EBWA 1B6DA 2DQTH 4F15B 1YEWA 2NMSA 3OAUH 2VDPH 4D8PA 2H5UA 2EH8H 5DS8B 2NY3C 1MCQA 3FZUC 4JFQA 4PD4K 3VG0H 4Z3EA 3OB0H 1GZQA 4QT5B 3SBRA 2FWOA 4GRLC 4XO5A 3ZK0A 4Y4HC 3HG1B 4LNRB 3N44F 2CBTA 4ZAKD 1X5YA 5D71L 4DJMA 3S3SA 1G7PA 1QFOA 1T80A 2R9HC 4YUEH 1KWKA 1JMXA 1UZ6E 2X9WA 1T0MA 3LVTA 3WHXB 3ULVF 5GGSY 1WSST 3AXHA 1TPXB 2ENSA 2BX5A 4X2UA 4RFOL 3RJOA 3MV7B 4QR7A 5D96C 4DT2A 3ROLA 2K0RA 2DTML 2H9GA 2X1OA 5IHUL 4FFVD 5IY5B 1S7XA 1AVAA 2BINA 4JFTA 5E2TL 2ORBL 4JM4L 1YN7B 2E7BA 2IGTA 4RWYL 5HHQA 1LP9B 3QUMA 3VXUB 4OD2A 4DUVA 2DQCL 2J43A 2JF1A 1E6JH 3BI9X 5GSVA 4H8HA 4M29A 4OLEA 3OMZA 1FC2D 2BP8B 2BIPA 2X4TA 5C97A 5I66A 1W0YT 1SVCP 4PEEA 4N3TA 2HX8A 3BIAX 3A6CH 5G2NA 3RILA 3SJVE 4PIBA 4UV4H 5KZCB 2QGBA 2ZSWA 1JRHH 3G6AA 5CUSH 5HHOA 4DNLA 1G6RA 3T6QC 3DWTA 5G4OA 2HN7B 2NXYC 2X4RA 2GYSA 2NYYD 3M1CA 5KSBB 1JFHA 3GUTB 3PQYE 1QR1A 4E41E 2N7AA 2L3BA 3T5WA 1NKOA 1CG9A 1KFGA 4Q97A 1OAJA 3ZE1E 3OVUB 4P9ML 3WOVA 1DQIA 5G5DA 4HUXB 2VXVH 3UTOA 2NTFB 3MCKA 2X6MA 4TPRH 4Z5RB 4GOSA 2I07B 3H2WA 3CSFA 2QHRH 3V8OA 1JK9B 5B1KA 3BWUF 3LRSB 3KPMA 3VG0L 1XDTT 1D7DA 4EZLA 4OH2A 2DIEA 3FCUB 5C0DB 2E5EA 2WP3O 4C47A 1S7TB 3QIBB 3GDBA 1FGNL 4QKTA 4CC1A 2CBMA 4I1PA 1PGRB 1GCFA 4YUEL 2ZNXA 4MA8H 3QUZD 1ORSA 2UZIH 4I9WE 3BAEH 4WK4B 4TL5A 2J73A 5BZWA 1EDHA 1CIDA 1LL1A 2WTRA 4X6DF 2XVLA 2Y3NA 1B90A 3CBRA 4ZFOA 3HZMA 1MHEA 3QDJD 3FTGA 3EOAB 4ZTOH 4GRLA 4QKXB 4Y4HA 3WIAA 2YN3A 4JREB 5DURD 4YK4B 1FYTA 1KXVA 2XV2A 5IIEA 1CBVH 4LVHC 2WIMA 2HVKA 4JFWA 1FCGA 5IQLA 1E6JL 2I9LB 2KC0A 2OSWA 4KI5E 3V0VA 1YJDH 3LV3A 1U3HD 3DTXB 3F2LA 2YUVA 4UV4L 5CUSL 1JRHL 2VZ1A 3IDNB 3IRZA 4LCYA 4L5FL 3UCQA 2XN9D 3AXLB 3TWCH 4XI5D 1RZQA 3S3CB 4OLZH 1QOKA 3RTLA 5T1LA 3MODH 4ELDA 4ZFFB 5FYLL 2UWEB 1BD2A 2WNWA 5KYUA 1FA4A 4PRBA 1G9MH 1JG9A 5E8PB 5EO0A 3VWJB 2F7IA 4S0HA 1BBDH 2X05A 4KGLA 3Q43A 3JYCA 2VXVL 3K2UH 3IMRA 5C0RL 1U4FA 3F85A 5JDJA 2WINB 3NJVA 1SYVB 1FAKT 2QHRL 1MIEH 2VLKE 1XSOA 3H7BB 4OR1A 2IG2H 3GUFA 3R8BB 5I1HH 4H8WH 2XWBA 4UQDA 1E65A 1UACH 1R5WB 4MZIA 4DZ8B 1IJNA 2XOTA 4YLBA 1NBQA 1QSEA 4HUVB 2CU9A 1HHGA 4AJYV 4LU5H 5AYQA 1I82A 4MA8L 4E5XG 1BVNP 1H5BA 1ASOA 1BG9A 4HIIA 2UZIL 2Z9TA 4L3AA 4BM7A 1HHJA 3HI5L 4IIQB 3P30H 5IJVB 5C0GA 1QWNA 1G7HA 1G7MA 2Y9RT 3B3IB 4ZTOL 3K72B 5JPNC 4CN6A 2DIBA 3ABZA 2WOYA 4JPWH 4WEEA 5CLXA 2Z7UA 3M88A 1FCCA 3VI3E 5LB1A 4W9LC 1WF5A 2R4SL 1JYWA 4EDWH 4JK0D 5I0VA 3ARED 3OKLA 4K8RC 1IEBB 4R0LB 5F7BA 5SX5K 2BHFA 4AYID 2DLFL 2YXVA 3IDUA 2L7QA 2PP9A 2Z4QB 1AGDB 1YEJH 4HGMA 3A4DA 1A65A 4BA8A 4L1LA 2KLTA 3KNBA 4M6NH 5E6ID 2OL3H 3TWCL 1ED3B 1ORQA 3QEQA 4FFYA 4OF0A 3MODL 1QWUA 3NH7L 4YFLI 4URKA 3S3BB 2IPTH 3IT8D 3VQMA 2GJJA 4PGEA 1NDMB 1MIML 1G9ML 2QGCA 1J0YA 4PGZA 1OF2A 3O4LA 1D6VH 5CINH 4HH9A 3K2UL 3R0NA 1FVEB 4Y2DD 2PW1B 4UTCA 4HSQA 3IDJA 3Q48A 3SPHA 3KLHC 3RY6C 1XR8B 1YVLA 1CVSC 1I1AD 5I1HL 4H8WL 2VDOH 4G43B 4JPKH 3ZW3A 3MRPA 4K3JL 1XF4A 1IC7H 3MKGA 3RWIA 1BF5A 4WY7H 4M5TA 3QARA 2HLAB 4PJ7B 3ZGHA 3PE9A 3AQYA 4AGPA 2RQ8A 3GSQB 1MCHA 1ZSDB 4U0QB 3S3PA 5C3TA 4EXKA 4FYTA 1M4KA 3I50L 5KVDE 3GI8H 3IFNH 1S46A 1DQKA 3DRQB 5JOFB 4GLRI 3UGXA 1HKFA 3JV4A 3QAZB 3P0GB 5CSZB 3L3DA 4JPWL 4K9JA 4P49A 1GH7A 1JXFA 4BYHA 3RTQD 2VE6B 3GQFA 4WV1B 2EICA 4EDWL 4UT9A 1OTUC 4PIRF 3WN5A 4X99B 4P07A 3CZJA 5IT2H 4Y2OB 1EGJH 3UTSD 1FO0B 1KNOB 3DO3A 3Q2LA 1YEJL 5I8KL 3FRUA 3W11D 4FQLL 2APBA 3S4SA 5JPNA 3S97C 2JIXD 4HBCH 1GZPB 2VQTA 2UUDH 1MVUB 2J88L 4U3XA 1M05A 2BRRL 1WFOA 3LKNA 5DUPH 3OHMB 4HZAA 4Y1AE 2AABH 4LB8A 4PJDA 2IPTL 5D1ZB 4FAAB 3ZMEA 3I75B 1KXQE 1W2KT 3QWOA 4LKXB 4MJID 4X0KA 1BF8A 1YPZE 4PVMA 2BJMH 3ZZ1A 1D6VL 3KPNA 2NT1A 4GXUN 4H0IA 1A7QH 1NL0H 2P48B 4IKLA 3CZGA 3KJ4B 3LB6C 3CUPA 5CLTA 4X83A 4BH7A 4NKDB 3HE7D 3L7FB 4X9FA 4DP1X 4TQIA 1HWGB 3A23A 5DK2B 2GC7C 2ZIDA 3AGVA 1YCSA 4DOHB 3DOSA 2VDOL 2FECL 3NIFF 1QRND 5J56B 4I0CC 3QJFA 4KNQA 1OHZA 1IC7L 4KUZH 3QJZA 3ZBMA 4M8QA 2HT2D 2UXFA 4P5MA 1IT9H 5FO8A 2QV2A 2W65B 4AH2A 5A2LH 4D9LL 5IHHA 4WAFA 2PW2A 3UX9B 2R1XB 1ETA1 5D2LA 1WFIA 2ZCKL 4CVXB 4MQSB 2LGNA 3RY6A 2XCMC 1BZ7A 4KY1H 3GSVB 4J3UA 4DCQA 4ZAKC 1AS6A 3VNZA 4A38A 1PKQA 2O4EA 4TUOA 4BK5A 2Y22A 2W80C 2AJVH 4TS6A 3KJ6H 3MRRA 4WIQA 1T6VN 5DS2A 3I6KB 3QR0A 1PZSA 3ETSA 3OKEA 4Z77A 2EE2A 5EOCL 5DWUH 4XNZC 4FFVC 4DVBA 1SLVA 3U36B 3L5WB 2VZ3A 2P5WE 5EN2B 3W81A 1P1ZB 1UEMA 3HVDA 3MV9A 4PJBB 2LU5A 5DUBA 4HG4K 5K9KB 1V3KA 4OW6A 4MMYA 4DP6X 3NFNB 1FNFA 1KDIA 2XC8A 1F5WA 2FSEA 5DUPL 3SN6N 2CLRA 3QHFH 1JPSH 1DVYA 2AABL 1P5VA 1QFPA 3FQWB 1C08B 1WBYA 1R47A 5AB1A 4U1HA 1JHTB 3RUGF 3WDHA 3CDFA 5E70A 4CBZA 3GJEA 3T8XB 4YHIB 5JMRA 4U1NB 1NGZA 4OCSH 2AS5M 3BPNB 3APFA 1A7QL 1L9TA 2D9QB 3LQMA 3LTVA 4HF5H 4NYLA 4RX4A 1FG2B 2C26A 2NYYC 3S5ZA 3GLAA 4KX8A 1I1RA 3DPBB 2NXZD 4OZIE 1SBBA 3MLZH 1QASA 3EYOB 5HYJB 3PJNA 3TCLA 1AZUA 4W4OC 4Q2ZA 4GXVL 4FQJL 4BFJA 4YX2H 4IIZA 1I1FA 3GLEA 4L8DB 2ZWLT 3RB7A 1IT9L 5DQJB 3QDMB 3W9EB 5FYKE 3TO4A 3T0XA 4AIEA 2BWQA 4QNPE 4KO9A 1FNSL 4RSVA 4HW6A 3ZT6A 3RWFB 1IGYB 1ET8A 4GW5A 4B9KC 4Z23A 4M1CD 4U6XA 3BHBA 3VRLE 5DJDB 3QUZC 1MHPL 5TFSH 3SDAB 1GSMA 3DX0A 2E27L 4PRDA 2AK1H 4JFEE 5AG9A 4N0YL 4P2QB 2CPCA 3EDFA 4C83B 3MRIB 3WL9A 5E5LA 3ENEA 3DX9B 5K9QG 3CFEB 3BN9D 3BQUA 4A2HA 2JH2A 4LT7A 2K3HA 1E8YA 4TLSA 1FNHA 2D0HA 1KJ2A 2EINB 3VJ6B 3P3TA 4MCZB 5KVGH 4PJXB 3WJMB 3X1GA 4PJ5B 2DYSB 3QHFL 4G71B 3WKMH 1JPSL 2G5RA 5A3ID 4FDWA 2HFTA 4D0BA 3WXVH 3H1ZA 2X88A 4J3OC 4Q6IC 2GBTA 3LSOA 1HL8A 4OCSL 4QD2E 4ZW5A 3E8VA 3ARGB 3ZT7A 1U91A 2WXJA 2ICEC 1MOEA 3UZQB 4XI5C 4E5XB 4BCZA 1A6VH 3D51A 2BVTA 1E9OB 1NCOA 3TLRA 2NSMA 2EDOA 1JWMA 3HZYA 2FUTA 4LL1A 4G83A 2Z7ZA 4PMFA 4HHAB 1M57B 4O2CB 4U33A 4FHJA 5EU6D 1ZA6B 1SXAA 3HC3H 4OZHA 4YX2L 3GSOB 3SDXE 5EU3A 3BVUA 4MNHB 1RZJC 3UEZA 3M17A 4JY4A 1CPUA 2FIKB 4G8IB 1H6EA 1KELL 2CIIA 4BSWB 1J0HA 1FV1B 2ARJQ 4F37K 1CURA 2JSFA 5D5ME 3WUWB 4G8FB 2XQYK 3HLKA 3GDCA 4TLTA 2IWFA 4HA1A 1KEMH 4FG2A 2D4DA 3FU5A 4Y1TA 5TFSL 5GS0H 1L7TH 4W4OA 3KCWA 5I0YA 4XCNA 1I1YA 4K5NA 2AK1L 4OGYL 2N59A 5IBLD 3BH4A 4P2RB 2X6VA 3B6SB 5DJ8B 5LGJB 4G80B 4G2AA 1D2OA 1NGQH 2YD3A 1ILSA 3BP6A 4LASH 2DMGA 4FS0A 2YN5A 2Y6TE 4FJ6A 5H94A 4TSCL 5J6GA 4I48A 5GRVK 4NQDE 1H9DA 3TM6A 3QUZA 4L4TB 4HK3N 3GEFA 4FX5A 4L23A 5EC1B 5CJOH 5KVGL 3AREC 1PS3A 3SGDI 1JGDA 3WKML 2VSCA 3UGUA 3VI4B 1NC4B 3KPRA 2ITFA 1E3XA 5FYLD 3WXVL 2EIZB 1RFDH 5E8DH 3QDJA 3MRHA 1DFBH 4G7YH 3EG9B 1X4YA 4IBSA 5I5MA 4PAZA 5E6IC 4M61B 3QBTB 4WHYG 3FH8A 4XO3A 1MWAH 2Y7MA 4HC1A 1KG0A 1F56A 3NEXA 5I1JL 2RR3A 2MQ0A 3JZYA 4FQQB 4FE9A 4HGWA 1BQRA 4ZK8A 2ZUQB 3NAAH 4KV5E 4WU5B 4AYEC 3HC3L 4JGNA 4K5PA 2NDFA 1XB8A 3REVA 1MG2C 3GNML 4L29A 4XNUH 4Y2DC 4YHYC 1N0LB 2ICEA 4YGAB 3O4OB 5D4QA 4L0ZA 3RX5A 3RZCA 3CSPA 3MFFA 1GXEA 3W2DH 4KDTC 1FIEA 3IXAA 4WZ9A 2JCCE 4RVBA 3LKRA 1I1AC 3V4UH 2IH9A 4UQ2B 4XC3H 4UM9A 3MOAH 3VFTB 1XGQB 4HX1B 2D7OA 2PXYB 3UACA 5GS0L 1T4KB 3NJGA 1H8NA 4GQPH 4PVNA 1A1NB 1PQZA 4K3EH 3TP4A 3DO7B 1HZKA 5JIMA 3M1OA 3B2PA 4BFBD 1BAFL 1K8IB 3DX7B 3LS4H 1T3FA 1EAPB 1FNGB 1NGQL 4RRPA 2X4QB 1XF2A 1PTZA 5K39B 4LASL 5LN4A 2XVBA 4L9LB 4O9HL 5LGHH 3UMNA 4ZS6C 4HWZB 1QHPA 2TSAA 2IBZX 3G6JA 3RTQC 4GLRH 3VXUE 2WVUA 5CJOL 2BFVH 3NVQA 2DOCA 3WS6C 4G7VH 3DYOA 4HIEA 1ZEAH 3LHPH 3MMEA 4CU6A 2AANA 5H37H 1OTTD 5IMMB 2R27A 5AYUH 3ASOB 3E6HA 1OP3K 1TCRA 5FYKH 1YHPA 2XVGA 3HMXL 1HOCA 1OLLA 5KSBE 1A9BA 3AREA 4K7FB 2GT9B 4F7TB 4A39A 1XIWC 5HPOA 1YEDB 2VDRH 4G9FB 4RGND 3ALPA 3NAAL 2RMNA 4G70B 3L8QA 4YHML 4W9EC 3ZKSD 1MNNA 4OAWB 4XNUL 5I1LB 5E6IA 3HE7C 1I8KA 1Z3RA 4TVPE 4R5TA 4NQCB 1UCBH 2JELH 5F1NB 5TTRA 4C55A 5CF3A 1AXTH 1PZ5B 2QV4A 3EH2A 3V0GA 4Z7NF 5TF1H 1THCA 3TIEA 5DD0H 4YVUA 4L05A 3V4UL 3EIFA 3H8NA 4IHBA 4ZMZA 2XV0A 4G5AA 3KBFA 1CYGA 1JVLA 3HLAA 4CSSA 3F7YB 2DJ4A 4FQ2H 4QO1B 2OMYB 4UNVA 1SLWA 2HT2C 3LHAA 4JE4B 1YAZA 3B9DA 4K3EL 4FLQA 4L1HA 4Y2DA 1AIFB 5AW0B 4AMWA 5F0PB 2DKSA 4IKJA 4NBYB 5CU5A 2WXKA 1WFJA 4A7UA 3RHWF 4ZMVA 4LLYA 2Y2YA 2P8PA 1I1AA 4H25B 4D94A 3DMMD 2HKHH 4HULB 3UC2A 5IVZA 2XPGA 1NOFA 4PRAB 3QYCA 3MZTA 4X8CA 1BM3L 1JWUA 3L4UA 5E6RB 1JV2A 1QBMH 1GYAA 3BZ4B 4YSQA 5HY9A 3FTWA 1RUML 2BFVL 5DJ2B 3BYYA 3RWHB 1HKLH 4G7VL 2QTVA 3LHPL 3HE6B 2ZONA 7CGTA 2AV7A 4JFHE 4QHMA 2F5BH 5AYUL 4GQZA 4PREB 3RGHA 4M4RA 3VH8B 1TF4A 3AG4B 1TQSA 4FZEH 4YIQB 3RTQA 2JKXA 3HBPA 5IW6B 4J5VA 2PPAA 2AQQA 2A74B 3H9SD 3DJ9A 3IJ8A 3OMAB 2Q7NA 3WS6A 1HILB 2UWEE 1NFAA 2VDRL 1I53A 1RD6A 3EO0A 4NB7A 3UTSA 1OEZW 3QUXD 1REIA 4FQCL 4UM8B 3VQ2C 5IF0B 3RNKB 3VO0A 4K73A 5FUZH 4GIPD 4X5PA 3SY0A 3QZOA 5GRVL 1UCBL 3ZMNA 1AXTL 3BWZA 2EYRB 1SN0A 3K8KA 2NXZC 5DD0L 2QJDA 5B39G 3TJEH 1XIWA 4X4YA 1RJZB 3MRNB 4FQ2L 2VQ4A 5D1ZI 3PCYA 6PAZA 2VO8A 4PP1D 3U0TB 2XZCH 1DFXA 5IUSA 1RPUA 1A1MB 3HE7A 5CD3A 5DYOB 2WQVA 5HHNB 3BP5A 2GK0A 4PJAF 2Y4SA 3CFBA 5ALCH 3SGEI 4GY4A 4Z3GA 1CDBA 2Y5TA 4GG8A 4JKWA 4O02B 4M1CC 3FU7B 3L81A 2AVFA 3G04A 4NN5B 4N2MA 3SCMD 3NZSA 3W5MA 3DO4A 1AS8A 3DROA 2X12A 1FZMA 2KPNA 5I9QB 2OMXA 4HH8A 2YO3A 3LVEA 4JKNA 5T5NG 4P3DB 3IGLA 2UZYB 3DOHA 5TK2A 1VLXA 1PAMA 5D70H 3D85D 3IGAA 4ONHA 1I3VA 2WQ8A 3C5JA 4JRYB 4XP9H 1KCRH 1XR9B 3QQ4A 3QB7C 4B7LA 1UT2A 5A3IC 1OGTB 3OGOE 1MW3A 3P9MB 5T1JA 4HSCX 4QRSB 4CSZA 3MCLH 1Q9KB 5L0QC 2OMVA 3ZDXE 3D48R 1XCWA 3AITA 4PH8A 1W0WB 5CWSA 4ODSL 4YBQD 1VJSA 1ZXKA 3P9LB 4YEFA 3NIDB 2ESVB 3SPJA 1J86A 1MSPA 2WWKO 2VAAB 2YAMA 2G3XA 1MFCL 4ZFZB 4HETA 2EIEA 5C9KA 1SF3A 1X9UA 4WTWA 1UZ6F 3QH3B 3EJSA 4WFGD 3IWVA 3O9WD 1DO5A 4X7CC 5CZVL 1GAFH 2C34A 4N2CA 4PHZA 2EDNA 1M1XB 1QLRB 1S5HA 2VR7A 4CGUB 4YJZL 4BFGA 4PJ7E 3VD4A 5D7IA 4GKNB 2WLMA 1MCDA 1QW9A 1ZIAA 3OAWA 2N1KA 2DQGL 4S1RH 5DK0A 4MNQA 3EO9H 3O8XB 4GP5B 5E6ZA 5I2IB 5GS1B 2VL4A 5ALCL 1D5MB 1YQVH 4FTVD 4OJAA 3WO3B 1T0NA 1TQCC 4R7NA 4WHTB 4OLVL 5AUMB 1PZBA 4IHOB 4K5MA 2NY1D 4JFYB 2K9UA 1NGXA 2WZAA 3UTQB 2DJSA 1BXXA 3X13A 1KXTB 2XWEA 4U1SA 2FBOJ 4LDLB 5DTFA 1KIUB 1ZDQA 3RKPA 1PNCA 3DYPA 1ZT1B 4YVNA 3NJIA 5FPIA 3PWLB 3R06B 2XTJD 2H3KA 2R15A 1ADQH 1UJ3C 3JWNG 4X7SH 1LVEA 2V8MA 4DTGL 3MUGB 4MD5A 4XZUB 3V5HA 4B60A 5D70L 3ZKMD 4TVPH 1QSFB 3QNFA 5I75B 4ZODA 1CXFA 2MQGA 3HB3D 5ERWA 1H3VA 1T1YA 5ACZB 1G9NC 5I16B 1PD6A 3Q1EA 3BWAB 4PRHD 3ZE1F 4QYOB 5JPMB 3BDYL 1I3RB 3SGDH 2JWYA 4R2GD 3L5IA 4EN3B 5E1QA 4A7GA 3SDDB 3H3PL 4OF8A 2FEEI 3MV8B 2E6JA 4G8GD 4NM4H 4W9IC 1AHMA 3ES6B 2P5ED 4LLWA 3LQZB 3LD8C 4LCCB 5GRYA 1RZIB 1HYSD 4H0GA 4PD4J 2X4UB 4LOEA 3NP3A 2OYLA 1IZJA 2P80A 4ODUB 4Z78B 2NLJA 1GAFL 1JS4A 3OHXB 1S7RA 3PAVA 2DEXX 4FD0A 5DXWA 3K0WA 4F3FA 5DK3A 4FC3E 3GGWA 1EV2E 2VH5H 4NQED 2J44A 4S1RL 3ECBA 1UH2A 1DQVA 1CGSH 1QPXA 1YQVL 2VXQH 5AL0A 3H42L 2C3WA 2PYED 5E1IA 3ZPDA 4X5WA 1CDIA 1OCRB 5CGBA 1U95B 1FFOA 4ACTA 2XTLA 1ZOXA 3QPKA 4XNMB 5FYJE 4UCFA 2O93L 4KI5F 5C09D 4MD0B 1UD2A 4L3EB 2DWTA 2A9MH 2BSTB 2RTTA 2W38A 3ULSA 1F11A 3WNKA 1OT4A 1S8DA 1OAXL 5EU4A 5MENB 4LHUG 3CLFH 5GGUA 3W57A 1QEXA 4X7SL 4NENB 1SJEA 1F18A 4TSAH 1KJMB 1LD9B 1KJ3H 1W80A 3HPJA 4AXWB 4JM2B 1YEFH 2ADIB 3IDIA 2QDVA 2YEZB 2IAMD 2MOVA 1DN2A 1HQRA 5JQIB 2EILB 3CGTA 3KXFA 3L4CA 2D7TH 2XBTA 1KSRA 1DO6A 1HC1A 4X4KA 3JV6A 2CM6A 2TAAA 3MUHL 1W72H 1UCTA 2D3LA 2NY5L 3O45A 1Z2KA 5LWYH 3K7UA 4WO4B 3AS2A 4PRID 5D1QB 1OTTC 3MRMA 1G9MC 1SMDA 1WLHA 2O6PA 2FO8A 1JI2A 2QQNH 3FQYA 3L6FA 3F6IA 1U8CB 3GBEA 2F15A 2M1KA 3O6KH 2L7JA 1NC2D 2DAVA 2HTKD 1HEZB 2KDGA 3S96A 4DH2A 3CFCL 4WTZG 4HCIA 3UJTH 3GMRA 1SN2A 2VLMD 4NRZA 4JDEA 4JHWH 2K1MA 3OX8A 1KGCD 4RGNC 4H8WC 4XPTH 3WDIA 3U2JA 2DWEB 5HYEA 1GGCL 4Z8FL 3MLWH 5HYJE 1JL8A 2R2BA 2VW7A 2DICA 4RMBA 1URZA 2HWZH 3ZRSA 4B3VA 4CDGC 5GS0D 1HCYA 3IU3A 4FXKC 5AZEH 5CJXC 3QDME 1KCWA 1TLKA 1SDYA 1JCVA 3ESPA 3ZDYE 2J6WA 2VH5L 3H3KA 1ANUA 1WC7A 3ARSA 1Q90A 4OF7A 1OY3B 4PTUB 2VXQL 2AGJH 3GBDA 5FO2A 3VI3F 3IVKB 3VXQA 4PLNC 5JORA 1BSIA 3NACL 4PMEA 1Q0EA 2IJ0C 3CDZB 3EBHA 3QO0A 4J8RA 4PWGA 1RERA 5SWZE 43CAA 1GTNA 4AJ0A 3BN3B 4IKKA 2ZXCA 4GXUM 5DRZB 4ZUWB 3SD2A 1T04B 1HCVA 3GC3A 1GZHA 3VG9C 5ETUA 4P2QE 2CGZA 4JFXB 1TT6A 3DMMC 1VACA 3PWUB 3EJYD 2P24B 3VW3H 4CC4C 5CILL 3GRWH 5IOPB 3NCYP 3D8MA 4D0DA 3S36X 4HUWB 1Y07A 3DYMA 3SYOA 2D7TL 3APMA 1G7JA 4FXGB 5AW7B 1MF2H 1QSVA 1UH3A 4N8PA 2QZQA 1W72L 5DZAA 4C58B 4YO0B 3T0VA 1LK2B 1X5XA 2F8IA 2H6PA 3GBNH 3RZWA 3KDMA 1BJ1H 1G84A 2HG0A 2F53D 4HAFA 3O6KL 4KNTA 4PG2C 1N5YH 3CN0A 4H13C 5JHDB 5DFAA 1BQUA 1LGVA 1II4E 1EJ8A 2DWSA 4NN6B 4XP5H 2XXFA 5CJ8A 5EOCJ 4ZXBB 1INQA 3UJTL 2Y2WA 3VFRB 1AG0A 2FO4A 3QCVH 4JHWL 4R8WH 4JMXA 5C0EA 3FYEB 3UROR 3GXNA 2IGFH 3QUXC 3LH2H 2A6JA 4UUJA 5E8EB 2YLHA 3FBQA 3KE0A 1HH9B 1XV8A 4DUXA 2GITB 3VXNA 2CDGB 1PFOA 1WCQA 3CVIH 4BXVA 2KS0A 3D1MC 4DP5X 3S5LB 3EH4B 4YSEA 1KLUB 3GM0A 5C71A 3WMPA 2IDFA 2O26U 5E8NB 2CNYA 2R7EB 1EFQA 5D2NC 4P4RA 4DO4A 2F1AA 2J3SA 3WFCH 4AQZA 4G7SB 4PCTA 3SYPA 3GIVB 1KN4H 2X4PB 4HOWA 3BFQG 4PP1C 2F61A 4XN1A 4X4ZA 2Y07H 1ULVA 3DX4A 3P1VA 4PJ9B 3PAZA 5T1MB 4P2RE 3BPLB 3Q13A 4UB0H 5CJXA 2VLJA 3BEWA 3MGAA 1Y7VA 2N0MA 2NNRA 5FW8A 1S9VB 5E4EB 5F7EH 1U8MA 3SGEH 5EF3A 1DEDA 4WSKA 3SCMC 2NQDA 3MREA 1HAWA 3WN6A 5DD6A 3IDGB 5DJ0B 2FLRT 1YPZF 1ZLSH 1N8ZA 1TZIA 2I24N 3HBGA 3L4WA 2EVJA 2GVYA 2DWDB 4JQXC 4Z3JA 4OIIH 4G42A 2OSYA 2X44D 4APQA 2B2XL 4UV7H 2HFEA 4WU7A 4NHUA 1XF3B 4CC4A 1N5YL 4ONGH 1E50A 1M3IA 4RMVA 2JJTC 4XP5L 2XZQL 3FTVA 3MRDB 3QZBA 1XSJA 2AEQH 2H41A 2B5IC 4B7IA 1D9KB 2WBJB 2D73A 3QCVL 3L4XA 4R8WL 1VIWA 2YGOA 2BPBA 5ISZD 4J3VA 5FYJH 3U25A 3LH2L 5DD5H 1IARB 5J1AB 4PP2B 2BIHA 3SBPA 2EDQA 2CRIA 3J27A 4YBQC 3MRGB 1TQBB 3CVIL 4PG2A 5MEQB 2YGQA 5E6SB 4XGZB 4HUKB 4L8SB 4WW2F 3LEYH 2K9FB 4AT6B 1TZ8A 2OR8A 2R2EA 2KYIA 4PB9H 1LO2H 5GGQH 4YFLF 3ULVD 1OCCB 3N85L 2X4OA 2MCAA 3I6LE 3O9WC 3QHTC 3QUXA 5IK3A 1F1GA 4X8JA 3WFCL 1HVXA 3HCVA 2WXNA 1G1OA 4F8TA 1Z0NA 5IW1B 1VFAA 1B0RB 4MDRA 1IIIA 3MX0B 1FJ1A 5J12B 3LQAL 4R84A 4XB8A 5FCSH 4AQ1C 1BZ9B 1D5BA 4UB0L 1FL6A 1SPDA 4MAYA 4NGHL 2P4AB 3JZ7A 1HL5A 2H26A 2WM0A 4QJ5B 2ZKMX 1J1OL 4HK0A 4WWPA 5DEJA 1VRSA 4PS4H 1UM5H 1DJSA 1FZJB 3Q8BA 3HG0A 4L1BA 3EHBD 4JHBA 3Q6GH 3GTNA 5FCUL 2CGRL 2YK1H 2ZX8A 1MPAH 2R23B 1SDAB 2XTJC 3EUUA 4MDJB 3C60B 4BBWA 3PQYA 2CRMA 4N2GA 4F93B 3U6RB 2NRDA 1RVFL 3MBXL 1HESA 4JCLA 4PI2A 4UANA 3U46A 3V6ZB 4R4ND 2PO6D 3ZKMC 4CL7A 2DEWX 4UV7L 2ZPKH 3HB3C 5T5NF 3BUBA 1E30A 2VISB 1VAHA 4GS7C 5I8CB 3IGKA 4OZIF 1KTLB 2AK4D 5IB1A 3D4GA 4G7QB 3W0WE 4Y4KC 3SOBH 1MLBA 2AEQL 1LLAA 3M07A 2Q8AH 3TEWA 4U0RC 3BPCA 1FBIH 1NIDA 3BKCH 5F6IC 4R2GC 4YGVA 4G9FE 4UMSA 4FJYA 3VD3A 3QORD 1FZOB 3D6GA 3E7JA 2GIXA 5J9PA 1P4LB 2V5SA 3OJDA 3HRZC 1WUZA 2VR6A 4OFIA 4GIOA 2AJXH 4QNPF 1LO5B 3FQNA 2E59A 3LEYL 1UXWA 1DSFH 2UX6A 1CXKA 4FNTA 5KJRL 1HYSC 3OLDA 4PB9L 3VRLF 4P2AA 2EC9U 3PWNB 3RY4A 2GTQA 3I2CH 4AYMC 1B4TA 1F4XL 3X3GH 2AAAA 4PSRA 1EANA 3DVGB 4POZD 2DN7A 5EUOA 1OKEA 3VFVB 3VGGA 4NQSB 3PWPA 2BHUA 4KNUA 3RWCB 4O5LL 4UTAL 1G1YA 3HI6H 2J6EH 1P5UC 4PS4L 3Q2NA 4IOSD 3B5TA 2BMKB 3HNSH 2Q10A 2LU7A 3WNLA 1NJ9A 3DXAD 3GTVA 3Q6GL 2V37A 2AZUA 2VERA 2YK1L 4XPAH 5ICZB 1MPAL 2DQ6A 5IHBA 4NUMA 4AQ1A 1YECH 5T3ZD 4RFNB 3KPSB 2UY7A 1Q9LB 1QBLH 4Y5XC 1CLCA 1N59B 3AWEA 4FEMA 5L4MA 4XMLH 2IAMC 2N7BA 3QAQA 4BH8A 1GPOH 2EACA 5FKPB 3BGFC 2ZPKL 3C09B 5LXGH 3T0ED 5LBSL 1OP5H 5FX3A 3OKMA 5B1JC 3T71A 1HN1A 1YEEH 2VLKA 3WJJA 1A6WH 2VN7A 2Q8AL 1F3DH 2O5NA 5MHSE 5HDLA 3BKCL 2VKWA 4TYUA 3E80A 3CVHB 5DC9B 3SGJC 3D3VD 4XMXA 2Y1AA 3CHPA 1BAGA 3QIUC 4FCAA 3O3EA 5CLZA 3K6SA 4J2XA 1UVQB 2X0VA 3KR3H 4O58H 3H85A 4G5ZL 5C08D 4Y4KA 1ZS8A 2NCEA 1IILE 3CMGA 5AVYB 1AJ7H 1E28B 2W0KA 4XP6L 3VE0A 4ELMA 1NGPH 2GTWA 1RKRA 4ZMYA 2VQUA 2GBAA 4C56D 5GGRB 2BVUA 4J3BA 3VFMA 3S0PA 2CR0A 2X6AA 2WUCL 1XGPA 2AQPA 5GS0C 3GB7A 4HIQA 1PZ2A 5CGMA 1DBKH 3G9AB 4HZLB 3MA7B 4ISVB 2KZWA 4AVIA 2J6EL 1XCXA 2B59A 1GGUA 4ORGA 2KDYA 1DANT 1PDKB 3BUYB 4RA0C 3MLTA 1UKSA 3TL5A 2ZXQA 1F4AA 3SDCB 3ECUA 1OXYA 2C9AA 3D4YA 5KSUB 2ZNWA 1EZUA 2CSPA 4LOFA 1Q94B 4FQPA 3VFPA 5IROD 1CE1H 4NQEA 1XGRB 1YECL 2E9GA 1W8EA 4F8NA 1AQDA 3LN5A 2R56H 1XCQA 4LCUB 2W07B 3TZVD 3EJYC 2MNJB 4LCIL 4OT1H 1E27B 4HOXA 2PLTA 2PYEA 2OMZB 2V33A 4KZDH 2D31A 3DIFB 3OJMB 4XMLL 2HX7A 1ZHNA 2EYSA 4MMXB 1XQ4A 1GPOL 4H7VA 3IMVA 5LNEA 4A2EA 3CMOH 2EUZA 2VDMB 5C09A 3SZ6A 3IKCA 2XY1A 2DMKA 1FE8H 1YEEL 4JRYE 4KTDH 5ANMB 1MCJA 5EUKB 1KDJA 2B4CH 4KV5F 2WAQA 5HHMB 4BZ2H 1A6TA 4JFUA 3TYGH 4BHUI 5FKAB 3FQRA 4UOW0 3QR1A 5L88H 4NCC2 1A14H 5DJAA 3TYFB 1IV8A 4ZO7A 2NX5B 4B5EA 2WLZA 3CFMA 2XACC 3QZLA 4KFZC 1NCWL 5B7EA 5HDBB 3HUJB 2IAMA 4G1EA 4BV1A 2JCCF 3QZWA 1ZWIA 1S5IL 2P45B 1A7OL 2X09A 2XWZA 3OGCA 2BNRD 2DYPB 1TZHB 1IGTA 2ESVE 3NIDE 5B1JA 4KKZA 4FLHA 4UIKL 5CP3H 4HJGB 4QJ4B 2X7LB 4MXWL 2ZOTA 1CL7I 4BEIA 1AJ7L 2CPUA 1NGPL 2HLFD 1M7XA 3CV5A 3MBEA 4PRIA 5GGTH 1NZRA 1M2VA 32C2B 3NJHA 4WJG3 3X3FH 3R7QA 4XOCA 3SGJA 2QVIA 4QRPE 5IFHL 3FCGA 3QYMA 2F74A 3QIUA 1UZGA 1DBKL 1M7IB 3DV6B 3MRFB 4MSWB 1X5IA 3UZVB 3KWWA 2C9QA 2DLGA 3C75A 2GJ6B 5EBLA 2J5LB 4OCXL 2LAGB 4CVWA 4QIRA 5I74B 4GW4B 3C5SA 3PLYA 4JFFD 1BZQK 4FEIA 2E9JA 4N25A 1LQSR 1UM6L 1A7NH 4QTIH 5E9AA 3LPFA 5HPMA 4I4WB 1SY6H 2VSMB 3HKFA 3V0WH 4OCYL 2KLSA 2NUTB 3B2XA 3LH9A 3D87B 4XE0A 3VXSE 1XZ0B 4QRUA 2O6DA 1CE1L 8PAZA 4JANA 5C07D 4W9FC 2VM3A 3RAJH 4HHGA 2XFGB 4AZ8A 4DO5A 2OX5B 3CFJB 1T89C 2UVFA 1JVOA 4NZTH 1IAOB 3N06B 5KSBF 4BKLB 5TDPB 2BSRB 3DVNA 1QSFE 1BCIA 3A0OA 4FNSA 3UJJL 3CMOL 1D3CA 2YPLD 3N42B 1N67A 4EUPB 4KMTH 1WIUA 2OJEB 1TO4A 2ZAGA 4L4VA 1JXKA 4KTDL 1W0VA 4GKSA 5IEKA 2B4CL 3UTTE 4D8OA 5F8QC 1FNEB 2Z31D 3L1EA 3UYRH 1DVFD 2GKIA 4PRNA 3FL7A 1A14L 1K6QH 4HD5A 1S7QA 2GFBA 1N2RA 4XC1H 2LV4A 4IBLT 4FLOA 4OKVA 3KLAB 3R7RA 3HMWH 1ZLWK 1SXCA 5T3XE 1VKXB 1BX2B 3LZNA 3OR7B 2YBRA 3FT0A 5I73C 5KAQG 3HMXA 3PWVA 4D3CH 1C12B 2PPCA 1DLHB 1MWAA 4TMPA 2V9QA 2VO5A 1IGCH 3QCTH 1OAKH 1O6SA 5LNDA 5EBWB 4IRJA 4CA4A 5F0JB 1K2DA 4HV8B 3FMGH 5D7JC 4D8PB 1NMCC 1CE6A 2VM9A 4JO5A 2DIJA 5JYLA 4YXHH 1RH8A 4ABUA 3LS5L 3TH2T 1NIFA 5D9SA 3DTUB 3K2IA 2NY7H 5BUPA 3ULVC 5D7LD 3ILQD 3ZKXC 1G7PB 2ZX6A 4Z7VF 2NY6B 2WZ5A 3MXWH 2NY4D 4M03A 5JHAA 2Z91B 1OPGL 1RK1A 3HVNA 1A7NL 3V52H 4QMEA 4ZOCA 3MUUA 4HDIA 3ZJAA 3V0WL 5J57B 4LLQA 2DQFB 4IBYA 4XN5A 4LARL 5GS2H 4AQAB 2YRZA 4A7TA 1PF3A 7TAAA 5GSRA 5BRQA 1NCIA 3RAJL 3ZZLA 3QUMB 1J5IA 1IC4H 3EFOA 4NQUA 4NZTL 3EHBC 3QDHA 3BIKA 4YDNA 3TESA 4KMTL 4DK5A 4TUJB 3SE9H 1S78D 5I66B 1NTDA 4PWFA 1I7ZB 4N68A 1KIPB 3IETA 5DHMC 1KCLA 1RURH 3UYRL 3G6AB 4ZNEA 5MI0B 4XMPH 3ILPB 5DR5H 3T08A 4PJFA 4R4NC 2FHCA 2H3XC 2PO6C 4XC1L 1F45A 3VDAA 5H37A 3EFFA 1O9WA 1T89A 1J8HA 3WKYA 3HMWL 2WQRA 1JGVL 5I1AB 1NMAH 1QR1B 2XQYA 2EJ1A 3P69A 4D3CL 1B0WA 1HL9A 1KYFA 4O02H 2YWZA 3PU7A 4PGCA 4UQAA 1NFDE 4Y7MA 5IKCB 3QCTL 1OAKL 3V9FA 1I31A 3VXRB 3MCKB 3VTAA 3DX6A 1CDYA 3BWUC 3OKNB 3OWRA 3QORC 3SB3A 3O2VH 3VGEA 2ID5A 4RZKA 3OXSA 2PYFA 2ITDA 3NRFA 2BHYA 3MOBH 2LT9A 3KPMB 2B20A 3ZDZB 4K7PY 4X8XA 4U05A 2IDQA 4KZ0A 2NY7L 4XH2B 1OAYL 3QC5X 4NPJA 5IBUB 5D1XE 4M7JH 4RMWA 1UJTA 3SYQA 3MXWL 3VGAC 5AVTB 2OV0A 3S2CA 4XVTH 1NBZA 1MCEA 5E56A 4JZJC 5D7JA 3V95A 5GIRB 4BKTC 5KN5A 5E2VH 2ZKXA 4F57L 4ZFOB 1FVDB 4FLSA 2DV6A 1OCOB 4LFHG 5M7QA 4Z7QB 4GRLB 3U2SB 2VDQL 4P4KD 4X9HA 1C7TA 4Y4HB 4BSVA 3VXMD 5GHWH 3UG4A 1HK6A 2GSIA 2NUPA 5EC2A 1P7QD 4QLRA 4HPYL 3B37A 5JQHC 1IC4L 5BPPA 5HYQB 5KYNA 4F15C 1M9WA 1Z3GH 2HVKB 3O3DB 1QNZH 3V6OE 2WXMA 1S9XB 2W60B 1YNTA 2FGWH 5D96B 3ZDXF 2VR8A 1L9RA 3KL3A 3UMTA 1BG1A 4P05A 1ERNA 4LCYB 1OB1A 1SUJA 5F7WC 4H20H 3HZKA 3SE4C 1X9RA 4O51A 4KQ4H 1N5AA 1M53A 4Y9EA 5L4FA 15C8L 1WITA 4EAEA 1Z32X 5JHDE 1BD2B 5KYUB 2GHZA 1IKNC 4PRBB 1Y0LA 2DLEA 1BVOA 1G0YR 4O02L 1XT5A 5D5MA 2D7MA 4H8VA 3HKZA 4R90H 2ZOLA 3L9BA 4MKTA 2CH8A 2E3VA 2AJZA 3O2VL 2NXYB 3S37X 3VWKB 1NDGA 5ACLA 1ETZA 2C7UA 4WWKD 4LF3A 3J2PA 2AK4A 2XWBB 2WLJA 3C6SA 4GSDL 3FB5A 2OJ1A 1QSEB 1CXEA 1H19A 12E8H 3MPCA 5E2WL 5FLUA 4GP4B 5D55A 4M7JL 4ZYKB 2HMID 4HIIB 1LK3L 1SJHA 2V3EA 4XVTL 5HGHB 4U1LA 5JOPD 3IE9A 3K6DA 2VDKB 3BESR 2NNFA 4HWNA 5JQ6L 1DQTA 2DY2A 5E2VL 5FWRA 5C0GB 1BFSA 1G7HB 2XETA 3NABH 4FERA 1UA6H 1N70A 4LEXH 1BJMA 4OZFA 1EUUA 3WKQA 2UX7A 5DZNA 1MWOA 2AP2A 1CFMA 1HHKA 3ATBA 4YE4H 2VDNB 3LPWA 4QOKD 3L1FA 1FSKB 3L08A 2IDUA 1P4BH 5K1VA 1Z3GL 3FULA 5DVPA 1QNZL 1Y6KR 5CSGA 1NLDL 2XTSA 4HIJB 3SE6A 3EF7A 4M56A 5AFAA 1K4CB 2DMBA 4JZJA 5HYFA 1G5GA 2CA3A 4ATTA 2FGWL 3V0IA 1AD0A 2AJ3A 1S4IA 3EJZD 3BEVB 2QPUA 2VT0A 4Z7WE 2NY5C 3I3EA 3TZVC 2WLLA 3HN3A 2WBWB 4H20L 4NO5A 1R3KB 2Q7AA 3FQXA 3D39B 3GHPA 3QEGH 4LVHB 3QEQB 3T6ZA 4ANXA 2YFOA 3GXFA 3CAFA 3DXAA 1DQML 4BFEA 4OGXL 5HHPA 2EDRA 4QT5A 4OVUA 1OF2B 3O4LB 4HH9B 2AEIT 1UEYA 3HG1A 2J1XA 4LNRA 4R90L 3CXDL 2VZTA 3TASA 4NZDA 2X0WA 3BCFA 4FFTA 2YD5A 3IDJB 4TQEH 4E0RB 3AACA 1H0DB 4Y8DC 3WHXA 1SHWA 4D9QD 3VYPA 3MUZ1 1IGFL 4NKMA 2IQ9H 1KULA 2VJXA 3SBWC 3MV7A 1IKNA 2EDJA 1AY1H 4YR6B 3FUFA 1I3GL 12E8L 2XRAH 4YHOH 2HLFC 1X7QA 1CL7H 1DLFH 1YN7A 4WTQA 3U7AA 3D3VA 1LP9A 5AW4B 4DW2H 1NH6A 2ROXA 4LPTA 4LEXL 1UA6L 1IGIH 2FEDD 3TH3T 4NFDA 5I6LA 4OLXH 2BP8A 3QG7H 2Q0ZX 3L4TA 4JO3L 4YE4L 2FUQA 1QP1A 3P2BA 2EVGA 4C56A 1LTXA 2RAMA 1BVKB 4LEOB 2YD7A 5EA0H 1NAKH 1OCWH 4A68A 3T2PA 1TVHA 1O9VA 2BIMA 3CWGA 3MLVH 3SKOA 3FSZA 5FHAH 3ELQA 5DO8A 1K3ZA 1P4UA 4G8EA 1Y1UA 3K46A 3L3HA 4AIOA 3S4SB 5JPNB 3Q1SH 1ADQA 4ALAL 2QBWA 3L5XH 2XA3A 4PCKA 1ND0B 3ABGA 5DEGB 4PJEA 1F4YH 1U30A 4HUXA 1WISA 4Z5RA 3ESMA 2HX9A 2D2OA 3HNTH 5E08H 2ZUYA 1WZKA 1JK9A 1Z9SA 1AFVL 3QFJE 4GB9A 4Q9BA 3V0FA 2OM5A 4LPWA 2Z31C 3JUYA 1IM9B 5C0DA 1TQWA 4PJIE 1DVFC 1S7TA 3QIBA 5JIIA 4QGYA 4IS6B 1HDMB 4NUQA 3V4VL 3BLBA 5IQNA 4Y19D 3ZDYF 5EZLB 3Q05A 3ETBJ 4Y5YC 1Q0XL 4ACPA 4M1DL 2WXHA 1RIHH 1GW6A 4Y8AA 2IQ9L 3HR5A 3T65A 1FFNB 4Y9FA 2BC4B 1AY1L 3E1ZA 3CFKA 3ZZQA 1MG3C 4JFDE 1VGEL 1C8PA 2Z7WA 4YHOL 1BJ1J 3EOAA 4M8QB 2HKFL 1LDPL 3DJTA 3HR6A 1DLFL 3NSFA 1E8ZA 4N2KA 3D33A 4AH2B 2A9BA 5IBTH 1SGKA 5LNGA 4OUOA 3P3RA 1MVYA 1IGIL 5CCKL 4NO2B 4LSQH 4DCQB 2CHWA 3COOA 3QG7L 3ILQC 1KYDA 2DQEL 3DTXA 2DF3A 1ZCRA 4TUOB 3TBVA 1PY0A 2NY4C 2VXQA 2FCBA 3IDNA 4KHXH 1CC3A 3FH5A 3T6XA 1NAKL 3TBWA 4QF1B 4AYDC 3TCXA 4YZWA 5FHAL 3FUMA 4DP0X 2Y06H 5F1OB 3TGXA 3X12B 4ZFFA 2V3FA 4XWGL 2UWEA