3SZ7A

Crystal structure of the sgt2 tpr domain from aspergillus fumigatus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
151
structure length
151
Chain Sequence
GPRSMAPTPESDKLKSEGNAAMARKEYSKAIDLYTQALSIAPANPIYLSNRAAAYSASGQHEKAAEDAELATVVDPKYSKAWSRLGLARFDMADYKGAKEAYEKGIEAEGNGGSDAMKRGLETTKRKIEEANRGAEPPADDVDDAAGASRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural model of the Sgt2 protein and its interactions with chaperones and the Get4/Get5 complex.
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Chaperone regulator
molecule keywords Hsc70 cochaperone (SGT)
total genus 56
structure length 151
sequence length 151
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13414 TPR_11 TPR repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3sz7A00
2VSYA 2BUGA 2XGMA 3E4BA 4G24A 4JA7A 3ZN3A 1IHGA 4H7YA 5FZQA 1PC2A 2XEVA 4GYOA 3NF1A 3MV3B 4I17A 3UUXA 4J8FA 3PE3A 3QOUA 2I6HA 4GCOA 2AVPA 3GYZA 4CDRA 4J8DA 2LNIA 4W9RA 3KD7A 1OUVA 2E2EA 4ABNA 4JL0A 3ZFWA 4H7XA 1WM5A 4UQXA 5HQ8A 2XCBA 4JA9A 2PL2A 4RG6A 2FF4A 2WQHA 3CKBA 5G05J 2ONDA 4WNFA 4CGWA 5ARGA 3IEGA 4YVQC 3ZGQA 2FEZA 2IF4A 3QDNA 5EX3A 2XGOA 3RU0A 4F3VA 2C0LA 4B94A 3WXXA 4AY5A 3CK9A 4O6FA 3MA5A 2J9QA 4UI9K 4WNEA 4XI0A 5DBKA 3AS5A 3FWVA 4A1SA 3CK7A 1ELWA 5FT9A 2UWJG 1TJCA 2VGYA 3URZA 2Q7FA 5D0QD 1KT0A 1Y8MA 3SF4A 3UQ3A 4EQFA 2UY1A 3ASDA 4BTBA 1ZBPA 2MHKA 3FFLA 2V5FA 3TG4A 3RJVA 4GA0A 4XIFA 1HXIA 2C2LA 4AY6A 3CEQA 3EDTB 1A17A 4J0UA 1NA3A 2C0MA 3Q15A 3S7JA 3TG5A 5M72A 3PE4A 5C1DA 2VSNA 2Y4UA 1HH8A 3CVQA 3RIBA 3S7BA 4XI9A 3ZHEB 4N2QA 1WAO1 5KJKA 2FO7A 4JHRA 2WPVA 3MKRA 4UI9J 5FZSA 3U4TA 1KT1A 4I1AA 2KCVA 2OOEA 4I9CA 4HOSA 4G2VA 4KYOB 5BNWA 3CK8A 2NC9A 2IFUA 2KC7A 3CKCA 4ME2A 4RG9A 4G26A 3U3WA 2P58C 2VGXB 5HI7A 3LY7A 5JJ7A 3LYAA 4GA1A 4U0SA 4WUYA 5JJ6A 3KS2A 4BWRA 4GZ6A 3QWWA 4J8EA 5KJMA 4IN3B 4GCNA 3R9AB 4BT8A 5FZRA 1W3BA 3LCAA 2YQ8A 4GA2A 3OXLA 2UY1B 4Y6CA 4LEUA 2PZIA 4N5CA 3Q47B 2KATA 1YA0A 3RO2A 3GZ2A 1B89A 3LPZA 5FTPA 4APOA 2VYIA 4I9EA 2DBAA 4UQZA 5BT1A 3PDNA 4U0UA 4N39A 1FCHA 1KLXA 4U07A 1ELRA 5EKQD 5G04J 4NQ0A 2HR2A 3Q4AB 4GZ5A 4KBQA 3LKUA 1QQEA 5FJYA 3ULQA 3LY9A 4G1TA 4YNDA 5KJNA 1P5QA 3JYSA 3Q49B 5LCWJ 4N2SA 3AS4A 3SZ7A 3FP3A 4Y6WA 5DIZA 1NA0A 4G23A 4HOUA 4YVOA 2XPIA 3ASGA 5A7DB 3OXGA 4N3BA 5BW8C 3Q5MA 3AS8A 4UI9C 3ESKA 3BEEA 3GW4A 3GZ1A 2VQ2A 3O48A 5G04C 3QWVA 5CCLA 3TAXA 2XGSA 2LSUA 2HYZA 2R5SA 4GYWA 4UQYA 3ASHA 2JLBA 2PQNA 4WNGA 3RO3A 5A6CA 3TGOA 2HO1A 1IYGA 3CVPA 4HOQA 3S7DA 4GZ3A 5CHEE 4HORA 1XNFA 4AIFA 2QFCA 5LCWC 2XCCA 3K9IA 3LY8A 3HYMB 1HZ4A 4WNDA 2PQRA 3RKVA 4GYYA 3S7FA 5KJLA 5ARFA 4GPKA 1ZU2A 4BTAA 2YHCA 3ASFA 1NZNA 5D0OD 5AYWD 1QZ2A 3MEKA 4NRHB 3CVNA 1E96B 3CV0A 3N71A 3OXFA 4I2WA 2Y4TA 4N3AA 5CCMA 4CGVA 2VGXA 3VTYA 2LSVA 5G05C 3QWPA 3MV2B 4AM9A 5JJTA 5EX0A 2KCLA 4HOTA 2KCKA 4G25A 4U0ZA 3KAEA 4I2ZA 2L6JA 4KXKB 3VTXA 4BT9A 3CVLA 4U04A 3ZPJA 3QKYA 2FBNA 3ZHEA 4N3CA 2GW1A 3UPVA 2FI7A
chains in the Genus database with same CATH superfamily
2VSYA 5EIDA 1MX2A 4C0MA 5FZQA 4ANUA 2V4HC 4WWPA 1WG0A 1G3NB 3ULYA 2F8XK 3ZFWA 1E90A 2EINE 4CDMA 2ONDA 4U95D 1HX8A 4AY5A 4EHMA 3UM3A 4UI9K 1ELWA 2UWJG 3DEOA 4UWGA 3L6AA 2RD0A 2LXMA 3BU8A 4HXIA 3FDHA 3ONKA 4M7CA 1A17A 1S70B 5HS0A 1N54A 4LUNU 4MRUA 1X5BA 3TJPA 4BESA 1E7VA 3LXUX 1H6PA 4EPZA 3PZ2A 3CQCB 3EUVA 5J08A 5ANLA 2OV8A 3T5XA 3CHQA 4OVUA 3ABKE 5FQ7A 4Y6WA 4G23A 2RFAA 5BW8C 1FVFA 1JCSA 1FT2A 2ILRA 3DSWA 2QYUA 2PM6A 5CHEE 4C0EA 1UOHA 3BG0B 3K9IA 1SA5A 3S7FA 5G2NA 2KCLA 4HOTA 3CVYA 2BEDA 3HXCA 3ZPJA 3V2OA 2FBNA 2LUHA 2HE0A 4FHJA 3ZN3A 3IHVA 1PC2A 4OYSA 4GU5A 3MV3B 3UIPC 3UT7A 3DPYA 2DWZA 4JW1A 3B7UX 5HQ8A 4JA9A 3RRMB 5EX3A 1TNYA 1JCRA 3CK9A 4WNEA 4AXHA 1Y8MA 4DX5D 1JUQA 1FPPA 2IOLA 2C0MA 2NXPA 4GTOA 2GRPB 3ZHEB 3B7SA 4JHRA 3KSQA 4NACA 4G2VA 4KYOB 2P58C 4HBDA 3I4RB 4K0RA 4BWRA 1MJ0A 3AU4A 3MKQA 4GMLA 3ESLA 3FUNA 3TWWA 3HXDA 3PDNA 1FCHA 1RZ4A 4XX5A 5HRYA 3ULQA 3LY9A 1V55E 1LD7A 3ZXSA 3ZEFA 5EYPF 3FUEA 2EIME 1LTXA 3EIQC 3QNKA 3S7DA 3Q75A 5ENSD 3FTWA 2J8SD 4MKTA 5T4YA 4U0ZA 1DC2A 1K1BA 2XRYA 2FI7A 3G2UA 4U7EB 3ABLE 4H7YA 1MZCA 3V31A 4GYOA 3NF1A 4J8FA 2XZDG 4DJAA 2LNIA 3D9NA 2ETCA 3VLDA 3LDZA 4YVQC 1WDYA 2FEZA 3QDNA 2CFUA 2X6KA 3EU9A 4UWHA 1TJCA 1DCEA 2Y0BG 3LJ3A 3L9TA 4HLLA 2MHKA 3RJVA 3TXMA 1H6KA 5KBAA 3PREA 2QZAA 4AY6A 1YCSB 5LX8A 2XS1A 3CEQA 4J0UA 3Q15A 2VJ8A 2VSNA 3MKRA 4GZCA 2IU1A 2I1JA 1D8DA 3RRUA 1E8WA 4RG9A 2VGXB 4JVSA 3Q78A 3B7BA 3ZUVB 4U0SA 3U64A 5BXOA 1Z6TA 4LG6A 3ASOE 1N4RA 4YDOA 5B1AE 4APOA 5BT1A 3G2VA 3S2AA 3T9KA 1BPOA 3O4ZA 3FUHA 3SFZA 3HDXA 4TXRA 4ZHBA 4U63A 3CGHA 5AJDA 4OAUC 3P2BA 2X6FA 5LFAA 4L9PA 3GZ1A 3OAWA 2YHEA 3MYVA 3NAWA 4C9BB 3B7RL 4LCTA 2V5QC 4BERA 2WXPA 3MGBA 2I1KA 1BU9A 2VGXA 3QK0A 4KZCA 4K5AB 3MV2B 3Q7FA 4XZ4A 2ZGDA 4IYPA 4RLYA 4UWKA 4KXKB 3E30A 2IO2C 5FQ8A 3UPVA 3E4BA 2Y1LE 4B8CB 5EDSA 1SZ9A 3PE3A 2R02A 1TNZA 1OUVA 4KVMA 4JD2G 5CRUA 2DZOA 4FU3A 1OXJA 5ENTD 1IHBA 3URZA 2AXVA 4O60A 3DPDA 2WXGA 3CR3A 4EBAG 4DX7D 2Y4UA 3S7BA 1N52A 5FZSA 1D9SA 4FLBA 2DYRE 2A4ZA 4G26A 2MYOA 3LVRE 4J8EA 5BPPA 4K5CA 3UMVA 4GA2A 3OXLA 4HRNA 3FTSA 2KZTB 5AARA 4U0UA 3ENEA 1KLXA 4RSYA 1P5QA 1NL4A 5LCWJ 2BTDA 3CSTA 3JUIA 3PUJA 4UWFA 3SNXA 2VQ2A 4CDNA 2WM9A 4TUMA 2ZGGA 1MHQA 1EF1C 2V0PA 1UJKA 3B13A 4AIFA 4HS2A 5LCWC 3LY8A 1UG3A 2P9PG 2L6BA 2GRQB 1RW2A 3SHFA 2X3MA 4BX9A 5G05C 3QWPA 5D66A 3SBTB 2KCKA 4ACLA 2L9BA 3CVLA 2WB2A 3UI2A 2J07A 3QKYA 1PAQA 4AEZC 3ZHEA 4RVBA 1QQEA 3HVEB 3EHQA 1Z5SC 1QNFA 2EIJE 1NI1A 2P9SG 3C3RA 2XS8A 4FA6A 2PL2A 3ZXPA 3DBSA 2DYSE 4P29A 4XI0A 5DBKA 3QB2A 3E37A 3J5QB 5AN8A 1QYMA 5EILA 3SGHA 2WXHA 4ATZD 3DSXA 3S7JA 4I1OB 3I3NA 1HH8A 3CVQA 1WAO1 4UI9J 3ML9A 4L23A 3KEAA 1E8ZA 1N9AA 2GRMA 3TWQA 5KJMA 3VLEA 5KCMA 2GRRB 3Q47B 3FUIA 4HB5A 1HFAA 1AP7A 4WWNA 5A7DB 4B93B 5FWQA 1Z3XA 4GYWA 4XKBA 3RO3A 1H2VC 2RKKA 3FH7A 2P9UG 4CT4A 3FEYA 5D0OD 3UINC 5CCMA 3VTYA 3EHMA 1Q2ZA 5ENQD 2V4LA 3NB2A 3UXGA 2WXKA 4ZFHA 4I17A 3NZSA 3GYZA 4EECA 2IEJA 4H7XA 4J6IA 2FF4A 1A5EA 5ARGA 4WAFA 3ZGQA 3RU0A 2AXUA 3AS5A 3MCXA 4L1BA 4XIFA 3VLFA 4Q69A 4XI9A 5KJKA 4B89A 3TWXA 2XPZA 3U3WA 1H6OA 5CERB 3IBEA 4HRLA 5JJ7A 3PZDA 3R9AB 4K5BA 2LAHA 4JEHA 5AENA 3LPZA 2MOWA 3PZ1A 3UKUG 5FJYA 3EHRA 5CMYA 4L2YA 5AAOA 2J49A 3TAXA 1OCCE 2B6CA 2I9CA 5JHAA 3QJZA 2I2OA 1PY1A 2RG8A 1OCZE 4G25A 3L08A 3KAEA 3IKOB 4U96D 1E8YA 3E33A 3F6QA 3D9LA 2CHZA 5AQAA 4JHKA 3UUXA 2AJAA 2CG2A 3TL5A 5JMND 1WM5A 2WQHA 1O5MA 2DVWA 5JA4D 1N4QA 2IF4A 2C0LA 3AJIA 2KZTA 4B94A 3APFA 3MA5A 4XEIG 4QQIA 5HKPA 4EBAA 5IY5E 5BV0A 1D8EA 2IO3C 4DX2A 3ABME 5M72A 1BI8B 2GROB 3B95A 3ZRHA 1OY3D 4HOSA 1SQMA 4AP2A 3LY7A 3D9IA 4J8YA 3UIOC 3ZYMA 2ETBA 5FZRA 1W3BA 3GZ2A 2VYIA 2DBAA 5G04J 3Q9NC 3AG2E 4GZ5A 4KBQA 1E8XA 3TXNA 4BETA 3JYSA 4FJYA 5DIZA 1K1AA 4UI9C 3CVUA 2FULA 5G04C 3APCA 2HYZA 4UQYA 4WNGA 3C3OA 4I6EA 3CVPA 5FINA 4GTVA 4DX1A 1EPUA 1MX4A 1E96B 2ZIRA 2X6HA 1K3ZD 3LVQE 2ZISA 4EZLA 1O1SA 1IHGA 4CRWA 5KWDA 2I6HA 4GTPA 1MX6A 3R9MA 2NYJA 3TWRA 2DCPA 1O1RA 2IONA 4F3VA 2XEEA 4GZDA 2QYJA 3FU6A 3SF4A 1ZBPA 4KMOA 4U8VD 3JXIA 2HM8A 4N2QA 3CHSA 2H6HA 3LS8A 1KT1A 4BSZB 4BEPA 3LYAA 4CCAA 4BSXA 3Q73A 4IULA 3LCAA 4ATGA 4LEUA 3D9KA 2YINA 3R7RA 4U07A 1HG2A 3FUKA 5BUZA 3G2WA 4HOUA 2XPIA 3RK6A 4JEUA 5FIOA 3FU3A 2JLBA 4HOQA 4ANXA 2XCCA 1FT1A 1NZNA 3MEKA 4N3AA 3CVNA 4DRXE 1XGWA 1YMPA 1INZA 3SQVA 1WY6A 2XGMA 2EILE 3L82A 4NIKA 3IV0A 2VGEA 5JHBA 3R7QA 3IXEA 1Y6IA 2Y69E 4WNFA 3RAUA 4FLHA 2XRZA 4TV3A 3UQ3A 2UY1A 3X2QE 3EU5A 2WXJA 2C2LA 4LSZE 2WPVA 1EYHA 3JCKC 2KCVA 2GRLA 1UJJA 5BNWA 2NC9A 4OAVB 1UN9A 4EZJA 4LNBA 4GZ6A 3QC1A 3L22A 2J09A 3UT4A 5AIJA 4M3OA 3JUEA 4N39A 1OWMA 3Q4AB 4LERA 4YNDA 3UT8A 3MJWA 4F1PA 3Q5MA 3AS8A 3L16A 3RRNB 5A6CA 3PH0C 2IY0C 4B8AA 3FTVA 2F8YA 3N71A 4BX8A 3FTYA 4N5QA 4JB8P 3FEXA 4ILIA 4FULA 5ITZF 2L6JA 4BT9A 4PS3A 4A1GA 2BUGA 2GRNB 5EN5D 3FH5A 3L13A 1TEZA 3WG7E 4GCOA 3ASNE 5FQ6A 1HF8A 4MBGA 1HU3A 4TUUA 2B0OE 5LP0A 2WXMA 2E0IA 2VTBB 1N95A 2WQ7A 3BG1B 1AWCB 3QARA 4BY6A 1FVHA 3HXBA 4ANVA 1OT8A 2FO1E 2CFZA 3G2TA 5ENPD 3FU0A 1HO8A 3BUAA 3EJNA 5HI7A 2KXPC 4GTMA 1OWOA 4WUYA 5JJ6A 3KSLA 1N11A 4AOFA 1ZB1A 3CIAA 2YQ8A 4DUIA 2P9LG 4FP7A 2J4BA 2PZIA 2KATA 2WXFA 2ETAA 4UQZA 1EDUA 1S0PA 3V79K 3SD5A 1TR4A 5D2MC 1V54E 3FHEA 4URKA 5KJNA 1JWFA 3CVXA 4ILHB 4ACKA 3PZ4A 3ZYLA 4RQIA 2LSUA 4CT0A 5A23A 1TN8A 3PVLA 3TGOA 5E76A 1X81A 1XNFA 2P9IG 3C5RA 4GTSA 3AG4E 4CGVA 1NP7A 2OEVA 4I43A 3U9WA 3V2XA 3ZU7B 4Z68A 1IQUA 1KZOA 5EIBE 3D9MA 3ZVVA 2XZTG 3HG0D 2YNQA 1GW6A 2QC9A 4JHJA 4HQDA 3NBNB 1DVPA 2OCCE 2XEVA 3EIJA 3GZSA 4UQXA 4RG6A 4GTRA 3CKBA 3CSFA 3IEGA 3D9PA 3UM0A 5EYLA 4A1SA 5AQ7A 2Q7FA 5D0QD 1KT0A 4EQFA 1OCRE 3AU5A 1L5JA 4G11A 3SBSA 4YDWA 4I9CA 1ELKA 3CKCA 3C72A 2WXRA 3KS2A 5ENRD 3HXEA 3Q79A 3I4GA 2UY1B 2NSZA 4GPMA 5G55A 3UX4A 3E32A 4CZ2D 4E6HA 1KPSB 5BV1A 4U8HA 3PS6A 2H6IA 2PQNA 2GGFA 4GZ3A 2XPYA 2PQRA 1ZU2A 5CMWA 3OXFA 2Y4TA 1NFIE 4I2ZA 3VTXA 4N3CA 3P1UA 4G24A 5CBNA 5AQ9A 5H7PA 4DLOA 3PRZA 3ZKJA 2CG3A 3QOUA 2WXOA 3KD7A 4XKCA 4ABNA 4JL0A 3CQGB 2AW6A 3FTUA 1OWPA 3DSTA 5CEAA 4JPSA 4FJZA 2X6IA 4DI3A 2WVIA 5FT9A 3UM2A 4HFGA 3TWVA 2DIWA 4GA0A 3DSVA 1HXIA 2IJGX 4YDEA 5CBOA 3D9OA 4PS7A 3RIBA 3U4TA 5B3SE 1S63A 2OOEA 1OWNA 4GMRA 3FUJA 3OTNA 3ML8A 4U8YD 3HIZA 3PEUB 1TN6A 3ONLA 4GA1A 4IN3B 2ZXWE 3ZYQA 1IKND 4KZ0A 2KBXA 3NOGD 5EKQD 3DSSA 3TWTA 4PUCA 4G1TA 5ENOD 3AS4A 3FTXA 3FY4A 3ZW3A 3ASGA 5CCLA 5AQBA 1JCQA 1IYGA 3JXJA 2WXQA 4KT6B 3AG1E 1OWLA 4WNDA 5AJLA 3ASFA 4G8KA 1IQRA 4GTQA 2WMNA 5B1BE 3UM1A 3UKRG 4CEMA 1TNOA 4F6RD 4FC8A 4A55A 1SW6A 2QY7A 1BD8A 1SZAA 2JEKA 4F7AA 3FH8A 2LO6A 3LEWA 2BF0X 3CVVA 4LNGA 2WXIA 3SFYA 4GMJA 2F0YA 4CGWA 2XHEA 2M63A 3WXXA 2XQ0A 1U3CA 2VSXE 3DRAA 2P2CP 3D9JA 4DI4A 2V5FA 4ANWA 4UWLA 1TYQG 1UN8A 3SI5A 2R17C 4FHKA 2FO7A 1DCQA 1JPLA 4IRUA 5LOZA 2IFUA 2KC7A 4Q94A 4Q96A 5FQ4A 4WWOA 1TNBA 1Z3YA 4PDXA 4Y6CA 1SA4A 4I9EA 3LKUA 1HS6A 3Q49B 4QFVA 3FP3A 4HNAD 1S64A 1E7UA 3ESKA 3FUMA 3GW4A 4TXPA 3DWLG 2J08A 2BKKB 4R7LA 5C2YA 1HE8A 3W9FA 1TN7A 3HYMB 3FUFA 2XEHA 2YHCA 2R2LA 4NRHB 3CHOA 5BXUA 3SFXA 3HRAA 3PNLB 3L17A 4X8QA 4AM9A 5JJTA 3QAQA 1N0QA 2GW1A 4W9RA 1LF8A 3JQ1A 2EIKE 4EZKA 3TWSA 3JQ0A 1VDYA 2WXNA 3HXFA 2BKGA 2E2EA 3BQOA 2XCBA 2P9KG 3J5PA 1YYHA 1MYOA 4GPKA 4O6FA 2J9QA 2VSOE 3ZIMA 3Q9UC 3ASDA 2V8SE 4HRMB 3TG4A 1NA3A 5C1DA 2AXZA 2IQCA 3T8MA 3APDA 4K03A 2OVFA 4I1MA 3LJNA 4YDYA 3CK8A 4ME2A 2ZU6B 1H2TC 1QBQA 3PEVB 4HI8A 5E75A 5CEDB 3PNTB 3T5VA 1B89A 3D3MA 2X6JA 2J4DA 4O1OA 2XENA 3U66A 1H19A 3DSUA 4DLQA 1NA0A 2P9NG 3DXKG 4YVOA 3SO8A 4N3BA 4GB9A 3RSEG 2R03A 2LXLA 3UTMA 3HVEA 4TXQA 2R5SA 1O1TA 4I6GA 4ILGA 2HO1A 3KEZA 1HZ4A 3CHPA 3RKVA 1QZ2A 4CYMD 2AWIA 4J7WA 1DNPA 4U04A 2RFMA 3G2SA 2OEWA 2VTBA 4GTTA 3I5PA 4J8SA 2AVPA 4J8DA 1H0AA 3NQPA 4BFRA 4TRQA 1TNUA 4LRZA 5J90A 4XE0A 3V30A 1TJFA 4D10C 4HLEA 4F53A 4JC8A 4OVVA 3DXMG 3FWVA 3CK7A 4CDRA 3C3QA 3L54A 4A3TA 3PZ3A 4G8LA 3TG5A 1HG5A 4JXTA 4B0ZA 1UW4B 2H6GA 1N0RA 4I1AA 3AG3E 2F37A 4MLPA 2A5EA 4NURA 5KNGA 5CRVA 1BI7B 3QWWA 4BT8A 2JABA 1JWGA 1N4SA 3Q7AA 4N5CA 2MRIA 4JZYA 3TWUA 3AAAC 3RO2A 4PH4B 5FTPA 1ELRA 2A5UA 4NQ0A 2HR2A 4N2SA 2PM7A 4AJWA 4FADA 3FUDA 2PNNA 2CHWA 3BEEA 2Y3AA 3SY2A 3O48A 3C98A 4KVOA 4L7TA 3ASHA 5T8IA 4HI9A 2R05A 4GYYA 5KJLA 5ARFA 4AV7A 3W9GA 2L0IA 5KNHD 3NZUA 4I2WA 2LSVA 2OVBA 4V3IA 2DZNA 1OCOE 4A3VA 4DK5A 4JA7A 4I6JA 3CVWA 3FTZA 3PUKA 2EQXA 2WQ6A 5ENNA 2L0TB 4F1SA 3ZYKA 1U2VG 4C48B 5G05J 3ZNGA 3HHMA 4E85A 4L2LA 2CHXA 1KZPA 2XGOA 4HVBA 1H2UA 2VGYA 4MS6A 4BTBA 2KM4A 4A63B 3FFLA 3MZLB 5T3RA 3CHMA 3EDTB 3PE4A 3MX3A 4APFA 3EHNA 4UUCA 3FU5A 3ULEG 3DEPA 4O1PA 1MQSA 4DPRA 5CECB 4GCNA 2H6FA 2WXLA 1YA0A 3D9HA 2LAIA 3E34A 4LNUD 1LD8A 3SZ7A 1U3DA 3FULA 1IXVA 3OXGA 3T8KA 4DX6D 3QWVA 2XGSA 4AVXA 3ISMC 1SVXA 3B7TA 3MKQB 4PS8A 1N4PA 4HORA 2QFCA 2IOSA 4BTAA 5AYWD 4GAAA 5ANRA 3CV0A 3NOCD 3CLJA 2R59A 2WMOA 5EX0A 3CHRA 1BLXB 3IHYA 2X38A 1K8KG 1N94A
chains in the Genus database with same CATH topology
2VSYA 2XGMA 3HVEB 1SZAA 2JEKA 4C0MA 5FZQA 4ANUA 1QNFA 4WWPA 3IV0A 4F7AA 5JHBA 3FH8A 2LO6A 3LEWA 2BF0X 3CVVA 3ZFWA 3R7QA 1E90A 4FA6A 1Y6IA 2PL2A 2WXIA 4CDMA 2ONDA 4GMJA 4WNFA 4CGWA 2XHEA 3DBSA 2M63A 1HX8A 4P29A 3WXXA 4AY5A 4XI0A 4UI9K 4FLHA 3QB2A 5DBKA 2XRZA 2XQ0A 1ELWA 1U3CA 2UWJG 4TV3A 4UWGA 2VSXE 3UQ3A 3L6AA 2UY1A 2RD0A 3D9JA 2WXJA 4DI4A 2V5FA 4HXIA 4ANWA 3FDHA 3SGHA 3ONKA 2WXHA 2C2LA 4UWLA 1A17A 1UN8A 4I1OB 3I3NA 3S7JA 2R17C 4FHKA 3SI5A 1HH8A 1N54A 3CVQA 1WAO1 4LUNU 2FO7A 2WPVA 1EYHA 4MRUA 4UI9J 3ML9A 4L23A 3JCKC 2KCVA 2GRLA 1E8ZA 1X5BA 1JPLA 4IRUA 1UJJA 5BNWA 2NC9A 2IFUA 2KC7A 4Q94A 5LOZA 4Q96A 2GRMA 5FQ4A 4WWOA 3TJPA 1UN9A 4EZJA 1E7VA 3LXUX 4GZ6A 5KJMA 3QC1A 3L22A 4EPZA 2J09A 1Z3YA 4PDXA 3UT4A 3CQCB 3VLEA 5KCMA 4Y6CA 5J08A 5ANLA 2OV8A 3Q47B 4M3OA 5AIJA 3T5XA 4I9EA 4N39A 1OWMA 3FUIA 3CHQA 3Q4AB 3LKUA 4LERA 4YNDA 1HS6A 3UT8A 4OVUA 3Q49B 1HFAA 5FQ7A 4QFVA 3FP3A 4Y6WA 4G23A 4WWNA 3MJWA 5A7DB 5BW8C 3Q5MA 5FWQA 3AS8A 1FVFA 1E7UA 3ESKA 3FUMA 3GW4A 3L16A 2ILRA 3RRNB 2J08A 1Z3XA 4GYWA 4XKBA 5A6CA 3RO3A 1H2VC 4R7LA 2PM6A 3FH7A 3PH0C 5CHEE 4C0EA 5C2YA 1HE8A 3BG0B 3K9IA 3HYMB 4CT4A 3FUFA 3FEYA 3S7FA 4B8AA 3FTVA 2YHCA 5D0OD 4NRHB 3N71A 3CHOA 5G2NA 5CCMA 3VTYA 4BX8A 3FTYA 3FEXA 3PNLB 3L17A 3EHMA 4ILIA 4AM9A 5JJTA 4FULA 2KCLA 4HOTA 2V4LA 3CVYA 2L6JA 4BT9A 3ZPJA 3QAQA 4PS3A 2FBNA 2GW1A 4W9RA 4A1GA 4FHJA 2BUGA 3ZN3A 3IHVA 2WXKA 1LF8A 3JQ1A 1PC2A 4OYSA 3FH5A 4GU5A 3MV3B 3L13A 4I17A 4AEZC 4EZKA 1TEZA 3NZSA 4GCOA 3JQ0A 3GYZA 1VDYA 2WXNA 3UT7A 4EECA 2E2EA 5FQ6A 4JW1A 4H7XA 3B7UX 1HF8A 5HQ8A 2XCBA 1HU3A 4JA9A 4J6IA 2FF4A 5ARGA 4WAFA 3ZGQA 3RRMB 4TUUA 4GPKA 5LP0A 5EX3A 3RU0A 2WXMA 2E0IA 3CK9A 4O6FA 2VTBB 4WNEA 2J9QA 2VSOE 4AXHA 2AXUA 3AS5A 3MCXA 4L1BA 3ZIMA 1Y8MA 3ASDA 1JUQA 2V8SE 2WQ7A 3TG4A 3BG1B 4XIFA 2IOLA 3QARA 1NA3A 2C0MA 2NXPA 4BY6A 3VLFA 5C1DA 1FVHA 3ZHEB 4Q69A 2AXZA 2IQCA 3B7SA 4XI9A 3APDA 3T8MA 4JHRA 4K03A 5KJKA 2OVFA 4I1MA 4B89A 4ANVA 4NACA 2CFZA 3G2TA 4G2VA 4KYOB 2XPZA 3FU0A 3CK8A 4ME2A 1HO8A 3U3WA 3EJNA 2P58C 5HI7A 2ZU6B 3IBEA 5JJ7A 1H2TC 3I4RB 4K0RA 1OWOA 4BWRA 4WUYA 3PEVB 5JJ6A 3PZDA 3AU4A 3R9AB 5E75A 3MKQA 4GMLA 3CIAA 4AOFA 2YQ8A 2LAHA 3ESLA 2J4BA 2PZIA 3FUNA 4FP7A 4JEHA 5AENA 2KATA 2WXFA 3PNTB 3T5VA 1B89A 3D3MA 3LPZA 4UQZA 2X6JA 1EDUA 1S0PA 3PDNA 3SD5A 2J4DA 1FCHA 2MOWA 5FJYA 4XX5A 3U66A 3FHEA 1H19A 3ULQA 3LY9A 5CMYA 1JWFA 4URKA 5KJNA 4DLQA 3CVXA 4L2YA 1NA0A 4YVOA 4ILHB 4GB9A 4N3BA 3ZXSA 3ZEFA 4ACKA 3ZYLA 3FUEA 2J49A 3TAXA 3HVEA 2LSUA 2R5SA 3EIQC 4I6GA 3QNKA 4ILGA 4CT0A 5A23A 3PVLA 3TGOA 2HO1A 5E76A 3S7DA 2I9CA 3KEZA 1XNFA 1HZ4A 3CHPA 3RKVA 5JHAA 3FTWA 3QJZA 2I2OA 1QZ2A 1PY1A 2RG8A 4CGVA 1NP7A 4I43A 3U9WA 1IQUA 4MKTA 5T4YA 4G25A 2AWIA 3L08A 4U0ZA 3KAEA 1DNPA 3D9MA 3ZVVA 4U04A 3IKOB 2XRYA 1E8YA 2YNQA 1GW6A 3G2SA 2FI7A 3G2UA 3D9LA 2VTBA 4JHJA 2CHZA 3I5PA 4H7YA 4JHKA 4J8SA 1DVPA 2XEVA 3NF1A 4GYOA 3UUXA 3EIJA 4J8FA 2CG2A 2AVPA 3TL5A 4J8DA 1H0AA 2LNIA 3D9NA 3NQPA 3GZSA 4BFRA 4DJAA 4TRQA 4UQXA 1WM5A 4LRZA 4XE0A 5J90A 1TJFA 4RG6A 2WQHA 3CKBA 3CSFA 3VLDA 4D10C 3IEGA 3LDZA 4YVQC 2FEZA 2IF4A 3QDNA 2C0LA 4B94A 2KZTA 4JC8A 4F53A 3D9PA 3APFA 4HLEA 2CFUA 3MA5A 2X6KA 4OVVA 4UWHA 3FWVA 4A1SA 3CK7A 4CDRA 1TJCA 2Q7FA 5D0QD 1KT0A 4EQFA 4EBAA 3LJ3A 3L54A 5BV0A 2MHKA 4A3TA 3RJVA 3TXMA 1H6KA 3AU5A 3PREA 4AY6A 3CEQA 4J0UA 3TG5A 1HG5A 1L5JA 3Q15A 4JXTA 5M72A 5LX8A 2VJ8A 4G11A 2VSNA 4B0ZA 1UW4B 3ZRHA 3SBSA 3MKRA 4GZCA 2IU1A 2I1JA 4I1AA 4I9CA 4HOSA 3RRUA 1ELKA 1E8WA 3CKCA 4RG9A 4MLPA 1SQMA 2VGXB 4NURA 4AP2A 3LY7A 2WXRA 4JVSA 3D9IA 4U0SA 3KS2A 3U64A 3QWWA 1Z6TA 3ZYMA 4BT8A 5FZRA 1W3BA 1JWGA 3I4GA 2UY1B 4N5CA 2MRIA 2NSZA 4JZYA 5G55A 3UX4A 3RO2A 3GZ2A 4PH4B 4APOA 5FTPA 3G2VA 2VYIA 5BT1A 2DBAA 3S2AA 1BPOA 3O4ZA 1ELRA 2A5UA 3FUHA 5G04J 4NQ0A 2HR2A 4GZ5A 4KBQA 3SFZA 1E8XA 3HDXA 3TXNA 3JYSA 4E6HA 2PM7A 4FJYA 5BV1A 4N2SA 4AJWA 4FADA 5DIZA 4U63A 3CGHA 4U8HA 3FUDA 5AJDA 3P2BA 2X6FA 4UI9C 2CHWA 3BEEA 5LFAA 2Y3AA 3CVUA 3GZ1A 3O48A 2FULA 2YHEA 3APCA 3MYVA 3C98A 3OAWA 3PS6A 4KVOA 5G04C 4L7TA 4C9BB 2HYZA 4UQYA 3ASHA 4WNGA 2PQNA 4I6EA 2GGFA 3B7RL 4LCTA 3CVPA 5T8IA 4GZ3A 2XPYA 2WXPA 2PQRA 4GYYA 1EPUA 5KJLA 5ARFA 1ZU2A 3MGBA 4AV7A 5CMWA 2L0IA 1E96B 3NZUA 3OXFA 4I2WA 2Y4TA 2I1KA 2X6HA 2VGXA 2LSVA 2OVBA 3QK0A 3LVQE 4KZCA 4V3IA 3MV2B 4XZ4A 4UWKA 4IYPA 4I2ZA 3VTXA 4KXKB 4A3VA 4DK5A 4EZLA 4N3CA 5FQ8A 3UPVA 3E4BA 3P1UA 4G24A 4JA7A 4I6JA 4B8CB 1IHGA 4DLOA 3CVWA 3FTZA 3PRZA 5EDSA 2CG3A 2EQXA 3PUKA 5ENNA 4CRWA 2L0TB 2WQ6A 1SZ9A 4F1SA 3PE3A 3QOUA 2I6HA 2WXOA 3KD7A 1OUVA 4XKCA 2DCPA 3ZYKA 4JL0A 3CQGB 4ABNA 4KVMA 5G05J 2AW6A 3HHMA 3FTUA 1OWPA 4E85A 4L2LA 2CHXA 2IONA 2XGOA 4F3VA 4JPSA 4FU3A 4FJZA 2X6IA 4GZDA 4HVBA 1H2UA 4DI3A 3URZA 2WVIA 5FT9A 2AXVA 2VGYA 4HFGA 3FU6A 3SF4A 4MS6A 4BTBA 2KM4A 1ZBPA 3FFLA 3DPDA 2WXGA 2DIWA 4KMOA 3MZLB 5T3RA 4GA0A 3CR3A 3CHMA 1HXIA 4EBAG 3EDTB 2IJGX 3PE4A 2Y4UA 3D9OA 3MX3A 3EHNA 4PS7A 2HM8A 3RIBA 3S7BA 4APFA 3CHSA 3FU5A 4N2QA 1N52A 5FZSA 3LS8A 3U4TA 1KT1A 2OOEA 1OWNA 3FUJA 4FLBA 2A4ZA 3ML8A 3OTNA 3HIZA 4G26A 3PEUB 1MQSA 3LYAA 4CCAA 3ONLA 4GA1A 3LVRE 4BSXA 4DPRA 4J8EA 4IN3B 5BPPA 4GCNA 4IULA 3UMVA 3LCAA 4ATGA 2WXLA 4GA2A 3OXLA 4LEUA 3D9KA 3ZYQA 3FTSA 2KZTB 1YA0A 2YINA 4KZ0A 3ZHEA 2LAIA 3R7RA 4U0UA 3ENEA 1KLXA 4U07A 5EKQD 1HG2A 4PUCA 3FUKA 4RSYA 4G1TA 5BUZA 1P5QA 5LCWJ 3AS4A 3SZ7A 2BTDA 3FTXA 3G2WA 4HOUA 3FY4A 1U3DA 2XPIA 3ASGA 3RK6A 3CSTA 3FULA 4JEUA 3OXGA 3ZW3A 3JUIA 3PUJA 3FU3A 4UWFA 3SNXA 2VQ2A 3QWVA 5CCLA 2XGSA 4AVXA 4CDNA 2WM9A 2JLBA 3B7TA 1IYGA 3MKQB 4PS8A 4HOQA 4ANXA 1MHQA 2WXQA 1EF1C 2V0PA 4KT6B 4HORA 1UJKA 3B13A 4AIFA 2QFCA 4HS2A 5LCWC 2XCCA 1OWLA 3LY8A 1UG3A 4WNDA 5AJLA 3SHFA 2IOSA 4BTAA 3ASFA 1NZNA 4GAAA 5AYWD 5ANRA 3MEKA 1IQRA 3CVNA 4N3AA 3CV0A 2WMNA 2X3MA 3CLJA 1XGWA 2R59A 4BX9A 4CEMA 5G05C 2WMOA 3QWPA 1INZA 3SBTB 5EX0A 2KCKA 3CHRA 4FC8A 4A55A 4ACLA 2L9BA 3CVLA 3IHYA 1WY6A 2WB2A 2X38A 2J07A 3QKYA 1PAQA 2QY7A 4RVBA 1QQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSY A;  2BUG A;  2XGM A;  3E4B A;  4G24 A;  4JA7 A;  3ZN3 A;  1IHG A;  4H7Y A;  5FZQ A;  1PC2 A;  2XEV A;  4GYO A;  3NF1 A;  3MV3 B;  4I17 A;  3UUX A;  4J8F A;  3PE3 A;  3QOU A;  2I6H A;  4GCO A;  2AVP A;  3GYZ A;  4CDR A;  4J8D A;  2LNI A;  4W9R A;  3KD7 A;  1OUV A;  2E2E A;  4ABN A;  4JL0 A;  3ZFW A;  4H7X A;  1WM5 A;  4UQX A;  5HQ8 A;  2XCB A;  4JA9 A;  2PL2 A;  4RG6 A;  2FF4 A;  2WQH A;  3CKB A;  5G05 J;  2OND A;  4WNF A;  4CGW A;  5ARG A;  3IEG A;  4YVQ C;  3ZGQ A;  2FEZ A;  2IF4 A;  3QDN A;  5EX3 A;  2XGO A;  3RU0 A;  4F3V A;  2C0L A;  4B94 A;  3WXX A;  4AY5 A;  3CK9 A;  4O6F A;  3MA5 A;  2J9Q A;  4UI9 K;  4WNE A;  4XI0 A;  5DBK A;  3AS5 A;  3FWV A;  4A1S A;  3CK7 A;  1ELW A;  5FT9 A;  2UWJ G;  1TJC A;  2VGY A;  3URZ A;  2Q7F A;  5D0Q D;  1KT0 A;  1Y8M A;  3SF4 A;  3UQ3 A;  4EQF A;  2UY1 A;  3ASD A;  4BTB A;  1ZBP A;  2MHK A;  3FFL A;  2V5F A;  3TG4 A;  3RJV A;  4GA0 A;  4XIF A;  1HXI A;  2C2L A;  4AY6 A;  3CEQ A;  3EDT B;  1A17 A;  4J0U A;  1NA3 A;  2C0M A;  3Q15 A;  3S7J A;  3TG5 A;  5M72 A;  3PE4 A;  5C1D A;  2VSN A;  2Y4U A;  1HH8 A;  3CVQ A;  3RIB A;  3S7B A;  4XI9 A;  3ZHE B;  4N2Q A;  1WAO 1;  5KJK A;  2FO7 A;  4JHR A;  2WPV A;  3MKR A;  4UI9 J;  5FZS A;  3U4T A;  1KT1 A;  4I1A A;  2KCV A;  2OOE A;  4I9C A;  4HOS A;  4G2V A;  4KYO B;  5BNW A;  3CK8 A;  2NC9 A;  2IFU A;  2KC7 A;  3CKC A;  4ME2 A;  4RG9 A;  4G26 A;  3U3W A;  2P58 C;  2VGX B;  5HI7 A;  3LY7 A;  5JJ7 A;  3LYA A;  4GA1 A;  4U0S A;  4WUY A;  5JJ6 A;  3KS2 A;  4BWR A;  4GZ6 A;  3QWW A;  4J8E A;  5KJM A;  4IN3 B;  4GCN A;  3R9A B;  4BT8 A;  5FZR A;  1W3B A;  3LCA A;  2YQ8 A;  4GA2 A;  3OXL A;  2UY1 B;  4Y6C A;  4LEU A;  2PZI A;  4N5C A;  3Q47 B;  2KAT A;  1YA0 A;  3RO2 A;  3GZ2 A;  1B89 A;  3LPZ A;  5FTP A;  4APO A;  2VYI A;  4I9E A;  2DBA A;  4UQZ A;  5BT1 A;  3PDN A;  4U0U A;  4N39 A;  1FCH A;  1KLX A;  4U07 A;  1ELR A;  5EKQ D;  5G04 J;  4NQ0 A;  2HR2 A;  3Q4A B;  4GZ5 A;  4KBQ A;  3LKU A;  1QQE A;  5FJY A;  3ULQ A;  3LY9 A;  4G1T A;  4YND A;  5KJN A;  1P5Q A;  3JYS A;  3Q49 B;  5LCW J;  4N2S A;  3AS4 A;  3SZ7 A;  3FP3 A;  4Y6W A;  5DIZ A;  1NA0 A;  4G23 A;  4HOU A;  4YVO A;  2XPI A;  3ASG A;  5A7D B;  3OXG A;  4N3B A;  5BW8 C;  3Q5M A;  3AS8 A;  4UI9 C;  3ESK A;  3BEE A;  3GW4 A;  3GZ1 A;  2VQ2 A;  3O48 A;  5G04 C;  3QWV A;  5CCL A;  3TAX A;  2XGS A;  2LSU A;  2HYZ A;  2R5S A;  4GYW A;  4UQY A;  3ASH A;  2JLB A;  2PQN A;  4WNG A;  3RO3 A;  5A6C A;  3TGO A;  2HO1 A;  1IYG A;  3CVP A;  4HOQ A;  3S7D A;  4GZ3 A;  5CHE E;  4HOR A;  1XNF A;  4AIF A;  2QFC A;  5LCW C;  2XCC A;  3K9I A;  3LY8 A;  3HYM B;  1HZ4 A;  4WND A;  2PQR A;  3RKV A;  4GYY A;  3S7F A;  5KJL A;  5ARF A;  4GPK A;  1ZU2 A;  4BTA A;  2YHC A;  3ASF A;  1NZN A;  5D0O D;  5AYW D;  1QZ2 A;  3MEK A;  4NRH B;  3CVN A;  1E96 B;  3CV0 A;  3N71 A;  3OXF A;  4I2W A;  2Y4T A;  4N3A A;  5CCM A;  4CGV A;  2VGX A;  3VTY A;  2LSV A;  5G05 C;  3QWP A;  3MV2 B;  4AM9 A;  5JJT A;  5EX0 A;  2KCL A;  4HOT A;  2KCK A;  4G25 A;  4U0Z A;  3KAE A;  4I2Z A;  2L6J A;  4KXK B;  3VTX A;  4BT9 A;  3CVL A;  4U04 A;  3ZPJ A;  3QKY A;  2FBN A;  3ZHE A;  4N3C A;  2GW1 A;  3UPV A;  2FI7 A; 
#chains in the Genus database with same CATH topology
 2VSY A;  5EID A;  1MX2 A;  4C0M A;  5FZQ A;  4ANU A;  2V4H C;  4WWP A;  1WG0 A;  1G3N B;  3ULY A;  2F8X K;  3ZFW A;  1E90 A;  2EIN E;  4CDM A;  2OND A;  4U95 D;  1HX8 A;  4AY5 A;  4EHM A;  3UM3 A;  4UI9 K;  1ELW A;  2UWJ G;  3DEO A;  4UWG A;  3L6A A;  2RD0 A;  2LXM A;  3BU8 A;  4HXI A;  3FDH A;  3ONK A;  4M7C A;  1A17 A;  1S70 B;  5HS0 A;  1N54 A;  4LUN U;  4MRU A;  1X5B A;  3TJP A;  4BES A;  1E7V A;  3LXU X;  1H6P A;  4EPZ A;  3PZ2 A;  3CQC B;  3EUV A;  5J08 A;  5ANL A;  2OV8 A;  3T5X A;  3CHQ A;  4OVU A;  3ABK E;  5FQ7 A;  4Y6W A;  4G23 A;  2RFA A;  5BW8 C;  1FVF A;  1JCS A;  1FT2 A;  2ILR A;  3DSW A;  2QYU A;  2PM6 A;  5CHE E;  4C0E A;  1UOH A;  3BG0 B;  3K9I A;  1SA5 A;  3S7F A;  5G2N A;  2KCL A;  4HOT A;  3CVY A;  2BED A;  3HXC A;  3ZPJ A;  3V2O A;  2FBN A;  2LUH A;  2HE0 A;  4FHJ A;  3ZN3 A;  3IHV A;  1PC2 A;  4OYS A;  4GU5 A;  3MV3 B;  3UIP C;  3UT7 A;  3DPY A;  2DWZ A;  4JW1 A;  3B7U X;  5HQ8 A;  4JA9 A;  3RRM B;  5EX3 A;  1TNY A;  1JCR A;  3CK9 A;  4WNE A;  4AXH A;  1Y8M A;  4DX5 D;  1JUQ A;  1FPP A;  2IOL A;  2C0M A;  2NXP A;  4GTO A;  2GRP B;  3ZHE B;  3B7S A;  4JHR A;  3KSQ A;  4NAC A;  4G2V A;  4KYO B;  2P58 C;  4HBD A;  3I4R B;  4K0R A;  4BWR A;  1MJ0 A;  3AU4 A;  3MKQ A;  4GML A;  3ESL A;  3FUN A;  3TWW A;  3HXD A;  3PDN A;  1FCH A;  1RZ4 A;  4XX5 A;  5HRY A;  3ULQ A;  3LY9 A;  1V55 E;  1LD7 A;  3ZXS A;  3ZEF A;  5EYP F;  3FUE A;  2EIM E;  1LTX A;  3EIQ C;  3QNK A;  3S7D A;  3Q75 A;  5ENS D;  3FTW A;  2J8S D;  4MKT A;  5T4Y A;  4U0Z A;  1DC2 A;  1K1B A;  2XRY A;  2FI7 A;  3G2U A;  4U7E B;  3ABL E;  4H7Y A;  1MZC A;  3V31 A;  4GYO A;  3NF1 A;  4J8F A;  2XZD G;  4DJA A;  2LNI A;  3D9N A;  2ETC A;  3VLD A;  3LDZ A;  4YVQ C;  1WDY A;  2FEZ A;  3QDN A;  2CFU A;  2X6K A;  3EU9 A;  4UWH A;  1TJC A;  1DCE A;  2Y0B G;  3LJ3 A;  3L9T A;  4HLL A;  2MHK A;  3RJV A;  3TXM A;  1H6K A;  5KBA A;  3PRE A;  2QZA A;  4AY6 A;  1YCS B;  5LX8 A;  2XS1 A;  3CEQ A;  4J0U A;  3Q15 A;  2VJ8 A;  2VSN A;  3MKR A;  4GZC A;  2IU1 A;  2I1J A;  1D8D A;  3RRU A;  1E8W A;  4RG9 A;  2VGX B;  4JVS A;  3Q78 A;  3B7B A;  3ZUV B;  4U0S A;  3U64 A;  5BXO A;  1Z6T A;  4LG6 A;  3ASO E;  1N4R A;  4YDO A;  5B1A E;  4APO A;  5BT1 A;  3G2V A;  3S2A A;  3T9K A;  1BPO A;  3O4Z A;  3FUH A;  3SFZ A;  3HDX A;  4TXR A;  4ZHB A;  4U63 A;  3CGH A;  5AJD A;  4OAU C;  3P2B A;  2X6F A;  5LFA A;  4L9P A;  3GZ1 A;  3OAW A;  2YHE A;  3MYV A;  3NAW A;  4C9B B;  3B7R L;  4LCT A;  2V5Q C;  4BER A;  2WXP A;  3MGB A;  2I1K A;  1BU9 A;  2VGX A;  3QK0 A;  4KZC A;  4K5A B;  3MV2 B;  3Q7F A;  4XZ4 A;  2ZGD A;  4IYP A;  4RLY A;  4UWK A;  4KXK B;  3E30 A;  2IO2 C;  5FQ8 A;  3UPV A;  3E4B A;  2Y1L E;  4B8C B;  5EDS A;  1SZ9 A;  3PE3 A;  2R02 A;  1TNZ A;  1OUV A;  4KVM A;  4JD2 G;  5CRU A;  2DZO A;  4FU3 A;  1OXJ A;  5ENT D;  1IHB A;  3URZ A;  2AXV A;  4O60 A;  3DPD A;  2WXG A;  3CR3 A;  4EBA G;  4DX7 D;  2Y4U A;  3S7B A;  1N52 A;  5FZS A;  1D9S A;  4FLB A;  2DYR E;  2A4Z A;  4G26 A;  2MYO A;  3LVR E;  4J8E A;  5BPP A;  4K5C A;  3UMV A;  4GA2 A;  3OXL A;  4HRN A;  3FTS A;  2KZT B;  5AAR A;  4U0U A;  3ENE A;  1KLX A;  4RSY A;  1P5Q A;  1NL4 A;  5LCW J;  2BTD A;  3CST A;  3JUI A;  3PUJ A;  4UWF A;  3SNX A;  2VQ2 A;  4CDN A;  2WM9 A;  4TUM A;  2ZGG A;  1MHQ A;  1EF1 C;  2V0P A;  1UJK A;  3B13 A;  4AIF A;  4HS2 A;  5LCW C;  3LY8 A;  1UG3 A;  2P9P G;  2L6B A;  2GRQ B;  1RW2 A;  3SHF A;  2X3M A;  4BX9 A;  5G05 C;  3QWP A;  5D66 A;  3SBT B;  2KCK A;  4ACL A;  2L9B A;  3CVL A;  2WB2 A;  3UI2 A;  2J07 A;  3QKY A;  1PAQ A;  4AEZ C;  3ZHE A;  4RVB A;  1QQE A;  3HVE B;  3EHQ A;  1Z5S C;  1QNF A;  2EIJ E;  1NI1 A;  2P9S G;  3C3R A;  2XS8 A;  4FA6 A;  2PL2 A;  3ZXP A;  3DBS A;  2DYS E;  4P29 A;  4XI0 A;  5DBK A;  3QB2 A;  3E37 A;  3J5Q B;  5AN8 A;  1QYM A;  5EIL A;  3SGH A;  2WXH A;  4ATZ D;  3DSX A;  3S7J A;  4I1O B;  3I3N A;  1HH8 A;  3CVQ A;  1WAO 1;  4UI9 J;  3ML9 A;  4L23 A;  3KEA A;  1E8Z A;  1N9A A;  2GRM A;  3TWQ A;  5KJM A;  3VLE A;  5KCM A;  2GRR B;  3Q47 B;  3FUI A;  4HB5 A;  1HFA A;  1AP7 A;  4WWN A;  5A7D B;  4B93 B;  5FWQ A;  1Z3X A;  4GYW A;  4XKB A;  3RO3 A;  1H2V C;  2RKK A;  3FH7 A;  2P9U G;  4CT4 A;  3FEY A;  5D0O D;  3UIN C;  5CCM A;  3VTY A;  3EHM A;  1Q2Z A;  5ENQ D;  2V4L A;  3NB2 A;  3UXG A;  2WXK A;  4ZFH A;  4I17 A;  3NZS A;  3GYZ A;  4EEC A;  2IEJ A;  4H7X A;  4J6I A;  2FF4 A;  1A5E A;  5ARG A;  4WAF A;  3ZGQ A;  3RU0 A;  2AXU A;  3AS5 A;  3MCX A;  4L1B A;  4XIF A;  3VLF A;  4Q69 A;  4XI9 A;  5KJK A;  4B89 A;  3TWX A;  2XPZ A;  3U3W A;  1H6O A;  5CER B;  3IBE A;  4HRL A;  5JJ7 A;  3PZD A;  3R9A B;  4K5B A;  2LAH A;  4JEH A;  5AEN A;  3LPZ A;  2MOW A;  3PZ1 A;  3UKU G;  5FJY A;  3EHR A;  5CMY A;  4L2Y A;  5AAO A;  2J49 A;  3TAX A;  1OCC E;  2B6C A;  2I9C A;  5JHA A;  3QJZ A;  2I2O A;  1PY1 A;  2RG8 A;  1OCZ E;  4G25 A;  3L08 A;  3KAE A;  3IKO B;  4U96 D;  1E8Y A;  3E33 A;  3F6Q A;  3D9L A;  2CHZ A;  5AQA A;  4JHK A;  3UUX A;  2AJA A;  2CG2 A;  3TL5 A;  5JMN D;  1WM5 A;  2WQH A;  1O5M A;  2DVW A;  5JA4 D;  1N4Q A;  2IF4 A;  2C0L A;  3AJI A;  2KZT A;  4B94 A;  3APF A;  3MA5 A;  4XEI G;  4QQI A;  5HKP A;  4EBA A;  5IY5 E;  5BV0 A;  1D8E A;  2IO3 C;  4DX2 A;  3ABM E;  5M72 A;  1BI8 B;  2GRO B;  3B95 A;  3ZRH A;  1OY3 D;  4HOS A;  1SQM A;  4AP2 A;  3LY7 A;  3D9I A;  4J8Y A;  3UIO C;  3ZYM A;  2ETB A;  5FZR A;  1W3B A;  3GZ2 A;  2VYI A;  2DBA A;  5G04 J;  3Q9N C;  3AG2 E;  4GZ5 A;  4KBQ A;  1E8X A;  3TXN A;  4BET A;  3JYS A;  4FJY A;  5DIZ A;  1K1A A;  4UI9 C;  3CVU A;  2FUL A;  5G04 C;  3APC A;  2HYZ A;  4UQY A;  4WNG A;  3C3O A;  4I6E A;  3CVP A;  5FIN A;  4GTV A;  4DX1 A;  1EPU A;  1MX4 A;  1E96 B;  2ZIR A;  2X6H A;  1K3Z D;  3LVQ E;  2ZIS A;  4EZL A;  1O1S A;  1IHG A;  4CRW A;  5KWD A;  2I6H A;  4GTP A;  1MX6 A;  3R9M A;  2NYJ A;  3TWR A;  2DCP A;  1O1R A;  2ION A;  4F3V A;  2XEE A;  4GZD A;  2QYJ A;  3FU6 A;  3SF4 A;  1ZBP A;  4KMO A;  4U8V D;  3JXI A;  2HM8 A;  4N2Q A;  3CHS A;  2H6H A;  3LS8 A;  1KT1 A;  4BSZ B;  4BEP A;  3LYA A;  4CCA A;  4BSX A;  3Q73 A;  4IUL A;  3LCA A;  4ATG A;  4LEU A;  3D9K A;  2YIN A;  3R7R A;  4U07 A;  1HG2 A;  3FUK A;  5BUZ A;  3G2W A;  4HOU A;  2XPI A;  3RK6 A;  4JEU A;  5FIO A;  3FU3 A;  2JLB A;  4HOQ A;  4ANX A;  2XCC A;  1FT1 A;  1NZN A;  3MEK A;  4N3A A;  3CVN A;  4DRX E;  1XGW A;  1YMP A;  1INZ A;  3SQV A;  1WY6 A;  2XGM A;  2EIL E;  3L82 A;  4NIK A;  3IV0 A;  2VGE A;  5JHB A;  3R7Q A;  3IXE A;  1Y6I A;  2Y69 E;  4WNF A;  3RAU A;  4FLH A;  2XRZ A;  4TV3 A;  3UQ3 A;  2UY1 A;  3X2Q E;  3EU5 A;  2WXJ A;  2C2L A;  4LSZ E;  2WPV A;  1EYH A;  3JCK C;  2KCV A;  2GRL A;  1UJJ A;  5BNW A;  2NC9 A;  4OAV B;  1UN9 A;  4EZJ A;  4LNB A;  4GZ6 A;  3QC1 A;  3L22 A;  2J09 A;  3UT4 A;  5AIJ A;  4M3O A;  3JUE A;  4N39 A;  1OWM A;  3Q4A B;  4LER A;  4YND A;  3UT8 A;  3MJW A;  4F1P A;  3Q5M A;  3AS8 A;  3L16 A;  3RRN B;  5A6C A;  3PH0 C;  2IY0 C;  4B8A A;  3FTV A;  2F8Y A;  3N71 A;  4BX8 A;  3FTY A;  4N5Q A;  4JB8 P;  3FEX A;  4ILI A;  4FUL A;  5ITZ F;  2L6J A;  4BT9 A;  4PS3 A;  4A1G A;  2BUG A;  2GRN B;  5EN5 D;  3FH5 A;  3L13 A;  1TEZ A;  3WG7 E;  4GCO A;  3ASN E;  5FQ6 A;  1HF8 A;  4MBG A;  1HU3 A;  4TUU A;  2B0O E;  5LP0 A;  2WXM A;  2E0I A;  2VTB B;  1N95 A;  2WQ7 A;  3BG1 B;  1AWC B;  3QAR A;  4BY6 A;  1FVH A;  3HXB A;  4ANV A;  1OT8 A;  2FO1 E;  2CFZ A;  3G2T A;  5ENP D;  3FU0 A;  1HO8 A;  3BUA A;  3EJN A;  5HI7 A;  2KXP C;  4GTM A;  1OWO A;  4WUY A;  5JJ6 A;  3KSL A;  1N11 A;  4AOF A;  1ZB1 A;  3CIA A;  2YQ8 A;  4DUI A;  2P9L G;  4FP7 A;  2J4B A;  2PZI A;  2KAT A;  2WXF A;  2ETA A;  4UQZ A;  1EDU A;  1S0P A;  3V79 K;  3SD5 A;  1TR4 A;  5D2M C;  1V54 E;  3FHE A;  4URK A;  5KJN A;  1JWF A;  3CVX A;  4ILH B;  4ACK A;  3PZ4 A;  3ZYL A;  4RQI A;  2LSU A;  4CT0 A;  5A23 A;  1TN8 A;  3PVL A;  3TGO A;  5E76 A;  1X81 A;  1XNF A;  2P9I G;  3C5R A;  4GTS A;  3AG4 E;  4CGV A;  1NP7 A;  2OEV A;  4I43 A;  3U9W A;  3V2X A;  3ZU7 B;  4Z68 A;  1IQU A;  1KZO A;  5EIB E;  3D9M A;  3ZVV A;  2XZT G;  3HG0 D;  2YNQ A;  1GW6 A;  2QC9 A;  4JHJ A;  4HQD A;  3NBN B;  1DVP A;  2OCC E;  2XEV A;  3EIJ A;  3GZS A;  4UQX A;  4RG6 A;  4GTR A;  3CKB A;  3CSF A;  3IEG A;  3D9P A;  3UM0 A;  5EYL A;  4A1S A;  5AQ7 A;  2Q7F A;  5D0Q D;  1KT0 A;  4EQF A;  1OCR E;  3AU5 A;  1L5J A;  4G11 A;  3SBS A;  4YDW A;  4I9C A;  1ELK A;  3CKC A;  3C72 A;  2WXR A;  3KS2 A;  5ENR D;  3HXE A;  3Q79 A;  3I4G A;  2UY1 B;  2NSZ A;  4GPM A;  5G55 A;  3UX4 A;  3E32 A;  4CZ2 D;  4E6H A;  1KPS B;  5BV1 A;  4U8H A;  3PS6 A;  2H6I A;  2PQN A;  2GGF A;  4GZ3 A;  2XPY A;  2PQR A;  1ZU2 A;  5CMW A;  3OXF A;  2Y4T A;  1NFI E;  4I2Z A;  3VTX A;  4N3C A;  3P1U A;  4G24 A;  5CBN A;  5AQ9 A;  5H7P A;  4DLO A;  3PRZ A;  3ZKJ A;  2CG3 A;  3QOU A;  2WXO A;  3KD7 A;  4XKC A;  4ABN A;  4JL0 A;  3CQG B;  2AW6 A;  3FTU A;  1OWP A;  3DST A;  5CEA A;  4JPS A;  4FJZ A;  2X6I A;  4DI3 A;  2WVI A;  5FT9 A;  3UM2 A;  4HFG A;  3TWV A;  2DIW A;  4GA0 A;  3DSV A;  1HXI A;  2IJG X;  4YDE A;  5CBO A;  3D9O A;  4PS7 A;  3RIB A;  3U4T A;  5B3S E;  1S63 A;  2OOE A;  1OWN A;  4GMR A;  3FUJ A;  3OTN A;  3ML8 A;  4U8Y D;  3HIZ A;  3PEU B;  1TN6 A;  3ONL A;  4GA1 A;  4IN3 B;  2ZXW E;  3ZYQ A;  1IKN D;  4KZ0 A;  2KBX A;  3NOG D;  5EKQ D;  3DSS A;  3TWT A;  4PUC A;  4G1T A;  5ENO D;  3AS4 A;  3FTX A;  3FY4 A;  3ZW3 A;  3ASG A;  5CCL A;  5AQB A;  1JCQ A;  1IYG A;  3JXJ A;  2WXQ A;  4KT6 B;  3AG1 E;  1OWL A;  4WND A;  5AJL A;  3ASF A;  4G8K A;  1IQR A;  4GTQ A;  2WMN A;  5B1B E;  3UM1 A;  3UKR G;  4CEM A;  1TNO A;  4F6R D;  4FC8 A;  4A55 A;  1SW6 A;  2QY7 A;  1BD8 A;  1SZA A;  2JEK A;  4F7A A;  3FH8 A;  2LO6 A;  3LEW A;  2BF0 X;  3CVV A;  4LNG A;  2WXI A;  3SFY A;  4GMJ A;  2F0Y A;  4CGW A;  2XHE A;  2M63 A;  3WXX A;  2XQ0 A;  1U3C A;  2VSX E;  3DRA A;  2P2C P;  3D9J A;  4DI4 A;  2V5F A;  4ANW A;  4UWL A;  1TYQ G;  1UN8 A;  3SI5 A;  2R17 C;  4FHK A;  2FO7 A;  1DCQ A;  1JPL A;  4IRU A;  5LOZ A;  2IFU A;  2KC7 A;  4Q94 A;  4Q96 A;  5FQ4 A;  4WWO A;  1TNB A;  1Z3Y A;  4PDX A;  4Y6C A;  1SA4 A;  4I9E A;  3LKU A;  1HS6 A;  3Q49 B;  4QFV A;  3FP3 A;  4HNA D;  1S64 A;  1E7U A;  3ESK A;  3FUM A;  3GW4 A;  4TXP A;  3DWL G;  2J08 A;  2BKK B;  4R7L A;  5C2Y A;  1HE8 A;  3W9F A;  1TN7 A;  3HYM B;  3FUF A;  2XEH A;  2YHC A;  2R2L A;  4NRH B;  3CHO A;  5BXU A;  3SFX A;  3HRA A;  3PNL B;  3L17 A;  4X8Q A;  4AM9 A;  5JJT A;  3QAQ A;  1N0Q A;  2GW1 A;  4W9R A;  1LF8 A;  3JQ1 A;  2EIK E;  4EZK A;  3TWS A;  3JQ0 A;  1VDY A;  2WXN A;  3HXF A;  2BKG A;  2E2E A;  3BQO A;  2XCB A;  2P9K G;  3J5P A;  1YYH A;  1MYO A;  4GPK A;  4O6F A;  2J9Q A;  2VSO E;  3ZIM A;  3Q9U C;  3ASD A;  2V8S E;  4HRM B;  3TG4 A;  1NA3 A;  5C1D A;  2AXZ A;  2IQC A;  3T8M A;  3APD A;  4K03 A;  2OVF A;  4I1M A;  3LJN A;  4YDY A;  3CK8 A;  4ME2 A;  2ZU6 B;  1H2T C;  1QBQ A;  3PEV B;  4HI8 A;  5E75 A;  5CED B;  3PNT B;  3T5V A;  1B89 A;  3D3M A;  2X6J A;  2J4D A;  4O1O A;  2XEN A;  3U66 A;  1H19 A;  3DSU A;  4DLQ A;  1NA0 A;  2P9N G;  3DXK G;  4YVO A;  3SO8 A;  4N3B A;  4GB9 A;  3RSE G;  2R03 A;  2LXL A;  3UTM A;  3HVE A;  4TXQ A;  2R5S A;  1O1T A;  4I6G A;  4ILG A;  2HO1 A;  3KEZ A;  1HZ4 A;  3CHP A;  3RKV A;  1QZ2 A;  4CYM D;  2AWI A;  4J7W A;  1DNP A;  4U04 A;  2RFM A;  3G2S A;  2OEW A;  2VTB A;  4GTT A;  3I5P A;  4J8S A;  2AVP A;  4J8D A;  1H0A A;  3NQP A;  4BFR A;  4TRQ A;  1TNU A;  4LRZ A;  5J90 A;  4XE0 A;  3V30 A;  1TJF A;  4D10 C;  4HLE A;  4F53 A;  4JC8 A;  4OVV A;  3DXM G;  3FWV A;  3CK7 A;  4CDR A;  3C3Q A;  3L54 A;  4A3T A;  3PZ3 A;  4G8L A;  3TG5 A;  1HG5 A;  4JXT A;  4B0Z A;  1UW4 B;  2H6G A;  1N0R A;  4I1A A;  3AG3 E;  2F37 A;  4MLP A;  2A5E A;  4NUR A;  5KNG A;  5CRV A;  1BI7 B;  3QWW A;  4BT8 A;  2JAB A;  1JWG A;  1N4S A;  3Q7A A;  4N5C A;  2MRI A;  4JZY A;  3TWU A;  3AAA C;  3RO2 A;  4PH4 B;  5FTP A;  1ELR A;  2A5U A;  4NQ0 A;  2HR2 A;  4N2S A;  2PM7 A;  4AJW A;  4FAD A;  3FUD A;  2PNN A;  2CHW A;  3BEE A;  2Y3A A;  3SY2 A;  3O48 A;  3C98 A;  4KVO A;  4L7T A;  3ASH A;  5T8I A;  4HI9 A;  2R05 A;  4GYY A;  5KJL A;  5ARF A;  4AV7 A;  3W9G A;  2L0I A;  5KNH D;  3NZU A;  4I2W A;  2LSV A;  2OVB A;  4V3I A;  2DZN A;  1OCO E;  4A3V A;  4DK5 A;  4JA7 A;  4I6J A;  3CVW A;  3FTZ A;  3PUK A;  2EQX A;  2WQ6 A;  5ENN A;  2L0T B;  4F1S A;  3ZYK A;  1U2V G;  4C48 B;  5G05 J;  3ZNG A;  3HHM A;  4E85 A;  4L2L A;  2CHX A;  1KZP A;  2XGO A;  4HVB A;  1H2U A;  2VGY A;  4MS6 A;  4BTB A;  2KM4 A;  4A63 B;  3FFL A;  3MZL B;  5T3R A;  3CHM A;  3EDT B;  3PE4 A;  3MX3 A;  4APF A;  3EHN A;  4UUC A;  3FU5 A;  3ULE G;  3DEP A;  4O1P A;  1MQS A;  4DPR A;  5CEC B;  4GCN A;  2H6F A;  2WXL A;  1YA0 A;  3D9H A;  2LAI A;  3E34 A;  4LNU D;  1LD8 A;  3SZ7 A;  1U3D A;  3FUL A;  1IXV A;  3OXG A;  3T8K A;  4DX6 D;  3QWV A;  2XGS A;  4AVX A;  3ISM C;  1SVX A;  3B7T A;  3MKQ B;  4PS8 A;  1N4P A;  4HOR A;  2QFC A;  2IOS A;  4BTA A;  5AYW D;  4GAA A;  5ANR A;  3CV0 A;  3NOC D;  3CLJ A;  2R59 A;  2WMO A;  5EX0 A;  3CHR A;  1BLX B;  3IHY A;  2X38 A;  1K8K G;  1N94 A; 
#chains in the Genus database with same CATH homology
 2VSY A;  2XGM A;  3HVE B;  1SZA A;  2JEK A;  4C0M A;  5FZQ A;  4ANU A;  1QNF A;  4WWP A;  3IV0 A;  4F7A A;  5JHB A;  3FH8 A;  2LO6 A;  3LEW A;  2BF0 X;  3CVV A;  3ZFW A;  3R7Q A;  1E90 A;  4FA6 A;  1Y6I A;  2PL2 A;  2WXI A;  4CDM A;  2OND A;  4GMJ A;  4WNF A;  4CGW A;  2XHE A;  3DBS A;  2M63 A;  1HX8 A;  4P29 A;  3WXX A;  4AY5 A;  4XI0 A;  4UI9 K;  4FLH A;  3QB2 A;  5DBK A;  2XRZ A;  2XQ0 A;  1ELW A;  1U3C A;  2UWJ G;  4TV3 A;  4UWG A;  2VSX E;  3UQ3 A;  3L6A A;  2UY1 A;  2RD0 A;  3D9J A;  2WXJ A;  4DI4 A;  2V5F A;  4HXI A;  4ANW A;  3FDH A;  3SGH A;  3ONK A;  2WXH A;  2C2L A;  4UWL A;  1A17 A;  1UN8 A;  4I1O B;  3I3N A;  3S7J A;  2R17 C;  4FHK A;  3SI5 A;  1HH8 A;  1N54 A;  3CVQ A;  1WAO 1;  4LUN U;  2FO7 A;  2WPV A;  1EYH A;  4MRU A;  4UI9 J;  3ML9 A;  4L23 A;  3JCK C;  2KCV A;  2GRL A;  1E8Z A;  1X5B A;  1JPL A;  4IRU A;  1UJJ A;  5BNW A;  2NC9 A;  2IFU A;  2KC7 A;  4Q94 A;  5LOZ A;  4Q96 A;  2GRM A;  5FQ4 A;  4WWO A;  3TJP A;  1UN9 A;  4EZJ A;  1E7V A;  3LXU X;  4GZ6 A;  5KJM A;  3QC1 A;  3L22 A;  4EPZ A;  2J09 A;  1Z3Y A;  4PDX A;  3UT4 A;  3CQC B;  3VLE A;  5KCM A;  4Y6C A;  5J08 A;  5ANL A;  2OV8 A;  3Q47 B;  4M3O A;  5AIJ A;  3T5X A;  4I9E A;  4N39 A;  1OWM A;  3FUI A;  3CHQ A;  3Q4A B;  3LKU A;  4LER A;  4YND A;  1HS6 A;  3UT8 A;  4OVU A;  3Q49 B;  1HFA A;  5FQ7 A;  4QFV A;  3FP3 A;  4Y6W A;  4G23 A;  4WWN A;  3MJW A;  5A7D B;  5BW8 C;  3Q5M A;  5FWQ A;  3AS8 A;  1FVF A;  1E7U A;  3ESK A;  3FUM A;  3GW4 A;  3L16 A;  2ILR A;  3RRN B;  2J08 A;  1Z3X A;  4GYW A;  4XKB A;  5A6C A;  3RO3 A;  1H2V C;  4R7L A;  2PM6 A;  3FH7 A;  3PH0 C;  5CHE E;  4C0E A;  5C2Y A;  1HE8 A;  3BG0 B;  3K9I A;  3HYM B;  4CT4 A;  3FUF A;  3FEY A;  3S7F A;  4B8A A;  3FTV A;  2YHC A;  5D0O D;  4NRH B;  3N71 A;  3CHO A;  5G2N A;  5CCM A;  3VTY A;  4BX8 A;  3FTY A;  3FEX A;  3PNL B;  3L17 A;  3EHM A;  4ILI A;  4AM9 A;  5JJT A;  4FUL A;  2KCL A;  4HOT A;  2V4L A;  3CVY A;  2L6J A;  4BT9 A;  3ZPJ A;  3QAQ A;  4PS3 A;  2FBN A;  2GW1 A;  4W9R A;  4A1G A;  4FHJ A;  2BUG A;  3ZN3 A;  3IHV A;  2WXK A;  1LF8 A;  3JQ1 A;  1PC2 A;  4OYS A;  3FH5 A;  4GU5 A;  3MV3 B;  3L13 A;  4I17 A;  4AEZ C;  4EZK A;  1TEZ A;  3NZS A;  4GCO A;  3JQ0 A;  3GYZ A;  1VDY A;  2WXN A;  3UT7 A;  4EEC A;  2E2E A;  5FQ6 A;  4JW1 A;  4H7X A;  3B7U X;  1HF8 A;  5HQ8 A;  2XCB A;  1HU3 A;  4JA9 A;  4J6I A;  2FF4 A;  5ARG A;  4WAF A;  3ZGQ A;  3RRM B;  4TUU A;  4GPK A;  5LP0 A;  5EX3 A;  3RU0 A;  2WXM A;  2E0I A;  3CK9 A;  4O6F A;  2VTB B;  4WNE A;  2J9Q A;  2VSO E;  4AXH A;  2AXU A;  3AS5 A;  3MCX A;  4L1B A;  3ZIM A;  1Y8M A;  3ASD A;  1JUQ A;  2V8S E;  2WQ7 A;  3TG4 A;  3BG1 B;  4XIF A;  2IOL A;  3QAR A;  1NA3 A;  2C0M A;  2NXP A;  4BY6 A;  3VLF A;  5C1D A;  1FVH A;  3ZHE B;  4Q69 A;  2AXZ A;  2IQC A;  3B7S A;  4XI9 A;  3APD A;  3T8M A;  4JHR A;  4K03 A;  5KJK A;  2OVF A;  4I1M A;  4B89 A;  4ANV A;  4NAC A;  2CFZ A;  3G2T A;  4G2V A;  4KYO B;  2XPZ A;  3FU0 A;  3CK8 A;  4ME2 A;  1HO8 A;  3U3W A;  3EJN A;  2P58 C;  5HI7 A;  2ZU6 B;  3IBE A;  5JJ7 A;  1H2T C;  3I4R B;  4K0R A;  1OWO A;  4BWR A;  4WUY A;  3PEV B;  5JJ6 A;  3PZD A;  3AU4 A;  3R9A B;  5E75 A;  3MKQ A;  4GML A;  3CIA A;  4AOF A;  2YQ8 A;  2LAH A;  3ESL A;  2J4B A;  2PZI A;  3FUN A;  4FP7 A;  4JEH A;  5AEN A;  2KAT A;  2WXF A;  3PNT B;  3T5V A;  1B89 A;  3D3M A;  3LPZ A;  4UQZ A;  2X6J A;  1EDU A;  1S0P A;  3PDN A;  3SD5 A;  2J4D A;  1FCH A;  2MOW A;  5FJY A;  4XX5 A;  3U66 A;  3FHE A;  1H19 A;  3ULQ A;  3LY9 A;  5CMY A;  1JWF A;  4URK A;  5KJN A;  4DLQ A;  3CVX A;  4L2Y A;  1NA0 A;  4YVO A;  4ILH B;  4GB9 A;  4N3B A;  3ZXS A;  3ZEF A;  4ACK A;  3ZYL A;  3FUE A;  2J49 A;  3TAX A;  3HVE A;  2LSU A;  2R5S A;  3EIQ C;  4I6G A;  3QNK A;  4ILG A;  4CT0 A;  5A23 A;  3PVL A;  3TGO A;  2HO1 A;  5E76 A;  3S7D A;  2I9C A;  3KEZ A;  1XNF A;  1HZ4 A;  3CHP A;  3RKV A;  5JHA A;  3FTW A;  3QJZ A;  2I2O A;  1QZ2 A;  1PY1 A;  2RG8 A;  4CGV A;  1NP7 A;  4I43 A;  3U9W A;  1IQU A;  4MKT A;  5T4Y A;  4G25 A;  2AWI A;  3L08 A;  4U0Z A;  3KAE A;  1DNP A;  3D9M A;  3ZVV A;  4U04 A;  3IKO B;  2XRY A;  1E8Y A;  2YNQ A;  1GW6 A;  3G2S A;  2FI7 A;  3G2U A;  3D9L A;  2VTB A;  4JHJ A;  2CHZ A;  3I5P A;  4H7Y A;  4JHK A;  4J8S A;  1DVP A;  2XEV A;  3NF1 A;  4GYO A;  3UUX A;  3EIJ A;  4J8F A;  2CG2 A;  2AVP A;  3TL5 A;  4J8D A;  1H0A A;  2LNI A;  3D9N A;  3NQP A;  3GZS A;  4BFR A;  4DJA A;  4TRQ A;  4UQX A;  1WM5 A;  4LRZ A;  4XE0 A;  5J90 A;  1TJF A;  4RG6 A;  2WQH A;  3CKB A;  3CSF A;  3VLD A;  4D10 C;  3IEG A;  3LDZ A;  4YVQ C;  2FEZ A;  2IF4 A;  3QDN A;  2C0L A;  4B94 A;  2KZT A;  4JC8 A;  4F53 A;  3D9P A;  3APF A;  4HLE A;  2CFU A;  3MA5 A;  2X6K A;  4OVV A;  4UWH A;  3FWV A;  4A1S A;  3CK7 A;  4CDR A;  1TJC A;  2Q7F A;  5D0Q D;  1KT0 A;  4EQF A;  4EBA A;  3LJ3 A;  3L54 A;  5BV0 A;  2MHK A;  4A3T A;  3RJV A;  3TXM A;  1H6K A;  3AU5 A;  3PRE A;  4AY6 A;  3CEQ A;  4J0U A;  3TG5 A;  1HG5 A;  1L5J A;  3Q15 A;  4JXT A;  5M72 A;  5LX8 A;  2VJ8 A;  4G11 A;  2VSN A;  4B0Z A;  1UW4 B;  3ZRH A;  3SBS A;  3MKR A;  4GZC A;  2IU1 A;  2I1J A;  4I1A A;  4I9C A;  4HOS A;  3RRU A;  1ELK A;  1E8W A;  3CKC A;  4RG9 A;  4MLP A;  1SQM A;  2VGX B;  4NUR A;  4AP2 A;  3LY7 A;  2WXR A;  4JVS A;  3D9I A;  4U0S A;  3KS2 A;  3U64 A;  3QWW A;  1Z6T A;  3ZYM A;  4BT8 A;  5FZR A;  1W3B A;  1JWG A;  3I4G A;  2UY1 B;  4N5C A;  2MRI A;  2NSZ A;  4JZY A;  5G55 A;  3UX4 A;  3RO2 A;  3GZ2 A;  4PH4 B;  4APO A;  5FTP A;  3G2V A;  2VYI A;  5BT1 A;  2DBA A;  3S2A A;  1BPO A;  3O4Z A;  1ELR A;  2A5U A;  3FUH A;  5G04 J;  4NQ0 A;  2HR2 A;  4GZ5 A;  4KBQ A;  3SFZ A;  1E8X A;  3HDX A;  3TXN A;  3JYS A;  4E6H A;  2PM7 A;  4FJY A;  5BV1 A;  4N2S A;  4AJW A;  4FAD A;  5DIZ A;  4U63 A;  3CGH A;  4U8H A;  3FUD A;  5AJD A;  3P2B A;  2X6F A;  4UI9 C;  2CHW A;  3BEE A;  5LFA A;  2Y3A A;  3CVU A;  3GZ1 A;  3O48 A;  2FUL A;  2YHE A;  3APC A;  3MYV A;  3C98 A;  3OAW A;  3PS6 A;  4KVO A;  5G04 C;  4L7T A;  4C9B B;  2HYZ A;  4UQY A;  3ASH A;  4WNG A;  2PQN A;  4I6E A;  2GGF A;  3B7R L;  4LCT A;  3CVP A;  5T8I A;  4GZ3 A;  2XPY A;  2WXP A;  2PQR A;  4GYY A;  1EPU A;  5KJL A;  5ARF A;  1ZU2 A;  3MGB A;  4AV7 A;  5CMW A;  2L0I A;  1E96 B;  3NZU A;  3OXF A;  4I2W A;  2Y4T A;  2I1K A;  2X6H A;  2VGX A;  2LSV A;  2OVB A;  3QK0 A;  3LVQ E;  4KZC A;  4V3I A;  3MV2 B;  4XZ4 A;  4UWK A;  4IYP A;  4I2Z A;  3VTX A;  4KXK B;  4A3V A;  4DK5 A;  4EZL A;  4N3C A;  5FQ8 A;  3UPV A;  3E4B A;  3P1U A;  4G24 A;  4JA7 A;  4I6J A;  4B8C B;  1IHG A;  4DLO A;  3CVW A;  3FTZ A;  3PRZ A;  5EDS A;  2CG3 A;  2EQX A;  3PUK A;  5ENN A;  4CRW A;  2L0T B;  2WQ6 A;  1SZ9 A;  4F1S A;  3PE3 A;  3QOU A;  2I6H A;  2WXO A;  3KD7 A;  1OUV A;  4XKC A;  2DCP A;  3ZYK A;  4JL0 A;  3CQG B;  4ABN A;  4KVM A;  5G05 J;  2AW6 A;  3HHM A;  3FTU A;  1OWP A;  4E85 A;  4L2L A;  2CHX A;  2ION A;  2XGO A;  4F3V A;  4JPS A;  4FU3 A;  4FJZ A;  2X6I A;  4GZD A;  4HVB A;  1H2U A;  4DI3 A;  3URZ A;  2WVI A;  5FT9 A;  2AXV A;  2VGY A;  4HFG A;  3FU6 A;  3SF4 A;  4MS6 A;  4BTB A;  2KM4 A;  1ZBP A;  3FFL A;  3DPD A;  2WXG A;  2DIW A;  4KMO A;  3MZL B;  5T3R A;  4GA0 A;  3CR3 A;  3CHM A;  1HXI A;  4EBA G;  3EDT B;  2IJG X;  3PE4 A;  2Y4U A;  3D9O A;  3MX3 A;  3EHN A;  4PS7 A;  2HM8 A;  3RIB A;  3S7B A;  4APF A;  3CHS A;  3FU5 A;  4N2Q A;  1N52 A;  5FZS A;  3LS8 A;  3U4T A;  1KT1 A;  2OOE A;  1OWN A;  3FUJ A;  4FLB A;  2A4Z A;  3ML8 A;  3OTN A;  3HIZ A;  4G26 A;  3PEU B;  1MQS A;  3LYA A;  4CCA A;  3ONL A;  4GA1 A;  3LVR E;  4BSX A;  4DPR A;  4J8E A;  4IN3 B;  5BPP A;  4GCN A;  4IUL A;  3UMV A;  3LCA A;  4ATG A;  2WXL A;  4GA2 A;  3OXL A;  4LEU A;  3D9K A;  3ZYQ A;  3FTS A;  2KZT B;  1YA0 A;  2YIN A;  4KZ0 A;  3ZHE A;  2LAI A;  3R7R A;  4U0U A;  3ENE A;  1KLX A;  4U07 A;  5EKQ D;  1HG2 A;  4PUC A;  3FUK A;  4RSY A;  4G1T A;  5BUZ A;  1P5Q A;  5LCW J;  3AS4 A;  3SZ7 A;  2BTD A;  3FTX A;  3G2W A;  4HOU A;  3FY4 A;  1U3D A;  2XPI A;  3ASG A;  3RK6 A;  3CST A;  3FUL A;  4JEU A;  3OXG A;  3ZW3 A;  3JUI A;  3PUJ A;  3FU3 A;  4UWF A;  3SNX A;  2VQ2 A;  3QWV A;  5CCL A;  2XGS A;  4AVX A;  4CDN A;  2WM9 A;  2JLB A;  3B7T A;  1IYG A;  3MKQ B;  4PS8 A;  4HOQ A;  4ANX A;  1MHQ A;  2WXQ A;  1EF1 C;  2V0P A;  4KT6 B;  4HOR A;  1UJK A;  3B13 A;  4AIF A;  2QFC A;  4HS2 A;  5LCW C;  2XCC A;  1OWL A;  3LY8 A;  1UG3 A;  4WND A;  5AJL A;  3SHF A;  2IOS A;  4BTA A;  3ASF A;  1NZN A;  4GAA A;  5AYW D;  5ANR A;  3MEK A;  1IQR A;  3CVN A;  4N3A A;  3CV0 A;  2WMN A;  2X3M A;  3CLJ A;  1XGW A;  2R59 A;  4BX9 A;  4CEM A;  5G05 C;  2WMO A;  3QWP A;  1INZ A;  3SBT B;  5EX0 A;  2KCK A;  3CHR A;  4FC8 A;  4A55 A;  4ACL A;  2L9B A;  3CVL A;  3IHY A;  1WY6 A;  2WB2 A;  2X38 A;  2J07 A;  3QKY A;  1PAQ A;  2QY7 A;  4RVB A;  1QQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...