3SZ7A

Crystal structure of the sgt2 tpr domain from aspergillus fumigatus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
151
structure length
151
Chain Sequence
GPRSMAPTPESDKLKSEGNAAMARKEYSKAIDLYTQALSIAPANPIYLSNRAAAYSASGQHEKAAEDAELATVVDPKYSKAWSRLGLARFDMADYKGAKEAYEKGIEAEGNGGSDAMKRGLETTKRKIEEANRGAEPPADDVDDAAGASRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural model of the Sgt2 protein and its interactions with chaperones and the Get4/Get5 complex.
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Chaperone regulator
molecule keywords Hsc70 cochaperone (SGT)
total genus 56
structure length 151
sequence length 151
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13414 TPR_11 TPR repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3sz7A00
3OXLA 2XGSA 4UI9J 4BT8A 2XGMA 1W3BA 2HR2A 4GCNA 4KYOB 4AY6A 3ASDA 4I9EA 3CEQA 1NZNA 4WUYA 3CVNA 4IN3B 4W9RA 4GYWA 5G05C 2LSUA 4RG9A 2AVPA 4YVQC 3QOUA 4GA2A 3S7DA 3CVLA 3UQ3A 3FFLA 5JJTA 3U4TA 3Q15A 2XCBA 3KS2A 1WAO1 2FF4A 5D0QD 3QWWA 5ARGA 2R5SA 5CCMA 5EX3A 3LY9A 2OOEA 2DBAA 2XEVA 4J8EA 4N3CA 4LEUA 4XI0A 3RIBA 4H7XA 1Y8MA 4U0SA 4XI9A 4N2SA 4YNDA 3UPVA 5JJ6A 3S7JA 3VTXA 4GYOA 1A17A 5CCLA 3TG4A 4HORA 2LNIA 5D0OD 1B89A 2WQHA 4I2WA 3ASFA 3CVPA 2GW1A 3HYMB 4B94A 3TGOA 3U3WA 2WPVA 3JYSA 3VTYA 2NC9A 5FJYA 5DBKA 4HOSA 3BEEA 5FZQA 5KJLA 4UQYA 3CKBA 3KD7A 3ESKA 3OXGA 4UI9K 4BWRA 5C1DA 4N2QA 4WNGA 2C2LA 5FTPA 2VQ2A 1ELWA 3ASGA 3GYZA 3LCAA 3Q4AB 4GZ5A 1OUVA 5G04C 3SZ7A 1KT1A 2YQ8A 3LY8A 3CV0A 2KCKA 4JA9A 5M72A 2LSVA 3O48A 2UY1B 2ONDA 2VGXB 3MEKA 2BUGA 2XPIA 3GW4A 2L6JA 3IEGA 2PQNA 4J0UA 1KT0A 4CGVA 2IF4A 2PQRA 4I9CA 4WNDA 1YA0A 2P58C 3GZ2A 4AIFA 5FZSA 3CK8A 4UQXA 4GPKA 3RJVA 3AS4A 3QDNA 4GA1A 4H7YA 4N3AA 5BW8C 3LPZA 4U0UA 5HI7A 2YHCA 1KLXA 1TJCA 3FWVA 4J8FA 3ZFWA 4CGWA 5ARFA 3ZPJA 4HOUA 5KJNA 3RKVA 3Q47B 4U04A 3PE4A 4GYYA 2Y4TA 3ZHEB 5HQ8A 2PL2A 3EDTB 4G1TA 2FO7A 2KATA 2UY1A 4G2VA 4UI9C 1NA3A 3QKYA 1HZ4A 3Q49B 4G23A 4I17A 4N39A 3TAXA 2I6HA 5DIZA 4I1AA 4BTAA 3GZ1A 3R9AB 5FZRA 2XGOA 4KBQA 4JA7A 3AS5A 4XIFA 2VSYA 3CK9A 2IFUA 3PE3A 4HOQA 5AYWD 3Q5MA 3RO3A 1WM5A 2QFCA 4NRHB 4F3VA 5BNWA 3K9IA 4EQFA 3OXFA 1QZ2A 3PDNA 2Q7FA 3RU0A 4JHRA 3N71A 4G24A 1FCHA 4UQZA 4CDRA 2C0LA 1IYGA 4J8DA 5EX0A 5BT1A 5LCWJ 4G25A 1P5QA 1HXIA 2VGXA 1ZBPA 3ASHA 4G26A 2V5FA 4GZ3A 2Y4UA 1E96B 5KJMA 3MV3B 4I2ZA 3S7BA 5A7DB 5G04J 4O6FA 3ZN3A 1NA0A 3RO2A 4N5CA 3SF4A 5CHEE 4WNEA 3UUXA 3TG5A 5A6CA 4RG6A 1ZU2A 3LYAA 3ULQA 4U0ZA 4BTBA 2FEZA 2KC7A 3CKCA 5G05J 5JJ7A 2VYIA 2J9QA 3KAEA 2VGYA 3MV2B 3ZHEA 3WXXA 3FP3A 4KXKB 3AS8A 4Y6WA 5FT9A 4AY5A 4Y6CA 3QWPA 4ABNA 3MA5A 2FI7A 4BT9A 5KJKA 5LCWC 3CK7A 3URZA 4GCOA 4YVOA 1PC2A 2MHKA 5EKQD 1XNFA 4U07A 3CVQA 3QWVA 4N3BA 4JL0A 4APOA 3S7FA 3E4BA 4WNFA 2C0MA 2FBNA 2UWJG 2KCLA 2XCCA 2JLBA 3LY7A 3MKRA 4GZ6A 3ZGQA 4A1SA 2HYZA 4HOTA 4GA0A 3NF1A 1IHGA 2HO1A 2VSNA 3LKUA 2PZIA 4ME2A 1QQEA 2E2EA 4NQ0A 1HH8A 4AM9A 2KCVA 1ELRA
chains in the Genus database with same CATH superfamily
2HR2A 3FEXA 2R2LA 4AY6A 4I9EA 2CG2A 3RAUA 3AJIA 1V55E 2KM4A 4J8SA 3Q15A 3KS2A 5ENQD 2OOEA 4FHJA 4U0SA 4N2SA 3FHEA 1BI8B 5JJ6A 3VTXA 1A17A 3HYMB 3ML9A 2GW1A 2ETAA 3OAWA 3T5XA 5JMND 3UIOC 3P2BA 2KCKA 1D9SA 3AG2E 2PQNA 1TJFA 2LUHA 4CGVA 4KVOA 5BW8C 4U0UA 3FWVA 1UG3A 1DC2A 5KJNA 1E8ZA 4HBDA 3CVUA 3EDTB 5DIZA 4DUIA 3QARA 3LEWA 2A5EA 4LNUD 3UM2A 3V30A 3PREA 1HE8A 1ZBPA 2LXMA 2CFUA 3E34A 4I2ZA 5G04J 3D9JA 1NA0A 3RO2A 2RFMA 4APFA 3ULQA 2J8SD 1DCQA 4J8YA 3DSXA 1G3NB 1SZAA 2ZU6B 5FT9A 3URZA 4YVOA 5EKQD 1WDYA 3D9KA 3CVQA 3UX4A 2C0MA 1HH8A 1H2TC 4BSXA 2R03A 3CGHA 2HO1A 5B1AE 2R17C 2L0IA 5AJLA 3CEQA 1IQRA 2F8YA 3FTVA 2WXPA 3FH8A 4D10C 1EDUA 1E8WA 3QWWA 2R5SA 3PZ4A 5ENRD 3ZYQA 3ZYLA 3CQGB 3BUAA 4PUCA 1BLXB 4JW1A 4K5AB 1H2VC 4LSZE 2DIWA 4ILHB 5M72A 4PS3A 1HU3A 1YA0A 3GZ2A 3PNTB 4UQXA 1OY3D 4ATGA 2IU1A 3C3QA 1YCSB 3Q9NC 1RZ4A 4C48B 5AARA 5ITZF 4RLYA 4G23A 3U9WA 4GPMA 3HRAA 3B7UX 2XGOA 3UT7A 3ZU7B 2I9CA 4U8YD 1NP7A 5AQAA 5B1BE 4GU5A 2CHWA 1U3CA 1TYQG 1IQUA 3Q79A 3L9TA 3UUXA 2XRZA 4EPZA 4KMOA 4U0ZA 4BEPA 3CKCA 1X81A 3UI2A 3QWPA 2QYUA 3D9OA 4N3BA 2YINA 1WY6A 3ONLA 5ENOD 1Y6IA 2WQ7A 1IHGA 4ME2A 2GRLA 2GRNB 3FTWA 4DX5D 1Z3YA 2WVIA 2Y1LE 2AVPA 3TJPA 3HXBA 3HHMA 5D0QD 3Q7AA 3S7JA 2WXKA 5D0OD 3S2AA 3F6QA 4K5CA 2DYSE 2PM6A 4HI8A 4BWRA 3T8MA 3Q4AB 3MEKA 3PEVB 4I9CA 4WNDA 2WB2A 5C2YA 2XHEA 2YHCA 4HOUA 4L2YA 2F0YA 4OVVA 2FO7A 4G2VA 2DZOA 1OCZE 3Q49B 4AJWA 3S7DA 4GMJA 4LCTA 5T3RA 3QJZA 3CSFA 3NOGD 1H6OA 5E75A 5BT1A 3DPDA 4O6FA 3T9KA 4WNEA 4BSZB 3PH0C 4YDYA 2KC7A 4PDXA 3MV2B 1S63A 2XS8A 4AY5A 1H0AA 1SVXA 4UWGA 4JL0A 3VLDA 4A55A 2J4BA 3NBNB 4DI3A 1E7VA 3OXLA 1SQMA 1ZB1A 4IN3B 4RG9A 4EBAA 5KWDA 1N4RA 4K0RA 2XCBA 3LS8A 1TNZA 4H7XA 1KZOA 3SO8A 4JHKA 2FULA 4DX2A 3FUDA 3JXJA 3VTYA 4HOSA 4RQIA 3OXGA 3CVVA 2V0PA 4GTSA 2UY1B 3CR3A 4MLPA 4LG6A 1TNYA 3EIJA 2H6GA 4DLQA 5HRYA 3B7BA 5FIOA 1HF8A 4HI9A 5FQ7A 4JC8A 1HFAA 3PE3A 3TWTA 5B3SE 3RU0A 3FU3A 3PNLB 3APFA 1FT1A 4URKA 1A5EA 4HQDA 2GRMA 5CHEE 5A6CA 3TWXA 1ZU2A 3LYAA 3ZHEA 1TN8A 3AU5A 2VSXE 1FVHA 3UKUG 4BX9A 1K1BA 2KCLA 5ENSD 4GA0A 5BV0A 1QQEA 5KCMA 4BT8A 4FC8A 3AG3E 4W9RA 3G2WA 5D2MC 3QOUA 1H6KA 3FFLA 4F1SA 1OWNA 3R7RA 5CCMA 3O4ZA 3FULA 4XI0A 3UPVA 2ZGDA 4ZHBA 3B7TA 3D9MA 4UWHA 4I1MA 3SBTB 3UIPC 4FULA 3WG7E 3ZYMA 1AWCB 2NSZA 4RVBA 3ESKA 3FUMA 3IHVA 1N0QA 3NZSA 3CHQA 1ELWA 1EPUA 5T4YA 3LPZA 3IKOB 5HI7A 3B7SA 2I2OA 2KBXA 4B8AA 2KATA 2IONA 3D9NA 4I1AA 4LNGA 3NOCD 4XE0A 3R9AB 3DEOA 3JQ0A 3AS5A 4XIFA 2VSYA 3JUIA 1N54A 1QZ2A 3PDNA 2AJAA 2BF0X 2J08A 3Q75A 5EILA 2XQ0A 2V5FA 3MZLB 3SQVA 2P2CP 5EN5D 2MOWA 4BTBA 1UJJA 5G55A 2VGYA 3CHOA 3AS8A 5KJKA 4TXQA 3CK7A 2MHKA 2LXLA 2WXGA 2XENA 3ZGQA 2HYZA 3BG1B 2DVWA 4HRLA 4NACA 3G2VA 3J5PA 4K5BA 3TWVA 3SI5A 1IHBA 4LERA 3ZNGA 2X6KA 1U3DA 3OTNA 1Y8MA 4QQIA 4HLLA 4WWPA 3UM3A 3I5PA 3UMVA 3CVPA 4CZ2D 3PS6A 2BTDA 2HM8A 4N2QA 2VTBA 3AAAC 1JCRA 3O48A 5BV1A 3FEYA 1KT0A 1OWOA 4C9BB 4FJYA 3EJNA 4GZCA 3AS4A 2RKKA 4O1PA 2I1KA 5ENNA 4CT0A 5HQ8A 1KZPA 1HZ4A 4G8KA 3GZSA 3SGHA 3TAXA 3CQCB 3IHYA 2CHXA 2AXUA 3NB2A 4B89A 2V4HC 2MYOA 4UQZA 2C0LA 5EX0A 4G25A 3IXEA 3DEPA 4IULA 4AXHA 4B0ZA 3HIZA 3APCA 2RG8A 4GTPA 4JZYA 2F8XK 2AWIA 1E7UA 4E85A 5JJ7A 4Y6CA 5CBNA 1DCEA 4XX5A 1O1SA 4PS7A 2KCVA 3RRUA 3TXNA 2V4LA 3DPYA 3JCKC 4GYWA 3CVLA 1FVFA 3ISMC 4UWLA 1WAO1 3SFZA 4CDMA 5EX3A 3FH5A 1N52A 4TXRA 5BUZA 2OVBA 4F53A 3FTUA 5AN8A 3SBSA 3D3MA 4B94A 4GAAA 5AQ9A 2J07A 3ZIMA 2JABA 5FZQA 4ZFHA 4BFRA 4WNGA 2C2LA 2EIJE 4GZ5A 1K8KG 3LY8A 3CVYA 2ONDA 3L22A 2ILRA 3FH7A 3ASOE 3CK8A 4H7YA 4N3AA 2H6HA 4EBAG 3PZ3A 2IO2C 5ARFA 1JCSA 1N0RA 1N4PA 3PZDA 1TNOA 4N39A 4FJZA 5CERB 2WXFA 3SFXA 5BNWA 3ASNE 2WXRA 5IY5E 1LD7A 1HXIA 3APDA 3E33A 2KZTB 2Y4UA 4TV3A 3TWUA 3DWLG 1OWPA 2J4DA 3JQ1A 3S7BA 2WXMA 3TG5A 3R9MA 5FQ6A 3W9FA 3KAEA 4L9PA 2MRIA 4JD2G 4KXKB 3E30A 3L54A 4MKTA 2FI7A 3B95A 4CRWA 1XNFA 2WXQA 3QWVA 1UW4B 3MKRA 3DXMG 1EF1C 1JPLA 4NQ0A 5AIJA 3KSLA 4P29A 2IJGX 3MX3A 4B8CB 3TWSA 2KXPC 4NURA 4N5QA 1O1TA 3LVRE 3ZVVA 4G11A 4XI9A 3C98A 5CCLA 2NXPA 3ESLA 3MYVA 3CVWA 3JYSA 5DBKA 4JVSA 2BEDA 3UTMA 4L23A 3ASGA 1LF8A 5BXUA 2J49A 1JWFA 2P9UG 3GW4A 4JEUA 2PQRA 2XS1A 3L82A 1HS6A 1N9AA 1MZCA 3RJVA 2VJ8A 2ETCA 4HB5A 4CGWA 3ZFWA 3IBEA 4U04A 3PE4A 1NL4A 4GZDA 2I6HA 3GZ1A 2X38A 2EINE 4J6IA 4EQFA 3TWQA 4OAVB 5CEDB 5LCWJ 4GZ3A 5FINA 1K1AA 2XPZA 3FU0A 4KVMA 1TN6A 3ZN3A 2ZGGA 5CRUA 4XZ4A 4BETA 2J9QA 1H2UA 4U63A 3SHFA 5LCWC 4A1GA 4OVUA 3PZ2A 4GCOA 1PC2A 1OXJA 2FO1E 2UWJG 5JHAA 4ANWA 3HVEA 4HXIA 3QC1A 2PZIA 3I4RB 2X6HA 2WXIA 5A23A 4NIKA 4CCAA 4DX6D 3ABKE 5JJTA 1TNBA 3U4TA 2VTBB 4J8EA 4LEUA 2ZIRA 1BD8A 5KBAA 2H6FA 4DX1A 4GTMA 3TGOA 4MBGA 3UT8A 3CHSA 2OVFA 3TL5A 3UM0A 4GB9A 5FTPA 4C0EA 5G04C 4JA9A 3ML8A 3FY4A 2V5QC 4ANUA 2P58C 1UOHA 1TJCA 2H6IA 1NI1A 4ILGA 2CFZA 4DRXE 3G2UA 4G1TA 4UWKA 1KPSB 2JEKA 4JHJA 1K3ZD 1BU9A 1YMPA 4JPSA 4J8DA 2VGXA 2XRYA 5A7DB 5ANLA 3FTXA 3SF4A 3T5VA 5CECB 4I6EA 5LX8A 3FDHA 4FP7A 3UINC 2FEZA 2WMOA 4FADA 3FP3A 5D66A 5BPPA 3I4GA 3ZUVB 3EUVA 2XCCA 4J7WA 2AXVA 3DXKG 1ELRA 3ZXSA 3HXFA 4UI9J 2IO3C 5G05C 4X8QA 5LOZA 3EIQC 2FF4A 3CHRA 3EU5A 2DBAA 1HX8A 4HRNA 4LNBA 4G8LA 4DX7D 3BEEA 1OWMA 2IY0C 4L1BA 3KD7A 3UM1A 4XKCA 3D9LA 2V8SE 1INZA 1Q2ZA 3UT4A 3SD5A 1UN9A 5H7PA 1S70B 4J8FA 3PUKA 2PL2A 1H19A 3PUJA 4KBQA 3CSTA 1SW6A 2IFUA 3MCXA 3Q5MA 4KZCA 1BPOA 3OXFA 1PY1A 1OWLA 3N71A 1FT2A 1P5QA 5CBOA 4HFGA 2LAHA 3FTSA 3G2SA 4HS2A 2WMNA 4IYPA 3CVXA 2WXOA 3B7RL 1MHQA 1D8EA 4U07A 1HG5A 2VGEA 3RRNB 4ANVA 3NF1A 3DSTA 3RSEG 3HXCA 3PZ1A 3DSVA 2P9NG 3HXEA 3BQOA 3ASDA 3FU6A 5JHBA 1SA5A 3ABME 5ARGA 1WG0A 4I43A 3SFYA 3E32A 5AJDA 4GYOA 2B6CA 4O60A 2P9KG 3AU4A 3ABLE 2VQ2A 3J5QB 3VLEA 4Q69A 2IOSA 3CLJA 3NQPA 4FU3A 1YYHA 2X6FA 4AIFA 3P1UA 4GA1A 1E90A 3W9GA 3RKVA 2QZAA 2DZNA 1Z3XA 3ZRHA 3MGBA 2WQ6A 3QKYA 1MJ0A 2P9IG 5BXOA 4XKBA 5AYWD 2LO6A 2DYRE 3U66A 2Q7FA 3C5RA 4OYSA 4EHMA 1NFIE 1N4SA 4JEHA 3ULEG 4FLHA 4G26A 3MV3B 3MKQB 3EHQA 3LDZA 3PEUB 2E0IA 4LRZA 1U2VG 3L08A 3NZUA 4JXTA 4XEIG 4DPRA 1UN8A 3R7QA 3I3NA 3TWWA 3S7FA 2BKGA 4AV7A 4GZ6A 3PVLA 4ACKA 5EIBE 3QAQA 4AP2A 1BI7B 2XGSA 4KYOB 1NZNA 4B93B 3MKQA 3ZXPA 4E6HA 2X3MA 4U7EB 3TXMA 5AENA 4GPKA 2WXJA 4TRQA 1OCCE 4HRMB 3Q73A 4YNDA 5FQ8A 2LNIA 3PRZA 4HVBA 5FJYA 3SNXA 3V2XA 4HNAD 1O5MA 3FUFA 4UI9K 3DBSA 3GYZA 4A3TA 1KT1A 2P9SG 2BUGA 5EYLA 3KEAA 4TUUA 3NAWA 4C0MA 2P9PG 2X6IA 4TUMA 5HS0A 1DVPA 4BTAA 4WWOA 2J09A 2QFCA 3EHMA 2KZTA 4CDRA 3HG0D 4CYMD 4GTVA 4GTOA 4RSYA 2NYJA 2QY7A 5EYPF 3ZKJA 4DLOA 1S0PA 4Y6WA 4ABNA 2BKKB 1OT8A 4WAFA 3V2OA 2IQCA 2FBNA 2PM7A 3LY7A 2JLBA 3ENEA 4U95D 4DK5A 4YDOA 4M3OA 4ATZD 2I1JA 2OEWA 4TXPA 3D9IA 4YVQC 1IKND 2M63A 1QNFA 3UKRG 4AEZC 3DSUA 4Q96A 3V79K 1SA4A 3AG4E 2Y0BG 3BU8A 4GTRA 4HORA 3CHMA 2PNNA 1D8DA 2WPVA 2WXHA 3JUEA 4GTQA 4UQYA 4F6RD 3CKBA 2OV8A 3FUNA 3L6AA 2GROB 4A63B 2XPIA 4J0UA 4OAUC 2VSOE 5LFAA 2CG3A 4UUCA 2AXZA 4IRUA 2GRRB 1LTXA 3ZPJA 1OCOE 3Q47B 4EZLA 3IV0A 4A3VA 3HXDA 1TNUA 2UY1A 4KZ0A 4UI9C 4R7LA 4JA7A 2IEJA 4NRHB 2YHEA 3V31A 3DSSA 1FCHA 3RRMB 1Z6TA 3RK6A 3ASHA 5CEAA 1E96B 1IXVA 3EU9A 1MYOA 4N5CA 2RD0A 2YNQA 3ZYKA 1JCQA 3MA5A 4FHKA 2QYJA 4BT9A 3X2QE 3ONKA 4Q94A 5KNHD 3B13A 2R05A 1HG2A 3Q7FA 3FTZA 3L17A 1RW2A 2HE0A 1TEZA 4UWFA 5J90A 4EECA 4GCNA 4WUYA 3CVNA 2GRPB 3UQ3A 4K03A 4BESA 5JA4D 3G2TA 4CT4A 4N3CA 3E37A 2IOLA 3Q78A 2OCCE 1N11A 3TG4A 1B89A 2WQHA 3D9PA 3U3WA 4PS8A 3JXIA 1N94A 3FUHA 1HO8A 3D9HA 5ENTD 3CV0A 1ELKA 2P9LG 4BERA 3IEGA 5EIDA 1X5BA 4AOFA 3QDNA 4U8HA 3FTYA 3DSWA 3LJ3A 5LP0A 2Y4TA 3HVEB 5AAOA 1N4QA 4WWNA 1WM5A 2XEHA 1O1RA 4G24A 2GGFA 2EQXA 1JUQA 4F1PA 1UJKA 2XPYA 4L2LA 2OEVA 1MX4A 1VDYA 1DNPA 5T8IA 4AVXA 4GMLA 1E8YA 3FUJA 3AG1E 1MX2A 3BG0B 3ULYA 5ENPD 4I1OB 4PH4B 4O1OA 4EZKA 2L6BA 2AW6A 4APOA 4HLEA 2VSNA 3QB2A 3U64A 2XGMA 1W3BA 4QFVA 3SY2A 3QK0A 4ACLA 4GA2A 4FA6A 3RIBA 3EHNA 2QC9A 1EYHA 3LVQE 4I2WA 4CDNA 3ASFA 3KEZA 1N95A 5CMWA 2B0OE 5KJLA 4Z68A 3DRAA 3LCAA 3SZ7A 3C72A 2LSVA 1Z5SC 2L6JA 5HKPA 2IF4A 4U96D 2ZXWE 1H6PA 2EIKE 5AQ7A 3LXUX 1KLXA 4GYYA 4FLBA 1XGWA 4JB8P 4DI4A 5FZRA 4F3VA 1OCRE 2A4ZA 3CK9A 3RO3A 2Y69E 3Q9UC 4CEMA 3FU5A 4V3IA 3ZW3A 4LUNU 2CHZA 5E76A 4RG6A 4BX8A 5G05J 4I6GA 2LAIA 4MRUA 1QBQA 4EZJA 2X6JA 1MX6A 2RFAA 4YDWA 3MJWA 3CHPA 5FQ4A 4ILIA 5FWQA 4YDEA 3E4BA 3QNKA 4A1SA 5J08A 5G2NA 4HOTA 3LKUA 2E2EA 3L16A 4DJAA 2A5UA 2DCPA 2EILE 2LSUA 1GW6A 1TN7A 2DWZA 1V54E 1MQSA 1JWGA 3VLFA 1PAQA 3C3RA 3LY9A 2XEVA 4GMRA 1L5JA 1SZ9A 3CIAA 2L9BA 2R02A 1AP7A 2R59A 3L13A 2NC9A 2ETBA 2ZISA 3FUKA 5ANRA 5C1DA 2L0TB 1OUVA 1QYMA 2YQ8A 2F37A 2VGXB 3UXGA 5EDSA 1FPPA 5FZSA 4GTTA 1E8XA 3ZHEB 5AQBA 5CMYA 4MS6A 3TWRA 1NA3A 4I17A 2XZTG 4KT6B 4I6JA 4BY6A 4HOQA 3EHRA 2EIME 3FUIA 3K9IA 1S64A 2GRQB 4JHRA 2WXLA 1IYGA 3C3OA 4U8VD 2XZDG 3HDXA 4L7TA 5KJMA 4M7CA 1LD8A 1TR4A 5KNGA 2XEEA 2VYIA 3WXXA 5CRVA 2WM9A 3T8KA 2Y3AA 3ZEFA 4ANXA 2WXNA 4WNFA 4F7AA 3LJNA 3FUEA 3KSQA 4AM9A
chains in the Genus database with same CATH topology
2WXIA 5A23A 4BT8A 2HR2A 3FEXA 4FC8A 4AY6A 4I9EA 2CG2A 4W9RA 3G2WA 3D9IA 4YVQC 3QOUA 4CCAA 1H6KA 3FFLA 2KM4A 4J8SA 2M63A 4F1SA 1QNFA 4AEZC 3U4TA 3Q15A 1OWNA 3KS2A 4Q96A 5JJTA 3R7RA 5CCMA 3O4ZA 2VTBB 3FULA 2OOEA 4J8EA 4LEUA 4XI0A 4FHJA 4U0SA 4N2SA 3FHEA 3UPVA 5JJ6A 3B7TA 3VTXA 1A17A 4HORA 3CHMA 3D9MA 4UWHA 4I1MA 3SBTB 3HYMB 3ML9A 2GW1A 4FULA 3TGOA 3ZYMA 3UT8A 2WPVA 2WXHA 3CHSA 3OAWA 2OVFA 4UQYA 2NSZA 3CKBA 4RVBA 3ESKA 3T5XA 3TL5A 3FUMA 3IHVA 4GB9A 3NZSA 5FTPA 4C0EA 3CHQA 1ELWA 1EPUA 2OV8A 3P2BA 5G04C 3FUNA 3L6AA 4JA9A 2KCKA 3ML8A 3FY4A 2XPIA 4J0UA 4ANUA 2PQNA 1TJFA 4CGVA 2P58C 2VSOE 5LFAA 2CG3A 4KVOA 5BW8C 2AXZA 4IRUA 5T4YA 3LPZA 4U0UA 3IKOB 5HI7A 3B7SA 3FWVA 1TJCA 1UG3A 2I2OA 3ZPJA 5KJNA 3Q47B 4EZLA 3IV0A 2CFZA 4ILGA 4A3VA 1E8ZA 4B8AA 3CVUA 3EDTB 3G2UA 2KATA 2IONA 2UY1A 3D9NA 4G1TA 4KZ0A 4UI9C 4UWKA 5DIZA 4I1AA 2JEKA 4R7LA 4XE0A 3QARA 3R9AB 4JHJA 3JQ0A 4JA7A 3AS5A 4XIFA 2VSYA 3LEWA 4NRHB 2YHEA 3JUIA 1N54A 1QZ2A 3PDNA 4JPSA 3PREA 1FCHA 2BF0X 2J08A 1Z6TA 4J8DA 3RRMB 1HE8A 3RK6A 2VGXA 1ZBPA 2XQ0A 3ASHA 2V5FA 3MZLB 2CFUA 1E96B 4I2ZA 2XRYA 5A7DB 5G04J 5ANLA 3D9JA 3FTXA 1NA0A 3RO2A 4N5CA 3SF4A 3T5VA 4APFA 4I6EA 5LX8A 3FDHA 4FP7A 3ULQA 2MOWA 2FEZA 4BTBA 2WMOA 1UJJA 5G55A 2RD0A 2VGYA 3CHOA 4FADA 2YNQA 3FP3A 3AS8A 3ZYKA 1SZAA 2ZU6B 5FT9A 3MA5A 4FHKA 5BPPA 4BT9A 5KJKA 3ONKA 3CK7A 3I4GA 4YVOA 5EKQD 2MHKA 3URZA 3D9KA 3CVQA 3B13A 4Q94A 2WXGA 3UX4A 2C0MA 2XCCA 3ZGQA 1H2TC 4BSXA 1HG2A 2HYZA 3BG1B 3FTZA 3CGHA 3L17A 2HO1A 2R17C 4NACA 2AXVA 1TEZA 3G2VA 4UWFA 1ELRA 3ZXSA 5J90A 4UI9J 4EECA 2L0IA 4GCNA 5AJLA 4WUYA 5G05C 3CEQA 3CVNA 5LOZA 1IQRA 3SI5A 3UQ3A 3FTVA 4K03A 3G2TA 2WXPA 3EIQC 3FH8A 4LERA 4D10C 1EDUA 4CT4A 1E8WA 2FF4A 3CHRA 3QWWA 2R5SA 2X6KA 2DBAA 4N3CA 1U3DA 3OTNA 3ZYQA 1Y8MA 1HX8A 2IOLA 4WWPA 3ZYLA 3TG4A 3CQGB 1B89A 2WQHA 3I5PA 4PUCA 4JW1A 3UMVA 3CVPA 3D9PA 3U3WA 4PS8A 3BEEA 3FUHA 3PS6A 1HO8A 1OWMA 1H2VC 2BTDA 3KD7A 4L1BA 2HM8A 4N2QA 2VTBA 2DIWA 4ILHB 4XKCA 5M72A 3CV0A 4PS3A 1ELKA 3O48A 3D9LA 2V8SE 5BV1A 1HU3A 3IEGA 3FEYA 1INZA 1KT0A 1OWOA 1X5BA 4C9BB 4AOFA 3UT4A 1YA0A 3GZ2A 3PNTB 4FJYA 3EJNA 3SD5A 4UQXA 4GZCA 3AS4A 3QDNA 4U8HA 3FTYA 4ATGA 1UN9A 3LJ3A 2IU1A 5LP0A 4J8FA 2I1KA 5ENNA 2Y4TA 4CT0A 3PUKA 5HQ8A 3HVEB 2PL2A 4G23A 1H19A 1HZ4A 3SGHA 3GZSA 4WWNA 3TAXA 3CQCB 3U9WA 3IHYA 2CHXA 2AXUA 3B7UX 2XGOA 3PUJA 4KBQA 3CSTA 2IFUA 3UT7A 3MCXA 3Q5MA 1WM5A 4B89A 4KZCA 1BPOA 3OXFA 1PY1A 1OWLA 3N71A 4G24A 4UQZA 2I9CA 2C0LA 5EX0A 2GGFA 2EQXA 1JUQA 1NP7A 1P5QA 4G25A 4GU5A 2CHWA 1U3CA 4IULA 4B0ZA 1UJKA 4AXHA 4HFGA 2LAHA 3HIZA 3APCA 2RG8A 3FTSA 1IQUA 2XPYA 4L2LA 3G2SA 4JZYA 4HS2A 3UUXA 2XRZA 1VDYA 4EPZA 1DNPA 2AWIA 2WMNA 1E7UA 4KMOA 4U0ZA 5T8IA 3CKCA 4E85A 5JJ7A 4IYPA 4AVXA 4GMLA 1E8YA 3FUJA 3CVXA 4Y6CA 3QWPA 2WXOA 3BG0B 3B7RL 4I1OB 1MHQA 3D9OA 4PH4B 4EZKA 4U07A 1HG5A 4N3BA 2YINA 2AW6A 4APOA 1WY6A 3RRNB 3ONLA 4XX5A 4ANVA 3NF1A 1Y6IA 4HLEA 1IHGA 2VSNA 2WQ7A 3QB2A 4ME2A 4PS7A 2KCVA 2GRLA 4QFVA 2XGMA 1W3BA 3U64A 3RRUA 3FTWA 3TXNA 2V4LA 3ASDA 3JCKC 3QK0A 4GYWA 1Z3YA 2WVIA 4ACLA 2AVPA 3FU6A 5JHBA 4GA2A 4FA6A 3CVLA 1FVFA 4UWLA 3TJPA 3HHMA 1WAO1 3SFZA 5D0QD 5ARGA 4CDMA 5EX3A 3FH5A 1N52A 4I43A 3RIBA 3EHNA 1EYHA 5BUZA 3S7JA 2OVBA 4F53A 5AJDA 3FTUA 2WXKA 4GYOA 5D0OD 3S2AA 3LVQE 4I2WA 3D3MA 3ASFA 3KEZA 3SBSA 4CDNA 4B94A 4GAAA 2J07A 3ZIMA 2PM6A 5CMWA 5FZQA 5KJLA 3AU4A 4BWRA 4BFRA 3T8MA 4WNGA 2C2LA 2VQ2A 3LCAA 3SZ7A 4GZ5A 3Q4AB 3VLEA 4Q69A 3LY8A 3CVYA 2LSVA 2ONDA 3L22A 3MEKA 2L6JA 2IOSA 3CLJA 3NQPA 4FU3A 3PEVB 2IF4A 2X6FA 4I9CA 2ILRA 3FH7A 4WNDA 4AIFA 2WB2A 3P1UA 3CK8A 5C2YA 4GA1A 4H7YA 4N3AA 2XHEA 4EBAG 3LXUX 1E90A 2YHCA 1KLXA 5ARFA 4HOUA 3RKVA 4L2YA 4GYYA 4FLBA 1Z3XA 1XGWA 3ZRHA 3PZDA 3MGBA 4OVVA 2WQ6A 4DI4A 5FZRA 2FO7A 4F3VA 4G2VA 3QKYA 3Q49B 4N39A 5KCMA 4AJWA 4FJZA 4XKBA 2WXFA 2A4ZA 3CK9A 3S7DA 3RO3A 5BNWA 5AYWD 2LO6A 4GMJA 4LCTA 3U66A 2WXRA 5T3RA 3QJZA 4CEMA 2Q7FA 4OYSA 3CSFA 3FU5A 4V3IA 3ZW3A 5E75A 5BT1A 1HXIA 4JEHA 3APDA 4FLHA 4G26A 4LUNU 2CHZA 2KZTB 2Y4UA 4TV3A 3MV3B 1OWPA 2J4DA 3DPDA 3JQ1A 3MKQB 4O6FA 3LDZA 2WXMA 3S7BA 5E76A 3PEUB 2E0IA 4LRZA 4WNEA 3TG5A 4RG6A 4BX8A 3PH0C 5FQ6A 5G05J 2KC7A 3L08A 3NZUA 4I6GA 4PDXA 2LAIA 4JXTA 4MRUA 3KAEA 4DPRA 3MV2B 2MRIA 1UN8A 3R7QA 4KXKB 3I3NA 3L54A 4AY5A 4MKTA 4EZJA 2X6JA 2FI7A 1H0AA 4CRWA 3MJWA 3CHPA 5FQ4A 4ILIA 1XNFA 5FWQA 2WXQA 3QWVA 4UWGA 4JL0A 1UW4B 3S7FA 3E4BA 4AV7A 3QNKA 4GZ6A 4A1SA 5J08A 3MKRA 1EF1C 5G2NA 1JPLA 3PVLA 2J4BA 3VLDA 4ACKA 4A55A 4HOTA 3LKUA 4NQ0A 2E2EA 3QAQA 4AP2A 5AIJA 4DI3A 3L16A 1E7VA 4DJAA 3OXLA 2XGSA 4KYOB 4P29A 1SQMA 2IJGX 1NZNA 2A5UA 3MX3A 2DCPA 4IN3B 2LSUA 3MKQA 4RG9A 1GW6A 4EBAA 4E6HA 2X3MA 4B8CB 4K0RA 1MQSA 1JWGA 2XCBA 3VLFA 3TXMA 5AENA 4NURA 4GPKA 1PAQA 2WXJA 3LY9A 3LS8A 4TRQA 2XEVA 3LVRE 3ZVVA 4G11A 4H7XA 4XI9A 4YNDA 1L5JA 1SZ9A 3C98A 3CIAA 5FQ8A 4JHKA 2FULA 2L9BA 2NXPA 5CCLA 2LNIA 3ESLA 2R59A 3FUDA 3MYVA 3PRZA 3CVWA 3L13A 4HVBA 3JYSA 3VTYA 2NC9A 5FJYA 5DBKA 3SNXA 3FUKA 4HOSA 4JVSA 5ANRA 3OXGA 3FUFA 4UI9K 5C1DA 4L23A 2L0TB 3CVVA 3ASGA 1LF8A 3DBSA 3GYZA 2V0PA 1OUVA 4A3TA 1KT1A 2YQ8A 2J49A 2UY1B 2VGXB 1JWFA 2BUGA 3GW4A 5EDSA 4JEUA 2PQRA 3CR3A 4MLPA 4TUUA 1HS6A 5FZSA 4C0MA 3RJVA 3EIJA 2VJ8A 4DLQA 2X6IA 4CGWA 3ZFWA 1E8XA 3IBEA 4U04A 3PE4A 3ZHEB 5CMYA 4MS6A 1NA3A 4I17A 1DVPA 1HF8A 4GZDA 4BTAA 2I6HA 4KT6B 4WWOA 4I6JA 3GZ1A 5FQ7A 4BY6A 4JC8A 1HFAA 3PE3A 2X38A 4HOQA 2J09A 4J6IA 3FUIA 2QFCA 3K9IA 4EQFA 3EHMA 3RU0A 4JHRA 2KZTA 4CDRA 3FU3A 2WXLA 1IYGA 3PNLB 5LCWJ 3APFA 4GZ3A 4URKA 2XPZA 3HDXA 3FU0A 4L7TA 4KVMA 5KJMA 3ZN3A 2GRMA 5CHEE 5A6CA 4RSYA 2QY7A 1ZU2A 3LYAA 4XZ4A 2VYIA 2J9QA 4DLOA 1H2UA 4U63A 3WXXA 3ZHEA 2WM9A 1S0PA 3SHFA 4Y6WA 3AU5A 2VSXE 4ABNA 1FVHA 2Y3AA 3ZEFA 4A1GA 5LCWC 4OVUA 4GCOA 1PC2A 4WAFA 4BX9A 4ANXA 2WXNA 2IQCA 4WNFA 2FBNA 2UWJG 2PM7A 2KCLA 3LY7A 2JLBA 3ENEA 4F7AA 5JHAA 4GA0A 5BV0A 4ANWA 3HVEA 4HXIA 3FUEA 3QC1A 2PZIA 4DK5A 1QQEA 3I4RB 1HH8A 2X6HA 4M3OA 4AM9A 2I1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OXL A;  2XGS A;  4UI9 J;  4BT8 A;  2XGM A;  1W3B A;  2HR2 A;  4GCN A;  4KYO B;  4AY6 A;  3ASD A;  4I9E A;  3CEQ A;  1NZN A;  4WUY A;  3CVN A;  4IN3 B;  4W9R A;  4GYW A;  5G05 C;  2LSU A;  4RG9 A;  2AVP A;  4YVQ C;  3QOU A;  4GA2 A;  3S7D A;  3CVL A;  3UQ3 A;  3FFL A;  5JJT A;  3U4T A;  3Q15 A;  2XCB A;  3KS2 A;  1WAO 1;  2FF4 A;  5D0Q D;  3QWW A;  5ARG A;  2R5S A;  5CCM A;  5EX3 A;  3LY9 A;  2OOE A;  2DBA A;  2XEV A;  4J8E A;  4N3C A;  4LEU A;  4XI0 A;  3RIB A;  4H7X A;  1Y8M A;  4U0S A;  4XI9 A;  4N2S A;  4YND A;  3UPV A;  5JJ6 A;  3S7J A;  3VTX A;  4GYO A;  1A17 A;  5CCL A;  3TG4 A;  4HOR A;  2LNI A;  5D0O D;  1B89 A;  2WQH A;  4I2W A;  3ASF A;  3CVP A;  2GW1 A;  3HYM B;  4B94 A;  3TGO A;  3U3W A;  2WPV A;  3JYS A;  3VTY A;  2NC9 A;  5FJY A;  5DBK A;  4HOS A;  3BEE A;  5FZQ A;  5KJL A;  4UQY A;  3CKB A;  3KD7 A;  3ESK A;  3OXG A;  4UI9 K;  4BWR A;  5C1D A;  4N2Q A;  4WNG A;  2C2L A;  5FTP A;  2VQ2 A;  1ELW A;  3ASG A;  3GYZ A;  3LCA A;  3Q4A B;  4GZ5 A;  1OUV A;  5G04 C;  3SZ7 A;  1KT1 A;  2YQ8 A;  3LY8 A;  3CV0 A;  2KCK A;  4JA9 A;  5M72 A;  2LSV A;  3O48 A;  2UY1 B;  2OND A;  2VGX B;  3MEK A;  2BUG A;  2XPI A;  3GW4 A;  2L6J A;  3IEG A;  2PQN A;  4J0U A;  1KT0 A;  4CGV A;  2IF4 A;  2PQR A;  4I9C A;  4WND A;  1YA0 A;  2P58 C;  3GZ2 A;  4AIF A;  5FZS A;  3CK8 A;  4UQX A;  4GPK A;  3RJV A;  3AS4 A;  3QDN A;  4GA1 A;  4H7Y A;  4N3A A;  5BW8 C;  3LPZ A;  4U0U A;  5HI7 A;  2YHC A;  1KLX A;  1TJC A;  3FWV A;  4J8F A;  3ZFW A;  4CGW A;  5ARF A;  3ZPJ A;  4HOU A;  5KJN A;  3RKV A;  3Q47 B;  4U04 A;  3PE4 A;  4GYY A;  2Y4T A;  3ZHE B;  5HQ8 A;  2PL2 A;  3EDT B;  4G1T A;  2FO7 A;  2KAT A;  2UY1 A;  4G2V A;  4UI9 C;  1NA3 A;  3QKY A;  1HZ4 A;  3Q49 B;  4G23 A;  4I17 A;  4N39 A;  3TAX A;  2I6H A;  5DIZ A;  4I1A A;  4BTA A;  3GZ1 A;  3R9A B;  5FZR A;  2XGO A;  4KBQ A;  4JA7 A;  3AS5 A;  4XIF A;  2VSY A;  3CK9 A;  2IFU A;  3PE3 A;  4HOQ A;  5AYW D;  3Q5M A;  3RO3 A;  1WM5 A;  2QFC A;  4NRH B;  4F3V A;  5BNW A;  3K9I A;  4EQF A;  3OXF A;  1QZ2 A;  3PDN A;  2Q7F A;  3RU0 A;  4JHR A;  3N71 A;  4G24 A;  1FCH A;  4UQZ A;  4CDR A;  2C0L A;  1IYG A;  4J8D A;  5EX0 A;  5BT1 A;  5LCW J;  4G25 A;  1P5Q A;  1HXI A;  2VGX A;  1ZBP A;  3ASH A;  4G26 A;  2V5F A;  4GZ3 A;  2Y4U A;  1E96 B;  5KJM A;  3MV3 B;  4I2Z A;  3S7B A;  5A7D B;  5G04 J;  4O6F A;  3ZN3 A;  1NA0 A;  3RO2 A;  4N5C A;  3SF4 A;  5CHE E;  4WNE A;  3UUX A;  3TG5 A;  5A6C A;  4RG6 A;  1ZU2 A;  3LYA A;  3ULQ A;  4U0Z A;  4BTB A;  2FEZ A;  2KC7 A;  3CKC A;  5G05 J;  5JJ7 A;  2VYI A;  2J9Q A;  3KAE A;  2VGY A;  3MV2 B;  3ZHE A;  3WXX A;  3FP3 A;  4KXK B;  3AS8 A;  4Y6W A;  5FT9 A;  4AY5 A;  4Y6C A;  3QWP A;  4ABN A;  3MA5 A;  2FI7 A;  4BT9 A;  5KJK A;  5LCW C;  3CK7 A;  3URZ A;  4GCO A;  4YVO A;  1PC2 A;  2MHK A;  5EKQ D;  1XNF A;  4U07 A;  3CVQ A;  3QWV A;  4N3B A;  4JL0 A;  4APO A;  3S7F A;  3E4B A;  4WNF A;  2C0M A;  2FBN A;  2UWJ G;  2KCL A;  2XCC A;  2JLB A;  3LY7 A;  3MKR A;  4GZ6 A;  3ZGQ A;  4A1S A;  2HYZ A;  4HOT A;  4GA0 A;  3NF1 A;  1IHG A;  2HO1 A;  2VSN A;  3LKU A;  2PZI A;  4ME2 A;  1QQE A;  2E2E A;  4NQ0 A;  1HH8 A;  4AM9 A;  2KCV A;  1ELR A; 
#chains in the Genus database with same CATH topology
 2HR2 A;  3FEX A;  2R2L A;  4AY6 A;  4I9E A;  2CG2 A;  3RAU A;  3AJI A;  1V55 E;  2KM4 A;  4J8S A;  3Q15 A;  3KS2 A;  5ENQ D;  2OOE A;  4FHJ A;  4U0S A;  4N2S A;  3FHE A;  1BI8 B;  5JJ6 A;  3VTX A;  1A17 A;  3HYM B;  3ML9 A;  2GW1 A;  2ETA A;  3OAW A;  3T5X A;  5JMN D;  3UIO C;  3P2B A;  2KCK A;  1D9S A;  3AG2 E;  2PQN A;  1TJF A;  2LUH A;  4CGV A;  4KVO A;  5BW8 C;  4U0U A;  3FWV A;  1UG3 A;  1DC2 A;  5KJN A;  1E8Z A;  4HBD A;  3CVU A;  3EDT B;  5DIZ A;  4DUI A;  3QAR A;  3LEW A;  2A5E A;  4LNU D;  3UM2 A;  3V30 A;  3PRE A;  1HE8 A;  1ZBP A;  2LXM A;  2CFU A;  3E34 A;  4I2Z A;  5G04 J;  3D9J A;  1NA0 A;  3RO2 A;  2RFM A;  4APF A;  3ULQ A;  2J8S D;  1DCQ A;  4J8Y A;  3DSX A;  1G3N B;  1SZA A;  2ZU6 B;  5FT9 A;  3URZ A;  4YVO A;  5EKQ D;  1WDY A;  3D9K A;  3CVQ A;  3UX4 A;  2C0M A;  1HH8 A;  1H2T C;  4BSX A;  2R03 A;  3CGH A;  2HO1 A;  5B1A E;  2R17 C;  2L0I A;  5AJL A;  3CEQ A;  1IQR A;  2F8Y A;  3FTV A;  2WXP A;  3FH8 A;  4D10 C;  1EDU A;  1E8W A;  3QWW A;  2R5S A;  3PZ4 A;  5ENR D;  3ZYQ A;  3ZYL A;  3CQG B;  3BUA A;  4PUC A;  1BLX B;  4JW1 A;  4K5A B;  1H2V C;  4LSZ E;  2DIW A;  4ILH B;  5M72 A;  4PS3 A;  1HU3 A;  1YA0 A;  3GZ2 A;  3PNT B;  4UQX A;  1OY3 D;  4ATG A;  2IU1 A;  3C3Q A;  1YCS B;  3Q9N C;  1RZ4 A;  4C48 B;  5AAR A;  5ITZ F;  4RLY A;  4G23 A;  3U9W A;  4GPM A;  3HRA A;  3B7U X;  2XGO A;  3UT7 A;  3ZU7 B;  2I9C A;  4U8Y D;  1NP7 A;  5AQA A;  5B1B E;  4GU5 A;  2CHW A;  1U3C A;  1TYQ G;  1IQU A;  3Q79 A;  3L9T A;  3UUX A;  2XRZ A;  4EPZ A;  4KMO A;  4U0Z A;  4BEP A;  3CKC A;  1X81 A;  3UI2 A;  3QWP A;  2QYU A;  3D9O A;  4N3B A;  2YIN A;  1WY6 A;  3ONL A;  5ENO D;  1Y6I A;  2WQ7 A;  1IHG A;  4ME2 A;  2GRL A;  2GRN B;  3FTW A;  4DX5 D;  1Z3Y A;  2WVI A;  2Y1L E;  2AVP A;  3TJP A;  3HXB A;  3HHM A;  5D0Q D;  3Q7A A;  3S7J A;  2WXK A;  5D0O D;  3S2A A;  3F6Q A;  4K5C A;  2DYS E;  2PM6 A;  4HI8 A;  4BWR A;  3T8M A;  3Q4A B;  3MEK A;  3PEV B;  4I9C A;  4WND A;  2WB2 A;  5C2Y A;  2XHE A;  2YHC A;  4HOU A;  4L2Y A;  2F0Y A;  4OVV A;  2FO7 A;  4G2V A;  2DZO A;  1OCZ E;  3Q49 B;  4AJW A;  3S7D A;  4GMJ A;  4LCT A;  5T3R A;  3QJZ A;  3CSF A;  3NOG D;  1H6O A;  5E75 A;  5BT1 A;  3DPD A;  4O6F A;  3T9K A;  4WNE A;  4BSZ B;  3PH0 C;  4YDY A;  2KC7 A;  4PDX A;  3MV2 B;  1S63 A;  2XS8 A;  4AY5 A;  1H0A A;  1SVX A;  4UWG A;  4JL0 A;  3VLD A;  4A55 A;  2J4B A;  3NBN B;  4DI3 A;  1E7V A;  3OXL A;  1SQM A;  1ZB1 A;  4IN3 B;  4RG9 A;  4EBA A;  5KWD A;  1N4R A;  4K0R A;  2XCB A;  3LS8 A;  1TNZ A;  4H7X A;  1KZO A;  3SO8 A;  4JHK A;  2FUL A;  4DX2 A;  3FUD A;  3JXJ A;  3VTY A;  4HOS A;  4RQI A;  3OXG A;  3CVV A;  2V0P A;  4GTS A;  2UY1 B;  3CR3 A;  4MLP A;  4LG6 A;  1TNY A;  3EIJ A;  2H6G A;  4DLQ A;  5HRY A;  3B7B A;  5FIO A;  1HF8 A;  4HI9 A;  5FQ7 A;  4JC8 A;  1HFA A;  3PE3 A;  3TWT A;  5B3S E;  3RU0 A;  3FU3 A;  3PNL B;  3APF A;  1FT1 A;  4URK A;  1A5E A;  4HQD A;  2GRM A;  5CHE E;  5A6C A;  3TWX A;  1ZU2 A;  3LYA A;  3ZHE A;  1TN8 A;  3AU5 A;  2VSX E;  1FVH A;  3UKU G;  4BX9 A;  1K1B A;  2KCL A;  5ENS D;  4GA0 A;  5BV0 A;  1QQE A;  5KCM A;  4BT8 A;  4FC8 A;  3AG3 E;  4W9R A;  3G2W A;  5D2M C;  3QOU A;  1H6K A;  3FFL A;  4F1S A;  1OWN A;  3R7R A;  5CCM A;  3O4Z A;  3FUL A;  4XI0 A;  3UPV A;  2ZGD A;  4ZHB A;  3B7T A;  3D9M A;  4UWH A;  4I1M A;  3SBT B;  3UIP C;  4FUL A;  3WG7 E;  3ZYM A;  1AWC B;  2NSZ A;  4RVB A;  3ESK A;  3FUM A;  3IHV A;  1N0Q A;  3NZS A;  3CHQ A;  1ELW A;  1EPU A;  5T4Y A;  3LPZ A;  3IKO B;  5HI7 A;  3B7S A;  2I2O A;  2KBX A;  4B8A A;  2KAT A;  2ION A;  3D9N A;  4I1A A;  4LNG A;  3NOC D;  4XE0 A;  3R9A B;  3DEO A;  3JQ0 A;  3AS5 A;  4XIF A;  2VSY A;  3JUI A;  1N54 A;  1QZ2 A;  3PDN A;  2AJA A;  2BF0 X;  2J08 A;  3Q75 A;  5EIL A;  2XQ0 A;  2V5F A;  3MZL B;  3SQV A;  2P2C P;  5EN5 D;  2MOW A;  4BTB A;  1UJJ A;  5G55 A;  2VGY A;  3CHO A;  3AS8 A;  5KJK A;  4TXQ A;  3CK7 A;  2MHK A;  2LXL A;  2WXG A;  2XEN A;  3ZGQ A;  2HYZ A;  3BG1 B;  2DVW A;  4HRL A;  4NAC A;  3G2V A;  3J5P A;  4K5B A;  3TWV A;  3SI5 A;  1IHB A;  4LER A;  3ZNG A;  2X6K A;  1U3D A;  3OTN A;  1Y8M A;  4QQI A;  4HLL A;  4WWP A;  3UM3 A;  3I5P A;  3UMV A;  3CVP A;  4CZ2 D;  3PS6 A;  2BTD A;  2HM8 A;  4N2Q A;  2VTB A;  3AAA C;  1JCR A;  3O48 A;  5BV1 A;  3FEY A;  1KT0 A;  1OWO A;  4C9B B;  4FJY A;  3EJN A;  4GZC A;  3AS4 A;  2RKK A;  4O1P A;  2I1K A;  5ENN A;  4CT0 A;  5HQ8 A;  1KZP A;  1HZ4 A;  4G8K A;  3GZS A;  3SGH A;  3TAX A;  3CQC B;  3IHY A;  2CHX A;  2AXU A;  3NB2 A;  4B89 A;  2V4H C;  2MYO A;  4UQZ A;  2C0L A;  5EX0 A;  4G25 A;  3IXE A;  3DEP A;  4IUL A;  4AXH A;  4B0Z A;  3HIZ A;  3APC A;  2RG8 A;  4GTP A;  4JZY A;  2F8X K;  2AWI A;  1E7U A;  4E85 A;  5JJ7 A;  4Y6C A;  5CBN A;  1DCE A;  4XX5 A;  1O1S A;  4PS7 A;  2KCV A;  3RRU A;  3TXN A;  2V4L A;  3DPY A;  3JCK C;  4GYW A;  3CVL A;  1FVF A;  3ISM C;  4UWL A;  1WAO 1;  3SFZ A;  4CDM A;  5EX3 A;  3FH5 A;  1N52 A;  4TXR A;  5BUZ A;  2OVB A;  4F53 A;  3FTU A;  5AN8 A;  3SBS A;  3D3M A;  4B94 A;  4GAA A;  5AQ9 A;  2J07 A;  3ZIM A;  2JAB A;  5FZQ A;  4ZFH A;  4BFR A;  4WNG A;  2C2L A;  2EIJ E;  4GZ5 A;  1K8K G;  3LY8 A;  3CVY A;  2OND A;  3L22 A;  2ILR A;  3FH7 A;  3ASO E;  3CK8 A;  4H7Y A;  4N3A A;  2H6H A;  4EBA G;  3PZ3 A;  2IO2 C;  5ARF A;  1JCS A;  1N0R A;  1N4P A;  3PZD A;  1TNO A;  4N39 A;  4FJZ A;  5CER B;  2WXF A;  3SFX A;  5BNW A;  3ASN E;  2WXR A;  5IY5 E;  1LD7 A;  1HXI A;  3APD A;  3E33 A;  2KZT B;  2Y4U A;  4TV3 A;  3TWU A;  3DWL G;  1OWP A;  2J4D A;  3JQ1 A;  3S7B A;  2WXM A;  3TG5 A;  3R9M A;  5FQ6 A;  3W9F A;  3KAE A;  4L9P A;  2MRI A;  4JD2 G;  4KXK B;  3E30 A;  3L54 A;  4MKT A;  2FI7 A;  3B95 A;  4CRW A;  1XNF A;  2WXQ A;  3QWV A;  1UW4 B;  3MKR A;  3DXM G;  1EF1 C;  1JPL A;  4NQ0 A;  5AIJ A;  3KSL A;  4P29 A;  2IJG X;  3MX3 A;  4B8C B;  3TWS A;  2KXP C;  4NUR A;  4N5Q A;  1O1T A;  3LVR E;  3ZVV A;  4G11 A;  4XI9 A;  3C98 A;  5CCL A;  2NXP A;  3ESL A;  3MYV A;  3CVW A;  3JYS A;  5DBK A;  4JVS A;  2BED A;  3UTM A;  4L23 A;  3ASG A;  1LF8 A;  5BXU A;  2J49 A;  1JWF A;  2P9U G;  3GW4 A;  4JEU A;  2PQR A;  2XS1 A;  3L82 A;  1HS6 A;  1N9A A;  1MZC A;  3RJV A;  2VJ8 A;  2ETC A;  4HB5 A;  4CGW A;  3ZFW A;  3IBE A;  4U04 A;  3PE4 A;  1NL4 A;  4GZD A;  2I6H A;  3GZ1 A;  2X38 A;  2EIN E;  4J6I A;  4EQF A;  3TWQ A;  4OAV B;  5CED B;  5LCW J;  4GZ3 A;  5FIN A;  1K1A A;  2XPZ A;  3FU0 A;  4KVM A;  1TN6 A;  3ZN3 A;  2ZGG A;  5CRU A;  4XZ4 A;  4BET A;  2J9Q A;  1H2U A;  4U63 A;  3SHF A;  5LCW C;  4A1G A;  4OVU A;  3PZ2 A;  4GCO A;  1PC2 A;  1OXJ A;  2FO1 E;  2UWJ G;  5JHA A;  4ANW A;  3HVE A;  4HXI A;  3QC1 A;  2PZI A;  3I4R B;  2X6H A;  2WXI A;  5A23 A;  4NIK A;  4CCA A;  4DX6 D;  3ABK E;  5JJT A;  1TNB A;  3U4T A;  2VTB B;  4J8E A;  4LEU A;  2ZIR A;  1BD8 A;  5KBA A;  2H6F A;  4DX1 A;  4GTM A;  3TGO A;  4MBG A;  3UT8 A;  3CHS A;  2OVF A;  3TL5 A;  3UM0 A;  4GB9 A;  5FTP A;  4C0E A;  5G04 C;  4JA9 A;  3ML8 A;  3FY4 A;  2V5Q C;  4ANU A;  2P58 C;  1UOH A;  1TJC A;  2H6I A;  1NI1 A;  4ILG A;  2CFZ A;  4DRX E;  3G2U A;  4G1T A;  4UWK A;  1KPS B;  2JEK A;  4JHJ A;  1K3Z D;  1BU9 A;  1YMP A;  4JPS A;  4J8D A;  2VGX A;  2XRY A;  5A7D B;  5ANL A;  3FTX A;  3SF4 A;  3T5V A;  5CEC B;  4I6E A;  5LX8 A;  3FDH A;  4FP7 A;  3UIN C;  2FEZ A;  2WMO A;  4FAD A;  3FP3 A;  5D66 A;  5BPP A;  3I4G A;  3ZUV B;  3EUV A;  2XCC A;  4J7W A;  2AXV A;  3DXK G;  1ELR A;  3ZXS A;  3HXF A;  4UI9 J;  2IO3 C;  5G05 C;  4X8Q A;  5LOZ A;  3EIQ C;  2FF4 A;  3CHR A;  3EU5 A;  2DBA A;  1HX8 A;  4HRN A;  4LNB A;  4G8L A;  4DX7 D;  3BEE A;  1OWM A;  2IY0 C;  4L1B A;  3KD7 A;  3UM1 A;  4XKC A;  3D9L A;  2V8S E;  1INZ A;  1Q2Z A;  3UT4 A;  3SD5 A;  1UN9 A;  5H7P A;  1S70 B;  4J8F A;  3PUK A;  2PL2 A;  1H19 A;  3PUJ A;  4KBQ A;  3CST A;  1SW6 A;  2IFU A;  3MCX A;  3Q5M A;  4KZC A;  1BPO A;  3OXF A;  1PY1 A;  1OWL A;  3N71 A;  1FT2 A;  1P5Q A;  5CBO A;  4HFG A;  2LAH A;  3FTS A;  3G2S A;  4HS2 A;  2WMN A;  4IYP A;  3CVX A;  2WXO A;  3B7R L;  1MHQ A;  1D8E A;  4U07 A;  1HG5 A;  2VGE A;  3RRN B;  4ANV A;  3NF1 A;  3DST A;  3RSE G;  3HXC A;  3PZ1 A;  3DSV A;  2P9N G;  3HXE A;  3BQO A;  3ASD A;  3FU6 A;  5JHB A;  1SA5 A;  3ABM E;  5ARG A;  1WG0 A;  4I43 A;  3SFY A;  3E32 A;  5AJD A;  4GYO A;  2B6C A;  4O60 A;  2P9K G;  3AU4 A;  3ABL E;  2VQ2 A;  3J5Q B;  3VLE A;  4Q69 A;  2IOS A;  3CLJ A;  3NQP A;  4FU3 A;  1YYH A;  2X6F A;  4AIF A;  3P1U A;  4GA1 A;  1E90 A;  3W9G A;  3RKV A;  2QZA A;  2DZN A;  1Z3X A;  3ZRH A;  3MGB A;  2WQ6 A;  3QKY A;  1MJ0 A;  2P9I G;  5BXO A;  4XKB A;  5AYW D;  2LO6 A;  2DYR E;  3U66 A;  2Q7F A;  3C5R A;  4OYS A;  4EHM A;  1NFI E;  1N4S A;  4JEH A;  3ULE G;  4FLH A;  4G26 A;  3MV3 B;  3MKQ B;  3EHQ A;  3LDZ A;  3PEU B;  2E0I A;  4LRZ A;  1U2V G;  3L08 A;  3NZU A;  4JXT A;  4XEI G;  4DPR A;  1UN8 A;  3R7Q A;  3I3N A;  3TWW A;  3S7F A;  2BKG A;  4AV7 A;  4GZ6 A;  3PVL A;  4ACK A;  5EIB E;  3QAQ A;  4AP2 A;  1BI7 B;  2XGS A;  4KYO B;  1NZN A;  4B93 B;  3MKQ A;  3ZXP A;  4E6H A;  2X3M A;  4U7E B;  3TXM A;  5AEN A;  4GPK A;  2WXJ A;  4TRQ A;  1OCC E;  4HRM B;  3Q73 A;  4YND A;  5FQ8 A;  2LNI A;  3PRZ A;  4HVB A;  5FJY A;  3SNX A;  3V2X A;  4HNA D;  1O5M A;  3FUF A;  4UI9 K;  3DBS A;  3GYZ A;  4A3T A;  1KT1 A;  2P9S G;  2BUG A;  5EYL A;  3KEA A;  4TUU A;  3NAW A;  4C0M A;  2P9P G;  2X6I A;  4TUM A;  5HS0 A;  1DVP A;  4BTA A;  4WWO A;  2J09 A;  2QFC A;  3EHM A;  2KZT A;  4CDR A;  3HG0 D;  4CYM D;  4GTV A;  4GTO A;  4RSY A;  2NYJ A;  2QY7 A;  5EYP F;  3ZKJ A;  4DLO A;  1S0P A;  4Y6W A;  4ABN A;  2BKK B;  1OT8 A;  4WAF A;  3V2O A;  2IQC A;  2FBN A;  2PM7 A;  3LY7 A;  2JLB A;  3ENE A;  4U95 D;  4DK5 A;  4YDO A;  4M3O A;  4ATZ D;  2I1J A;  2OEW A;  4TXP A;  3D9I A;  4YVQ C;  1IKN D;  2M63 A;  1QNF A;  3UKR G;  4AEZ C;  3DSU A;  4Q96 A;  3V79 K;  1SA4 A;  3AG4 E;  2Y0B G;  3BU8 A;  4GTR A;  4HOR A;  3CHM A;  2PNN A;  1D8D A;  2WPV A;  2WXH A;  3JUE A;  4GTQ A;  4UQY A;  4F6R D;  3CKB A;  2OV8 A;  3FUN A;  3L6A A;  2GRO B;  4A63 B;  2XPI A;  4J0U A;  4OAU C;  2VSO E;  5LFA A;  2CG3 A;  4UUC A;  2AXZ A;  4IRU A;  2GRR B;  1LTX A;  3ZPJ A;  1OCO E;  3Q47 B;  4EZL A;  3IV0 A;  4A3V A;  3HXD A;  1TNU A;  2UY1 A;  4KZ0 A;  4UI9 C;  4R7L A;  4JA7 A;  2IEJ A;  4NRH B;  2YHE A;  3V31 A;  3DSS A;  1FCH A;  3RRM B;  1Z6T A;  3RK6 A;  3ASH A;  5CEA A;  1E96 B;  1IXV A;  3EU9 A;  1MYO A;  4N5C A;  2RD0 A;  2YNQ A;  3ZYK A;  1JCQ A;  3MA5 A;  4FHK A;  2QYJ A;  4BT9 A;  3X2Q E;  3ONK A;  4Q94 A;  5KNH D;  3B13 A;  2R05 A;  1HG2 A;  3Q7F A;  3FTZ A;  3L17 A;  1RW2 A;  2HE0 A;  1TEZ A;  4UWF A;  5J90 A;  4EEC A;  4GCN A;  4WUY A;  3CVN A;  2GRP B;  3UQ3 A;  4K03 A;  4BES A;  5JA4 D;  3G2T A;  4CT4 A;  4N3C A;  3E37 A;  2IOL A;  3Q78 A;  2OCC E;  1N11 A;  3TG4 A;  1B89 A;  2WQH A;  3D9P A;  3U3W A;  4PS8 A;  3JXI A;  1N94 A;  3FUH A;  1HO8 A;  3D9H A;  5ENT D;  3CV0 A;  1ELK A;  2P9L G;  4BER A;  3IEG A;  5EID A;  1X5B A;  4AOF A;  3QDN A;  4U8H A;  3FTY A;  3DSW A;  3LJ3 A;  5LP0 A;  2Y4T A;  3HVE B;  5AAO A;  1N4Q A;  4WWN A;  1WM5 A;  2XEH A;  1O1R A;  4G24 A;  2GGF A;  2EQX A;  1JUQ A;  4F1P A;  1UJK A;  2XPY A;  4L2L A;  2OEV A;  1MX4 A;  1VDY A;  1DNP A;  5T8I A;  4AVX A;  4GML A;  1E8Y A;  3FUJ A;  3AG1 E;  1MX2 A;  3BG0 B;  3ULY A;  5ENP D;  4I1O B;  4PH4 B;  4O1O A;  4EZK A;  2L6B A;  2AW6 A;  4APO A;  4HLE A;  2VSN A;  3QB2 A;  3U64 A;  2XGM A;  1W3B A;  4QFV A;  3SY2 A;  3QK0 A;  4ACL A;  4GA2 A;  4FA6 A;  3RIB A;  3EHN A;  2QC9 A;  1EYH A;  3LVQ E;  4I2W A;  4CDN A;  3ASF A;  3KEZ A;  1N95 A;  5CMW A;  2B0O E;  5KJL A;  4Z68 A;  3DRA A;  3LCA A;  3SZ7 A;  3C72 A;  2LSV A;  1Z5S C;  2L6J A;  5HKP A;  2IF4 A;  4U96 D;  2ZXW E;  1H6P A;  2EIK E;  5AQ7 A;  3LXU X;  1KLX A;  4GYY A;  4FLB A;  1XGW A;  4JB8 P;  4DI4 A;  5FZR A;  4F3V A;  1OCR E;  2A4Z A;  3CK9 A;  3RO3 A;  2Y69 E;  3Q9U C;  4CEM A;  3FU5 A;  4V3I A;  3ZW3 A;  4LUN U;  2CHZ A;  5E76 A;  4RG6 A;  4BX8 A;  5G05 J;  4I6G A;  2LAI A;  4MRU A;  1QBQ A;  4EZJ A;  2X6J A;  1MX6 A;  2RFA A;  4YDW A;  3MJW A;  3CHP A;  5FQ4 A;  4ILI A;  5FWQ A;  4YDE A;  3E4B A;  3QNK A;  4A1S A;  5J08 A;  5G2N A;  4HOT A;  3LKU A;  2E2E A;  3L16 A;  4DJA A;  2A5U A;  2DCP A;  2EIL E;  2LSU A;  1GW6 A;  1TN7 A;  2DWZ A;  1V54 E;  1MQS A;  1JWG A;  3VLF A;  1PAQ A;  3C3R A;  3LY9 A;  2XEV A;  4GMR A;  1L5J A;  1SZ9 A;  3CIA A;  2L9B A;  2R02 A;  1AP7 A;  2R59 A;  3L13 A;  2NC9 A;  2ETB A;  2ZIS A;  3FUK A;  5ANR A;  5C1D A;  2L0T B;  1OUV A;  1QYM A;  2YQ8 A;  2F37 A;  2VGX B;  3UXG A;  5EDS A;  1FPP A;  5FZS A;  4GTT A;  1E8X A;  3ZHE B;  5AQB A;  5CMY A;  4MS6 A;  3TWR A;  1NA3 A;  4I17 A;  2XZT G;  4KT6 B;  4I6J A;  4BY6 A;  4HOQ A;  3EHR A;  2EIM E;  3FUI A;  3K9I A;  1S64 A;  2GRQ B;  4JHR A;  2WXL A;  1IYG A;  3C3O A;  4U8V D;  2XZD G;  3HDX A;  4L7T A;  5KJM A;  4M7C A;  1LD8 A;  1TR4 A;  5KNG A;  2XEE A;  2VYI A;  3WXX A;  5CRV A;  2WM9 A;  3T8K A;  2Y3A A;  3ZEF A;  4ANX A;  2WXN A;  4WNF A;  4F7A A;  3LJN A;  3FUE A;  3KSQ A;  4AM9 A; 
#chains in the Genus database with same CATH homology
 2WXI A;  5A23 A;  4BT8 A;  2HR2 A;  3FEX A;  4FC8 A;  4AY6 A;  4I9E A;  2CG2 A;  4W9R A;  3G2W A;  3D9I A;  4YVQ C;  3QOU A;  4CCA A;  1H6K A;  3FFL A;  2KM4 A;  4J8S A;  2M63 A;  4F1S A;  1QNF A;  4AEZ C;  3U4T A;  3Q15 A;  1OWN A;  3KS2 A;  4Q96 A;  5JJT A;  3R7R A;  5CCM A;  3O4Z A;  2VTB B;  3FUL A;  2OOE A;  4J8E A;  4LEU A;  4XI0 A;  4FHJ A;  4U0S A;  4N2S A;  3FHE A;  3UPV A;  5JJ6 A;  3B7T A;  3VTX A;  1A17 A;  4HOR A;  3CHM A;  3D9M A;  4UWH A;  4I1M A;  3SBT B;  3HYM B;  3ML9 A;  2GW1 A;  4FUL A;  3TGO A;  3ZYM A;  3UT8 A;  2WPV A;  2WXH A;  3CHS A;  3OAW A;  2OVF A;  4UQY A;  2NSZ A;  3CKB A;  4RVB A;  3ESK A;  3T5X A;  3TL5 A;  3FUM A;  3IHV A;  4GB9 A;  3NZS A;  5FTP A;  4C0E A;  3CHQ A;  1ELW A;  1EPU A;  2OV8 A;  3P2B A;  5G04 C;  3FUN A;  3L6A A;  4JA9 A;  2KCK A;  3ML8 A;  3FY4 A;  2XPI A;  4J0U A;  4ANU A;  2PQN A;  1TJF A;  4CGV A;  2P58 C;  2VSO E;  5LFA A;  2CG3 A;  4KVO A;  5BW8 C;  2AXZ A;  4IRU A;  5T4Y A;  3LPZ A;  4U0U A;  3IKO B;  5HI7 A;  3B7S A;  3FWV A;  1TJC A;  1UG3 A;  2I2O A;  3ZPJ A;  5KJN A;  3Q47 B;  4EZL A;  3IV0 A;  2CFZ A;  4ILG A;  4A3V A;  1E8Z A;  4B8A A;  3CVU A;  3EDT B;  3G2U A;  2KAT A;  2ION A;  2UY1 A;  3D9N A;  4G1T A;  4KZ0 A;  4UI9 C;  4UWK A;  5DIZ A;  4I1A A;  2JEK A;  4R7L A;  4XE0 A;  3QAR A;  3R9A B;  4JHJ A;  3JQ0 A;  4JA7 A;  3AS5 A;  4XIF A;  2VSY A;  3LEW A;  4NRH B;  2YHE A;  3JUI A;  1N54 A;  1QZ2 A;  3PDN A;  4JPS A;  3PRE A;  1FCH A;  2BF0 X;  2J08 A;  1Z6T A;  4J8D A;  3RRM B;  1HE8 A;  3RK6 A;  2VGX A;  1ZBP A;  2XQ0 A;  3ASH A;  2V5F A;  3MZL B;  2CFU A;  1E96 B;  4I2Z A;  2XRY A;  5A7D B;  5G04 J;  5ANL A;  3D9J A;  3FTX A;  1NA0 A;  3RO2 A;  4N5C A;  3SF4 A;  3T5V A;  4APF A;  4I6E A;  5LX8 A;  3FDH A;  4FP7 A;  3ULQ A;  2MOW A;  2FEZ A;  4BTB A;  2WMO A;  1UJJ A;  5G55 A;  2RD0 A;  2VGY A;  3CHO A;  4FAD A;  2YNQ A;  3FP3 A;  3AS8 A;  3ZYK A;  1SZA A;  2ZU6 B;  5FT9 A;  3MA5 A;  4FHK A;  5BPP A;  4BT9 A;  5KJK A;  3ONK A;  3CK7 A;  3I4G A;  4YVO A;  5EKQ D;  2MHK A;  3URZ A;  3D9K A;  3CVQ A;  3B13 A;  4Q94 A;  2WXG A;  3UX4 A;  2C0M A;  2XCC A;  3ZGQ A;  1H2T C;  4BSX A;  1HG2 A;  2HYZ A;  3BG1 B;  3FTZ A;  3CGH A;  3L17 A;  2HO1 A;  2R17 C;  4NAC A;  2AXV A;  1TEZ A;  3G2V A;  4UWF A;  1ELR A;  3ZXS A;  5J90 A;  4UI9 J;  4EEC A;  2L0I A;  4GCN A;  5AJL A;  4WUY A;  5G05 C;  3CEQ A;  3CVN A;  5LOZ A;  1IQR A;  3SI5 A;  3UQ3 A;  3FTV A;  4K03 A;  3G2T A;  2WXP A;  3EIQ C;  3FH8 A;  4LER A;  4D10 C;  1EDU A;  4CT4 A;  1E8W A;  2FF4 A;  3CHR A;  3QWW A;  2R5S A;  2X6K A;  2DBA A;  4N3C A;  1U3D A;  3OTN A;  3ZYQ A;  1Y8M A;  1HX8 A;  2IOL A;  4WWP A;  3ZYL A;  3TG4 A;  3CQG B;  1B89 A;  2WQH A;  3I5P A;  4PUC A;  4JW1 A;  3UMV A;  3CVP A;  3D9P A;  3U3W A;  4PS8 A;  3BEE A;  3FUH A;  3PS6 A;  1HO8 A;  1OWM A;  1H2V C;  2BTD A;  3KD7 A;  4L1B A;  2HM8 A;  4N2Q A;  2VTB A;  2DIW A;  4ILH B;  4XKC A;  5M72 A;  3CV0 A;  4PS3 A;  1ELK A;  3O48 A;  3D9L A;  2V8S E;  5BV1 A;  1HU3 A;  3IEG A;  3FEY A;  1INZ A;  1KT0 A;  1OWO A;  1X5B A;  4C9B B;  4AOF A;  3UT4 A;  1YA0 A;  3GZ2 A;  3PNT B;  4FJY A;  3EJN A;  3SD5 A;  4UQX A;  4GZC A;  3AS4 A;  3QDN A;  4U8H A;  3FTY A;  4ATG A;  1UN9 A;  3LJ3 A;  2IU1 A;  5LP0 A;  4J8F A;  2I1K A;  5ENN A;  2Y4T A;  4CT0 A;  3PUK A;  5HQ8 A;  3HVE B;  2PL2 A;  4G23 A;  1H19 A;  1HZ4 A;  3SGH A;  3GZS A;  4WWN A;  3TAX A;  3CQC B;  3U9W A;  3IHY A;  2CHX A;  2AXU A;  3B7U X;  2XGO A;  3PUJ A;  4KBQ A;  3CST A;  2IFU A;  3UT7 A;  3MCX A;  3Q5M A;  1WM5 A;  4B89 A;  4KZC A;  1BPO A;  3OXF A;  1PY1 A;  1OWL A;  3N71 A;  4G24 A;  4UQZ A;  2I9C A;  2C0L A;  5EX0 A;  2GGF A;  2EQX A;  1JUQ A;  1NP7 A;  1P5Q A;  4G25 A;  4GU5 A;  2CHW A;  1U3C A;  4IUL A;  4B0Z A;  1UJK A;  4AXH A;  4HFG A;  2LAH A;  3HIZ A;  3APC A;  2RG8 A;  3FTS A;  1IQU A;  2XPY A;  4L2L A;  3G2S A;  4JZY A;  4HS2 A;  3UUX A;  2XRZ A;  1VDY A;  4EPZ A;  1DNP A;  2AWI A;  2WMN A;  1E7U A;  4KMO A;  4U0Z A;  5T8I A;  3CKC A;  4E85 A;  5JJ7 A;  4IYP A;  4AVX A;  4GML A;  1E8Y A;  3FUJ A;  3CVX A;  4Y6C A;  3QWP A;  2WXO A;  3BG0 B;  3B7R L;  4I1O B;  1MHQ A;  3D9O A;  4PH4 B;  4EZK A;  4U07 A;  1HG5 A;  4N3B A;  2YIN A;  2AW6 A;  4APO A;  1WY6 A;  3RRN B;  3ONL A;  4XX5 A;  4ANV A;  3NF1 A;  1Y6I A;  4HLE A;  1IHG A;  2VSN A;  2WQ7 A;  3QB2 A;  4ME2 A;  4PS7 A;  2KCV A;  2GRL A;  4QFV A;  2XGM A;  1W3B A;  3U64 A;  3RRU A;  3FTW A;  3TXN A;  2V4L A;  3ASD A;  3JCK C;  3QK0 A;  4GYW A;  1Z3Y A;  2WVI A;  4ACL A;  2AVP A;  3FU6 A;  5JHB A;  4GA2 A;  4FA6 A;  3CVL A;  1FVF A;  4UWL A;  3TJP A;  3HHM A;  1WAO 1;  3SFZ A;  5D0Q D;  5ARG A;  4CDM A;  5EX3 A;  3FH5 A;  1N52 A;  4I43 A;  3RIB A;  3EHN A;  1EYH A;  5BUZ A;  3S7J A;  2OVB A;  4F53 A;  5AJD A;  3FTU A;  2WXK A;  4GYO A;  5D0O D;  3S2A A;  3LVQ E;  4I2W A;  3D3M A;  3ASF A;  3KEZ A;  3SBS A;  4CDN A;  4B94 A;  4GAA A;  2J07 A;  3ZIM A;  2PM6 A;  5CMW A;  5FZQ A;  5KJL A;  3AU4 A;  4BWR A;  4BFR A;  3T8M A;  4WNG A;  2C2L A;  2VQ2 A;  3LCA A;  3SZ7 A;  4GZ5 A;  3Q4A B;  3VLE A;  4Q69 A;  3LY8 A;  3CVY A;  2LSV A;  2OND A;  3L22 A;  3MEK A;  2L6J A;  2IOS A;  3CLJ A;  3NQP A;  4FU3 A;  3PEV B;  2IF4 A;  2X6F A;  4I9C A;  2ILR A;  3FH7 A;  4WND A;  4AIF A;  2WB2 A;  3P1U A;  3CK8 A;  5C2Y A;  4GA1 A;  4H7Y A;  4N3A A;  2XHE A;  4EBA G;  3LXU X;  1E90 A;  2YHC A;  1KLX A;  5ARF A;  4HOU A;  3RKV A;  4L2Y A;  4GYY A;  4FLB A;  1Z3X A;  1XGW A;  3ZRH A;  3PZD A;  3MGB A;  4OVV A;  2WQ6 A;  4DI4 A;  5FZR A;  2FO7 A;  4F3V A;  4G2V A;  3QKY A;  3Q49 B;  4N39 A;  5KCM A;  4AJW A;  4FJZ A;  4XKB A;  2WXF A;  2A4Z A;  3CK9 A;  3S7D A;  3RO3 A;  5BNW A;  5AYW D;  2LO6 A;  4GMJ A;  4LCT A;  3U66 A;  2WXR A;  5T3R A;  3QJZ A;  4CEM A;  2Q7F A;  4OYS A;  3CSF A;  3FU5 A;  4V3I A;  3ZW3 A;  5E75 A;  5BT1 A;  1HXI A;  4JEH A;  3APD A;  4FLH A;  4G26 A;  4LUN U;  2CHZ A;  2KZT B;  2Y4U A;  4TV3 A;  3MV3 B;  1OWP A;  2J4D A;  3DPD A;  3JQ1 A;  3MKQ B;  4O6F A;  3LDZ A;  2WXM A;  3S7B A;  5E76 A;  3PEU B;  2E0I A;  4LRZ A;  4WNE A;  3TG5 A;  4RG6 A;  4BX8 A;  3PH0 C;  5FQ6 A;  5G05 J;  2KC7 A;  3L08 A;  3NZU A;  4I6G A;  4PDX A;  2LAI A;  4JXT A;  4MRU A;  3KAE A;  4DPR A;  3MV2 B;  2MRI A;  1UN8 A;  3R7Q A;  4KXK B;  3I3N A;  3L54 A;  4AY5 A;  4MKT A;  4EZJ A;  2X6J A;  2FI7 A;  1H0A A;  4CRW A;  3MJW A;  3CHP A;  5FQ4 A;  4ILI A;  1XNF A;  5FWQ A;  2WXQ A;  3QWV A;  4UWG A;  4JL0 A;  1UW4 B;  3S7F A;  3E4B A;  4AV7 A;  3QNK A;  4GZ6 A;  4A1S A;  5J08 A;  3MKR A;  1EF1 C;  5G2N A;  1JPL A;  3PVL A;  2J4B A;  3VLD A;  4ACK A;  4A55 A;  4HOT A;  3LKU A;  4NQ0 A;  2E2E A;  3QAQ A;  4AP2 A;  5AIJ A;  4DI3 A;  3L16 A;  1E7V A;  4DJA A;  3OXL A;  2XGS A;  4KYO B;  4P29 A;  1SQM A;  2IJG X;  1NZN A;  2A5U A;  3MX3 A;  2DCP A;  4IN3 B;  2LSU A;  3MKQ A;  4RG9 A;  1GW6 A;  4EBA A;  4E6H A;  2X3M A;  4B8C B;  4K0R A;  1MQS A;  1JWG A;  2XCB A;  3VLF A;  3TXM A;  5AEN A;  4NUR A;  4GPK A;  1PAQ A;  2WXJ A;  3LY9 A;  3LS8 A;  4TRQ A;  2XEV A;  3LVR E;  3ZVV A;  4G11 A;  4H7X A;  4XI9 A;  4YND A;  1L5J A;  1SZ9 A;  3C98 A;  3CIA A;  5FQ8 A;  4JHK A;  2FUL A;  2L9B A;  2NXP A;  5CCL A;  2LNI A;  3ESL A;  2R59 A;  3FUD A;  3MYV A;  3PRZ A;  3CVW A;  3L13 A;  4HVB A;  3JYS A;  3VTY A;  2NC9 A;  5FJY A;  5DBK A;  3SNX A;  3FUK A;  4HOS A;  4JVS A;  5ANR A;  3OXG A;  3FUF A;  4UI9 K;  5C1D A;  4L23 A;  2L0T B;  3CVV A;  3ASG A;  1LF8 A;  3DBS A;  3GYZ A;  2V0P A;  1OUV A;  4A3T A;  1KT1 A;  2YQ8 A;  2J49 A;  2UY1 B;  2VGX B;  1JWF A;  2BUG A;  3GW4 A;  5EDS A;  4JEU A;  2PQR A;  3CR3 A;  4MLP A;  4TUU A;  1HS6 A;  5FZS A;  4C0M A;  3RJV A;  3EIJ A;  2VJ8 A;  4DLQ A;  2X6I A;  4CGW A;  3ZFW A;  1E8X A;  3IBE A;  4U04 A;  3PE4 A;  3ZHE B;  5CMY A;  4MS6 A;  1NA3 A;  4I17 A;  1DVP A;  1HF8 A;  4GZD A;  4BTA A;  2I6H A;  4KT6 B;  4WWO A;  4I6J A;  3GZ1 A;  5FQ7 A;  4BY6 A;  4JC8 A;  1HFA A;  3PE3 A;  2X38 A;  4HOQ A;  2J09 A;  4J6I A;  3FUI A;  2QFC A;  3K9I A;  4EQF A;  3EHM A;  3RU0 A;  4JHR A;  2KZT A;  4CDR A;  3FU3 A;  2WXL A;  1IYG A;  3PNL B;  5LCW J;  3APF A;  4GZ3 A;  4URK A;  2XPZ A;  3HDX A;  3FU0 A;  4L7T A;  4KVM A;  5KJM A;  3ZN3 A;  2GRM A;  5CHE E;  5A6C A;  4RSY A;  2QY7 A;  1ZU2 A;  3LYA A;  4XZ4 A;  2VYI A;  2J9Q A;  4DLO A;  1H2U A;  4U63 A;  3WXX A;  3ZHE A;  2WM9 A;  1S0P A;  3SHF A;  4Y6W A;  3AU5 A;  2VSX E;  4ABN A;  1FVH A;  2Y3A A;  3ZEF A;  4A1G A;  5LCW C;  4OVU A;  4GCO A;  1PC2 A;  4WAF A;  4BX9 A;  4ANX A;  2WXN A;  2IQC A;  4WNF A;  2FBN A;  2UWJ G;  2PM7 A;  2KCL A;  3LY7 A;  2JLB A;  3ENE A;  4F7A A;  5JHA A;  4GA0 A;  5BV0 A;  4ANW A;  3HVE A;  4HXI A;  3FUE A;  3QC1 A;  2PZI A;  4DK5 A;  1QQE A;  3I4R B;  1HH8 A;  2X6H A;  4M3O A;  4AM9 A;  2I1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...