3SZ8A

Crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia pseudomallei
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
279
structure length
264
Chain Sequence
b'SMNVAISPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIPFVFKASFDKANRSSIHSYRGVGLDEGLKIFAEVKARFGVPVITDVHEAEQAAPVAEIADVLQVPAFLARQTDLVVAIAKAGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQMAETTGGCPVIFDVTHSLQVLDLARAGIAVGIAGLFLEAHPDPDRARCDGPSALPLHQLEGLLSQMKAIDDLVKRMPAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase 2
molecule tags Transferase
source organism Burkholderia pseudomallei
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
total genus 81
structure length 264
sequence length 279
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sz8A00
3T55A 1C29A 2V5BA 2VFIA 1EB3A 2CU0A 4GE8A 1TPEA 3EWWA 3SY5A 4WZHA 4DO4A 4YLWA 5LHFA 4FF7A 4E2DA 3C3NA 4O11A 1TQJA 2JK2A 4CCEA 4DPQA 4AHQA 4LC6A 3QMTA 4K36A 4N6EA 4UCGA 3N14A 3W70A 3N9RA 3PBUA 1IIGA 1H61A 3LI1A 3IEBA 4HN4A 1V7YA 2YFOA 1O5XA 5LZLA 3LERA 5AYYA 3AJXA 2I9EA 4EF8A 1SR9A 1FDJA 1HG3A 4R7JA 4LOCA 2FTPA 1Y0EA 4MIMA 3QRHA 1W5QA 3CWOX 4ZQNA 4DO5A 1OF6A 5K2ZA 1PCWA 3C2EA 3QF0A 1VPXA 1TO3A 3EWYA 3GNNA 3A24A 1QPRA 4FNTA 3LHYA 1KM5A 3LCHA 1KV5A 3TSDA 2FQIA 4O8RA 4NUWA 2NV1A 5D2VA 3ATZA 3DENA 2OX1A 3OEXA 3TW7A 5CGQA 4ADTA 3MMTA 3GZ3A 1G4EA 4PA8A 2B7NA 3O6YX 4ICNA 3T7VA 3NM3A 3R13A 4PL1A 2UV8G 1SFJA 3UQNA 1H7WA 2WO5A 4O0KA 1I2OA 4MFDA 2XN1A 3GXTA 3E9AA 5HR7A 3UZ5A 4B5NA 3HMJG 4N2YA 4IX2A 4UXDA 4JIQA 2Z2UA 4A29A 1OABA 3E49A 3QEZA 4GRSA 1HTIA 3PB2A 2CLFA 1WYIA 2CZEA 1W56A 1YDVA 2FJKA 4H6KA 1H51A 2XN0A 3DH7A 3A21A 4DF2A 4HNTA 5AHMA 2WQPA 4UNKA 1KM1A 1PCKA 4FNQA 4FNSA 2RHGA 3W1PA 5C5YA 5C54A 2LLEA 1K8ZA 1KBIA 1G69A 3PSVA 1BKSA 4KFOA 5FI8A 2C6QA 2QCDB 3T78A 2AAMA 5L9FA 2TMDA 3TE9A 3S42A 1SPQA 4JR5A 1KFKA 1YADA 4N9CA 1WOBA 3NR0A 4XQ6A 4CCCA 1JUKA 4DQWA 1XUUA 3N9SA 5I3HA 4WJEA 2PCQA 1SSDA 4JICA 1A5SA 4GFSA 1ICSA 5G4EA 4O16A 5BW6A 5HR6A 4OT7A 2Y89A 3W71A 5U7SA 2CWNA 2V5LA 5AOUA 3TNOA 2NX9A 1TPB1 2P0OA 1YXDA 4NX5A 3GKFA 1VYSX 3CM4A 4TX9A 3WJXA 4YCOA 5TBOA 1TTIA 3W7DA 2ISVA 3VCRA 3RFAA 4LS2A 1HO1A 1M5WA 2CLLA 1TPWA 3MI2A 4IQLA 3EKLA 1SO4A 3PBWA 2BX7A 2JKEA 3M41A 1UCWA 3M7WA 4O28A 4DO6A 4JTTA 3LHZA 4UTIA 1TMHA 3WJSA 2EKCA 3USBA 4IOTA 1SW7A 3M5YA 5CPLA 3I7QA 1FCVA 3HOJA 2TSYA 3W1MA 3O06A 3SR7A 4EWND 4EVZA 2VEPA 3B8DA 3I7RA 2HS8A 2HS6A 3NPUA 1ZY9A 4P61A 3P62A 2E6AA 2KZHA 2Y70A 5EBUA 1VQTA 1OFAA 2PC4A 4AWSA 1P5BA 3EX3A 4IX0A 3CIXA 4LC8A 2ABAA 1L6YA 2DU2A 4A2RA 4XUGA 4S2BA 2FFCA 1GVQA 1PIIA 4Z08A 3IVTA 1F05A 4L4LA 4E0CA 1EA0A 4QAIA 2PRMA 2WPBA 3QW3A 1EX5A 1WBJA 1DQXA 4M6VA 3TKFA 3NOEA 3W2MA 2Q8ZA 1YPFA 3Q2DA 3WJYA 1MZHA 3GR7A 4ALDA 3E12A 1LM1A 1GWJA 1R2SA 2TPSA 5D02A 1JUBA 1YXCA 5IM51 3R5EA 4IJBA 3O15A 3MYOA 3E02A 4PH6A 1CI1A 1L6WA 3LCFA 3W7KA 4O17A 2QDHA 3P82A 2QCFA 1VCFA 1VYPX 4MLRA 3L65A 4UNLA 4OGZA 4OU1A 2W79A 1TV8A 4Z0JA 3OIXA 3FLUA 2ZFAA 3STEA 3R8RA 1JJKA 3W83A 4RZ4A 4JTHA 3G3DA 3SFKA 4UUIA 4PL2A 3TU9A 5MHBA 3CU2A 4MJMA 4QQ3A 1OFOA 1LOQA 3HGRA 3GDRA 3Q58A 3S0CA 2R8WA 4MFEA 1SO5A 5EPDA 1W3TA 4HSNA 3S5YA 3DBPA 3KVJA 3GK0A 1EIXA 1KLZA 5CZ0A 3IIXA 3W7NA 3PG9A 3TFXA 3TXZA 3UZJA 3GXPA 4OV9A 2NWRA 4MVAA 2A7PA 3W2UA 4RV8A 2A5HA 3GIYA 1L6SA 4WXYA 2V9DA 4O57A 3GDMA 4DBEA 2QCNA 5FF4A 3DFQA 4NNBA 3TA6A 5F4WA 4I7VA 1VC4A 3ANYA 4ZVJA 2X1UA 1W5MA 4JTEA 1R47A 1YDNA 1TJRA 4PC8A 3NQ8A 5AYXA 2PE4A 1SU5A 3P8JA 4AHPA 4I7WA 3C52A 4IMGA 1GZGA 4HNVA 2BSLA 5FESA 2CZ5A 2GQ9A 3BG9A 2E1DA 2V2DA 2YFNA 2G97A 4NT0A 4NXSA 1SZEA 2QCGA 4O50A 5AYZA 2R14A 4LVDA 3NZ1A 3W7MA 3NQVA 4DEFA 1FWSA 1VZWA 1Z44A 3M47A 3JRKA 2NXIA 3BW3A 4YXGA 3VE9A 3B03A 5GVJA 2ZA2A 3M5XA 3LTSA 1AMKA 4P2VA 3NL6A 5FEXA 3S9YA 2Q3RA 4S2CA 4JTGA 2H3DA 4UTLA 4RXFA 1EEPA 2Y63A 4AHOA 3W74A 3L67A 1F6KA 1X8FA 3BGJA 3N2XA 4RJEA 1W1ZA 3IRDA 3UPBA 2F7FA 1OFRA 1FWNA 1W37A 3SSJA 3WK3A 3M44A 5DY3A 2EPHA 4U28A 1FY6A 3M6YA 3VE7A 1FWTA 3HGJA 3DKLA 2XFWA 3CTLA 1Q6RA 4HIBA 3HO8A 1LOLA 2A2IA 2ATSA 3OA3A 2E6YA 1UJPA 5CKSA 4UMBA 5E1QA 4JDBA 4RX0A 2OMAA 2CZFA 3IVSA 3BG5A 1KTCA 2TRSA 3PR2A 3L0GA 4H3DA 3FOKA 4GUGA 4Z1CA 1IGSA 1H50A 1LYXA 1JVNA 4EF9A 4LY8A 1FBAA 1QMLA 1K7FA 3O07A 1QWGA 4MY8A 4OWGA 3QSTA 4BWLC 5LGXA 5KITA 1OHLA 4LRTA 3KRSA 4GUHA 1WV2A 2VOMA 1I2NA 3G1VA 3S1WA 4W9TA 4MJZA 5HMSA 4LWWA 2J27A 1G67A 1GVOA 1NF0A 2GJNA 3BLIA 5HWNA 3IGSA 2E77A 2DZXA 2ZZ7A 1OK6A 1OYAA 1SQ7A 2J9ZA 3W3OA 4UFMA 1XBVA 1TTQA 1R2TA 1YTKA 5D2YA 4GUFA 5LHEA 5EA9A 1H1ZA 5DXYA 1BTMA 4ZQRA 3JR2A 1TJPA 3IGXA 3KX6A 1O60A 4O52A 3F03K 3STCA 3DU0A 4PEKA 3G1XA 4LUIA 2NUYA 3S5NA 2ZZ3A 3I65A 1ONRA 2EF9A 2H8ZA 1Q6QA 4M7SA 1GTHA 4MLJA 3NPVA 2CFFA 1THFD 1WXJA 4NXKA 5FF0A 4HSOA 4O14A 2B0MA 2ZZ2A 4S1FA 3E96A 5HJLA 2A4AA 4BFAA 2VFEA 3KAOA 4FB7A 4KFPA 2VXNA 5CPNA 3F4NA 1UUOA 3H55A 3QQ1A 5D33A 3PWAA 1H7XA 1Z41A 3CWNA 4CNOA 1PL9A 4UTKA 3NA8A 2E6FA 3QJAA 1DL3A 2Y6ZA 1W8SA 5AC8A 2FB3A 2VC6A 4NJKA 5C2XA 2AQWA 4AVFA 1O5KA 5G1YA 1XKYA 1TPDA 5H2ZA 5KTLA 2Z1BA 4RK8A 5HUOA 1OX4B 1IXOA 1JQXA 2ZRWA 1TRIA 1I8JA 3O63A 1JCJA 4J9JA 3R2GA 3NQ6A 5K9CA 3GKAA 4TMBA 4NU7A 3NQFA 2YW4A 2AGKA 4NJJA 3BARA 2QUVA 3GDKA 3W1AA 4AB4A 2O7QA 5I3IA 4PODA 4AMAA 1DKWA 1TPFA 2X30A 4JTSA 4JXCA 2P1FA 4PCFA 1YTDA 2RH9A 4WXZA 1LLWA 4A3UA 3TROA 4ADSA 3LXBA 1MXSA 3TUUA 4GJ1A 3HPZA 2ZTKA 3FKKA 3FS2A 3BW4A 1PHWA 1ZJIA 1I45A 1IF2A 3DHFA 3O6DA 2YW3A 3W76A 3LHWA 3UWUA 3FKRA 1F7BA 3NQ7A 4POCA 4AEOA 4BR1A 2EHHA 1ME7A 2ATMA 1X1OA 3NQ2A 1G6CA 4A22A 3O16A 1J2WA 2C16A 3LOTA 3MP3A 5CZTA 1VCGA 4DF0A 1HL2A 4LVAA 4JD4A 3W1NA 1RQHA 2ZRYA 4N9EA 5I3GA 1FXPA 3NQEA 4AF0A 1OG0A 2QCMA 1Q3NA 3MHFA 1B3OA 1YXYA 3BO9A 2PRLA 2V0TA 3A5VA 1J4EA 5DCDA 1TSIA 1T96A 4ZQOA 4KFNA 2V2HA 1UBSA 2D73A 3W72A 3S8HA 3CIWA 1G7VA 3PS7A 4I7UA 1IXNA 4O54A 4R34A 3EWBX 3EX6A 1RR2A 4QISA 3G8RA 3NXFA 3TSBA 2C0AA 5KZEA 3KVMA 2HTMA 2X2GA 4JTFA 4OV4A 4UTJA 3BLFA 3ZFHA 1JCYA 2YZRA 1A53A 2GVLA 4WY0A 3W2NA 2BXVA 2Y61A 3G0SA 1EP1A 5HULA 1FCUA 1RQEA 2Y7FA 3NQDA 5AC7A 1M6JA 3R12A 3WJZA 3IV3A 1KFEA 4XWUA 3SI9A 1JUEA 3G8EA 2GUUA 5K4ZA 3IIOA 5FF2A 4H4IA 4N9DA 3V1PA 3T4CA 3SGUA 1DV7A 3CC1A 5D38A 1TYGA 5E0KA 4X3ZA 2OT0A 3LBMA 3MBFA 3DZ1A 3B05A 1TB3A 1ICQA 3QH2A 3O1NA 3G1FA 4ZL1A 3BK0A 2QCCA 5D37A 5D2XA 1RPXA 1VHCA 8TIMA 3O05A 1K8XA 4K8EA 1N7KA 2NV2A 4LU0A 3GVGA 4O1AA 3LRKA 1YYAA 3L0NA 3UY7A 4AAJA 1KFBA 5KZDA 4Q4KA 4UTHA 3MBDA 2H3BA 2CW6A 2E09A 2J24A 5LKYA 4O19A 3TQKA 4A21A 2DORA 4JX4A 5CZJA 2YSWA 1O94A 4G1KA 5KZMA 1TV5A 4O4VA 4OHQA 3W84A 2V81A 4GBUA 5G4WA 5EYWA 1SSGA 2QF7A 2NLIA 1TPUA 3GX9A 1TPC1 5LSMA 4Z0SA 2Y85A 1QCWA 3MUXA 2OT1A 1G7UA 3KHJA 4YWIA 2V2CA 4RLIA 4WQ6A 3OHIA 3TXVA 3BV4A 4MY1A 3W85A 2BTMA 3QW4B 3LDVA 3C2RA 1OVDA 3LCGA 4TU1A 5G2HA 3TDFA 1S5TA 3P84A 4FXRA 4XKYA 4QSHA 2ZA3A 3UWQA 3IVUA 5CPOA 1PVNA 3W1RA 4KKXA 1FDZA 4N02A 4NX0A 2VFGA 2BWGA 4NJGA 1XFBA 1EUNA 1WAUA 3INPA 1ZAJA 3MP4A 1VJIA 3ELFA 3SECA 1QO5A 3PM6A 3C8FA 4UTUA 1GG0A 5IBXC 1GYLA 2ZZ1A 3R89A 5FF7A 4O18A 2ZZ6A 3DKJA 4DELA 1QNVA 1ME9A 3MP5A 3LCIA 1HO4A 2A85A 1DBTA 5BMXA 3G18A 1W3IA 2H90A 1SFLA 1K3UA 1HFBA 4JTKA 3U6WA 3G1DA 3S6DA 1JRBA 4WOZA 5I3JA 5I3KA 4HNNA 4JYFA 3P5YA 3A22A 3N3MA 4UFJA 2BZNA 2VEIA 5AHFA 2GQ8A 2X1SA 1VR6A 3DGRA 1RV8A 3EWXA 3FEMA 4MYAA 1LRTA 1ME8A 3FFSA 4N6FA 2ALDA 4ADUA 1FUYA 4JYEA 3H54A 2YR1A 4JX6A 3CEPA 2JGQA 1BWLA 3UYCA 1L9WA 3VNDA 1C8VA 5T26A 2CLKA 3C4UA 5U4NA 2NUXA 2C19A 1TTJA 3C2VA 4IGHA 2C1HA 3L2IA 3W73A 3GXNA 4DF1A 1GVSA 4LW7A 5BRBA 4K7YA 3HJZA 1GVFA 2J88A 1DQWA 2NXHA 4Z1AA 1VLIA 4QNWA 4CNPA 1TQXA 1PE1A 4HPXA 2RFGA 4IXXA 3ZWTA 2WNQA 2A0NA 5DELA 1W5PA 1M7PA 4IUOA 3TCEA 2WOQA 4QNEA 1TCDA 1MEIA 1RQBA 2V8ZA 4ZQPA 3S5OA 1RVGA 4LVBA 1LTDA 3O6CA 5DBUA 5D09A 2NZLA 3QC3A 4CCDA 3QQ0A 4ML9A 3GLCA 1X6UA 3I68A 3FIGA 4Z1BA 5DXXA 4DBDA 3FA5A 4R33A 1OJXA 1F76A 2VEMA 1B9BA 3ABSA 2X1TA 4NNAA 1LDCA 4O1BA 4UTWA 5EY5A 3W87A 1VH7A 3ZS4A 3HB9A 4RKAA 3UWWA 3I7SA 3W1LA 4IMFA 5CSRA 3LCXA 4Y8FA 3GR8A 4Q33A 4I9AA 2BLEA 1AK5A 1QOQA 4O15A 2C14A 1SW3A 5DY2A 1VYRA 2QJGA 2V30A 3U2OA 1H62A 3PBVA 4O10A 1FCQA 1SZNA 4K8HA 1RZMA 2X1RA 2ZBTA 1VRDA 2C18A 4JIPA 1TV7A 3Q37A 4Y96A 2WSRA 4X22A 3ZR4A 2QKFA 1K03A 1BEUA 2B4GA 2ZYFA 2ABBA 3OBKA 1YPIA 1D3GA 2YGYA 4FXSA 4HPJA 1I2PA 3GDTA 2PRHA 3B06A 3FJ6A 1H5YA 2Z6IA 1LZOA 4HHPA 4LVFA 3UXDA 3P80A 3VFLA 3G1HA 5LNWA 2QDGA 4O0ZA 5K9XA 1KM2A 2WJZA 3S1UA 3MJYA 1GG1A 1FQ0A 1IXPA 3D0CA 2ZZ5A 5TQLA 5AHIA 3KOFA 3QMRA 1FCBA 4UR8A 1F6PA 4LVGA 3NL3A 1Q6OA 3W7PA 5DCEA 3TMQA 1L2UA 5D04C 1KBJA 3LM7A 4Z1DA 1W0MA 1ADOA 3FYPA 3GAYA 4LV9A 3TQVA 3W7OA 1WOAA 3SIZA 3W7RA 4LS1A 1XUZA 4UMCA 5K4XA 3G0XA 4MKNA 1TIMA 1XI3A 1KFLA 1OFBA 2C15A 3WJWA 1OK4A 3E0IA 3L9CA 5EKYA 1DOSA 4GWEA 4GNJA 4LS0A 3WK1A 1B57A 3ATYA 4JTIA 3RK8A 4EOUA 2RKXA 3W23A 3MHUA 4YL2A 3A9IA 5D30A 5D2WA 3LRLA 3CT7A 4KWVA 2DJLA 3W22A 1Z48A 3DI1A 2GJLA 1SUXA 3QZEA 1XDMA 2ZRUA 1QPNA 3NQCA 1V5XA 1LORA 2FPYA 4UR7A 3C6CA 3MWAA 1WBHA 4D2JA 2NWSA 4OBTA 4UFKA 1NFBA 5DN1A 4FIRA 3U8GA 3EXSA 4LV4A 3CLMA 3C2OA 3NYZA 4M19A 1LP6A 1O4UA 2OZ0A 3CHVA 1KM3A 2A21A 1GPWA 4FX8A 3CPRA 4O1CA 5F2GA 4IMCA 4XBKA 3G24A 1JCMP 3L5AA 1G4SA 1X1ZA 5AHNA 2Z0IA 1JCLA 3ABOA 1OX6A 3NL2A 2QUTA 1NEYA 2ZTJA 1SO3A 1EWEA 1H7NA 4K39A 1KFCA 3ABQA 4M5PA 5K7JA 1G4TA 1IIHA 2ZA1A 4R53A 1KA9F 4ZQMA 2ZRVA 4ZMGA 1R46A 1DORA 3BW2A 4UTTC 1O95A 2QUUA 3KRUA 4JYDA 1A5BA 3LV5A 1W5OA 3NGJA 2A7RA 4ZQCA 3UPWA 4FNUA 3LHVA 4JNMA 4DXVA 4M6QA 3HGSA 2V82A 3HQ1A 1LBMA 5AC6A 4IWWA 2VFHA 5F1VA 4C1LA 5AFDA 3DFNA 3L5LA 2R94A 5D05A 3NO5A 1Z42A 3VKJA 3S5ZA 2DZTA 1GT8A 4JTUA 1YLVA 3PUEA 1H1YA 4JY9A 5AN7A 2JKPA 1AW1A 3TSMA 1KLYA 4ORMA 4RR4A 3WK0A 3P7YA 5KINA 3DAQA 3JS3A 2WV8A 1OX5A 3SW6A 3KRZA 3CB8A 4K6AA 3STFA 1K7XA 4L4MA 3BGGA 3FJLA 4XZ9A 2YDAA 5L6UA 3M0ZA 4WOQA 3BLEA 5DLCA 1KV8A 2ISSA 2QCEA 4X2RA 4UMAA 2VFFA 3HG5A 5H91A 3RU6A 2GPTA 3PULA 2J9XA 1RD5A 4XTIA 3EEGA 5HINA 3Q94A 4N4PA 1DHPA 1UUMA 1Q45A 4WUIA 1R30A 2TYSA 3RMJA 5F2IA 2FB2A 3L68A 5HWMA 4NVTA 4C1KA 3TQ0A 1LCOA 1ML1A 2Y7GA 1TTPA 2Y7EA 1YDOA 2Q3OA 3GAKA 4GXMA 1JULA 4DPPA 3L66A 1T99A 4ONVA 1BWKA 5F1UA 1W3NA 5BOOA 1EPXA 3BPWA 2JGYA 3PBYA 2ZQ0A 3IIZA 3F1QA 2QR6A 3B04A 4LNYA 2GQAA 5HUPA 2A6NA 3HG2A 1PS9A 1H60A 5EMUA 3PUDA 3W2LA 1QDSA 2A7NA 2NX1A 2NUWA 1U5JA 1XDLA 4FO4A 3L21A 1MEHA 5E93A 4UFHA 2WSYA 1R2RA 1JR1A 4RZ5A 4JGDA 3W07A 2DZUA 3P81A 1WDWA 3BG3A 4FIQA 3GB6A 1GJPA 4NNCA 1TPVA 3W2JA 1GVRA 3G1AA 4IPIA 2GVJA 2W6RA 4TMCA 2FPVA 3MO7A 1WA3A 3QYQA 4XKYB 1XXXA 1E51A 3NAVA 4NZFA 2CLEA 1VHNA 1C9DA 3M43A 1QR7A 4AXKA 2EAWA 4MZYA 5G5IA 1WX0A 3MHGA 4WX2A 5G1TA 3W1QA 2DZPA 3TR2A 1H7PA 4FEZA 4QITA 1M7OA 2B7PA 1UASA 1JCXA 4IMEA 1S5WA 3B0VC 3QFEA 3L5MA 1YTEA 4UFIA 3G3MA 2J9YA 4AH7A 4AF0B 1GYNA 3M5VA 4RCXA 5BMWA 2VENA 5FEPA 1DJNA 3THAA 4JTLA 5EL1A 3SJ3A 1SZFA 4JN6A 1TRDA 3PY2A 3NPWA 3PC0A 5FEZA 3C0JA 1U83A 2DJXA 3KVLA 1AW5A 3T40A 1LRNA 3W6YA 5SWUA 3UXAA 3LTPA 4CLMA 1SZGA 2Z6JA 3W86A 1QAPA 2JKAA 4Q32A 4HKPA 1OYCA 1VCVA 3NZRA 3PUOA 4BI5A 3NNTA 3UD6A 1LBFA 2FDSA 5LNSA 3LHUA 1N55A 1A50A 4A2SA 5A5WA 1KTNA 3G0UA 2J6XA 1OFDA 3HGOA 4LUJA 2RDWA 4WD0A 4CQ9A 4HT3A 4NZJA 1D9EA 4LRSA 3RLUA 1GQNA 1QOPA 3HG3A 3W7EA 5DBTA 7TIMA 3TK7A 1ZAHA 1T0OA 1OYBA 1W54A 2ZZ4A 2RDUA 2B7OA 3W1XA 3BVJA 2YPIA 2WNNA 3UNDA 4MYXA 3LRMA 4IPJA 2G96A 1H63A 2Y62A 2I14A 3I6RA 2NXGA 3N73A 1A5CA 2DZVA 1K7EA 1P4CA 1JRCA 2WNZA 3C56A 4XTDA 3LXCA 3NM1A 4JDYA 1LLZA 4NJIA 4ZZ9A 3G22A 3OVPA 4MOZA 2X16A 1NSJA 3P60A 3THQA 3DHDA 4K7VA 4K37A 3TC7A 4JEQA 1WQ5A 4UC5A 4X9SA 3DXIA 3EX2A 3HPSA 1JCNA 4UTMA 2YXGA 1XL9A 3TH6A 2ZRXA 3P61A 4WY0B 4YCPA 2ZCGA 3EX4A 5IBXA 4MUZA 2CLMA 1QFEA 3QPZA 1XBYA 3UWYA 4CNNA 3GDLA 1ICPA 2CLHA 3NDOA 6TIMA 2CLIA 3LTYA 2C13A 1ZALA 2E5CA 3LCWA 3N19B 3T44A 5J5RA 3SZ8A 5AB3A 4FNPA 3UWZA 3GYEA 4N9BA 4UIOA 3WFAA 5FF3A 2JBMA 3W75A 1Q6LA 3PF3A 2QCHA 2E5BA 4JTJA 1KTBA 3RLVA 5AHLA 3LXAA 1CW2A 2FIQA 4MPQA 4O13A 3A23A 4Y90A 5CG7A 3OVRA 2QEZA 2QAFA 3G1SA 3PG8A 3TAKA 1XBXA 2W0UA 2DZSA 2H6RA 4JS3A 4NJHA 3W7LA 3W7CA 3QMSA 3LLDA 4K38A 4YMZA 5I3FA 5LNRA 3EWZA 1P0KA 2ZRZA 1B4KA 2HSAA 2QAPA 3EXTA 3QPYA 1JQVA 3A5FA 2EGZA 3V75A 4NQ1A 1XM3A 1KW1A 2O7SA 4UFLA 5KMYA 5AHEA 4GUIA 3LGEA 3M16A 2Q8LA 2HMCA 3W9ZA 5F2MA 3HF3A 3PVFA 5F4XA 3M9YA 1N8FA 2E5DA 3EXRA 3S1XA 2WKJA 3PAJA 2YYUA 2QCLA 3LLFA 3KVKA 4FHAA 4IXHA 2QJHA 3TMLA 3B0UX 1OFQA 2PURA 3TV8A 4QM1A 3N34A 4Y6GA 3DFPA 1LBLA 2ISWA 1T8XA 5FEWA 1GTEA 1TREA 3EKZA 1NF7A 1HUVA 2B7QA 3CQ0A 1QO2A 4E2BA 1NVMA 4HNUA 1EP3A 1ZFJA 1PHQA 1OFPA 3EX1A 3MW7A 5C6MA 3LI0A 4OE7A 3F4WA 4PTNA 2H8XA 1EP2A 3AO0A 4N4QA 4EIVA 1SO6A 3NPXA 3DFTA 4BI7A 1W5NA 1LRQA 4XBSA 3TIMA 3W7HA 2ZDRA 6ALDA 3NQMA 2G5WA 1LOSA 5C55A 2VFDA 2P10A 2CLOA 1AL8A 3HIJA 2Y7DA 4O12A 4QIUA 1SW0A 1PV8A 2E68A 2FPTA 3MI6A 1LROA 1KM0A 1K8YA 3LHTA 3TFCA 1I4NA 3W2KA 2VELA 3LBCA 4AWUA 5D03A 2GVGA 1XC4A 4KWWA 3ZWSA 1MSSA 1QPQA 3EB2A 4O1DA 4FX7A 1ZAIA 3EWUA 4RZ6A 5ABTA 3LCLA 1EUAA 3YPIA 1J5TA 1KM4A 5HQEA 1K02A 3RNDA 1IXQA 1FWWA 4M6PA 2DZWA 3P5ZA 1ZHAA 1S3HA 1F74A 2IQTA 3M5ZA 4WY0F 1VGAA 5TIMA 4CQ8A 2YCEA 1X7FA 5F2LA 1FXQA 3DFSA 3LX9A 1OFEA 3W1TA 5BNKA 3DFOA 3STGA 4O4WA 5D2TA 2DP3A 3W7GA 3FYOA 2CZDA 3C2FA 1XCFA 2A1YA 4RXGA 5F4SA 3KFTA 1ALDA 5A8GA 2NX3A 1OF8A 1ZCOA 2GOUA 4MY9A 2RDTA 4OQVA 4BWLA 1H7RA 4LT9A 5KSWA 4E38A 5K9DA 2WSQA 3LV6A 3H53A 4U4MA 5J5DA 3L0KA 3RF9A 3NQAA 4GC4A 3TC6A 5K3VA 1MEWA 3ABRA 2I1OA 1DJQA 5G2WA 5LGZA 2QCDA 3SGZA 1FX6A 2YYTA 4UTWC 3TW6A 3LB0A 5CSSA 5CZSA 3HPXA 3C61A 1TPH1 2OCZA 1D3HA 4ORIA 1B4EA 1W31A 4Y9AA 3W1UA 3N2MA 1P1XA 1FDYA 4MZ1A 4TR9A 1S5VA 2A6LA 2F84A 4BI6A 3TX9A 4IMDA 3P74A 3NL5A 4UTTA 1UB3A 5DCBA 3W88A 1MO0A 4QJ1A 3HBLA 1GEQA 1XBZA 2E6DA 3VI2A 1KFJA 2YX0A 4FNRA 3W7IA 3W7JA 3KXQA 3IIVA 1G4PA 5D32A 3S1VA 2QJIA 1I2QA 3CEUA 1ZNNA 3DI0A 3UWVA 3NVTA 4TIMA 5HNRA 4GUJA 3GNDA 3IGUA 1A5AA 3OG3A 4PFMA 4O53A 1P0NA 4TO8A 3QM3A 1AL7A 2XN2A 1F2JA 1EWDA 3O8AA 3IIPA 1GOXA 3B4UA 2FLIA 3OVQA 4CQAA 5LNVA 2G95A 1H7OA 3NQGA 3M1ZA 1AG1O 1VS1A 5HWJA 1I2RA 3TAOA 4JY8A 2R91A 3WK2A 2VKZG 3PSWA 2OJPA 3G1YA 1VLWA 1OX4A 4BK9A 4JX5A 1AW2A 4AWTA 3P8IA 4M7TA 3K30A 1F73A 1F5ZA 3HG4A 3PB0A 1DVJA 1NAL1 3TJXA 4BF9A 1ZENA 3MI3A 3B0PA 3MYPA 3W7QA 5LNUA 3UY8A 1KM6A 3P67A 1CX9A 2Y88A 3NG3A 4LTSA 3NEVA 1FWRA 4FX6M 5G2IA 1QPOA 5CPMA 2C3ZA 4MZ8A 3TJLA 2VEKA 3QSRA
chains in the Genus database with same CATH superfamily
4YTSA 2V5BA 3SRHA 2YBUA 4REQB 1ZJAA 4F0RA 1RJQA 3BAKA 2HEJA 1TPEA 4CQBA 2VR4A 3VPLA 3EOOA 2PDJA 3U5YA 1Q6DA 5LHFA 4W8AA 3ES8A 3JVAA 3TLQA 3EMZA 3O7UA 1MDLA 2PTXA 2BOFX 3N14A 4W7WA 3PBUA 1QK2A 2V69A 2OEJA 3LI1A 4HN4A 1V7YA 2NSOA 1O5XA 4RE2A 5LZLA 1JFHA 1Q6GA 4JCMA 4R7JA 1JNEA 4MNLA 4E4PA 2ZUNA 4LOCA 1DJYA 1DWHM 4DO5A 3MO4A 1B0IA 1PSCA 3UFYA 5IDZA 3N17A 4ZXOA 2OSXA 4GVIA 1GHRA 3A24A 1QPRA 1KV5A 3BGAA 3FYYA 4O8RA 5IDIA 3WNKA 2PDHA 3Q45A 4X60A 3ATZA 4KEZA 5E5CA 3OEXA 1DTNA 4IP5A 4JIRA 4RNHA 1E70M 4B5SA 3QVQA 1E73M 4FA3A 3NM3A 5A3HA 3AALA 1S3TC 4JNYA 1A3WA 5C7HA 3UQNA 4O0KA 1TVLA 3FVDA 4MFDA 2H9AB 3GXTA 3B4YA 4HPNA 1UMLA 4JIQA 1UUQA 1V8EA 4MAVA 3IAQA 1OABA 4CN6A 1PXGA 2VTFA 1L8NA 5T91A 1YDVA 2BGSA 3TW9A 3R0KA 4BCEA 1JCTA 1W32A 4DYEA 5FAJA 1KBIA 4ERGA 1A0CA 1TMLA 1TWIA 3U3HA 1VJZA 4JTQA 3GG0A 3ME3A 2AAMA 5M1TA 1OCNA 2VQTA 5GNYA 1SPQA 4J27A 1YADA 4E2VA 3NR0A 3VOHA 4XQ6A 3W6MA 3LUTA 2OPJA 5I3HA 2QJJA 1R3VA 2PDYA 4JICA 1HL9A 1YNQA 1A49A 5BW6A 5FA5A 1W1A1 4R5EA 4OT7A 4YU1A 4GI9A 3MMWA 3ITVA 1Z9AA 3VK5A 5CGTA 2Y89A 1M7JA 3W02A 4Q8TA 5HPOA 3HV8A 1O6IA 2BB0A 2P0OA 4UQCA 2EG7A 4DUXA 3CM4A 4JOMA 4V15A 2GSHA 2FGZA 4QGCA 2F8QA 1ITUA 4F66A 4O28A 5IRPA 4JTTA 1AD1A 4UTIA 1TE6A 4PTXA 3DYMA 3WJSA 3RN6A 5JVLA 3M5YA 5CPLA 2PWDA 1FCVA 2ZUUA 1HN1A 1XLDA 3W1MA 3O06A 4AD5A 2O9TA 2VEPA 1Q4NX 3B8DA 3T4WA 3P62A 5A6TC 4Q4QA 2Y70A 5EBUA 1XV8A 3THUA 3RM9A 3CIXA 4XUGA 3WLKX 2WKGA 4Z08A 3IVTA 1F05A 4L4LA 1CBGA 1CGWA 4PMVA 3QW3A 1CECA 2PTDA 1WBJA 1DQXA 4M6VA 4AVNA 3VIMA 1ODZA 2CZVA 3W2MA 3Q2DA 3BLOA 3WJYA 4G7FA 1MZHA 2R9RA 4HQVA 2VDGA 1ISVA 4Q8WA 1LM1A 3OA5A 1GWJA 1R2SA 2TPSA 2UY3A 1Q4WA 4LYQA 5ABEA 3O15A 3MYOA 4PH6A 1L6WA 2TAAA 4WDTA 3UPMA 2D3LA 3WDJA 4O17A 3P82A 1A5MC 1K9DA 1TJ1A 3IWPA 2YL5A 5CG0A 4H1ZA 4OU1A 1FFQA 3MZNA 4N42A 1TV8A 4Z0JA 5CQ1A 3FSTA 3W83A 4RZ4A 4JTHA 4PL2A 3CU2A 1VIWA 4Q8PA 1OFOA 1P7TB 3NZQA 3S0CA 4MFEA 1SO5A 1VEOA 3S5YA 4GIRA 1CXFA 2PDLA 1KLZA 5CZ0A 3GU2A 3IIXA 3MANA 2Z1XA 3T0BA 1V02E 4IQEA 3EBVA 2AKMA 1XYCA 2ACSA 4RV8A 4YTUA 1MRQA 1KR1A 3QBUA 2VR5A 2QCNA 1LT7A 3OG2A 5FF4A 4NNBA 2ZX8A 4I7VA 2QIWA 4ZVJA 2V3EA 1XINA 1OB0A 1TJRA 3VDHA 5AYXA 1GNXA 3ZVIA 5B80A 5AECA 2O9PA 2PGFA 2BSLA 2CZ5A 3BG9A 1FWJC 2F38A 4L61A 1QOXA 4IPPA 2WC7A 5AYZA 4LVDA 4AZIA 3S3GA 1REQA 1Z44A 2NXIA 5T8GA 3VE9A 2QJMA 3LTSA 4P2VA 4HNOA 2W63A 3NL6A 2FHBA 3LK6A 5FEXA 4FOUA 2Q3RA 4Y2WA 2PLCA 4RXFA 1U1HA 4B5WA 1JI1A 1E43A 4PB5A 3W74A 3L67A 3SCRA 1FP8A 2QHAA 3VD5A 3FAXA 4RJEA 4H8UA 3KOZA 3PN8A 3UPBA 1UA7A 1OFRA 4GQGA 1W37A 4AW7A 3SSZA 3O0FA 1EDTA 1FWTA 2XFWA 1AQ0A 3N1AA 1Z7AA 4AY8A 1Q6RA 3B9EA 3BCJA 3DC0A 2C71A 3MVIA 3MV01 2OMAA 4D6CA 4K1WA 1Q66A 1XHGA 4E3VA 4AZ6A 4HPGA 2TRSA 3M07A 5H1WA 4IICA 2DSUA 4H3DA 3FOKA 4ZTYA 1IGSA 1LYXA 5A6JA 4LY8A 1K7FA 4AZCA 4QE4A 2VT0A 4LRTA 2FMOA 3ZO9A 5JQ9A 1I2NA 3S1WA 4W9TA 4GBDA 2TODA 1KO0A 3N3TA 1JZ3A 5HMSA 3ARTA 2P5NA 2GJNA 2DZXA 4B5UA 1EJRC 3V35A 4LSBA 3ENLA 4DWSA 2Z1WA 4AC1X 1YTKA 1JD9A 3AYSA 4F4RA 1H1ZA 2QW5A 5DXYA 1C91A 2Z24A 4GISA 3WY1A 4DJFA 3JR2A 3IGXA 1RLCL 1O60A 2PTWA 3W53A 2YJQA 4PEKA 3L4ZA 2INFA 4C6EA 1QNOA 4F3HA 4MB5A 5HBFA 1ONRA 5A1AA 2G3JA 1FH9A 1Q6QA 4MLJA 3NPVA 3TVAA 2CFFA 1HGYA 3VOFA 3WF0A 1E6XM 2PUZA 4RPPA 4NXKA 5FF0A 4HSOA 4O14A 3BAYA 2B0MA 3PJXA 2XHYA 4GQBA 3VKCA 2VI0A 1MW0A 3K13A 3S83A 3F5JA 4H7ZA 4QE1A 3IAPA 4F9DA 2VXNA 5CPNA 5D33A 4A3YA 4GFIA 3NA8A 5CPQA 1ONXA 2E6FA 1ITXA 1DJHA 5BXRA 4EXAA 1U1UA 1DXIA 2Z1KA 1NTHA 1LUCB 2FB3A 3MCOA 3ES7A 3UJEA 1E40A 2OSWA 3W82A 4KWOA 5G1YA 2OQHA 3CAKA 5KTLA 4JZ5A 1EO7A 4RK8A 1OT1A 1TRIA 1JCJA 1XYMA 3E2QA 3NQ6A 4Z2JA 3GC2A 1GJWA 3IK2A 5AVHA 1IV8A 4NU7A 3NQFA 4PMXA 4GYKA 1OADA 4H9MA 3GDKA 2QUVA 3POHA 4P7LA 5I3IA 3EPNA 4PODA 1DKWA 1TPFA 3I6EA 1ZL1A 3OJGA 5BYWA 2E7FA 4JXCA 2P1FA 1ITQA 4IFRA 2RH9A 4WXZA 3SCUA 4NL1A 3TC3A 1VFMA 3FKKA 3FS2A 3EYPA 3M0KA 1IF2A 3DHFA 4HJWA 2YW3A 1PX3A 1QNRA 3FKRA 1CENA 5KZ6A 4BR1A 4KF1A 2CC0A 2ATMA 5HMDA 1IGWA 1X1OA 3T08A 3WLOA 3CASA 4A22A 4GQRA 1TUFA 3LOTA 4DUVA 3KWSA 3N4AA 2BODX 3LNPA 1X1NA 4WDWA 1XYBA 2VHLA 2DIKA 3MHFA 1YXYA 1UPPA 2V0TA 4GZEA 1J4EA 1C90A 4ZQOA 3LENA 3P3BA 3WUGA 4QQUA 2D73A 1H09A 4IP4A 4EPDC 3VGHA 2AQVA 3QQWA 3NXFA 2X2GA 4KPLA 2ACRA 2A3HA 2X41A 1FKWA 3ZFHA 5EU9A 3CAQA 2GVLA 4QE5A 1B3ZA 1TZZA 2BXVA 3TTEA 3VNKA 1FCUA 1RQEA 1RCXB 2Y7FA 3NCOA 4UWMA 2PC8A 3EOUA 4XWUA 2GUUA 1XIBA 1ZB5A 4N9DA 3T4CA 4IZGA 1E15A 2PWFA 4DWDA 1TYGA 2IS7A 3A3HA 3LBMA 1TB3A 1ICQA 3QH2A 4F79A 4DBSA 3O1NA 1JYWA 1RPXA 1TWWA 4IL0A 4JQ3A 3W37A 3GVGA 5MF5A 3UR5A 1YYAA 1GCYA 2GDQA 4AAJA 1KFBA 3VKDA 1W1YA 5LKYA 1YBQB 3VGFA 3UEQA 5CZJA 2YSWA 4WEVX 4G1KA 4GBUA 1R3RA 4PMUA 2QF7A 4UQEA 1SFTA 3ZM8A 5LSMA 5FJUA 1QCWA 2OT1A 4JL2A 3EAUA 2NQ9A 4NRRA 3M0MA 1B30A 3TR9A 1XGDA 5M03A 1S2UA 1R9YA 3BV4A 4MY1A 1OVDA 5G2HA 3NYDA 2XWEA 2D69A 1Q7MA 4FXRA 2RGMA 1V08A 5CBIA 2ZA3A 1RK6A 4LXFA 1KXHA 3W1RA 1KB3A 4HN8A 2NT0A 4WCJA 1A3XA 2E67A 1XSKA 4NJGA 1A5KC 4C65A 3INPA 4J7RA 3ELFA 2WWDA 3GSMA 2XU2A 1GUVA 3IS4A 3JZEA 3PM6A 1X8CA 2DVUA 5A8NA 2XGIA 4BQ4A 4O18A 3T2QA 3AIQA 2ZZ6A 4LX4A 1DP0A 5REQA 2I57A 4NI3A 3TN6A 2X8RA 4CD7A 1ME9A 2WVTA 1EBGA 5BMXA 1EPVA 5ABFA 3U6WA 3G1DA 2J7GA 3S6DA 1FWEC 1JXJA 4GK8A 4WOZA 3D3AA 5I3KA 4JYFA 3A22A 3N3MA 3PZUA 3GE7A 4AZGA 1JG9A 1VR6A 3REQB 4MB3A 3LPPA 3ONBA 3SFWA 3FEMA 3PHAA 1OC7A 4HYVA 1FUYA 1V6YA 4JYEA 3AISA 2YR1A 4DM1A 3GIQA 4JX6A 4XZLX 4DHGA 2JGQA 1BWLA 3UYCA 4AG0A 5JU6A 1L9WA 1C8VA 5T26A 3C4UA 5U4NA 1W9UA 2C19A 3GC4A 3C2VA 2GDVA 4QX4A 1YEYA 1UWAA 2EG6A 3MDUA 1E56A 4DZIA 3OB8A 1W9BM 2J88A 1DQWA 2NXHA 2ONEA 5HK4A 4ZR8A 3RDKA 3LS9A 3H2MA 4AXNA 3HTWA 1M7PA 4TUFA 2HRWA 4ROPA 4UQAA 2V8ZA 3S5OA 3W4RA 1RVGA 3O6CA 3S2NA 1CXIA 2F2KA 4CCDA 1TV2A 3KBMA 3WD4A 1X6UA 1PIGA 1OJXA 3ABSA 2X1TA 1EF3A 3TYBA 4G2DA 3HB9A 4RKAA 4HPHA 1XKJA 2CBUA 3IANA 3T2OA 1TG7A 4MWAC 2ZUTA 1OBAA 2BLEA 1AK5A 5JBFA 4O15A 2C14A 1VYRA 2D0GA 1TR1A 3ITXA 3VOGA 3EOSA 1GYMA 1RZMA 1NH6A 3E3HA 3KL3A 3Q37A 3OGVA 1D7KA 2WSRA 3VDBA 1DE5A 2BVDA 3RUBL 3OBKA 2GDUA 4HOXA 2OYLA 3B06A 4WK9A 5LA2A 4HHPA 1AUSL 4LVFA 5EMKA 3AU2A 4PTWA 3H4GA 1U33A 5LNWA 3PFMA 4IHCA 4GINA 1XQKA 3HU7A 4TV5A 1UR1A 2DT3A 3M7SA 2OGYA 1WP6A 2FZ8A 1F07A 3UA3A 2Z25A 3KOFA 4JQ1A 4BF7A 3AYRA 1L2UA 3AI0A 3LPOA 3DG7A 4Z1DA 1W0MA 4LV9A 3GAYA 3SIZA 3GR4A 5K4XA 3H2NA 5DFAA 4ERIA 4DIAA 2DSWA 3G0XA 4MKNA 1CDGA 2C15A 4D6JA 3IJ7A 5EMYA 4XO6A 1EO5A 3RAOA 5A95A 3U5UA 4LS0A 2CESA 3WK1A 1B57A 3ATYA 3SADA 2DY3A 4M3PA 3OZOA 3MHUA 4YL2A 5D2WA 4ZGYA 5C9ZA 3WMLA 5D9NA 1OEPA 1HZYA 1POJA 4Q8NA 1V5XA 4UR7A 2GZXA 1RBAA 3BAWA 4H41A 2NWSA 4IIDA 4C1NB 4UFKA 3MSRA 3KLLA 4FIRA 4HOZA 2WKLA 3SCTA 4J35A 1FHLA 3H24A 3CH0A 3NYZA 3PTDA 2OO6A 3C0LA 3GDBA 3ABXA 3CHVA 1KM3A 1KRBC 3CPRA 4O1CA 3VNMA 5F2GA 3APTA 1NFGA 4S38A 1QPKA 2C0HA 3MSYA 3ITYA 4Y9MA 3ABOA 3PPFA 1OX6A 1HP4A 3K1DA 3DX5A 5HPCA 2FH6A 1H7NA 1KQZA 1KFCA 3ABQA 3N2CA 1G4TA 1J0ZA 3VGEA 3V0TA 1BAGA 2ZA1A 2OZ3A 4R53A 4PSPA 1QNSA 4Q8QA 3KW3A 3AHXA 3RM8A 1A5BA 3NGJA 2IXUA 4FNUA 1H0GA 1J0JA 3HQ1A 1KXTA 1LBMA 1SJCA 2BY1A 1QASA 5F1VA 4QP0A 1BGGA 2XIBA 2DZTA 3WNPA 1BVNP 3M64A 3PUEA 3CUIA 4JY9A 5AN7A 2Q6ZA 3CJPA 5XINA 4RR4A 4YS1A 3UGVA 2GGJA 3DAQA 2R1MA 3HPAA 1UR8A 4L4MA 3BGGA 4B5TA 3EKGA 5L6UA 3M0ZA 5DLCA 1KV8A 3G5EA 4UMAA 4X9YA 2VFFA 1KNWA 1V0NA 4S39A 2ICSA 3EEGA 4OVXA 1BF6A 5HINA 1WDSA 1Q8AA 1DHPA 1UUMA 4WUIA 1R30A 4KGJA 5FJRA 4XZHA 3L2LA 1GQJA 3RMJA 3L68A 4NVTA 4C1KA 2J7DA 2Y7GA 4HMCA 3A4WA 3L66A 3W28A 2OYMA 4L7ZA 4K1GA 3POCA 3J7HA 1UZHA 1US2A 1CLVA 5C2GA 2ZQ0A 3F1QA 3CL8A 4LNYA 2GQAA 2PMQA 4OOUA 3KBVA 2A6NA 4H2CA 1PS9A 1H60A 3KOYA 3PUDA 3W2LA 4KEVA 2A7NA 2EPKX 1XDLA 1ZLPA 4JGDA 2VX7A 3ZR6A 1FH8A 4C6CA 3RG6A 2J66A 2J62A 2W6RA 3QOKA 1R3TA 3NAVA 2WMIA 4P8UA 3U2CA 1VHNA 1C9DA 5BRQA 1OD8A 1D7FA 1DJZA 4XD4A 3DC8A 3SUUA 4MTVA 1WX0A 3FY1A 1N8WA 3TR2A 2ZX6A 4BY3A 3WG6A 4IMEA 4F8XA 4Z2KA 3UNTA 1VENA 2CXGA 4AH7A 2O0TA 2PP0A 3M5VA 1NP2A 4FS9A 5GQBA 5FEPA 1CXLA 4GX8A 1EHAA 4JTLA 4JFWA 3ITGA 4JN6A 4P8VA 3C0JA 1XCWA 4MB4A 1XF0A 5E6ZA 4CU8A 1HJXA 3LM3A 1LRNA 3TJIA 4CLMA 4AVOA 2Z6JA 3W86A 2FJUB 3QPEA 4Q32A 4US5A 1VCVA 3PUOA 3CQIA 3BCFA 1RA0A 2FDSA 5LNSA 1IE7C 1OINA 1AA1B 1ECEA 3G0UA 3GZAA 3ZSTA 4LUJA 4LRSA 1NWRA 1QOPA 4CU6A 5DBTA 4H9VA 1D8WA 3TK7A 3PPCA 3UCDA 1EYEA 1Q5MA 3UR8A 1DHKA 3WUEA 2B7OA 3EA2A 2Z28A 3VOIA 3UNDA 2IKIA 3B8SA 3MKKA 3WNOA 4ZOCA 3ITLA 5BROA 1E4LA 1H63A 1MNZA 3N73A 1A5CA 1SVDA 1K7EA 4XTDA 1EQPA 4JHMA 3II1A 1CWYA 1GKQA 3G22A 1FP9A 2NSXA 1N2VA 4HHHA 1CPUA 4GI6A 2J8TA 4KRTA 2V3DA 4EKJA 3AS2A 3P60A 3THQA 3ANVA 5A8QA 1OM0A 3WZ0E 2POTA 2REQA 3HMCA 1ZPTA 5TD4A 1PJ9A 4UTMA 4NYUA 3F5KA 2YXGA 3TH6A 2V5DA 3GFXA 3PZIA 1GQLA 2CLMA 2C91A 3UWYA 4CNNA 4LF1A 5M3WA 2PWGA 2PI6A 3ZLFA 2IQ0A 4B9ZA 3CYVA 5HOSA 1AVAA 3ID7A 3LCWA 2PF0A 5J5RA 4KBXA 3UWZA 2JBMA 4HCHA 3W75A 1KTBA 5AHLA 1GOWA 2AMXA 4WR3A 4O13A 4ZTXA 2AOSA 3G1SA 2O9RA 2XSAA 4EE9A 1XBXA 3FV9A 4JS3A 3L12A 4K38A 4YMZA 4G7EA 3EWZA 2DDXA 3PTQA 3A5FA 2FYMA 3V75A 4J3UA 5F7UA 3GNXA 4PUUA 4GVFA 1JDCA 1CLXA 4KQNA 1Q7QA 5AHEA 3LGEA 1PZ3A 4CNTA 4Q4PA 3A4XA 2WNWA 5F4XA 1WDRA 3CBWA 5E70A 1N8FA 2E5DA 3I4KA 3EXRA 2HK1A 3S1XA 3AHVA 1PWMA 1TUXA 2VOTA 2J79A 2YA2A 4QM1A 3VAVA 4KCUA 2ISWA 9RUBA 1GTEA 1TREA 2FGBA 2BBFA 2B7QA 2PDQA 3U0HA 3T8QA 3CLWA 4HNUA 1ZFJA 1PHQA 5C6MA 3F4WA 2H8XA 1EP2A 4N4QA 1J11A 3R8GA 3UGRA 3GBEA 4DN1A 1W5NA 2I5GA 3LZ5A 2ADAA 4MF4A 3LGDA 3CQHA 4F40A 3K1GA 3BLLA 4FK9A 3WLQA 1O5QA 1MFUA 2CLOA 4HGXA 2QQ6A 2GJRA 2XGZA 3W0KA 4BS0A 4H7VA 3CIVA 3MI6A 1EF2A 1TV3A 1KM0A 1S2WA 1P6BA 2OZ8A 4PTVA 4AWUA 5T9CE 1Y5WA 2W91A 1QPQA 3EB2A 2G3IA 5I00A 2NQ5A 2UZ9A 5ABTA 4NASA 5GNZA 1EUAA 1ZUAX 1K02A 3W38A 5G1MA 2DZWA 3P5ZA 2VR2A 1S3HA 2IQTA 1HXJA 3M5ZA 1W17A 2HDJA 4KRUA 3DFSA 2ASHA 3HM7A 1OFEA 1F8IA 1B31A 4J1OA 3STGA 4O4WA 5AC5A 4WHBA 3W7GA 3FYOA 4J40A 5EMLA 4RXGA 1QW7A 1ALDA 5A8GA 1ZCOA 4GI4A 3R1ZA 3THDA 2RDTA 4OQVA 1US3A 3IUIA 2X42A 5K9DA 3LV6A 3GHTA 1HJUA 2VX6A 3ZZ1A 2ZX5A 3RYSA 5CBBA 4J3WA 2YBTA 5I77A 4PMDA 5G2WA 1IWBA 5FAGA 5FCZA 4PUMA 2VGBA 1U30A 1JYNA 2PODA 5CSSA 3HQNA 2CWXA 2DQXA 3QOMA 5TF0A 1V79A 2OCZA 4E5TA 4ORIA 3IACA 2BHYA 3W1UA 2OVLA 2Z4GA 1P1XA 5A2BA 1FDYA 1G01A 4MZ1A 4DJEC 5DMMA 1QBAA 1C7TA 2F84A 3IJ8A 1FWIC 2XTKA 3PPHA 3SY1A 1WCGA 1V0LA 4UR9A 1UB3A 2JF6A 1XBZA 2E6DA 5ECVA 4NIRA 3DYOA 4L4OA 4J3TA 3D6NA 1WZLA 1KFJA 4FNRA 2XM1A 3S1VA 2BOGX 2QJIA 3BSMA 3UWVA 1EXPA 4HTBA 2WMHA 4GLEA 3BQ5A 4H9UA 2QT3A 4C6PA 2WYSA 3ZLGA 1AL7A 2XN2A 1F2JA 5AC4A 1EWDA 3WQ4A 3IIPA 3ZJKA 4P5UA 1FRBA 1KXVA 3RLGA 4IP7A 3OVQA 2F9RA 3SDOA 1J0IA 4URIA 3HQOA 3QY6A 1OWQA 3CZGA 2VRJA 2PDCA 3B9OA 1OX4A 3WNLA 1V3KA 3P8IA 4M7TA 1GORA 3TJXA 4J28A 1PKLA 1CX9A 3NG3A 2A3AA 1T7LA 1VBUA 1TX2A 1XISA 3OOQA 3GO2A 2WB5A 1EB3A 5DT7A 2CU0A 4GNKB 3AHTA 2FDMA 2PBGA 5I23A 4GMEA 4AMCA 3SY5A 4NRSA 4S3KA 4DO4A 3C0QA 4YLWA 3C3NA 3CUJA 2BOEX 4ZENA 2JK2A 5EFDA 1GK8A 4EACA 4DPQA 4K36A 4N6EA 3W70A 3N9RA 5JIPA 5I7GA 4FXFA 4DYJA 1GHSA 1LG1A 1H4PA 2WVVA 3AJXA 4I5RA 2I9EA 4LH8A 1UP0A 1SR9A 3CUHA 4QAWA 2Q02A 1HG3A 3K8MA 2FTPA 3PPGA 1R3YA 4MIMA 3QRHA 1W5QA 3CWOX 3VIPA 3ARRA 3QF0A 3QN3A 3PAOA 1TO3A 3EWYA 1Y5VA 3LHYA 3LCHA 2FQIA 2NV1A 3GTNA 1KGUA 3TW7A 3GZ3A 4JN7A 2B7NA 3CZ8A 3QV8A 4LAUA 2OQLA 4A8IA 3LY0A 1SFJA 3I3BA 1WZKA 1LJYA 3B9AA 3GH7A 3UZ5A 4B5NA 2ZUSA 4ZO8A 1PIFA 4N2YA 3H7RA 3VUPA 2Z2UA 1QXLA 2XIOA 3GU1A 3BZJA 3GRIA 1FWBC 3AQUA 5HAOA 3L23A 4I8DA 2PDMA 1W56A 4H6KA 2XN0A 7CGTA 2WQPA 4UNKA 1WKFA 4WGXA 4H8VA 5JXQA 3JW7A 1G69A 1BKSA 4XZNX 4KFOA 3E1F1 3G2GA 1O1ZA 4QTGA 3MQTA 5FI8A 2RAGA 4GYPC 2WC4A 3ZXWA 4HOWA 4JR5A 3H23A 2Y4SA 1WOBA 4CCCA 4UOQA 3V5FA 3N9SA 2PLMA 4WJEA 1QNQA 2FVLA 4L80A 5G4EA 4RE4A 2PWUA 4O16A 4CD4A 2J13A 1XG3A 5C9XA 5CBJA 4NHVA 4HSHA 5DF0A 2CWNA 4XBJA 1XC6A 4LNCA 2PGRA 3ARVA 1HVQA 5HXMA 3P2VA 3VCRA 2IPWA 5AYBA 2AAAA 3DCPA 3ITTA 4W8BA 2CLLA 4DJDA 1MQPA 4AYGA 4FAMA 2PDNA 1J12A 4G56A 1D2KA 3RCMA 1SO4A 3PZVA 2JKEA 1CCWB 3M7WA 4HA4A 3LHZA 2EKCA 4ASTA 3USBA 2XIJA 1WKDA 1XLEA 3BICA 4EVZA 5TNVA 3WN6A 1UC5A 4JTDA 4U10A 3I7RA 2OKTA 4PUEA 1ZY9A 4P61A 3UJ2A 2E6AA 1FWCC 1VBRA 2D22A 2KZHA 1OFAA 3K46A 2EO7A 3HURA 3EX3A 3BMVA 3R94A 3W24A 3LEPA 2DU2A 1L6YA 2BXZA 4NAFB 3ZIZA 9XIAA 5M5DA 4S2BA 2FFCA 1GVQA 1W9DM 5IHSA 3XIMA 1EA0A 4CKQA 1OCBA 3SY8A 4QS5A 3EDEA 3F7JA 3NOEA 2ZX9A 5E9XA 2PF8A 2Q8ZA 3VMNA 2E9LA 3IJLA 3GVWA 4DJFD 5D02A 1JUBA 4WKHA 5IM51 3R5EA 1EJ7L 3MKCA 3JU2A 3E02A 2GWGA 4LYKA 2YXXA 2XH7A 3W7KA 1CIUA 2X7VA 2QCFA 1B3VA 1WXYA 4GC3A 4XAZA 4L9ZA 1PUDA 4OGZA 5I6SA 1XLMA 4GACA 3FLUA 3STEA 1NWUA 1A4MA 1T5AA 3SFKA 1EZ2A 2WSKA 1YNPA 2JEQA 3TU9A 3R58A 2NQZA 4GY1A 4QROA 3I3EA 4QEHA 1LOQA 3LPFA 5HJYA 2R8WA 1W3TA 4HSNA 2E25A 3DBPA 2PWHA 3GK0A 3WD1A 2ZOXA 3DOPA 3PG9A 1WDQA 3TFXA 4AZHA 5DT5A 5A94A 2A7PA 3E38A 3BC9A 4XZMX 2IPFA 1L6SA 2V5KA 2J8FA 2G8ZA 4W7UA 4M0XA 1TVPA 4TTUA 3DFQA 3TA6A 3VMOA 5F4WA 3WENA 5I78A 2DEPA 1VPQA 2X1UA 4JTEA 3H26A 1YDNA 2ZXAA 4AHPA 2XDFA 4XX6A 1JL8A 3C52A 4IMGA 3AS1A 1POKA 2V2DA 1XJBA 1PBGA 4NXSA 4PUNA 4L5ZA 8XIAA 4DNHA 2R14A 1NWSA 1E4MM 1NQ6A 1VZWA 3SUTA 2OWXA 4YXGA 4C6LA 4Q7BA 3EEZA 3TQPA 3UESA 5IFPA 2PFHA 1DJXA 4FOKA 3MDWA 3S9YA 3PNZA 4S2CA 4WDUA 4JTGA 4UTLA 6XIMA 4ACZA 4UQDA 5JBEA 4LUTB 3AXKA 3IRDA 2F7FA 3E2SA 5HJXA 4LB3A 3SSJA 5DY3A 4U28A 3PJWA 3BWWA 5FL0A 3HGJA 3BLDA 2BXYA 2A2IA 4P7QA 2I16A 2E6YA 5CKSA 1RA5A 3AJ7A 2NT1A 4AYSA 2OELA 4JFTA 2CZFA 2XWDA 4I5UA 3V18A 2X0HA 1HL8A 3QLDA 1F9CA 2V68A 5JMUA 3GTXA 2X05A 3B97A 1HJQA 3AWNA 2QUNA 1QMLA 1QWGA 2Z7GA 4MY8A 4M1BA 1OHLA 1QW9A 4GUHA 2OWWA 5DX7A 3GY1A 1W91A 4DXKA 1UD6A 3WLTA 1E0UA 4MJZA 3I10A 1G67A 3OLGA 4ES4A 1XD0A 1JDAA 2E77A 5I09A 3PK7A 3QR1A 1IZCA 2J9ZA 5LIYX 2OQYA 3C8NA 3BOLA 4MB1A 2FH8A 5EA9A 1BTMA 2NQLA 4D6GA 3BMWA 3KX6A 1SJAA 3F03K 3DU0A 2JIEA 4LUIA 2O4MA 3S5NA 1MI3A 2ZZ3A 3WCZA 4IISA 2YCJA 1RBLA 2INZA 3AWOA 1WXJA 4QDPA 1U22A 2ZUWA 5HJLA 1K1DA 2DZBA 3CAVA 2VFEA 4D71A 3KAOA 4FB7A 3LSCA 1UUOA 3H55A 3QQ1A 3ZYZA 4JKMA 2FHCA 1PL9A 2HVNA 3QKZA 3UXKA 3EB3A 3VNLA 4DNMA 1DL3A 1WDPA 3VIGA 4GQ0A 4EANA 2VC6A 3TCSA 5H6HA 2HJPA 4OUIA 1YE4A 2Z1BA 4ZO9A 1AJZA 4LY4A 1BXBA 1IXOA 1OX4B 2FTYA 2GSEA 2QZRA 1S5NA 1PTGA 3URAA 2DUAA 5BZAA 3GKAA 4KCTA 4TMBA 3SQSA 3DFHA 4IF2A 1S2CA 3S46A 3VGBA 2QPSA 4AMAA 3WEOA 1W8GA 1TX0A 4G1NA 1YTDA 3BURA 1OGBA 1LLWA 4P7RA 4LUYA 1A47A 1MXSA 2DV0A 3HPZA 3M4HA 1XIHA 2EEXA 3W29A 1PHWA 1ZJIA 3BZGA 4HMNA 2HNEA 1B2YA 3AXMA 2WLYA 3UETA 3KWXA 3LHWA 1F7BA 1NOWA 5JH2A 4F9JA 4POCA 1XH0A 1HKWA 4AEOA 1ME7A 2VEFA 1BG9A 1J2WA 5CZTA 1VCGA 1GVEA 1A5LC 5KEZA 4A3RA 1GKRA 2ZRYA 4N9EA 1FXPA 1OG0A 2QCMA 3EWCA 1NOUA 3A5VA 1EZWA 1WUEA 4JTRA 3TOPA 2E28A 3LQGA 2V2HA 3O2LA 1BVZA 3MJMA 4QCFA 3PS7A 4I7UA 1ZBVA 4O54A 3RITA 4JQ4A 3FJ4A 4I8YA 3TSBA 5KZEA 2HTMA 4JTFA 3WF4A 2OZTA 2PDIA 4C6DA 4IGNA 3Q65A 1A53A 4F0LA 3N2OA 2Y61A 1YMYA 1PYMA 4H7CA 3TLLA 2QULA 3FJNA 2KX9A 3NQDA 4YHGA 5AC7A 4CD8A 4C6QA 3R12A 3IV3A 4ZFCA 3TWBA 1KFEA 5K4ZA 3IIOA 3RMEA 4ZOBA 3U2ZA 1DV7A 1MUWA 4B16A 4X3ZA 2OT0A 1UKQA 3WQFA 2X1IA 3B05A 4L6DA 2XZ7A 4YYFA 3G1FA 3VDCA 2VWTA 4K8EA 2NV2A 4LU0A 1W1B1 2OO0A 4O1AA 3LRKA 1IEIA 2ISFA 3WH9A 1ZJHA 2BASA 2J24A 2E09A 4O19A 3TQKA 4NZ5A 1GOQA 3GFZA 1O94A 3CUFA 4A4AA 4AD0A 4OHQA 2WZMA 3PJTA 2VRKA 1SSGA 4E4FA 2NLIA 2GVEA 2GJPA 1IHIA 4XISA 1TZ9A 1XICA 1I6NA 3AXXA 4YWIA 1XRSA 3EDFA 4PB4A 4LAMA 3TXVA 4IQDA 1U2YA 3C2RA 1S5TA 2J7CA 4ZCWA 1PDZA 4WIWA 1DJGA 3ZJ7A 1B3WA 5BXTA 3E0VA 4NX0A 2VFGA 2BV9A 3UG3A 2P88A 3NDZA 1QI4A 3MP4A 1VJIA 4XAPA 2FZDA 3SECA 1QO5A 4Y9NA 4F48A 3C8FA 3W27A 1GG0A 3R89A 1FWFC 3DKJA 2X7WA 4XVDA 1QI0A 2A85A 1Y65A 1KC7A 1W3IA 2H90A 1I1WA 1K3UA 5AYIA 4JTKA 4R7WA 1J18A 1XSIA 4P8XA 2ZVRA 3BSHA 4DLFA 3P5YA 3QV7A 3N2BA 3S4TA 2VEIA 1XLKA 2G50A 2GQ8A 2X1SA 3DGRA 1AH0A 1RV8A 3EWXA 3M0IA 4CVWA 4BEQA 2W27A 2VJXA 1LRTA 1C8QA 1ME8A 4HD5A 3MU7A 3FFSA 4N6FA 2A3LA 3H54A 5FOOA 4BZYA 1NDWA 4V1XA 3VNDA 3RPTA 5CEWA 5HNNA 3I3DA 2NUXA 1TTJA 4XAFA 1Z69A 1HQTA 4HYWA 3L2IA 3RX3A 3W73A 4C90A 3M0VA 5BRBA 3BXWA 1MRAA 4PBGA 3SN0A 1CB7B 1V6WA 2X09A 5BOEA 4YVPA 1TQXA 3VD4A 4HPXA 4TVCA 4M81A 1NQKA 3WQCA 1TJ0A 3ZWTA 2OLHA 5CXPA 3G6LA 1EKOA 3PANA 3VM7A 4KWSA 2VM8A 4ZQPA 3VOJA 3IJDA 1V0MA 1EX1A 1E4NA 3N4EA 3GLCA 1BG4A 3FIGA 4DO7A 5DXXA 4RUBA 3PJUA 2WMJA 1F76A 3OU8A 1BYAA 1A5OC 1XIDA 2VZOA 4NNAA 1W9VA 1LDCA 4GIAA 2WW5A 4UTWA 2E8YA 5EY5A 4AQLA 4JFVA 3OGRA 3ZS4A 5H8MA 2UBPC 3QGVA 2YA1A 1TKKA 3SM0A 3I7SA 4PMRA 5CSRA 4Y8FA 3GFYA 4ZFMA 3WQOA 4I9AA 4V1YA 1GW9A 1SW3A 4QBXA 3U2OA 1H62A 4O10A 2D3NA 1VB9A 1W1TA 4Y96A 3BOFA 1FWGC 1BEUA 1VFFA 1XRVA 2ZYFA 2ABBA 3BANA 1UZ1A 2FZ9A 1YPIA 3H7VA 4FXSA 4GGHA 4ATLA 4HPJA 2PRHA 1IWPA 2YXOA 2YBVA 2J78A 3H22A 1RP9A 1E3ZA 4HNLA 5D4YA 4Z42C 3B8IA 1IR2A 5AY7A 1GG1A 3O0KA 2BY3A 4JN8A 1EDGA 4H9ZA 3WL1A 4ZEPA 3VIHA 1IXPA 3D0CA 2ZZ5A 1GVYA 1F6PA 3NL3A 9XIMA 4EXBA 3E74A 3WQ8A 4HNCA 1EC7A 1KBJA 3ITOA 3TQVA 1WOAA 3W7RA 4LUSB 2QV4A 4RZBA 2EXOA 1C8XA 3WLIA 3TYCA 3WJWA 1DYSA 1I0DA 3E0IA 3VC6A 2XUCA 3DBNA 1DOSA 4GWEA 3M0LA 3KBSA 3UR2A 1UA3A 4DZAA 3QKEA 4OUEA 1XLFA 4JTIA 5D30A 4FP1A 4AUBA 1T40A 4KWVA 2DJLA 4UZSA 2PLJA 3CL7A 4Z2GA 4WSHA 1QPNA 3NQCA 5A6KA 1MW2A 2DT0A 2DGAA 3TYUA 3C6CA 1ENUA 4QJ5B 1J8VA 4OBTA 5DN1A 4NILA 1DXFA 3U8GA 3EXSA 3CLMA 2YZ5A 4XG1A 3C2OA 4M19A 4OIFA 1NM9A 2GOKA 1UD5A 2A21A 1GPWA 3VD7A 4FX8A 4MNKA 1VD6A 3VDGA 1G4SA 4WRHA 1JCLA 1ZCCA 1M7XA 1V6XA 3NL2A 1EWEA 2WVSA 5K7JA 1IIHA 1OGSA 1KCLA 4IGMA 3B8UA 4ZMGA 4J2MA 1R46A 1DORA 4UTTC 1O95A 3LNMA 4RNFA 2JE8A 4XVEA 1EJVC 4JYDA 3LV5A 1UR2A 2X0YA 1W2VA 1JZ7A 4DXVA 2HBVA 3DFYA 5D9MA 4MNMA 3SEPA 4C1LA 2VUYA 3OTRA 4HCLA 5D05A 1US0A 3NO5A 4E8CA 1Z42A 3UXIA 3S5ZA 2Y8UA 4U3AA 4JFUA 4D8ZA 3N25A 4OBSA 1KLYA 3GVQA 4H6QA 1RJPA 4H9YA 4WF7A 3ZOAA 1FHUA 2XIMA 5H8PA 1OX5A 1ZBKA 4NYYA 3KRZA 5REQB 4K6AA 4QDWA 2V3GA 3RJYA 2C8NA 2PDPA 1BYDA 2J6VA 4HHMA 2ISSA 1UD2A 3PULA 4JEJA 2DW7A 1RD5A 3GHUA 3SCWA 4GJIA 1BQGA 1K6AA 1W3LA 3QTGA 4V27A 4LFYA 1S2VA 3MC5A 5F2IA 3IV8A 5I3DA 4DLMA 1BGAA 1JI2A 2JQXA 4WSJA 4C7GA 5J04A 2GGHA 2Q3OA 2WZTA 4PRRA 3QR3A 3OBAA 3WLPA 2PDKA 4GXMA 1T99A 1A5UA 5KETA 5F1UA 1IEVA 1EPXA 3P6LA 5BOOA 2D24A 3BPWA 1L0PA 4W87A 1NELA 3PWIA 4PCNA 2MUCA 3IJIA 2JALA 5DQPA 3SUVA 2NX1A 4MNJA 1U5JA 3GW0A 3KCJA 4S3CA 5E93A 1MEHA 1KR0A 2BDQA 2WSYA 1R2RA 1JR1A 1IEXA 3CHFA 4LAZA 3WQ6A 1W3KA 4FIQA 3GB6A 4NNCA 3SRKA 3AMKA 3TNBA 3ALGA 1GVRA 4W7VA 3O3RA 3G1AA 1F61A 4TMCA 3AU6A 4HZ8A 1XPYA 3MO7A 5I5RA 1NP0A 1E51A 4Q4RA 4ZSUA 3MUZ1 1V6UA 1XP3A 3CB3A 5C7VA 4NZFA 7REQB 2YA0A 2AL1A 4C6KA 3M43A 4M8UA 1DEDA 1GQKA 4AXKA 2EAWA 4MZYA 5G5IA 1BHGA 5AZ1A 5G1TA 4DWSB 3BLKA 4FEZA 4QITA 4S3AA 1UASA 1JCXA 3REQA 3WH6A 4PMZA 1E0TA 5CSUA 4E6MA 3ZT7A 4TVUA 1C3FA 1X98A 2J9YA 4QXIA 3KM8A 1XIJA 2VENA 1OIFA 2G37A 1DJNA 3AZTA 3CO8A 5LXXA 5EL1A 1SZFA 3APYA 3SUWA 2FKPA 3PC0A 2EBNA 2DJXA 4JKLA 4KWUA 6CGTA 1XCXA 4RW5A 3TONA 4OJYA 5SWUA 2ZIDA 3CO4A 3MKVA 2XZ9A 2VVNA 2XIIA 3CXOA 4KGLA 4BI5A 2XIQA 3NNTA 1LBFA 4UQ9A 3LZ3A 3IPWA 4Q6XA 1OFDA 3HGOA 4IFOA 2RDWA 3T9PA 3NQBA 2QJNA 3OQEA 5HQMA 4AIBA 2ESCA 4OKDA 3W7EA 7TIMA 1GW1A 2CIPA 3DN5A 4KMQA 2EJ1A 4HHLA 2ZZ4A 2OWCA 3C3UA 4PCSA 4TX6A 3W1XA 1M65A 4PCPA 5IFTA 2YPIA 2QLYA 1BYCA 3LRMA 4GZIA 4NF7A 4PUJA 2I14A 2NXGA 2DZVA 2CBIA 1JRCA 2WNZA 4DJDD 1RY0A 4WVXA 1UWRA 3EDDA 1E72M 3WBYA 2B31A 3WBXA 3ZVHA 1KGXA 1PKMA 4X0VA 4PBEA 4X9SA 3DXIA 3EX2A 3HPSA 4U2ZA 2PSNA 1WAWA 2A3CA 2D2OA 2CEQA 1UROA 1XL9A 4WY0B 4YCPA 1SJBA 4KCVA 3KLKA 3UWEA 1YIXA 1RCOB 5PTDA 4MUZA 3GS6A 1CGUA 3NDOA 4LANA 1UD4A 1W9PA 3AUJA 3H12A 1ADSA 4JAWA 3LTYA 1A5NC 5FSDC 4H2HA 3F4DA 3N19B 3GD6A 5AB3A 1VFOA 4N9BA 5FF3A 3GUWA 4US5D 1YPXA 4YIWA 3A23A 5CG7A 5ABHA 4M24A 2QEZA 4FLOA 4ZBCA 3PG8A 2DZSA 2H6RA 2AMGA 2EPNA 2IXVA 3W7CA 1UIOA 3QMSA 5I3FA 1G0CA 5LNRA 3F4CA 2ZRZA 2QAPA 1R3SA 2ISDA 2EGZA 1XIEA 1XM3A 1KRAC 2CNCA 2O7SA 4L9XA 5A6LA 5A69A 2Q8LA 4N0RA 2DZAA 3KZSA 3LU2A 3PVFA 1EJUC 2AKZA 4ICMA 3PAJA 2QCLA 1P48A 3KVKA 2XH2A 4IXHA 2QJHA 4GYPA 1OFQA 3TV8A 1OG6A 1XGZA 5GPRA 3EKZA 3UZWA 1HUVA 1B3XA 4QR6A 1MW1A 3PZQA 4J5NA 1QO2A 4EAYA 1NVMA 3WLJA 1EP3A 3BJTA 4H8NA 1OFPA 3WQGA 3H21A 3UJFA 1ZTVA 4H8HA 4BI7A 4Q22A 1CGVA 1WB0A 1XYZA 4XBSA 4DRSA 1ESWA 4LUSA 3TIMA 2ZDRA 5JUVA 3NQMA 2YCLA 4OBRA 5C55A 1AL8A 3THCA 1VP5A 2OOFA 2IPGA 2HZGA 3LHTA 1ELSA 1XC4A 3AIRA 1MSSA 4H9XA 1ZAIA 4WKAA 2FZNA 4RZ6A 1DQUA 1YNYA 4C6BA 1J5TA 1KM4A 5HQEA 1ISYA 1UR4A 3CZJA 1FWWA 3N04A 4AZBA 1BFNA 1VGAA 2SFPA 2XVKA 4CQ8A 5F2LA 1OSEA 3NZPA 1EGVA 2WLZA 3WQVA 4CCZA 3DFOA 5D2TA 3P14A 3C2FA 3VMPA 3MWCA 1W2PA 3AS0A 1MYRA 2E0PA 2GOUA 4MY9A 1A4LA 1UWSA 4LT9A 3DDMA 2MNRA 2QF8A 2WSQA 4P7NA 3FDKA 1V6TA 3H53A 2Z7KA 3L0KA 4GC4A 4Q4OA 1MEWA 3BJSA 2Q71A 2I1OA 1TVNA 2OTDA 3LB0A 5CZSA 3VVGA 1JF5A 4LALA 1TPH1 3C61A 5MKGA 3W00A 1D3HA 3BE7A 2XPKA 1UH4A 5EBAA 3N2MA 3V5CA 2A3BA 4LGXA 4TR9A 1S5VA 4HU3A 4KCWA 3OODA 3NO3A 1K4HA 2OFJA 3TTYA 3LMYA 3P74A 3NL5A 2J75A 3AZRA 5C0QA 1EJWC 4AIUA 3U9IA 3VI2A 5LA1A 2ZKMX 3WDPP 1LQ0A 2OKOA 5D32A 3O9NA 1I2QA 3CEUA 3DI0A 3NVTA 3NEHA 4GUJA 1TWZA 3IGUA 3OG3A 1MMFA 3WBEA 2P8CA 3WLNA 4PFMA 3VNJA 3GH4A 1P0NA 3T09A 3GG1A 1NOFA 1K77A 2WHKA 3FVMA 1GOXA 1RJRA 3PUGA 2IKHA 3B0YA 3M1ZA 1VS1A 1I2RA 1JPHA 1XWYA 1PZ1A 2VX4A 3G1YA 3EMCA 1JYVA 2W66A 1F73A 1F5ZA 1DVJA 2C79A 2Q8XA 3OW1A 1ZENA 1HKIA 3MI3A 2G3FA 2WK2A 3B0PA 3ARPA 4CN1A 3FHQA 3MYPA 5LNUA 3UF9A 3UY8A 3B0XA 2Y88A 3KE0A 3OPSA 6PTDA 3NEVA 1I0BA 2VYOA 2C3ZA 4MZ8A 3QSRA 1QHPA 1C29A 1AZ1A 4GE8A 2VDIA 5C9UA 4Q8UA 3UG8A 5E0CA 2QGYA 4WZHA 5HNUA 1OQFA 5FJOA 4FF7A 1DTUA 3WH8A 1TQJA 4R27A 4CCEA 4AHQA 4LC6A 3QMTA 4UCGA 2FTWA 4M51A 1E9IA 1I9CB 5BWAA 1R0MA 3F2BA 1QRQA 1J10A 1IIGA 1H61A 4FF5A 3IEBA 2YFOA 3LERA 2VCBA 1XYFA 4JL1A 1FDJA 1PPIA 4TXEA 1GGOA 4GXWA 3SN4A 4LYPA 4ZQNA 2V5CA 3I4EA 1OF6A 5K2ZA 3FX4A 4C91A 4B9YA 1VPXA 2I9UA 2V67A 4FNTA 1KM5A 3TSDA 4YHEA 5I07A 4NUWA 2Z27A 1DIKA 2OX1A 4OTKA 5DANA 1WZAA 1JXKA 3T7VA 3R13A 2VNCA 4PL1A 3A12A 3U48A 2WO5A 1I2OA 1HX0A 4GH1A 1UKOA 4AFYA 4GY0A 3M0HA 3E9AA 3HMJG 2WHJA 2O9OA 4UXDA 2YL8A 1PYFA 1RALA 4PUKA 4AIEA 3WEZA 3QEZA 3L4WA 1HTIA 3PB2A 1WYIA 1FTXA 2CZEA 3WLHA 3DH7A 4HNTA 4GKLA 1KM1A 4FNSA 3W1PA 5C5YA 1XIGA 2LLEA 4FLSA 1K8ZA 3VD9A 1M68A 3H2CA 4F2BA 1EJXC 4HU0A 2C6QA 4XZWA 2D2GA 2QCDB 3T78A 1AQFA 3S42A 8CGTA 1XG4A 1KFKA 2D23A 4LCSA 2NV9A 2VGIA 3OP2A 2YCIX 4DQWA 1XUUA 2WBKA 4PYSA 5I2UA 3KL0A 4H6RA 1JIBA 2PCQA 2BGQA 1ICSA 2ANUA 1D8CA 5HR6A 3V36A 1VFLA 4HZMA 3S2JA 4C7DA 3LGGA 5U7SA 3TNOA 1J5SA 2NX9A 2HK0A 3ZT5A 1YXDA 4FXJA 1VYSX 4TX9A 5TBOA 1TTIA 4E3TA 5CH9A 1NDYA 4ERAA 2AL2A 4H04A 3S2MA 6REQA 3QY7A 4BA0A 2OX4A 4IQLA 4AIOA 3PZMA 4HP5A 1QU4A 3PBWA 4WJ8A 4D6DA 3M41A 4CQCA 1EOKA 3WEMA 1GZJA 5C9WA 4C6JA 1JF6A 1SMAA 1E1FA 1SW7A 4Q6JA 2X2YA 5HDRA 2TSYA 3KS6A 4EWND 3IGHX 4KH2A 2HS8A 3U7BA 2HS6A 1UPMB 4GOAA 3VIIA 1PAMA 1VQTA 2PC4A 1E4IA 4AWSA 1BWVA 1P5BA 1UC4A 2XSBA 3LSBA 4LC8A 2ABAA 4A2RA 4UNIA 2UWFA 4O1EA 3D3FA 1TZ7A 1TA3A 4M56A 2C7FA 2F6UA 4QAIA 3Q4DA 2PRMA 1SYTA 2J7HA 1FKXA 3DESA 1KXQA 4QG8A 2OU4A 4MWAB 1UJQA 1H49A 1YPFA 1LWIA 3GR7A 2GL5A 1W1IE 1YXCA 1R3QA 4IJBA 4LAKA 3CTTA 3EDJA 4HK7A 1K6WA 3BV7A 4Q4SA 4V28A 2JEPA 2QDHA 3WFLA 2WZEA 1W1PA 1VYPX 3L65A 1DWJM 4ZOEA 5BXPA 2VZVA 4GIEA 2BY0A 1IT0A 3B3DA 3OIXA 4ZO7A 1RXOB 1UG6A 2ZFAA 2INEA 4JIHA 3R8RA 4I9TA 5BU6A 4ZA0A 3G3DA 2HISA 4IG2B 4UUIA 2XH0A 5FJIA 4TTGA 5FJTA 1MUCA 3E2RA 2BHUA 4MJMA 4QQ3A 3HGRA 4PRTA 3GDRA 3Q58A 3QLLA 3WNNA 3CPGA 1S39A 1WXZA 1DIDA 2DQWA 3VIOA 3GXPA 3QGAC 4TV6A 2NWRA 4CNSA 1FVPA 3W2UA 1GVIA 4WXYA 2V9DA 3H70A 4O57A 3CHCA 4DBEA 3OIHA 7ENLA 1CNVA 3CYJA 1VC4A 2PAJA 2Y5SA 1EIBA 3ANYA 3RXZA 3NSMA 4R9OA 1W5MA 1R47A 5AVNA 3T81A 4PC8A 4IIGA 1SU5A 3P8JA 4I7WA 4LBRA 4F0KA 4Y7EA 2GQ9A 2YFNA 1W9XA 2QCGA 3GIPA 3NO1A 4O50A 3CK5A 4GYJA 3SB0A 2BGNE 1PDYA 3NZ1A 5ENLA 3M47A 3JRKA 2NLYA 3BW3A 4YVVA 3B03A 5EMJA 4EPKA 3SCNA 5GVJA 2E3ZA 1MXDA 3M5XA 2AQOA 1AMKA 4DJDC 4MMWA 3URQA 4S3FA 1HKJA 2Z29A 4ATWA 1P0DA 2DW6A 5ECUA 3KRBA 3N15A 1EEPA 3CUXA 3H8AA 3NSXA 3GWQA 2J47A 1V51A 4TQTA 4LCQA 1E6QM 1FWNA 2EPHA 4AEEA 1YDYA 1FY6A 3M6YA 5LXEA 4AZ7A 2HE5A 3VE7A 3UZXA 4O8AA 2IPJA 4HZ7A 2VMFA 3CTLA 4HIBA 4H6EA 3PZOA 2IMRA 1HJWA 1CB2A 1X96A 3VKKA 1QVBA 4RX0A 1TCMA 3T42A 3IVSA 4AX7A 3S1GA 2ZUMA 4MKVA 3UG5A 5XIMA 1CLKA 3NXLA 1P0EA 1OZQA 1V6VA 4RE3A 4ATDA 2F61A 1E0VA 4Z1CA 1H50A 1FBAA 4DJED 5LIXX 4ZB2A 2GGIA 3O07A 4OWGA 3QSTA 2ZVIA 3T2PA 4BWLC 5LGXA 1QI5A 2BS9A 1XIMA 1WV2A 4NG3A 1S1RA 4QSFA 1XDJA 3N6JA 1J2BA 1J01A 4TX8A 1NFPA 3ARYA 1R5YA 2J27A 4GNVA 1TELA 3QFWA 4DX3A 1GVOA 4QCEA 3IGSA 2ZZ7A 1SQ7A 3EOLA 2NVDA 4KETA 4IIFA 3W3OA 3WNMA 3AROA 1TTQA 1IZJA 1A0EA 5D2YA 1A0DA 4GUFA 4NAEA 3CQKA 4B5XA 3QHOA 3R4IA 1XR2A 4A05A 2PBOA 1K9TA 4L56A 4O52A 3AYVA 4MHBA 3STCA 3ZSSA 3G1XA 2J77A 4O1FA 3LBOA 1FOBA 2QVNA 2EF9A 2H8ZA 4M7SA 1UMYA 2UY4A 1VFTA 4PEEA 3A13A 3CHDA 3FHAA 1VJSA 1THFD 1AH4A 2NW0A 4DI9A 2BP1A 4S1FA 2QIIA 3B9DA 3VABA 4A6GA 2A4AA 4BFAA 2PWVA 4GZ7A 3AZSA 2ZWZA 4I9JA 1XLLA 4JFSA 4CNUA 3F4NA 4FALA 1PX4A 1Z41A 4CNOA 4UTKA 2WQDA 3VZYA 2ZWYA 2VGFA 3QJAA 4DYKA 5DO8A 3WMCA 2Y6ZA 1E9ZB 1CXHA 5AC8A 1Q8JA 4XZIA 5CSYA 5I02A 1GONA 2AQWA 1NU5A 1XKYA 5H2ZA 1PX8A 5D9OA 2ZRWA 3O63A 3KL5A 3GHSA 3A9BA 1C92A 4J9JA 4MSSA 4JHOA 3RX4A 4E8GA 3BARA 5E6YA 3E5BA 2VO5A 2O7QA 4XSMA 1RLDA 4XAGA 2X30A 1I1XA 4JTSA 2OLSA 3B8VA 1BRLA 3HFTA 2OB3A 3APGA 4ADSA 3QY8A 3TUUA 4GJ1A 3RR4A 2VRQA 3WQDA 2ZTKA 4HYRA 3K2GA 3BW4A 6TAAA 1I45A 2JIWA 1EHNA 1T6MA 3W76A 3VUSA 3C0SA 3NQ7A 3SBFA 2EHHA 3CUZA 3NQ2A 3RM4A 5A8OA 1E0WA 4MDOA 4HB7A 4CUCA 4D72A 2VC7A 2JF7A 4ZB0A 2ACUA 1VBGA 3JZUA 2BFGA 3WX7A 1B3OA 3IJ6A 4INFA 3BO9A 2PRLA 1AMYA 3VD3A 4ENLA 1T96A 2OXNA 5BXSA 4KFNA 5JBDA 3ONCA 4XD3A 3IRSA 1G7VA 1IXNA 4LUTA 3GUGA 3EWBX 4QISA 3G8RA 4FMVA 3LYEA 1HJSA 4PMYA 1MVYA 2YZRA 2C1GA 2WMFA 3G0SA 5HULA 1E1EA 3WLRA 1V3JA 4KT2A 1M6JA 4UCFA 3WJZA 3K4WA 3DG3A 4M80A 5A8MA 4HA0A 3SI9A 2FVKA 3SGUA 2VCCA 5D38A 5E0KA 3MBFA 3OHMB 6ENLA 3OLDA 3VILA 2AL2B 3BK0A 8TIMA 1RBOB 1XRFA 3O05A 3A64A 1QNPA 3L0NA 4RDVA 3UY7A 1SGJA 1E6RA 1U1JA 4Q4KA 3MBDA 2WCAA 1Q65A 2CW6A 3IJ9A 1NIUA 4EXQA 2VCAA 4A21A 3IJQA 4JX4A 4MM1A 3WD0A 4D1JA 3W84A 2V81A 5EYWA 4UB9A 1TPUA 4ZSTA 4HTYA 2Z2AA 3T8LA 2Y85A 4IIBA 5JIWA 5GNXA 3MUXA 3MCMA 1Q85A 3WMSA 3HN3A 1LQ2A 1RK5A 1FWAC 4Q7IA 2V2CA 3SO7A 2PZ0A 3VCCA 3R7MA 2EJAA 3OHIA 5FKYA 2OLAA 1PZ0A 2BTMA 3QW4B 3LDVA 5DMNA 1DJWA 4TU1A 3TDFA 3P84A 1OY0A 4FLRA 4XKYA 2FHFA 4QS6A 2R1NA 5J8LA 4RNJA 3IVUA 5AKQA 5CPOA 1G94A 1PVNA 1FDZA 4N02A 2NQJA 2BWGA 4R7OA 2V63A 1XFBA 1EUNA 3L4TA 2PZNA 3VIFA 1JNDA 1E1CB 1B90A 3I6TA 3HQPA 2W62A 3F5LA 1FHVA 2PCEA 3PZTA 4YNGA 1XLGA 2BNJA 4DELA 1FA2A 1FWDC 3AC0A 3MP5A 3GH5A 2HV5A 1BF2A 1DBTA 3S47A 1SFLA 3MSGA 1MUMA 5CGMA 2DSVA 2PP3A 4QLLA 2CYGA 2RUSA 4PMJA 5GJMA 2PDGA 2YLAA 4H9TA 1XW8A 4UFJA 2ZXQA 3BAJA 1ZGDA 3FDGA 5I0DA 1EEXA 3BAIA 3U4AA 2XFYA 3BDKA 4L65A 4U33A 3C86A 4MYAA 3TTOA 1GZ1A 1E55A 4DI8A 1K8CA 1R7AA 3NURA 3FXYA 2CLKA 3BAX<