3SZ8A

Crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia pseudomallei
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
279
structure length
264
Chain Sequence
b'SMNVAISPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIPFVFKASFDKANRSSIHSYRGVGLDEGLKIFAEVKARFGVPVITDVHEAEQAAPVAEIADVLQVPAFLARQTDLVVAIAKAGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQMAETTGGCPVIFDVTHSLQVLDLARAGIAVGIAGLFLEAHPDPDRARCDGPSALPLHQLEGLLSQMKAIDDLVKRMPAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase 2
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 81
structure length 264
sequence length 279
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sz8A00
2FPTA 3P82A 4JDBA 2FPVA 1TCDA 1VR6A 1XBVA 1LOSA 4WXYA 2QUTA 2ZRXA 2EAWA 4H3DA 5AHFA 2QCDA 3BO9A 3HG2A 4O13A 1F6PA 1SPQA 5H2ZA 4CNOA 1G4TA 2X1TA 3CLMA 3M5VA 3LLDA 3GAYA 1EX5A 1JR1A 3UPBA 3H53A 5I3GA 1SW7A 5A5WA 3SY5A 3M16A 4UTTC 2C16A 2WO5A 5HQEA 3KAOA 2FPYA 3W22A 5C5YA 1XBXA 1TQJA 2J24A 4UIOA 1VHNA 2GVGA 3USBA 1Z41A 5F4WA 3W7HA 2R14A 4WD0A 2C15A 4JTUA 1HO4A 4WOQA 5LNWA 1KTBA 4DEFA 4RXFA 2D73A 3NM3A 3LRKA 2E6DA 1IF2A 3I7RA 1RD5A 4A3UA 3FFSA 4YWIA 3LRMA 2QCCA 1F2JA 4JR5A 1GYLA 4AWTA 2H8XA 4FNPA 4LU0A 3DFPA 4JTLA 4CNPA 3JR2A 3B0PA 4PCFA 3P74A 2B4GA 2VKZG 3OA3A 5IM51 2EGZA 2X2GA 1K8XA 3WJZA 3CIWA 3QMTA 3FOKA 3F4WA 3T4CA 4JTFA 2BX7A 4QNWA 3THAA 4JY9A 5BOOA 5DY3A 4IMEA 3WK3A 2VFIA 3L5LA 3PSVA 1XC4A 2E6YA 1UBSA 3W86A 3R5EA 1O4UA 2RHGA 3M5YA 2GUUA 3PR2A 4MLRA 1TIMA 2V2DA 2BLEA 4X2RA 3NPVA 3LCWA 2WNQA 5L9FA 4K37A 3NYZA 3TROA 4TMCA 1I8JA 4R34A 2GVLA 3NOEA 4EOUA 2DZWA 2QJGA 2Z6IA 4JX6A 1SW3A 4JIQA 3W87A 1G7VA 2LLEA 2WSQA 1H60A 3GKAA 4TU1A 2Y85A 4GE8A 4UR7A 1EB3A 2G96A 3EX1A 2QCGA 3W6YA 4HNVA 1Z44A 3QM3A 5G1YA 4NZJA 3GX9A 3RLUA 4WJEA 3MW7A 4LT9A 4QQ3A 3HPXA 2OT1A 4XZ9A 1RVGA 1FDJA 3U2OA 3LM7A 2WSYA 5HNRA 4JDYA 3PWAA 3B0UX 4O54A 4AAJA 3QSRA 4HT3A 3PVFA 3EX4A 1TSIA 4BI5A 3GDMA 3G3DA 4RZ6A 3S6DA 3LBMA 2CZDA 3LLFA 3TC7A 2VFHA 3IIZA 2PURA 2FB3A 1VH7A 3W74A 4Y96A 1HFBA 2Z1BA 2YX0A 5D03A 3G1DA 4NVTA 4MUZA 1H1YA 4OHQA 2YW4A 4CLMA 1TTQA 5LGZA 3GR7A 3HB9A 3S42A 2YW3A 3LHYA 4GRSA 4OGZA 5TQLA 4A2SA 3TJXA 1ZHAA 3Q58A 3HQ1A 3W7JA 3FYPA 3G1XA 4ZQPA 1KM3A 3G8RA 1DVJA 4K38A 1K8YA 2X1SA 2X1RA 5EYWA 1GJPA 1VGAA 5D38A 3QMRA 3NR0A 1H7RA 3BK0A 3L5MA 2H8ZA 3NPWA 1JUKA 3BVJA 1GVRA 2QEZA 1F74A 4AF0B 2QUVA 3W2KA 1ICSA 1KTCA 4BF9A 2A7RA 4LRTA 3E02A 2HS8A 2RKXA 3MHGA 2QCMA 3H55A 2H6RA 2TSYA 3Q37A 2ATMA 5AC8A 1X7FA 4WY0B 1SZGA 4JXCA 5K9XA 1TPDA 3L5AA 1QFEA 4FNTA 3TXVA 3WJWA 2EKCA 2GQ8A 4FB7A 1NEYA 2Y62A 3LCXA 5IBXC 2HS6A 1AW1A 3R13A 3TV8A 2Z6JA 3PUOA 4CQ9A 3NL3A 3OVRA 4IMDA 3NL5A 1ZFJA 3P60A 5LNVA 1GQNA 1VCGA 3LX9A 2Y89A 1T99A 1O5KA 2GQ9A 5C2XA 1RV8A 4N02A 1FX6A 1D3GA 1UJPA 1W37A 4FXSA 4ADSA 4N9CA 2ZRZA 3QPYA 1S5VA 4P2VA 4E2DA 1GOXA 1LZOA 5GVJA 1T96A 3NEVA 3MI6A 3EWWA 1TRIA 3E9AA 3LHWA 2YCEA 4PL1A 1UUOA 4Y9AA 3W85A 5BW6A 1JQXA 2NZLA 4X22A 3WK0A 2XFWA 4DPPA 4Q4KA 2DJXA 3SSJA 5BMWA 4NJGA 4CNNA 3E0IA 3WFAA 3MMTA 4N6FA 4DO5A 4FX7A 3FYOA 4FNQA 1G4SA 1O60A 3NG3A 3W7RA 3G3MA 1RQEA 1ZAHA 2QF7A 2CZEA 3IVTA 3EB2A 3WJXA 4NT0A 5FF2A 4XBSA 1OF6A 4RR4A 2H3BA 1PIIA 4UR8A 2NUYA 1QNVA 2QCEA 2CW6A 3QYQA 4KWWA 4G1KA 2YFNA 1WA3A 4LV4A 1ICPA 4RX0A 5LSMA 1IGSA 1KLYA 1TTIA 3DFQA 4JIPA 3L67A 3C56A 4O50A 2AQWA 2DZXA 1OFBA 3LXAA 4R53A 1GEQA 3L0GA 4ZQMA 3NQ2A 2V8ZA 1UUMA 3BG5A 2ZZ2A 2OCZA 4Q32A 1OJXA 1F73A 1F6KA 1GG0A 2NV1A 3LHZA 1YPIA 3QEZA 3N2MA 2JK2A 3BGJA 4C1LA 1KBJA 3A5VA 1ADOA 1TRDA 4DBDA 4QSHA 1E51A 2CLKA 2ISVA 2OMAA 5F2MA 5MHBA 1L6YA 2B7PA 1FWNA 4UFKA 4ZMGA 3D0CA 1IXNA 2A0NA 5KTLA 4WOZA 1FCVA 1Q6QA 1L6SA 5A8GA 1XBYA 1TQXA 2CLOA 3INPA 3KRZA 3N73A 4JNMA 4JTEA 6ALDA 3I7SA 4TMBA 1KM1A 4M19A 3FA5A 3S1UA 4DF2A 4MFDA 5CZJA 5LNRA 3ABSA 2CFFA 2PC4A 3V1PA 1DQWA 5D2VA 2E1DA 3TH6A 2YGYA 3STEA 3L65A 4RKAA 3LBCA 5D2TA 2ZTJA 1W3NA 1UCWA 1SZEA 2ZZ7A 3P84A 1I2RA 4O1AA 4FX8A 2QCDB 1LOLA 4JY8A 3UXDA 3O6DA 1ML1A 4ONVA 4UUIA 4GUHA 3GIYA 1HG3A 1YYAA 1ZENA 3LGEA 2WPBA 8TIMA 2PE4A 4M6PA 3BLIA 4QJ1A 5K3VA 3KHJA 4GUFA 3CT7A 2GQAA 3RU6A 4CCCA 4QM1A 1LTDA 1I2QA 1VYRA 3TQ0A 2ZQ0A 5DBTA 1A5CA 3UWVA 1ICQA 1O94A 1S3HA 3VE7A 4C1KA 2R8WA 5ABTA 1SUXA 1KM2A 3P80A 1L2UA 1KFJA 3W7GA 4ML9A 2TMDA 1VQTA 3HO8A 4K7VA 1KM0A 4NZFA 5F1VA 3MP3A 2ZA1A 1VHCA 1GVOA 2CLIA 1WV2A 4O11A 2BXVA 3MHUA 4OU1A 2ZBTA 3BLEA 3OVPA 4BK9A 2NLIA 4NJJA 3A23A 1TV7A 3UWWA 3QPZA 1TREA 1OX4A 5HWNA 1I2NA 1TPH1 3YPIA 1T0OA 1TPFA 3SJ3A 4HN4A 4KFOA 1FQ0A 1PCWA 3TXZA 1Y0EA 4MY1A 1XXXA 3QSTA 1LRNA 5I3IA 3KRUA 1B9BA 3PUDA 3G1SA 2NX9A 4LS0A 4U4MA 1PHWA 5I3KA 1AK5A 4LTSA 3W2LA 4MZ8A 1R47A 4DF0A 2Q8ZA 1VCFA 3TX9A 3C2OA 1D9EA 1P1XA 1IIGA 3W1LA 1EUAA 3O1NA 4CCDA 1JULA 5HR6A 2ZRUA 3GNNA 5FEXA 2VFFA 4TIMA 1DL3A 3A9IA 2TPSA 4L4LA 5AHNA 3TW6A 4K39A 3RMJA 3LTYA 1VC4A 2B0MA 3HBLA 5D32A 5KMYA 1VYPX 5HUPA 1KFBA 5FEWA 1KTNA 5AC6A 1OYCA 2GPTA 1RQBA 3NPUA 3PY2A 4GUIA 3GR8A 1QCWA 1OK4A 2ABAA 5TIMA 4PH6A 5CPOA 5G1TA 4IWWA 1B3OA 1WOAA 4S2CA 2FJKA 1QPNA 3W2MA 4MZ1A 2FB2A 5L6UA 2C19A 4AHOA 2ZA2A 2J9XA 2A7PA 1G7UA 1GPWA 3MP4A 4IQLA 3NDOA 1X6UA 3TMLA 3SGZA 3G0XA 5CSSA 1XUZA 1EP1A 1I4NA 1ZAJA 1G6CA 4IMGA 1MEIA 4QISA 3UNDA 1QOQA 4YL2A 3GDLA 3LXBA 4N9EA 1OFDA 4OV4A 1EP3A 1Q6RA 4LS2A 4O1DA 3T7VA 1TMHA 2C13A 4OWGA 4Z0SA 4YXGA 4O53A 1B57A 4MYXA 4BI6A 4AB4A 4RJEA 5AHIA 4LS1A 4CQ8A 4UTKA 3PG9A 2VEPA 4PC8A 2QCHA 3S1WA 4O8RA 3ZFHA 3W73A 2B7QA 3W7MA 2WJZA 2QJHA 1GYNA 2QKFA 1K7FA 4RCXA 3TNOA 2G95A 1WOBA 5DELA 1LM1A 2E5CA 2NXHA 3QQ0A 1YTDA 4NX0A 1VRDA 3IGXA 4ADTA 1JUEA 1GTHA 1XBZA 2FLIA 4ZVJA 2V81A 1J5TA 4JEQA 3W71A 2Q3OA 1BEUA 3NPXA 2E5DA 2O7SA 4A21A 1BWKA 4JYDA 3L68A 1LRQA 4K36A 4RZ5A 1S5WA 3I7QA 3GXTA 2VELA 5KZMA 2NV2A 2XN2A 5DLCA 3C2VA 1H7WA 4NUWA 2WNNA 3DXIA 3LXCA 1TPEA 2A21A 3UWQA 1JJKA 2XN0A 3N14A 5AHMA 4UTHA 4IGHA 4AXKA 4POCA 3G0UA 2P1FA 1YXDA 1K02A 1LRTA 5F2LA 3IV3A 3N34A 2FTPA 1KFCA 4ZZ9A 2P0OA 4N4PA 4OV9A 5F4SA 1JCXA 1Z42A 4R7JA 1KM4A 1YDVA 3C2RA 1NAL1 5D02A 1XDMA 2ZYFA 3SW6A 4LWWA 4O28A 3QW3A 3DFNA 4LUJA 1MZHA 1UB3A 1O95A 4HHPA 4M7SA 4WZHA 4LC6A 4P61A 5LHEA 4IXHA 3QW4B 4OT7A 5CPLA 5EBUA 1IXQA 1KM6A 1TYGA 1YXYA 3MI3A 4BWLC 2R91A 1FWSA 3DHFA 4LV9A 4XUGA 3UPWA 4CCEA 5AYYA 1ZALA 4LC8A 3VKJA 4RXGA 1LLWA 4LY8A 3ZWSA 4X9SA 1EIXA 3UWUA 2VFEA 1VJIA 4UMAA 2QAFA 2DZSA 4DELA 3GXPA 2Y6ZA 3G8EA 3LHTA 3TE9A 3GVGA 5DY2A 1DV7A 4PODA 3TW7A 2E6FA 1A5AA 3TR2A 3DH7A 1I2PA 1XL9A 5D09A 5LNUA 4UNKA 1Q3NA 5F4XA 1YTEA 4NNBA 3L21A 3CHVA 2V9DA 1ALDA 2JGQA 4UFMA 3U8GA 3LDVA 3M5ZA 1N7KA 3ATYA 5G4EA 1H61A 2BTMA 2G97A 1SFJA 4GNJA 3TK7A 3TDFA 2VENA 5FF3A 1LCOA 5DCBA 1Q6LA 3P8IA 3KFTA 3KVJA 4O1BA 1TV8A 4BI7A 4MLJA 4UXDA 2V2CA 1R2TA 3CTLA 3FEMA 4FO4A 5CGQA 1EWEA 4K6AA 2WOQA 3A24A 4D2JA 3TMQA 4AMAA 3LTPA 3FJ6A 4XTIA 4LOCA 3S8HA 3M6YA 1DKWA 3MBFA 4BR1A 3C8FA 3NZRA 1C9DA 1JCLA 1JCNA 3LCIA 4ORIA 2I1OA 3HJZA 4MY8A 5BMXA 1TPVA 5H91A 3DKJA 3M5XA 1U5JA 1R2SA 2JKAA 4NX5A 3IVUA 5K7JA 2CLFA 4FXRA 3STCA 1K7XA 3PS7A 2CLHA 3O6YX 4A29A 1H7XA 1MEHA 5F2GA 2V2HA 1SO5A 3P8JA 5D2YA 3UY8A 3SZ8A 4AH7A 3NGJA 4JTHA 3S9YA 3S1XA 5CPMA 2V5BA 3B8DA 5G5IA 3NQ8A 3LRLA 3DENA 3E96A 1K3UA 4GBUA 2ZZ5A 4O0ZA 3GXNA 3L0KA 4IX0A 1QMLA 3VI2A 3DAQA 5D33A 2H3DA 5C55A 1IXOA 2YPIA 4UMBA 1BKSA 5CSRA 1VLWA 3W7NA 1KM5A 4GJ1A 3W9ZA 1SO6A 3O07A 5HMSA 2IQTA 1VYSX 3EWXA 3TCEA 2Y61A 3TJLA 5DCDA 1QO2A 5K4XA 2DZPA 1F76A 1A5BA 4BFAA 4OBTA 2W79A 4DO4A 4IOTA 2CU0A 3S5YA 1WXJA 3IIVA 7TIMA 4KWVA 3TA6A 3S5ZA 3BARA 4J9JA 2W0UA 1FXPA 3K30A 3EX2A 1H62A 1OFPA 4EVZA 1M5WA 3LHVA 1TPB1 4I7UA 4O10A 5DXYA 4UTWC 5J5DA 1QWGA 5LKYA 1SU5A 3H54A 2JGYA 4B5NA 3DFSA 1ZCOA 1KV5A 3W1PA 1YDNA 5AC7A 5I3HA 1OX4B 1KW1A 4H6KA 2NXIA 3CEUA 4M6QA 3W88A 4ZQOA 5AFDA 3DGRA 2C18A 2PRHA 4A2RA 3G1VA 5HULA 1OFRA 3P81A 4S1FA 3HPZA 1QR7A 3NQVA 3MO7A 5KINA 5HWJA 3G18A 3GDRA 2WKJA 1QPOA 5J5RA 1OYAA 1H7OA 2RDUA 5LNSA 3M41A 4UC5A 4FNRA 1XI3A 1ME7A 3C61A 4HKPA 3TFXA 2NX1A 3DFOA 1DORA 3P5YA 3W7OA 2FFCA 3IGSA 4JTSA 3W7LA 1OABA 4TX9A 3EXRA 3BPWA 3EKZA 3A5FA 2Y7DA 3OVQA 1FY6A 3NQDA 2ISSA 4O19A 3MP5A 1JUBA 3Q94A 1SW0A 4H4IA 4YMZA 2JKEA 4O15A 3FJLA 4LRSA 1J2WA 1KBIA 2KZHA 4Z1BA 3ABOA 3G1FA 4IMCA 3HMJG 4E2BA 3M44A 1LYXA 2EHHA 3LOTA 4Z1CA 4ZQRA 5AB3A 5LZLA 2GVJA 5FI8A 4AF0A 4OE7A 2A6NA 1IIHA 4DPQA 3HF3A 1QDSA 3MWAA 2BZNA 2C3ZA 3ELFA 2V82A 1FWTA 4UTMA 4PFMA 2NX3A 1A53A 1GVQA 3W1RA 3B03A 3O8AA 3CU2A 2QR6A 4K7YA 4UFLA 3W1TA 3BG9A 3GKFA 2Q3RA 3MI2A 2RDTA 2VFDA 4EWND 2DZVA 4O12A 1JQVA 4AEOA 4ICNA 4UTJA 4O1CA 1WQ5A 2NWSA 2BWGA 4QNEA 3G1YA 1HL2A 1GG1A 5EY5A 3C4UA 3PC0A 3EWUA 3O6CA 1XFBA 1H1ZA 5IBXA 3S1VA 2E5BA 2ZDRA 3QJAA 3G1AA 2TYSA 1LOQA 4LVGA 1ZJIA 1EWDA 3TIMA 1ONRA 1OHLA 2V0TA 4LVFA 4N9BA 5U4NA 3UZJA 3IIXA 2A5HA 2UV8G 1EPXA 1MXSA 2RFGA 4JTKA 4LVBA 3IIOA 3SFKA 3C3NA 5D05A 3T44A 4GWEA 5E93A 3GLCA 1S5TA 1MEWA 3S5OA 3PUEA 4FHAA 1FUYA 2P10A 4UMCA 5DXXA 4WQ6A 2NWRA 1OX5A 4UFIA 2X30A 4ZQNA 2ABBA 5G2IA 4GC4A 3W1NA 4W9TA 4WUIA 5DN1A 1YADA 5F1UA 5LGXA 3UWYA 5G4WA 4RV8A 5D30A 3W84A 1DHPA 3OEXA 3IIPA 2E68A 1AL8A 4MVAA 1GZGA 3M1ZA 3GNDA 4YCOA 3B06A 4XBKA 4MJZA 1M7PA 1QO5A 3BGGA 1QPQA 2OT0A 3G1HA 3HPSA 3G0SA 2OZ0A 4ORMA 3DI0A 2Y63A 2GJNA 2A6LA 4HIBA 1B4KA 3LV5A 4MIMA 3W7EA 3QC3A 1EUNA 2B7NA 4UTUA 4N4QA 2F7FA 5D2XA 4HPXA 1XM3A 3R12A 4TR9A 5D04C 2J9ZA 4JX5A 4AVFA 2A2IA 3W70A 4IMFA 1YXCA 4QITA 4JTTA 3KRSA 1XDLA 1R30A 1W5OA 4I7WA 3KVKA 4HPJA 4MY9A 3DFTA 1W3TA 3SI9A 3M0ZA 2Y88A 4FIRA 1EA0A 1SR9A 2XN1A 4MYAA 3P62A 2ZTKA 1LORA 1ZAIA 3QH2A 3TQKA 1C8VA 1XUUA 4JTGA 3W1AA 4UTLA 2QAPA 1RZMA 4NJHA 2ALDA 4DBEA 1TV5A 3DZ1A 4AHQA 3CQ0A 1JRCA 3W2UA 2GJLA 1TJPA 1L6WA 3GDTA 3MYOA 1PE1A 3EWBX 2QDGA 2E6AA 5TBOA 1SO3A 5SWUA 3E49A 3PSWA 5HINA 2VC6A 2X1UA 2AAMA 3W1XA 2PCQA 3KX6A 1FBAA 1FXQA 3M7WA 2J6XA 1OK6A 1GWJA 4DXVA 3F4NA 3TUUA 1DQXA 3QRHA 4Z0JA 2W6RA 4O4WA 3ABQA 3FS2A 5K9CA 2E09A 2EF9A 4MJMA 1P4CA 1FWWA 4E0CA 3PM6A 2YXGA 3FKKA 4LUIA 5LHFA 2Y7EA 4KFNA 4DO6A 1W5NA 3PBWA 1FDYA 1F7BA 1TJRA 4R33A 3TKFA 3LTSA 1WBJA 3VNDA 5K9DA 2YFOA 4N2YA 3NQ6A 3LERA 1TB3A 2VEMA 2ZCGA 3B0VC 5FF7A 3DKLA 2HTMA 1OFOA 3PB0A 4UCGA 1A50A 3TAKA 2CWNA 3T55A 3NQGA 5AOUA 1OFAA 2DP3A 1DJQA 3W7KA 3N19B 3W2JA 4WX2A 3G22A 5DBUA 3A21A 1DOSA 1KFLA 1R46A 3O15A 4MFEA 3BLFA 3GK0A 4EF9A 2CLLA 4YLWA 2YSWA 2VFGA 3RFAA 5CPNA 1OFQA 1AL7A 5EKYA 5AYZA 4Z08A 2OJPA 2PRLA 1CI1A 4TO8A 2A1YA 3WK2A 3NVTA 1KLZA 3C2EA 2F84A 1AG1O 4MPQA 3NQEA 2C0AA 3HG5A 4O14A 3NQ7A 4JICA 1RPXA 4MOZA 3L0NA 2CZFA 3NNTA 5CZSA 1PS9A 4A22A 3EXSA 4O0KA 5KZEA 1WDWA 5AHLA 4I9AA 2GOUA 1J4EA 1EP2A 3MJYA 1GVFA 3WK1A 4LVAA 3BG3A 1F5ZA 5G2HA 3JS3A 5AHEA 3ZR4A 3MHFA 3TSDA 4LVDA 4FNUA 3GAKA 4FX6M 2E77A 3W76A 1I2OA 4EF8A 3WJYA 3HOJA 5FF4A 3P5ZA 1ZY9A 3NZ1A 2Y7GA 3PBUA 3V75A 3WJSA 3HG4A 3O16A 5KZDA 4PL2A 3EKLA 4XKYA 5EMUA 1T8XA 1AMKA 4Z1DA 1BTMA 3NXFA 3CPRA 2EPHA 1KFEA 1WAUA 2J88A 2NXGA 2YR1A 2CZ5A 1G4EA 2JKPA 4NU7A 1N8FA 2CLEA 2WV8A 2AGKA 3CWNA 3TU9A 4GUGA 3R8RA 5CZTA 2DU2A 4U28A 4FF7A 3PBVA 1CX9A 5D37A 1H51A 2H90A 3W1QA 1R2RA 3GZ3A 3PG8A 3I65A 4HSOA 4NQ1A 3W07A 1OF8A 1JVNA 1N55A 3NL2A 3LCGA 3PF3A 3B04A 2DZTA 4JX4A 3EX6A 3OBKA 1SSGA 1NSJA 2QCFA 2QJIA 4QAIA 3NA8A 3DI1A 4IPIA 4UTTA 1H50A 2A4AA 3HGRA 5E0KA 2ISWA 2OX1A 3LHUA 1DJNA 4RZ4A 1OFEA 1JCYA 3W7IA 2V30A 4PA8A 3OG3A 4NNCA 4JYEA 4M7TA 2Z2UA 1NVMA 1WYIA 3W23A 3N3MA 3W7CA 2WNZA 2J27A 3S5NA 5F2IA 2O7QA 3FIGA 2VEKA 2VXNA 5FESA 4QIUA 1SZFA 3CEPA 1TTPA 3B05A 3C6CA 3DBPA 1K8ZA 1KFKA 1LBFA 3UYCA 4WY0F 1H7PA 1TTJA 3W7QA 3PBYA 3C52A 3T78A 5CKSA 3S0CA 2Y70A 5AN7A 3EXTA 4M6VA 1CW2A 1LBLA 3BW4A 3NAVA 3LV6A 3PB2A 4M5PA 2G5WA 3FLUA 2YYUA 4IJBA 4UFHA 1MO0A 4UFJA 3IGUA 5DCEA 4ADUA 3CM4A 3M9YA 3GB6A 3STGA 3C2FA 2X16A 3EX3A 3OIXA 1LROA 5I3FA 1LP6A 2FDSA 3W7DA 4JGDA 2WQPA 3RLVA 3W72A 5KITA 4Y90A 1I45A 3MBDA 3VCRA 2BSLA 4IUOA 1PHQA 3RK8A 2V5LA 3F03K 2DJLA 4HNTA 3I68A 3UD6A 3W2NA 3MUXA 1OYBA 3NL6A 3UXAA 4FNSA 1M7OA 3M47A 2I9EA 4FEZA 1H7NA 4ZL1A 4AWSA 4JN6A 3LI1A 1ZNNA 3HGSA 3MYPA 3JRKA 3M43A 3IEBA 3AJXA 4N9DA 3TSBA 4BWLA 1V5XA 4AHPA 1KA9F 1XKYA 3LB0A 5HJLA 4IXXA 1K03A 1W0MA 3P7YA 2PRMA 3W3OA 3SIZA 3TAOA 2ZFAA 3QMSA 3ABRA 1ME8A 1JCMP 5K2ZA 4N6EA 2HSAA 5HR7A 3NQAA 1JRBA 3CWOX 4Q33A 2RH9A 2DZUA 2ZZ6A 3KXQA 2NUXA 2YZRA 2RDWA 5HUOA 3STFA 1H63A 3L2IA 4JD4A 2C1HA 1X8FA 4O17A 3N9SA 4DQWA 2QCNA 3NQFA 3BV4A 1QOPA 3B4UA 3W1UA 4XWUA 1D3HA 1OX6A 5FEPA 5T26A 1HUVA 1TPC1 3GYEA 1EEPA 2QCLA 2TRSA 3O06A 2ZA3A 3HGJA 3DU0A 4JYFA 2VEIA 4PTNA 1NF0A 4PEKA 1AW2A 3LI0A 3QQ1A 4O57A 5U7SA 4FIQA 3TSMA 1BWLA 1FCUA 1W3IA 5BRBA 2J9YA 1TO3A 4WXZA 4JS3A 2FQIA 1NFBA 4UTIA 1RR2A 1YDOA 3PULA 3SGUA 3ZS4A 1X1OA 3W75A 5BNKA 4LW7A 2A7NA 1NF7A 4K8HA 1SFLA 1O5XA 5CZ0A 1VS1A 1PCKA 3A22A 3LCLA 3R89A 4NNAA 2YYTA 4X3ZA 4NXKA 4ALDA 1LLZA 5HWMA 2B7OA 3W7PA 1TPWA 4WY0A 2QUUA 4RLIA 2C14A 1SZNA 3FKRA 3N2XA 1FCQA 1P0NA 3ZWTA 1B4EA 3DHDA 4HSNA 1A5SA 2ZZ3A 1XCFA 2WSRA 1HTIA 1VLIA 3CB8A 3KVLA 4RK8A 5C54A 1RQHA 5EL1A 1K7EA 2C6QA 4XTDA 1W5PA 1ME9A 3KOFA 3BW2A 1V7YA 3W83A 1YPFA 3CC1A 4NJKA 5G2WA 3UZ5A 3GDKA 2ZZ1A 1IXPA 1Q6OA 3TC6A 1P0KA 3N9RA 3RNDA 3U6WA 1SO4A 3NO5A 1G69A 3HGOA 3EEGA 1FDZA 2CLMA 1PL9A 2NUWA 6TIMA 3TQVA 3ATZA 4DF1A 2Y7FA 3P67A 5EPDA 5FF0A 4XQ6A 4IX2A 3C0JA 4IPJA 3G24A 1W31A 3RF9A 3E12A 3UWZA 1OG0A 4JTJA 1GT8A 2ATSA 1W8SA 3IVSA 2VOMA 5I3JA 2ZRVA 4ZQCA 3UY7A 1F05A 3VE9A 3QZEA 3NQCA 1PV8A 1W5MA 4O4VA 3LCFA 1JCJA 2YDAA 3O63A 4KKXA 4CQAA 3PAJA 4NXSA 1SQ7A 2JBMA 4Y6GA 4GUJA 1W5QA 4K8EA 1HO1A 3Q2DA 3L66A 4JTIA 1FCBA 1W1ZA 1GTEA 1W56A 4HNUA 4UTWA 1H5YA 1Q45A 1THFD 1VPXA 4OQVA 3TFCA 2A85A 2Q8LA 1YLVA 5KSWA 3NM1A 4Z1AA 1VZWA 1WBHA 1MSSA 5CG7A 5K4ZA 1L9WA 3UQNA 4KFPA 3VFLA 4O18A 1G67A 3ANYA 4MZYA 4O52A 1LDCA 1M6JA 1P5BA 3QF0A 4HNNA 1W54A 3BW3A 3O05A 1FWRA 3AO0A 3KVMA 5D2WA 3HG3A 4EIVA 2I14A 4L4MA 3IRDA 1U83A 4LNYA 4GFSA 4GXMA 1TPUA 5AYXA 1GVSA 1QPRA 1C29A 1X1ZA 2ZZ4A 3W1MA 1UASA 1YTKA 3SECA 4NJIA 2HMCA 1AW5A 1LBMA 2Z0IA 3F1QA 3HIJA 3NQMA 3P61A 1PVNA 1G4PA 4S2BA 4AWUA 3THQA 3R2GA 4UNLA 5FEZA 2FIQA 4O16A 5C6MA 2R94A 5E1QA 3I6RA 4E38A 3CIXA 3SR7A 1OVDA 3T40A 1Z48A 1WX0A 3QFEA 3L9CA 2ZRWA 4YCPA 3OHIA 1KV8A 3LCHA 4XKYB 2ZRYA 1SSDA 2DORA 2QDHA 4MKNA 5EA9A 1VCVA 3EWYA 4I7VA 1DBTA 3EWZA 1QAPA 4Y8FA
chains in the Genus database with same CATH superfamily
1ZBCA 3VOJA 3TTQA 5I77A 1M04A 2BBFA 4UR9A 4XO7A 3GFZA 2VWTA 4LBSA 5H2ZA 4CNOA 1JDDA 4G6CA 3LLDA 2OYKA 1EX5A 3AIBA 4JNZA 3DUGA 4NL1A 5HQEA 1GVEA 3W22A 4FAMA 2YL8A 1XBXA 1TQJA 4XX6A 1QTWA 2BY1A 2CZVA 4EPEC 4PMQA 4IISA 1X97A 2R14A 5CGTA 2VR2A 3RIKA 3H22A 3VGHA 2RJGA 4OJYA 5LNWA 2CC0A 2VGGA 5B7ZA 3GC2A 1CGYA 1IF2A 1RD5A 4A8IA 2C8NA 1E0WA 3LRMA 3SQSA 4FNPA 4E4PA 1KQZA 1E4MM 1GOWA 3JR2A 4PCFA 4GY0A 1TELA 2B4GA 2VKZG 4N7QA 5HK4A 3WJZA 3CIWA 3QMTA 2R24A 3F4WA 3OJGA 5MKGB 3THAA 5DMYA 4JY9A 5BOOA 5DY3A 4UZUA 1JNDA 3K4DA 1F3XA 3WK3A 3AIWA 5HNNA 1J2BA 2GUUA 1S2AA 4MLRA 4L65A 2V2DA 2BNJA 4IJRA 1OIMA 1MW3A 3A4AA 4L1GA 4G9PA 8RUCA 1U5HA 4TMCA 4QCEA 2PGEA 5LIKX 2GVLA 2NT0A 4EOUA 5A6KA 4UOJA 2Z6IA 4S3AA 1CGXA 1PO9A 4XAFA 4YTQA 3W87A 1G7VA 2LLEA 4XB3A 2CNCA 3TYCA 4Y2WA 4CNUA 1F8IA 4GE8A 2VD9A 1E6RA 1EB3A 2G96A 1XIHA 3N9KA 1OZMA 3QM3A 4NZJA 5DMLA 4WKFA 2ZXAA 4RNIA 1W9PA 1RVGA 1FDJA 4LJ3A 5HNRA 4IIEA 1K6AA 3QSRA 1I6NA 1HKKA 3EX4A 4BI5A 3GDMA 3G3DA 3S6DA 4IGNA 2JIWA 2F6XA 1DJGA 2UBPC 3BLOA 1VH7A 5I79A 2V3GA 2Z1BA 2YX0A 3G1DA 3CAWA 4NVTA 3N4FA 4G7EB 4MUZA 2XIIA 3MCOA 1BXNA 1TTQA 5T91A 3HB9A 4PCTA 3NJ3A 2OX4A 5IDIA 4PN2A 1TJ1A 3TJXA 1ZHAA 4YU1A 2G3IA 3DX5A 3FYPA 3BAXA 1CNVA 2XIBA 3NDZA 1K8YA 4K38A 2X1SA 1UKPA 5A8QA 1JXJA 1D7KA 1E40A 3B8IA 4DJEC 3EB3A 3EMCA 3GHSA 3XINA 4B3KA 4IL0A 1YW1A 3TONA 4REQB 1JUKA 4D8ZA 1GVRA 5FOOA 2GJXB 1F74A 4L6HA 4XZMX 1ICSA 1J6PA 3ES8A 3RN6A 3FAWA 2ATMA 2D3LA 1XDJA 2CKRA 3DHPA 1Y5WA 2HVNA 1NEYA 3MKCA 3LCXA 2HS6A 1AW1A 4GYFA 3PUOA 4CQ9A 3NL3A 3OVRA 2I7GA 5LNVA 1U1HA 1GQNA 3TVAA 2OZ3A 3LX9A 2FZ8A 1O5KA 2GQ9A 1W2PA 4PSPA 1XP3A 5JBDA 3VKBA 1UJPA 1J8VA 4GVIA 3GXDA 1W37A 4FXSA 5HANA 4N9CA 1K9EA 4GQRA 2WVSA 3QPYA 3UR2A 4P2VA 1XQLA 3AZRA 3GO2A 5GVJA 3NEVA 3AXKA 3QYSA 1TRIA 4YIWA 3ES7A 3E9AA 3GH7A 4OFCA 3QKEA 1JQXA 4WDUA 2P88A 1CECA 1CXLA 1E1EA 3HM7A 5DRCA 3WK0A 2XFWA 4Q4KA 3D5HA 3SSJA 1Q4NX 2VD8A 1FWIC 1A5MC 1UZ1A 4DO5A 1Q13A 4FX7A 4FNQA 5CCZA 3W7RA 3G3MA 3VIKA 1TV3A 4H7CA 3ARXA 4RR4A 1PIIA 4F4RA 2A3HA 3VOGA 4F3HA 2CW6A 1GORA 1KD0A 3LBOA 2ZX8A 4KWWA 2EO7A 1EJWC 2YFNA 1WA3A 1H49A 1ICPA 1OBAA 4RX0A 5LSMA 1IGSA 4AYGA 4JIPA 3C56A 4HPNA 2DW7A 2DZXA 1OFBA 4ZCWA 1YRRA 1L6GA 4U10A 4US6A 3V1HA 4R53A 1GEQA 2EXOA 4XD4A 2V8ZA 1UUMA 4JAWA 3ARYA 1OJXA 4GNVA 1F6KA 5FA5A 1GG0A 4H2HA 3LHZA 1YPIA 2JK2A 3BGJA 3A5VA 1TRDA 4QSHA 3PK7A 2CLKA 1T8QA 1XLIA 3K13A 2A0NA 4ZFMA 1FCVA 2DT3A 1L6SA 5A8GA 1XIDA 3AU2A 3INPA 4JNMA 3VNMA 1JPDX 6ALDA 2PDYA 3GC5A 4TMBA 1KM1A 3N2BA 2PBGA 3S1UA 5CZJA 3ABSA 3PTMA 3CNYA 3VOIA 2CFFA 5D2VA 2HQAA 2QXWA 1UKSA 3IARA 4GA8A 1HKMA 2ACQA 1KFWA 1SZEA 5CPQA 3P84A 3GU1A 3W81A 4FX8A 2ZUVA 1LOLA 4JY8A 3BURA 4QJ4B 4HYRA 1VFTA 3CMFA 4GUHA 4NILA 4M6PA 1BQCA 4GFIA 3ID7A 4CCCA 4JTQA 1EF2A 1VYRA 5AY7A 1NH6A 1EGZA 3CAKA 2G37A 2IPFA 1E15A 2C79A 3VD4A 3VE7A 2WHLA 2R8WA 4PUMA 1XINA 1KM2A 1YBQA 1L2UA 4P8UA 3W7GA 3VOHA 1VQTA 4NZFA 5F1VA 3RPMA 4XAZA 3VZZA 1HW6A 2XH4A 4C6EA 4RE3A 1HKWA 1GJUA 2PLJA 3MHUA 2PC8A 1GEHA 3QY7A 3N13A 3P6LA 3A23A 1R3TA 1TA3A 1TV7A 9CGTA 4PZVA 1OX4A 1NDZA 1KXQA 4TVDA 3CH0A 4RDZA 3QZ6A 1PCWA 1Y0EA 1XXXA 1PDZA 1RD6A 3MUZ1 3ZR5A 4C5ZA 1TV4A 1QT1A 4GD0A 3CGTA 4Q4SA 4WSKA 1JZ5A 3VOFA 4LTSA 1ZS2A 1PTAA 3C2OA 1NOUA 3CPUA 1IIGA 1JULA 2ZRUA 5FEXA 3MKKA 1E0XA 3A9IA 4GMEA 3OGSA 3RMJA 1DE6A 1R7AA 5HUPA 3OLDA 4NYUA 1EZ2A 4LH8A 4Q8TA 5AC6A 2QGYA 1RQBA 3BH4A 3KL0A 1QCWA 1OK4A 5HPOA 2XIMA 1FVPA 4HP5A 4HZ8A 1B3OA 2OO6A 1XS2A 3WQGA 3SSZA 3N12A 1PAMA 4XZBA 2FB2A 1E56A 1QU4A 1ADSA 2VCBA 2J9XA 2DIKA 3IJ6A 3TNBA 1JDEA 4RNHA 4P7QA 3WQFA 3G0XA 3PJUA 2I5IA 1XUZA 1I4NA 3NSXA 4BQ3A 5ABGA 1G6CA 3KTXA 4IMGA 2Z1WA 1MEIA 1P0EA 4QISA 1QOQA 1XPGA 3PBMA 5GQBA 3LXBA 4N9EA 2AL2A 1FWGC 2DEPA 1PIGA 4GKLA 3A9BA 4D9PA 4U2ZA 4BI6A 4TVUA 4UTKA 2QCHA 2JEPA 1FHUA 3PPGA 2PDXA 3EAUA 2DSKA 3SUWA 3UJEA 2B7QA 3RR4A 4S3EA 6CGTA 2QKFA 1P7TB 2HNHA 2CIPA 2QV5A 1WOBA 4HTBA 4N0RA 3VNYA 4IT1A 4NX0A 1XBZA 3SO7A 1J5TA 4JEQA 4JTRA 3W71A 2BV9A 2Q3OA 3RDKA 3V3WA 3C0SA 1BWKA 3KLLA 4JYDA 5BU6A 4K68A 2PB1A 4DN1A 1LRQA 4AYSA 2NLYA 3CQHA 1B9ZA 1UWQA 2VELA 1UC4A 2GDVA 2XN2A 2BVWA 3B8WA 3BLPX 1JDAA 2MANA 2GJPA 3T05A 1BD0A 3SY8A 2Y8UA 3UWQA 1J11A 1S46A 2P1FA 2OYMA 4EXQA 3IV3A 1KFCA 4OV9A 5F4SA 1Z42A 3N18A 1KM4A 1YDVA 3C2RA 3PNZA 4R7JA 3D3FA 1TWIA 4L9XA 4F9DA 4IH3A 4C1NA 1E4NA 1JZ6A 3DFNA 1P48A 4F0MA 1E1FA 1UB3A 2WVVB 4HHPA 4M7SA 4LC6A 1RBAA 5LHEA 1DYSA 3RM9A 1UROA 5HATA 1IXQA 1C90A 1YXYA 3MI3A 4C90A 1FWSA 1V0NA 4RXGA 2ZVRA 4MKVA 4PMOA 4JL2A 4X9SA 2QYGA 5HQLA 1EIXA 5T9CE 3UWUA 1R3RA 1YHTA 1P43A 1VJIA 3QTGA 4QE4A 4UMAA 4UWMA 3U9IA 2QAFA 3VGBA 4DZ5A 4DELA 3R79A 3G8EA 4QDWA 3GVGA 1E0VA 3MUAA 4KPLA 2FVMA 2E40A 1NU5A 3WBXA 1I2PA 4JN8A 3QV7A 1JYWA 1PYMA 1BVZA 1FFQA 3N2OA 4Z2KA 1QW7A 1Q3NA 4H9XA 4XZLX 5CJMA 5KZ6A 3VGFA 3CHVA 1POJA 1ZUAX 1N7KA 3AIEA 3A6OA 1KQYA 5FD0A 1H61A 2BTMA 3EWDA 2G3FA 3W0KA 1SFJA 1C9WA 4I6VA 1J0ZA 2BXZA 3TK7A 3TDFA 2VDHA 5EFDA 2VENA 5FF3A 1LCOA 1NDWA 5DCBA 3CHEA 1K77A 1TV8A 2VURA 5TAOA 4UXDA 1SR0A 3J7HA 1MVYA 4FO4A 1F3WA 1EWEA 3BDKA 4I90A 2VYOA 5JQ9A 3KTSA 4IF2A 3NXLA 3S8HA 2E25A 4BR1A 3KL5A 4WF7A 1AQFA 1C9DA 3LCIA 1JCNA 3N6JA 2XFFA 3VIIA 4M29A 3URBA 5H8MA 1TPVA 3QV8A 3FSTA 3O9NA 4GVHA 5K7JA 5H1WA 2VC9A 1W9BM 2CLHA 4DUOA 2Q09A 3AMKA 3NGFA 4UTFA 4C6LA 2PWHA 2TAAA 3IK4A 3IUIA 3BOXA 3E96A 1NP0A 4WDWA 2Z00A 5G1MA 5HBFA 3F4CA 3LD5A 3PZOA 3DAQA 5D33A 1EC9A 2H3DA 3TQPA 4UMBA 2XIOA 2Y0FA 3A4WA 2XWEA 2VWSA 2DIEA 3O07A 3EWXA 4XD6A 3TCEA 2Y61A 3CV1A 3COTA 3D46A 3O3RA 4K1GA 4YN5A 3GH4A 4BFAA 3SQMA 4W87A 2F9RA 1XISA 4IOTA 4GGBA 1EKOA 2YDQA 3TA6A 3QHMA 1H62A 3LHVA 4I7UA 5DXYA 1HN1A 4LBUA 3GIPA 5J5DA 1DPMA 1XH2A 2ZWYA 2JGYA 4WGXA 3S2LA 3DFSA 1Z6KA 2Y5JA 3LK6A 1A0EA 1KCLA 2HRWA 3TJ4A 5AC7A 2BOGX 2JIEA 1RJRA 4IFKA 2WMIA 3CEUA 1G94A 3NZPA 2FFIA 1C8XA 3F5KA 4Z2JA 1EJTC 3N6QA 1OFRA 3WUBA 2J62A 1ZJBA 2WZIA 1QR7A 1VKFA 3NQVA 4M80A 1E5JA 3WMCA 6TAAA 3GDRA 2WKJA 4GG9A 1QPOA 1RBOB 4DUXA 2EEXA 3PTQA 1S2CA 4HBKA 3W6LA 3FXGA 4ES4A 3C61A 4FLRA 1M53A 1TZ7A 3CZGA 4OZOA 1WB0A 4XKMA 4TX9A 1VFOA 4W84A 3EKZA 4JN7A 4FLSA 2R1MA 4L1XA 4LF1A 4O19A 3MP5A 5BXSA 1L0PA 4LRSA 4TOQA 5E6ZA 2PLCA 1UZ4A 4B92A 4LUTB 4IMCA 3EOSA 4J28A 1ITXA 1GOMA 4E2BA 2EHHA 3LOTA 5H6HA 4ZQRA 1VRXA 2J7EA 1Y7VA 4ZOBA 3BCJA 4Q8WA 4DJEA 1BRLA 2A6NA 1IIHA 3ITGA 3PPFA 2P0IA 4DPQA 2IQDA 4W7VA 1E4IA 1Z9AA 2YZ5A 3ELFA 2C3ZA 4LAMA 2VT0A 2NX3A 3B03A 1KXVA 4CD4A 4BQ5A 2QR6A 3MI2A 2GSHA 2VFDA 2DZVA 4O1CA 1WQ5A 4P8WA 2BWGA 3G1YA 1HL2A 1EYEA 3EWUA 1XFBA 4AQLA 3OU8A 4OVXA 1TVLA 2E5BA 3G1AA 2TYSA 1ONRA 5BWAA 1A4MA 4LVFA 4KGJA 2J78A 1MUCA 3POHA 5U4NA 3IIXA 1ITUA 2VRKA 1MXSA 4LVBA 4JHZA 3B4YA 3FEQA 5FJRA 2V38A 4HCDA 3S5OA 2PCEA 3IJ9A 3QVQA 4GPNA 3U57A 3GBEA 4NP7A 3L4UA 3OW1A 3RCNA 3H4GA 3DYPA 2OYLA 4B5XA 2X30A 4ZQNA 3VTRA 3BTNA 1VIWA 5G2IA 3UCDA 3L2MA 4WUIA 3EGJA 3RYSA 3UWYA 1VP5A 3V35A 2GFTA 2QT3A 3MMWA 1DHPA 3IIPA 4LAOA 2A3CA 3WLHA 1E43A 2JF7A 1KKRA 2PPGA 3B06A 4XBKA 5HDRA 3PANA 3IWPA 3DC8A 3G0SA 2OZ0A 3DCPA 4Q4MA 2GJNA 2IKIA 1EFZA 4IIFA 5DX7A 1C91A 4MIMA 1JYXA 1EUNA 2PS2A 2H9AB 3R12A 5D04C 2NV9A 2A2IA 4L7ZA 3W70A 4KIRA 2WVTA 4JTTA 3GW0A 5AC5A 4M1RA 4AZHA 2WJEA 3MB9A 1H4PA 4QP0A 5CBJA 2G3NA 1QNOA 2QAPA 1RZMA 4DBEA 3KOZA 3M0HA 3UFYA 4PR4A 4DY1A 1GKRA 3UG8A 2EBNA 2QDGA 1MW0A 1SO3A 5SWUA 1EDGA 3E49A 3CQIA 2L5HA 3PSWA 2E9LA 2X1UA 2AAMA 3KX6A 1C3FA 1FXQA 4L64A 4MADA 3M0LA 4TV6A 1NTHA 3EPMA 1TMLA 3EYPA 3TUUA 3ICJA 3BZJA 3DBNA 4B9YA 1TR9A 4MJMA 1BWVA 2C91A 2AMGA 3FA4A 3QHOA 4B2DD 3MT1A 4JFTA 1AJ2A 2WC7A 3FHQA 2W9MA 4E0CA 4J3ZA 3LPGA 2Y7EA 3WCZA 5I6SA 1VENA 3PBWA 1EF3A 4HK5A 3AWNA 3ARQA 3TKFA 2CERA 4D6DA 3NQ6A 1TB3A 4JHMA 2ZCGA 3GR4A 4DVOA 4E6MA 3ABXA 3TZFA 3DKLA 1OFOA 5ECVA 4MNKA 2V3DA 2OFJA 3NQGA 2VZUA 1FA2A 5JMUA 2Z26A 1FRBA 1OFAA 3MZ2A 3N19B 4PMDA 2HVOA 1TX2A 4J4KA 1OM0A 3TTYA 1ZSXA 3OQEA 3T6CA 1VBRA 3CV7A 1CIUA 3RFAA 4CN4A 5CPNA 4M3PA 1ODZA 3QR3A 4AVOA 3POCA 4Z08A 2OJPA 1CI1A 4TO8A 2PWGA 3WK2A 3MSRA 3LNMA 4MOZA 1U33A 1DIKA 4QEHA 5CZSA 4HNOA 3BC9A 4A22A 3EXSA 3LPFA 1OB0A 3F4DA 1WDWA 3NOYA 4I9AA 2QQ6A 1J4EA 1EP2A 1GVFA 3DFYA 3K1DA 1TX0A 3S9ZA 5G2HA 4AXNA 3W82A 1EOKA 2WMFA 4R5EA 3A3WA 6A3HA 2MUCA 2V5DA 3SCNA 4PMVA 4J3WA 4NASA 2OO0A 1UP2A 4DUVA 2F6KA 4FR1A 3VIGA 4U33A 3V75A 3HG4A 1PXGA 4FALA 4IIDA 5KZDA 4NKCA 3PJTA 5JUVA 3V36A 4F2BA 3WH9A 3VD7A 1U30A 2EPHA 3KP0A 1WAUA 2NXGA 2YR1A 3SCWA 2OQHA 5E5CA 1G4EA 1N8WA 1N8FA 3TU9A 2WV8A 4INFA 2DU2A 3UG5A 5D37A 1H51A 1R2RA 3WL0A 3B0XA 3W07A 1OF8A 2FYMA 3A12A 1OT2A 1VF8A 3EX6A 1SSGA 4I5RA 1VBUA 4XAGA 1CWYA 3A64A 1EO7A 2J77A 3DI1A 3T2QA 4GZ7A 5XIAA 5I3DA 1CGUA 1XIFA 1H50A 2A4AA 4HYWA 2ISWA 2WC4A 4RZ4A 3T4WA 3W7IA 3LMYA 4L6DA 3LLXA 4NNCA 2J7GA 1JPMA 2YBVA 2J27A 4O1FA 5F2IA 1AMYA 2D69A 1YX1A 3KE0A 3IACA 1TTPA 1UH2A 1KFKA 1XD1A 1E55A 3LENA 4I9TA 5IDZA 1AZ2A 1F8MA 3BW4A 3NAVA 3LV6A 1SGJA 4WKAA 4M5PA 3FLUA 3APTA 1JAEA 1HJSA 3TYZA 3OVGA 3BSHA 4DM2A 4GC3A 4Q8NA 5DCEA 5JVLA 2J8GA 2XYLA 1MUWA 1W3KA 2X16A 3OIXA 1LROA 5I3FA 2PDMA 1LP6A 2W27A 4JGDA 1XGZA 3GNOA 5AC4A 2PZNA 2XHYA 2E8ZA 4QAWA 4HNTA 3UD6A 3UXLA 3SY1A 1P1MA 3W2NA 3MUXA 4XAYA 4J3SA 4FNSA 4F2TA 1TA3B 3M47A 4FEZA 1UYQA 3BAKA 4HZMA 1J0KA 3WD4A 3BCFA 3IEBA 3XIMA 5LIYX 3APGA 1LT7A 1KA9F 3L23A 5HJLA 2BVDA 1XGEA 5A8PA 3SBFA 3ABRA 1ME8A 5E70A 5EU9A 3WLNA 3BAIA 5HR7A 7REQB 2DZUA 2DH3A 1W1VA 2NUXA 2YZRA 4A35A 2WW5A 3QZAA 3STFA 4JD4A 3N9SA 3NQFA 1BSLA 3UERA 3R25A 2G3JA 3W1UA 4XWUA 1ONXA 2ZKMX 3GYEA 2TRSA 1PBGA 3HGJA 4GXPA 4I8YA 4OTKA 4W85A 3QQ1A 1Q66A 4B5SA 4FIQA 5GNYA 2GJRA 4M82A 4BS0A 1W1YA 1TO3A 1QUMA 3PULA 3W75A 4NYYA 1NF7A 4K8HA 1O5XA 4XZNX 1VS1A 3LSCA 3RM4A 3VC5A 4B5WA 3MDUA 3A22A 5BZAA 2ZXQA 1TZ9A 4ALDA 2EG8A 3W7PA 1CT5A 2QDDA 3CH9A 2MNRA 1K9TA 3E2QA 4WY0A 1JIBA 2FDMA 1SZNA 2XPKA 1VFSA 1FCQA 1MXGA 3KOYA 3ZWTA 2JEQA 4DBSA 4L56A 4RK8A 2FGZA 1K7EA 4XTDA 1W5PA 4DYJA 3KOFA 1UH4A 1V7YA 3P93A 4FPSA 4NJKA 3UZ5A 2ZZ1A 2XWDA 1WDQA 3U6WA 3GUGA 4F0LA 3EEGA 2GGEA 2X1IA 6TIMA 3RHGA 3TQVA 3ATZA 4XAPA 3P2VA 5FF0A 4IX2A 5I7GA 1PX3A 3E12A 4NRRA 3UWZA 1OG0A 1E71M 1Q8AA 1GT8A 3WSUA 2ATSA 4EE9A 1XYCA 3OZOA 2DH2A 3IVSA 2VOMA 3W26A 2ZRVA 3UWEA 3QZEA 3NQCA 2E28A 1W5MA 3LCFA 1JCJA 4NXSA 5CEWA 2OGYA 5AYIA 4PMXA 4Y6GA 3Q2DA 3L66A 1HQTA 4P7NA 2XVNA 4H9ZA 3TN5A 2HNEA 4E4UA 1VPXA 4WVXA 4DLFA 2A85A 2DFAA 2Q8LA 3NM1A 2F38A 2XH7A 1VZWA 2PD9A 2PEVA 1WBHA 1CLXA 4O18A 3ANYA 4O52A 1IEVA 1AFSA 4PMUA 1M6JA 4C1NB 4HNNA 1E3ZA 3O05A 4CD6A 4IFOA 1V51A 2C1IA 2I14A 4L4MA 1U83A 4LNYA 1W2VA 1XLGA 1W1IE 3NO3A 4C6IA 1X1ZA 1CGTA 3MA8A 2G8ZA 1XIGA 4MUPA 3VD9A 3S1GA 1LBMA 4L1WA 3F1QA 3NQMA 1G4PA 2OPJA 2PDQA 4NZ1A 4O16A 1V0LA 2E7FA 3DYMA 2D2HA 3CIXA 3B9DA 3SR7A 1XGDA 4FOUA 2GGIA 3RX3A 3AU6A 3T40A 4V1XA 2QS8A 2ZRWA 1FHDA 3OHIA 1KV8A 5EA9A 1VJSA 3G6MA 1VCVA 5HA7A 1DBTA 2VRJA 3KEHA 1M7XA 2FPTA 3P82A 2PLMA 2PWFA 3PFRA 1I1WA 4RNFA 4TXEA 1TCDA 1LOSA 4WXYA 2QUTA 5AHFA 1NDYA 5LIUX 2QCDA 3HG2A 4O13A 4C6CA 1SPQA 1T7LA 3AI0A 3B9NA 1IGWA 2PGWA 4MWAD 4RE2A 1JR1A 3H53A 3M16A 1RP8A 4UTTC 2C16A 3UU0A 2FPYA 5C7VA 4A3RA 1ZL1A 3VXGA 2J24A 3K5XA 4UIOA 1UOKA 2GVGA 2FVLA 1RK6A 1SM9A 3ABZA 5F4WA 3W7HA 2BY2A 4O8AA 4F9JA 3KOXA 4Q6XA 3SRFA 1B3VA 2I16A 2OKTA 4RXFA 1UIPA 1PDYA 3FK4A 4UB9A 2E6DA 4A3UA 4BEQA 5A2BA 1REQB 1XYLA 1F2JA 1NJJA 2VDIA 3UZWA 4AWTA 1UD5A 2OEJA 4AW7A 3STPA 2GVEA 4LU0A 4JTLA 2PDLA 3P74A 5CBBA 2XH0A 1XH1A 3GD6A 2X2GA 1K8XA 2GZXA 2P76A 4HSHA 3FOKA 1DP0A 3H7VA 3CO4A 3AICA 4L4PA 1TE1A 3BJFA 1G1YA 1XC4A 2E6YA 2PD5A 4L5ZA 3WBAA 4CQDA 2W92A 1S2TA 3W01A 1T6MA 2CCRA 4MNLA 2BLEA 1AVAA 4B9ZA 4X2RA 3LCWA 5L9FA 3USZA 2X0SA 3TROA 3URAA 1R5YA 4GCXA 4R34A 3NOEA 4NF7A 3EOEA 1RCXB 3CUHA 3SCOA 5HJXA 4GO8A 3VDCA 3BOFA 1WNOA 2YL5A 4JIQA 2WSQA 4XUYA 1H60A 2V3FA 4TU1A 3UA3A 2J7DA 2CETA 4FS9A 3I3BA 3EX1A 3MWCA 4GZEA 4C7FA 3AFBA 3GX9A 4ZSUA 3RLUA 3BJTA 4HOXA 2VO5A 1R3YA 1ZBVA 2WWCA 3LM7A 2XVKA 2BHYA 4JDYA 3DERA 3BGAA 5DT5A 1TSIA 4NY2A 1JXKA 3M0KA 4GH3A 4YHEA 4HHHA 5B7YA 2CZDA 1UZHA 3C2YA 4DBWA 2VX5A 2PURA 4L61A 3OBAA 3QHNA 2BGSA 3II1A 4MB3A 5D03A 4ERGA 1KNWA 5E0CA 4DZHA 1GVYA 3CB3A 4AUBA 4MF4A 1W3JA 3PUGA 5CG0A 5CXPA 2PGFA 1GQIA 3LHYA 2V6AA 4BF5A 5TQLA 3QN3A 4A2SA 3Q58A 2J7FA 1FWEC 3UR8A 3ZMRA 2G0WA 3G1XA 4H9YA 1DVJA 3ARSA 2GVYA 5EYWA 1GJPA 1WKEA 1BXCA 3BAYA 3BK0A 5H8PA 1ZRQA 3L5MA 2P50A 1NOWA 2BOEX 2WANA 3UP8A 3BE7A 2A7RA 3E02A 3WNNA 3FCPA 5I02A 3NSNA 3H55A 3EBVA 4GVGA 4HQVA 3Q37A 3F2BA 5AC8A 3THUA 4ASTA 3RCYA 1SZGA 3L5AA 1QFEA 4TTUA 2PGRA 3WJWA 2GQ8A 4H8VA 1V6VA 4JQAA 1L8PA 3TV8A 4IMDA 3OOQA 3P60A 3EEZA 4R27A 4XD3A 1XV8A 1Q7MA 3JZUA 4E8DA 4U3AA 1D3GA 2BMBA 4CCZA 2FH6A 3N4EA 4H9MA 3WF0A 3KZPA 2PWEA 2ZRZA 9RUBA 4E2DA 1GOXA 2DVUA 1RLDA 1US2A 1RY0A 2YCEA 3HU7A 1F9CA 4Y9AA 1JPHA 4RPPA 3RO6A 3ITCA 1KXTA 4F2UA 2NZLA 5GNZA 3CUIA 1MWOA 2CPUA 3THDA 4CNNA 3WFAA 3MMTA 4N6FA 1O60A 3NG3A 3FSUA 1MQPA 1FWJC 3MO4A 3ZJ8A 2REQB 4XBSA 1PEZA 1Q6FA 1OF6A 2H3BA 4UR8A 1XRTA 2QCEA 2YDSA 3CHDA 2ZWZA 2RUSA 1ONEA 1CLVA 1ZJAA 4NI8A 4I3GA 1UA7A 1TTIA 3DFQA 1UWTA 3L67A 2XH2A 5HMEA 2QF8A 1CGVA 2ASHA 2BFGA 5BXPA 3L0GA 4ZQMA 3NQ2A 2GWNA 2OCZA 1S5MA 1F73A 3WQ8A 2NV1A 3N2MA 4H9TA 2BG5A 1KBJA 4C1LA 4F8XA 3TCSA 1TV2A 2YA2A 1EQPA 5F2MA 5MHBA 3SUSA 4AZ7A 4UFKA 3W53A 4ZMGA 4HMCA 5KTLA 1V93A 2HBXA 2J47A 1KB3A 4JTEA 1IWPA 5J8LA 5JH1A 1B5TA 4QLLA 4UOZA 3FA5A 5C7HA 2QJNA 4DF2A 1QRQA 5LNRA 4AZBA 3V16A 3K8LA 1Q6DA 2WK2A 2YGYA 3STEA 1NQKA 3I10A 5D2TA 4CD5A 6XIMA 4DUWA 2ZZ7A 1W9UA 3DEQA 3GNPA 3UXDA 4GOAA 3O6DA 1ML1A 8CGTA 3BZGA 1XYBA 4LY4A 4NHVA 2VCCA 2IPJA 4UUIA 2XIQA 2WLYA 4W7UA 3RRAA 3WFLA 2NSXA 1YYAA 3LGEA 3L4XA 3N04A 2OSYA 3VMNA 4IL2A 4J5NA 4QJ1A 3KHJA 4GUFA 3CT7A 2GQAA 1RUSA 1K70A 2VTFA 4HCHA 1AD1A 1IR2A 3EZ4A 4EXAA 4QE1A 2ZQ0A 1V02E 2YCKX 4EAYA 1A5CA 3MUIA 2XDFA 2NW0A 3UWVA 5LIXX 1S3HA 3EOUA 4C60A 2TODA 3U7BA 2FMOA 4QSFA 2VRQA 3GXFA 2YB1A 1Z32X 3UCCA 1UKQA 3GTXA 1RA0A 2NLIA 4BY3A 3I4EA 4QGCA 2BASA 5FSEC 7A3HA 3RO8A 4FOJA 5HWNA 3YPIA 1TPFA 4MG4A 3TXZA 4CN6A 1LRNA 2WMJA 1GOKA 3FGCA 1B9BA 3KRUA 5I3IA 3SRKA 2KAUC 3T2OA 3QOMA 1J6OA 2YCLB 3PUDA 1QHOA 3G1SA 1OQFA 3EWCA 2BODX 1PHWA 2WZTA 4DRSA 3VZYA 1XPYA 1UHVA 3HURA 3W2LA 4DF0A 2Q8ZA 1VCFA 4HPGA 3TX9A 1OT1A 3AWOA 5FCZA 4LUSA 3O1NA 4CCDA 5HR6A 3GNNA 4PGLA 4Z2GA 4LFYA 3M0YA 1WP6A 4TIMA 2TPSA 4HHMA 5I78A 2DQWA 4K39A 3LTYA 1VC4A 4RDWA 1VFFA 3K1GA 1OYCA 4IZGA 3R58A 1QI5A 5M17A 5KEZA 3ONBA 4GUIA 3P0WA 5C2GA 3GRIA 1H5VA 4IWWA 2FJKA 1V7AA 1O1HA 3N29A 5L6UA 4P8XA 2F8QA 4AHOA 4UQBA 3H2OA 1JF6A 3WDJA 1GPWA 4QS5A 3MP4A 4RE0A 4AZIA 3IJ8A 1LL7A 3PZGA 3GHRA 1FP8A 4YL2A 5I23A 1US0A 4GQ0A 4MB1A 4OV4A 3OBEA 5C9WA 1EP3A 3ZLHA 1BYDA 4Z0SA 2E8YA 1B57A 4MYXA 3RU8X 4LS1A 4CQ8A 1NFPA 5A6TC 2Z27A 1EPVA 3WKZA 3WEMA 3WH6A 2OQLA 4L9YA 3ZFHA 4TQTA 1GOIA 1X38A 3W73A 4KCUA 2WJZA 4PBGA 1GYNA 1JZ8A 4RCXA 3TNOA 4ECLA 3SCPA 1D8CA 1MW1A 1LM1A 2D24A 1V3MA 1YTDA 1VRDA 1HJVA 4ADTA 1JUEA 1GTHA 3DYOA 1UKTA 2GUBA 5C8BB 3NPXA 1BEUA 1ZU8A 4A21A 5C9XA 3VUPA 5C0QA 4US5A 2VJXA 4GIRA 4I5XA 1OC7A 4RZ5A 3UXKA 3I7QA 3D3AA 1SJAA 2Y5EA 5KZMA 2VZSA 3BICA 3O7UA 1H7WA 2WNNA 2HE5A 3BJSA 4F79A 1W6TA 3DXIA 2A21A 3W02A 1JJKA 2XN0A 3N14A 4AXKA 4POCA 5FAGA 3ZO9A 1VPQA 1YXDA 3CUJA 4H6RA 1UQZA 2ZE0A 3NVDA 2V68A 3N34A 3T08A 1W1TA 4D6GA 4ZZ9A 4GQGA 2ZYFA 1KCXA 4H41A 2IS7A 1T41A 3KBMA 1OCBA 1MZHA 1O95A 4S3BA 4P61A 4IXHA 4OT7A 5CPLA 4ZXLA 3NDYA 4Y9NA 4S3CA 4DB7A 2ZOXA 3DHFA 4LV9A 4XUGA 1KWKA 4PSRA 3U5UA 1S38A 4A3HA 3HQPA 2XFRA 4C6MA 2GDQA 3UZZA 4O0QA 3SDOA 3RITA 4M24A 3S2NA 3WELA 1A47A 2G50A 2D2OA 3KBWA 1DV7A 1XL9A 3EA2A 5D09A 4DJDA 3RCMA 1BKHA 1VEOA 2PDUA 3MMUA 3ITTA 3OZMA 3OYXA 4WKHA 4UNKA 1YTEA 3V0UA 3ONCA 4UFMA 1A5NC 3M5ZA 4FXFA 3WD0A 3ATYA 1EJSC 5G4EA 4EX4A 4JCLA 1WZMA 5EMKA 1E6ZA 1T40A 2G97A 1UA3A 4GNJA 1S2VA 2HVMA 4XO6A 4J1OA 4D6JA 1Q6LA 3P8IA 4O1BA 3AZTA 4BI7A 3PZVA 3RMEA 3SN1A 1R2TA 3GVVA 4IP4A 3ORWA 4K6AA 1HXJA 4AMAA 3UZYA 4XTIA 4LOCA 1DXEA 1XLHA 3MBFA 1DKWA 1QPKA 4AY8A 3C8FA 4U31A 4ORIA 7TAAA 2I1OA 3PJXA 4HA0A 5BMXA 5H91A 4NX5A 3VVGA 3VIPA 3PBGA 1W9XA 1K7XA 3ZT5A 4D6HA 4ZO8A 2OELA 2XUCA 1OD0A 3SZ8A 1V4YA 1X39A 5CPMA 4ATLA 2V5BA 1TCMA 2QW5A 3NQ8A 1YPXA 1VFHA 1R9XA 3WFZA 3L0KA 5PTDA 4IX0A 2AL1A 2JFEX 4NSBA 2Z4GA 2YPIA 5CSRA 3AYRA 5JH2A 4RZBA 3WLKX 1SO6A 1XLEA 5HMSA 3E0FA 5BOEA 4A8RA 1MUMA 1NWRA 3TJLA 5FL0A 1QO2A 5K4XA 3UA4A 1GOQA 1A5BA 4XV0A 1E9LA 3GTFA 4DO4A 3UZXA 5EMLA 1WXJA 7TIMA 2XSXA 3BARA 1FXPA 3EX2A 4EVZA 4UTWC 1TPB1 5IXEA 2IXUA 1BSIA 4V2XA 3H54A 3W27A 1JL8A 4E2VA 3RJXA 1LWJA 4M81A 3MV11 4Q22A 5CJNA 3PZIA 4ZQOA 3V5OA 4AZ5A 1I60A 3UEQA 3P0XA 2C18A 2PRHA 3G1VA 5HULA 3P81A 4S1FA 3HPZA 3MO7A 4PRWA 3QKZA 4B4FA 3G18A 4GY7A 4IIHA 2BY0A 3H8AA 3ZLGA 4IIBA 1JGIA 3GG1A 2HV5A 4FNRA 4QRNA 3VMPA 1PB0A 2PP1A 3P5YA 1S2WA 2FFCA 3LGDA 3W7OA 1NWUA 3BWWA 3W7LA 1GVIA 4R3UA 4S39A 3FXYA 5DMNA 1XIMA 2ISSA 1H0IA 3EOOA 3VOCA 3PN8A 3Q94A 1IEQA 1DEDA 3IV8A 4O15A 4C6OA 1J2WA 4EPBC 1XLFA 5B80A 5T8GA 3ABOA 2OB3A 1RH9A 3AUOA 2RGLA 5A69A 5FI8A 4AF0A 4OE7A 3WD1A 3WNLA 4JTAA 2VX4A 1R87A 1QDSA 1RCQA 4H9UA 2WM1A 5HMDA 5IFPA 2BZNA 4PFMA 1JPKA 1KC7A 3K4AA 1A53A 1JAKA 4DI9A 2XVGA 2GK1B 3CU2A 4LXFA 4K7YA 1UR4A 3GKFA 3W1TA 3H2FA 3RX2A 4AEOA 3T07A 3W29A 3H4XA 4NAEA 4KWSA 3O6CA 4YWSA 2EKGA 1LOQA 1OHLA 2V0TA 4GH1A 2DGAA 1UIOA 2HEJA 4UBPC 4ZTXA 3AS2A 2A5HA 2UV8G 4BF7A 1EPXA 3WF3A 7ENLA 3IIOA 3R94A 3C3NA 2POZA 5E93A 3GLCA 3VO0A 4J40A 3PUEA 2OXNA 4C91A 3FJNA 3REQA 4PB5A 1FUYA 2WAGA 4DZIA 3WG6A 3H2CA 4WQ6A 3KP1A 1XFCA 2O0TA 3MSGA 1GKPA 1LQ2A 4GC4A 5HOSA 3RPDA 2Z1XA 3W1NA 2QZRA 4C5YA 1FWCC 4JKKA 5LGXA 5D30A 1XLMA 3OEXA 3WF4A 2E68A 4IG2A 4MVAA 1K9DA 3GNDA 2FZMA 4GHRA 4AD1A 3AAMA 3T2PA 1NOFA 3HPSA 2NVDA 1HJWA 1WZLA 2G3MA 1EGMA 1YMYA 3DI0A 4FLQA 3MMDA 1J93A 2A6LA 2EPOA 3W7EA 1ZPTA 4UTUA 5D2XA 1EGVA 1A3XA 2J9ZA 4JX5A 4CQCA 4AVFA 4L80A 3SM0A 5REQA 2Y5SA 3ITXA 3XISA 3KRSA 1M68A 1XD0A 1R30A 1W5OA 4I7WA 3R0KA 4HPJA 3WF2A 1XYMA 2QIWA 4UCFA 4Q3MA 4CU7A 5HXMA 3TYAA 1EA0A 1SR9A 2XN1A 3CASA 3TYDA 1LORA 2J13A 1C8VA 4UTLA 3MY9A 2Z24A 3R1ZA 1QHZA 2NVAA 2Q8XA 3UT0A 3CQ0A 1XR2A 5CH9A 4HD5A 4AC1X 1L6WA 3GDTA 2KX9A 4BQ2A 3MYOA 1PE1A 3EWBX 2X09A 2A3BA 3OODA 2VC6A 4AIUA 3W38A 3W1XA 2PCQA 3CV2A 4DXVA 1XX1A 1J9YA 4C6JA 1NY1A 1DQXA 1HL8A 2QIIA 5DRIA 1WAWA 3PTDA 4Z0JA 4O4WA 3M7SA 4JNYA 5BYWA 4EXBA 5K9CA 1VD6A 2EF9A 4AX7A 1FWWA 1US3A 8XIAA 4BKNA 3I3EA 5LHFA 4KFNA 1ZLPA 1WDPA 4DO6A 3I4KA 3VM7A 1FDYA 3C8NA 5ABFB 1ZP4A 2VCAA 1E1CA 3H26A 4N2YA 4EPDC 2A3LA 1EJUC 3WMSA 1HZYA 1BPLB 3B0VC 3ZJ6A 1HKVA 1OZQA 2HTMA 5JXQA 2OKOA 2PTDA 3CYJA 3IAQA 1A50A 3TAKA 2BGNE 2CWNA 1ELSA 4IMAA 2W4XA 5A95A 1TWZA 5AOUA 4GNKB 1DJQA 3W7KA 4Q8MA 4WX2A 4WR3A 3K8MA 3CUFA 3UESA 1HGYA 4MFEA 3GK0A 3M46A 4ILSA 1JCTA 2VFGA 1RAKA 1XRFA 4ACZB 5EKYA 5FIPA 4WIWA 5AYZA 1A3WA 2BVTA 5BOFA 1FFRA 3C2EA 4V33A 4MPQA 4YYFA 3NQEA 2NQZA 3HG5A 1Q6EA 1UD2A 4C6QA 2DT1A 4JICA 4AWEA 3NNTA 1JFXA 2CZFA 1V6UA 1PS9A 4O0KA 3ECQA 1Q85A 1F4AA 3KS5A 2C7FA 2DVXA 4JKLA 1VAHA 1EX1A 3MJYA 3CMGA 1F3EA 4LVAA 3BG3A 2AOSA 3KWSA 4FX6M 2E77A 3W76A 3SCVA 3CUGA 4HN8A 1FWAC 1DIDA 1KXHA 3P5ZA 1ZY9A 3MSYA 2P53A 1IYXA 3FDKA 4QG9A 3WJSA 1O6IA 2O56A 3O16A 4PL2A 3CYVA 4XKYA 1HJUA 4DZAA 1OCJA 1IE7C 1OSEA 3NXFA 2W67A 4BEUA 2IMRA 2QJMA 2CLEA 3FAXA 3R8RA 5CZTA 3IJDA 4U28A 2CHOA 4FF7A 3PPCA 2H90A 3W1QA 2I5QA 3I65A 1HKJA 4HSOA 2YCIX 1JVNA 2HWGA 1N55A 1UKOA 1LLOA 3B04A 1J5SA 4LUYA 4JX4A 1QW8A 1NSJA 2QJIA 4QAIA 5HJYA 1CB7B 3TP4A 3HGRA 1IWAA 2OX1A 3E2SA 3ZR6A 2VEGA 4R9OA 1JCYA 2NQJA 2V30A 3WLJA 4MJ4A 3OPSA 4D6CA 2WCAA 4M7TA 5D9MA 2EPKX 3TOYA 2WNZA 4IPNB 2I5GA 1QBBA 3AJ7A 4QR6A 2O7QA 3FIGA 2VEKA 1OG6A 2X0YA 4PULA 5FESA 4QIUA 3B05A 3DBPA 5CJ5A 1LBFA 3UYCA 3WF1A 1EXPA 3AIQA 3PBYA 3C52A 5CKSA 1PTDA 2J8FA 2AKMA 2PDPA 4M6VA 2CLPA 5MKGA 1LBLA 2INZA 2FH8A 4PCSA 2WM0A 2POTA 3CL7A 2PWDA 4CNTA 2YYUA 4LCSA 3I6EA 1ISXA 3FNDA 4UFJA 1XIBA 1PZ0A 4D1IA 3RR1A 3GB6A 1VB9A 3EX3A 2ZUNA 4QLKA 1B2YA 2ZX7A 3QFWA 3RLVA 5CAHA 2VP8A 3WYZA 4IUOA 1PHQA 3B40A 3RK8A 4JIHA 4R7WA 3F03K 2DJLA 5ENLA 4KEMA 2FTYA 2PU1A 1PJ9A 1M7OA 3V0TA 3UCQA 2I9EA 4OIFA 4JN6A 3LI1A 3HGSA 4CU8A 3JRKA 1Q7QA 1YEYA 4N9DA 1QOXA 1EHNA 1V5XA 3JU2A 1BYAA 2J74A 1K03A 1KRBC 3P7YA 5ABHA 4Y9OA 3W3OA 1M9HA 1MI3A 3SIZA 2DSVA 1JCMP 5K2ZA 4I6KA 4N6EA 1R9ZA 1UZDA 2HISA 1JRBA 5FJPA 1VEPA 1XYZA 3VC6A 2RDWA 1XLJA 2OEMA 2QCNA 1FWHC 2GGGA 2FGLA 3B4UA 4G7EA 4Q6JA 3T42A 1OX6A 5DANA 4M1BA 4DJFA 3MC5A 3QOKA 5T26A 1EEPA 3CZJA 2I17A 2AQOA 1Y65A 4PUWA 4I9MA 3H24A 3DU0A 3N2CA 1BGAA 3DG3A 1AW2A 3LI0A 5U7SA 5I5RA 3A47A 3KBVA 3TSMA 1FCUA 1W3IA 1PZ3A 4WXZA 4JS3A 4GYJA 1YDOA 4REQA 3SGUA 4LW7A 2OQYA 1SFLA 4MWAB 5CZ0A 3WLMA 1PCKA 2IUZA 2YYTA 3M0IA 4KH2A 1PWMA 3H70A 2C14A 3FVMA 3N2XA 3AUJA 2YDRA 2XISA 1H1NA 5CSUA 3WH5A 4OOUA 2IW0A 1VLIA 3CB8A 2WYSA 3KVLA 5C54A 3GVRA 2VVNA 4S3KA 3KBJA 1ME9A 4B3ZA 3EKGA 3W83A 1YPFA 4DJED 1XYFA 3TC3A 3RLGA 3GDKA 4D71A 5LXEA 1P0KA 3RNDA 5LA2A 1SO4A 3NO5A 2Y2WA 4V28A 4QG8A 3ZT7A 4QFUA 3HGOA 1OD8A 3NURA 2DQXA 5GPRA 1POKA 1PL9A 4XIAA 1EJRC 4DF1A 3AS0A 5JBEA 3P67A 2FZBA 3LU2A 1TUXA 5HNTA 1W31A 5AZ1A 4IJCA 4JTJA 1DTUA 2QMKA 3ZJKA 4H6QA 1YDYA 3UY7A 4DWDA 4YTSA 4YHGA 1PV8A 1I0DA 2OLHA 4NZ4A 3GYCA 1WPCA 2V5CA 5A6AA 2YDAA 3O63A 4KKXA 5I03A 3PAJA 1SQ7A 1E3XA 1GPFA 3T81A 3LPPA 5AYBA 4D6FA 4HNUA 1LL4A 1H5YA 4UTWA 1Q45A 3WLIA 4OQVA 3Q45A 3TFCA 3ZVHB 2ZUTA 3HTWA 4QHRA 1NELA 2DPEA 5DF0A 4Z1AA 3S2MA 1PKMA 3CV6A 1L9WA 3UQNA 4KFPA 3VNZA 4KMQA 1G67A 3SUTA 4TX8A 1QXLA 3BW3A 1LUCB 3WNMA 3KVMA 3WLOA 2O9TA 3RXZA 3RG6A 4GFSA 5AYXA 1TPUA 3IK2A 1QPRA 2ZZ4A 3W1MA 1WKYA 1UASA 4PB4A 3LEPA 4NJIA 1UR1A 3S46A 3HIJA 3HV8A 1EL3A 1K8CA 8A3HA 1UR9A 3R2GA 4EANA 2WKGA 5FEZA 4ZGYA 2FIQA 5C6MA 4LANA 4HA4A 4ZR8A 2WJDA 1OVDA 5A6BA 3B3DA 4C6BA 1LL6A 2B31A 3L9CA 4PBFA 3VDAA 1S2UA 2WB5A 2ZRYA 1SSDA 4EAMA 2QDHA 2X7WA 4YYCA 1QAPA 4Y8FA 2I57A 2I56A 2DZAA 4JIEA 4X60A 1LWHA 5D9OA 4A4AA 1DWFM 2FPVA 1UR0A 4M6UA 1FHVA 1XBVA 1VR6A 4W7WA 3AXHA 1TFVA 3BO9A 5GJPA 3CK5A 1CXKA 1F6PA 1P6BA 1G4TA 4D8AA 2X1TA 3M5VA 5FAJA 3UPBA 4B91A 2WC3A 5I3GA 5A5WA 2R82A 1L8NA 2WO5A 3KAOA 4H7ZA 3ANUA 1QNPA 3H21A 3KLKA 3WX7A 3LUTA 3USBA 4J2MA 3T0AA 4IP7A 4WD0A 1EDTA 2PBOA 4RUBA 1ZZMA 2C15A 4JTUA 1DJWA 4AC7C 3R7MA 1QATA 2D73A 3ZSSA 2HPIA 1N2VA 3VNLA 3FFSA 3WNPA 2QCCA 4JR5A 3R11A 3PZNA 1WKFA 3G5EA 4CNPA 3B0PA 4QJ3B 4OBRA 5CC6A 3OGVA 3OA3A 3VKCA 3NO1A 2EGZA 4CKQA 3CZKA 6REQB 4MJ2A 4JTFA 1GW9A 2BX7A 4OUEA 1WDDA 3L5LA 3PSVA 2AAAA 5M03A 1V6WA 2RHGA 1P6CA 1TIMA 4OECA 4ML4A 4AEEA 1MDLA 1QI3A 3NYZA 1W1A1 2E9BA 1I8JA 3C0LA 3ITLA 4LAKA 4C6FA 4AD5A 5I24A 4JX6A 5EFFA 1SW3A 1WZKA 3GKAA 1WUEA 2QCGA 3VGDA 4HNVA 1Z44A 4MSSA 3WBWA 1QASA 3UG4A 4WJEA 4QQ3A 3ARPA 4PCPA 2OT1A 2PMQA 1AH4A 4H19A 4HVXA 1HP5A 3U2OA 3T09A 2YXOA 3PWAA 2OZ8A 3GVWA 4O54A 4AAJA 2YCJA 3G2GA 4GI9A 5EMYA 2WVUA 3CHCA 2FZNA 1ZBKA 3T0CA 1F07A 3GUWA 3VYLA 5LXXA 3IIZA 3PWIA 2FB3A 1HFBA 3HFYA 4PTXA 1Q65A 3UPMA 4OHQA 2YW4A 3BOLA 3NQBA 3GR7A 4GK8A 3S42A 3VMOA 2YW3A 3SUVA 4AISA 3W7JA 3UGRA 4ZQPA 3G8RA 4XVDA 1ZJHA 4YTRA 4ZOCA 3WDRA 3WLQA 4LF2A 4RW3A 3UG3A 3B8UA 2HCVA 4LB4A 4PB3A 3L4YA 1VGAA 4QXIA 2PF0A 1NQ6A 2SFPA 1MDRA 3QMRA 4PTWA 4QDMA 3KS6A 1SZRA 2H8ZA 4ZFCA 3B9OA 4GI8A 3BVJA 2QEZA 4AF0B 5CGMA 1JD9A 4BF9A 2OLSA 1TJ2A 4H83A 2HS8A 2PP0A 2RKXA 1QNRA 3MHGA 1IZJA 2Z7KA 2QCMA 5TNVA 1QJWA 4MM1A 1RP9A 3BUVA 3PP7A 5K9XA 1TPDA 3E0VA 4FNTA 1UR3M 2QUMA 4HMDA 2Q01A 4FB7A 1TVNA 2ZVIA 4J3VA 3ITOA 3MANA 4DO7A 4ZB0A 2Z6JA 3NL5A 1VCGA 1CEOA 4Z42C 2Y89A 1T99A 3U48A 5C2XA 3CUXA 1FX6A 1C92A 4QG6A 5JBFA 5XINA 4GBDA 1Q6CA 3U5YA 2HDJA 3PHAA 3I3DA 1S5VA 2ZDSA 1LZOA 2PA6A 3EWWA 3W28A 4GO9A 4S3GA 2OEKA 2QULA 3LHWA 1UWAA 4Y9PA 3W85A 1WDSA 5IHSA 4B16A 1IEWA 1W3LA 3ARRA 4DPPA 4QQUA 4MTVA 4GJJA 5BMWA 4NJGA 3E0IA 4NAFB 4PYSA 1G01A 1G4SA 2ZC8A 3GQYA 3VNJA 3VDHA 2HK1A 3E1F1 3B9AA 3EB2A 3SN4A 5FF2A 1L2QA 2IXVA 5FJUA 1KCKA 3QYQA 4IGSA 3UW6A 4TTGA 3SCQA 3WQ6A 4G1KA 3MPGA 4LV4A 2ZUWA 3L7RA 3KDNA 1KLYA 2V3EA 1A5LC 4GJIA 1R3QA 4PUEA 3S83A 1F3TA 2WNWA 2AQVA 2J7BA 4JOMA 3URNA 1TR1A 4WGHA 3F2DA 3RLHA 1H2JA 3H2AA 1Q6GA 1D2KA 2RGMA 3UXIA 1VIZA 1E6XM 3WLSA 2PI6A 1SJDA 1L6YA 3MV01 2B7PA 1FWNA 2IKHA 3W6MA 3D0CA 1IXNA 2AMXA 4Z2HA 4AD0A 2FGBA 1Q6QA 1E72M 1ZGDA 1S39A 3EPNA 3LZ5A 9XIMA 3AYSA 4M19A 2WKLA 4MFDA 3PZUA 1LQ0A 4YTUA 2E1DA 1HT6A 1XCXA 4IICA 3L65A 1BAGA 5C9UA 5DO8A 1W3NA 1UCWA 4O1AA 1DHKA 2HJPA 4L9ZA 3H23A 1HG3A 3DC0A 8TIMA 1R9YA 2XG9A 2PE4A 5HNUA 1ZQ5A 4X61A 4QM1A 4MPKA 2CBIA 1LTDA 3BQ5A 1UMYA 4LAZA 1U5VA 2ZADA 1ESWA 3AXIA 1YNPA 5CLTA 2O9OA 3GTIA 1E1CB 2YBTA 2EPNA 4ZENA 3P80A 3P14A 1KFJA 2D2JA 3KRBA 4ML9A 2TMDA 1YE6A 5BRQA 2FHBA 3MP3A 2ZA1A 2OWWA 3LY0A 4NZ5A 1VHCA 3NZQA 3WEZA 4HB7A 4PMZA 1WV2A 4O11A 1V0MA 2ZBTA 3OVPA 4FMVA 4GX8A 4NJJA 1MQQA 4HJFA 3UWWA 5FJIA 3QPZA 4KRTA 4KGLA 1XJBA 1T0OA 2W5FA 4HN4A 4KFOA 4Q4PA 4MY1A 3PAOA 4WLCA 2P5NA 3TN3A 4Z1YA 4LS0A 4U4MA 3AS1A 3DN5A 5I3KA 4V1YA 2EG7A 4PRTA 1R47A 1EEXA 1R3WA 1N82A 3IGHX 1D9EA 1P1XA 3O2LA 5RUBA 3L4VA 4LALA 3GU2A 3LS9A 2ZX5A 2VFFA 1U1JA 1DL3A 4D72A 1Z3NA 4L4LA 5AHNA 3TW6A 3HPFA 2B0MA 1BG9A 3C5QA 1KTNA 3QQWA 3MVIA 2GPTA 4X63A 3QTPA 2QMJA 1DWHM 1M7JA 5A3HA 3IPWA 4KBXA 4ZB2A 3H12A 5A6SA 4W88A 4PH6A 4IGMA 4WRHA 2AKZA 4BA0A 1WOAA 3M0MA 4S2CA 3CS2A 1QPNA 3GG0A 3W2MA 2CWXA 1J18A 4MZ1A 5HMFA 1PWLA 1NWSA 3VIMA 4E3VA 2C19A 2ZA2A 1CYGA 4AZGA 2J66A 4ZO7A 1KGWA 4L6OA 2ANUA 5I00A 3TMLA 4AIOA 3N4AA 2VR5A 1EP1A 4GYPC 4ZSTA 1ZAJA 2Z2BA 3WBYA 2XGZA 3UNDA 3FVDA 3TOPA 3LMZA 2W66A 1UR2A 3LPOA 1C7TA 1OFDA 1Q6RA 4LS2A 3T7VA 4C7GA 1UP3A 2OSXA 2C13A 4OWGA 2R1LA 4YXGA 1JG9A 3H7RA 3AIRA 5I07A 2GDUA 4AB4A 1OINA 5AHIA 1PIFA 4AVNA 2VEPA 2Z1SA 4PC8A 3GW3A 3S1WA 3GG7A 4LYRA 3WY1A 2O4MA 2PTYA 3W7MA 4JHOA 5EMMA 1K7FA 2D2GA 2G95A 4G2DA 5DELA 2E5CA 3QQ0A 3IGXA 3BMXA 4GIYA 2FLIA 2V81A 3DIPA 5JIPA 2J25A 3T8QA 2E5DA 2O7SA 5EB8A 3KM8A 3L68A 4JQ3A 4NI3A 3CT2A 1GYMA 4D6IA 4DIAA 1MRQA 1WXYA 4K36A 4WSHA 1WE5A 1S5WA 3D6NA 1OEPA 1ONWA 5JIWA 4JTCA 1KWGA 2NV2A 2VDGA 5DLCA 2XSBA 4NUWA 3LXCA 1I75A 1TPEA 1Y5VA 4KWUA 4W89A 4A3QA 4RE4A 3UGVA 1CENA 1O12A 3UJRA 2D3NA 4UTHA 2VX7A 4IGHA 1E9ZB 3R8HA 1V6YA 3QBUA 4GZIA 2W61A 1K02A 5F2LA 2FTPA 3MS8A 1IEIA 4URIA 2QPSA 3RRXA 5D02A 4AFYA 3SW6A 2OOGA 4O28A 5LYRA 4WZHA 3AIUA 1UWIA 2H9AA 4DHGA 3ZQ9A 1DWGM 3QW4B 5CC3A 2Q6ZA 4BJHA 1O5QA 1TYGA 1WXZA 4BWLC 1OWQA 5IFTA 2R91A 5A8MA 4CCEA 1SFSA 5AYYA 4IP5A 1BYBA 1AQMA 4LC8A 4JFUA 4AD3A 2WSPA 4W8LA 1XICA 3ARZA 3ITYA 3HA1A 1XG4A 3SUUA 4H8HA 2E1WA 1PZ1A 4WDTA 3TE9A 2WCSA 4PODA 4XSMA 3TW7A 2E6FA 1A5AA 3TR2A 3DH7A 1CXHA 1LF1A 5LNUA 3E5PA 4LEQA 3VX1A 4ICCX 1UJQA 3UNTA 4HU3A 4NNBA 1ALDA 2JGQA 1XF0A 3GFYA 2FHFA 3LDVA 3VM5A 3WZ0E 1Q4WA 3BL3A 3NTYA 1J01A 2HXTA 3A4JA 2ACSA 4HNLA 3KFTA 5CAKA 4PCNA 2VOTA 3KVJA 5CLWA 4HPHA 2V2CA 2V63A 3CTLA 3FEMA 1SVDA 5CGQA 4FI4A 5AECA 2WOQA 3A24A 2PDCA 4GXWA 3LTPA 4OKDA 4A8NA 1W17A 3FJ6A 1W32A 3M6YA 1BF2A 1D7FA 1FP9A 3NZRA 3APYA 3HJZA