3SZ8A

Crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia pseudomallei
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
279
structure length
264
Chain Sequence
SMNVAISPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIPFVFKASFDKANRSSIHSYRGVGLDEGLKIFAEVKARFGVPVITDVHEAEQAAPVAEIADVLQVPAFLARQTDLVVAIAKAGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQMAETTGGCPVIFDVTHSLQVLDLARAGIAVGIAGLFLEAHPDPDRARCDGPSALPLHQLEGLLSQMKAIDDLVKRMPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase 2
total genus 81
structure length 264
sequence length 279
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sz8A00
1TPH1 1SSGA 2HS6A 5AYXA 2RKXA 1VCGA 1HUVA 1A5SA 3NQFA 2ZA3A 2QKFA 1I8JA 3BLIA 3PY2A 5C2XA 1VHCA 4FB7A 4BWLC 3LBCA 4GWEA 2CLKA 1EX5A 1OYCA 3V1PA 3W2UA 4JN6A 4LC8A 4D2JA 3MBFA 3BG3A 3LHYA 4FX8A 1LP6A 3O07A 4DQWA 2FPYA 1K7FA 3O16A 1LLWA 4LU0A 4CCCA 2O7QA 4O1DA 2QCNA 2C13A 3A21A 4GUJA 1L6SA 2EKCA 4MJMA 5FF2A 2GVGA 2VEKA 3GK0A 1MEIA 3NQVA 4GUGA 1OG0A 2RDWA 3UPWA 4OBTA 4IPJA 5A5WA 4FEZA 4BWLA 1SO6A 3UQNA 3F1QA 2A7NA 5C6MA 1W31A 3AJXA 4WXZA 5C55A 2Q8ZA 3W2NA 4JY9A 4LVFA 3IVTA 1SO3A 3I68A 4NZFA 3S9YA 3ZWTA 4ZQOA 7TIMA 5AN7A 3O6DA 1L6YA 3NEVA 5D32A 3BVJA 3G1FA 3O6YX 4LRSA 1DJNA 5F2LA 4IMGA 2Y62A 1Z42A 2JK2A 1TV8A 2E6AA 3N73A 1TTJA 4O19A 4IGHA 1DL3A 4IPIA 1LM1A 2CLIA 3W71A 4BF9A 2V8ZA 4RJEA 2C6QA 3K30A 1XUUA 4GJ1A 5J5RA 5DY3A 1O95A 1B9BA 4A21A 3DAQA 4YCOA 4RX0A 3NZRA 5K2ZA 1EWDA 3CPRA 1XBYA 1K8ZA 3MI2A 3G3MA 3UXAA 1OFQA 2E77A 4Z0SA 1QPNA 4O18A 4JR5A 1RQBA 4UNKA 4AF0B 3FA5A 1FWWA 1TPFA 1EEPA 1HO1A 3LI1A 4S2CA 3WJZA 3NA8A 4XBSA 3HG2A 3MW7A 4JIPA 1WA3A 4CNNA 4Q4KA 3EX3A 3EX1A 4R7JA 2C3ZA 2TRSA 1SFJA 3PF3A 4ADUA 4UFJA 4AHQA 2I1OA 1OX4A 2UV8G 3ZWSA 2PRLA 1C9DA 1F6KA 5E93A 4JTKA 3UZ5A 4DBDA 3LCHA 4DO4A 2YGYA 3PAJA 1SO5A 4WX2A 5HUOA 3S5NA 3FYPA 3WJWA 3OIXA 3S1XA 4MIMA 2GVJA 1KM5A 3OBKA 4MLRA 1F74A 2BWGA 2CW6A 3PULA 1G67A 3GNNA 4PTNA 5D30A 3BG5A 4ML9A 1B4KA 1W8SA 3S5ZA 3TQVA 1H60A 3QW3A 3NQMA 4N9DA 4NNBA 5D03A 3HGSA 3M41A 4RXFA 1KM6A 1TSIA 3LGEA 1M6JA 4N9CA 1GVQA 2WPBA 1IXOA 5FEZA 3B0VC 1YYAA 2YFNA 1SZFA 5LNUA 3LCGA 2R94A 3AO0A 3NL5A 4UTJA 1H51A 1SUXA 3S8HA 1IXPA 5F2GA 4CNOA 3TNOA 1JCMP 3EKZA 4UFKA 1VR6A 4M5PA 3PS7A 3L67A 3LRMA 4PODA 3OHIA 3OG3A 5TIMA 4DO6A 5FEXA 1A50A 1OFOA 3WFAA 3S1WA 3P67A 5KITA 3W7EA 3G24A 3DH7A 4RLIA 4Z08A 4JEQA 3UY7A 1SPQA 1GYNA 2CZFA 2J9YA 1AW5A 1ZJIA 4NX5A 4WOQA 2QCLA 4LUJA 4E2BA 1Y0EA 4UXDA 3W6YA 4B5NA 5F2MA 4HSNA 1QNVA 1GTHA 5CGQA 5DLCA 1LBMA 3FS2A 3L0NA 3P84A 4O1AA 1X8FA 4PCFA 3DGRA 3W7MA 1J4EA 1SZNA 5F1VA 4IXHA 1KFCA 4POCA 5HWNA 2Y70A 3INPA 1U83A 1LLZA 3TUUA 2CLMA 1H7OA 3P82A 2A6NA 4KFPA 3B04A 2X30A 3ELFA 1XBVA 1H7PA 1FDYA 4R53A 2A6LA 3LERA 1AG1O 1K02A 1TTQA 3W83A 2CZEA 1QFEA 1GJPA 2D73A 3T44A 4DEFA 2J27A 2EAWA 3NO5A 4HSOA 3C2OA 3PWAA 1H7WA 3KRSA 4OU1A 1TRDA 3MUXA 3W7QA 4CLMA 2J88A 3W2LA 3N19B 4AMAA 3KVJA 3LHWA 5I3HA 1IXQA 4O1CA 3Q94A 4CQ8A 3NQ8A 1KFLA 1LRQA 1K8XA 1VQTA 3BW3A 3RNDA 3C2RA 5DN1A 4X9SA 3UWUA 2C16A 1RV8A 3I7SA 2ZRVA 3IEBA 1AK5A 4OT7A 4MY1A 5EY5A 4XWUA 3P81A 5AC6A 3C56A 4LUIA 4K38A 2VXNA 4O13A 2VEIA 5LNWA 4I7WA 3M7WA 3KVKA 3VNDA 5F1UA 1LZOA 3MP4A 5EL1A 4FX7A 4O4WA 3LTPA 2CWNA 2NV1A 3HGRA 3PM6A 1YPFA 3GDLA 3MHFA 1SW3A 3UWZA 1WX0A 3W88A 2WOQA 2QUVA 5G1YA 3W73A 4JD4A 1MEWA 4PFMA 4S2BA 1I2OA 1OFPA 2E5CA 3MO7A 1FY6A 4L4MA 3W07A 1LRNA 2R8WA 1DJQA 2TPSA 4NJKA 4WY0F 5MHBA 1FDJA 2ATMA 2DJLA 4O52A 1MZHA 1G4SA 3A24A 1N55A 2YR1A 3D0CA 3YPIA 1EA0A 5I3GA 4QQ3A 4M6QA 4I9AA 3MMTA 4N4PA 3GLCA 2ZRZA 3WK3A 1T8XA 2EHHA 2GOUA 1O4UA 4JY8A 3C3NA 2NUXA 2NXHA 3FIGA 4NJIA 1W3TA 3EXSA 3G0SA 2JGYA 3CLMA 4Z1CA 2CLFA 2NLIA 5TQLA 2C18A 1H1YA 2X16A 5CSRA 1O94A 3NM3A 3TAKA 3A5VA 1PHWA 4JNMA 1FUYA 3W1LA 2ISWA 3CM4A 3W84A 1H7RA 1P4CA 1GT8A 1R2SA 5J5DA 1OJXA 2DZUA 4MZYA 2VEPA 4AWSA 3MYPA 3OVPA 4MOZA 1IGSA 3GZ3A 4YL2A 5KMYA 2X2GA 3TAOA 3L5LA 4XQ6A 5LNSA 2QCDB 3UWYA 3HPZA 3NR0A 3DI1A 3TXVA 4Y9AA 1JCNA 3P5YA 4K37A 1GQNA 1W3NA 2YX0A 4YMZA 1XL9A 2ZTJA 3SJ3A 3TSDA 4YCPA 4UMAA 3PSWA 3G1SA 4ZQRA 1ME8A 2H90A 5G2WA 3RU6A 3ANYA 4N2YA 4NVTA 5KZEA 4TMCA 3E49A 1OK4A 4JTHA 1JRCA 3S1VA 3LHUA 3STGA 5HWJA 4MZ8A 1TO3A 4H6KA 2GVLA 3LXAA 1KM4A 3HMJG 1GWJA 4UNLA 2YCEA 1QPQA 1ZAJA 3B0PA 4A3UA 4WD0A 1HFBA 3PB2A 4UCGA 2C1HA 3LLFA 4IMCA 1D9EA 4N9EA 1D3GA 2Z0IA 3W23A 4L4LA 3W7PA 3KVMA 4G1KA 4O57A 3E0IA 5AC8A 2X1UA 2XFWA 4O12A 2NWRA 2NZLA 2VKZG 3NQ2A 2X1TA 3OVQA 3BO9A 4I7UA 3CIWA 5DCBA 2J6XA 2E6DA 1UUOA 3NL3A 4Z1AA 1RR2A 2VEMA 2JKEA 2OX1A 1W5OA 3T55A 1PHQA 4N02A 1H63A 3GDRA 1EP1A 5AC7A 5HULA 3P62A 4LV9A 3JRKA 2VELA 1HO4A 3CWOX 3HPXA 5A8GA 4ADSA 5CZJA 3GAKA 1TJRA 2GQ9A 3R12A 5G2IA 4AWUA 2WSQA 1JUBA 4UIOA 2JKAA 3W87A 4X3ZA 3GDTA 1TMHA 2TSYA 1EWEA 1VCVA 4EVZA 1THFD 1PS9A 2QUTA 1H7XA 1KM0A 3QMSA 3W1UA 2ZZ1A 1RQHA 1KLZA 1O5KA 3P8JA 1K7EA 2ZRUA 1O5XA 1O60A 3W7JA 1PL9A 2CU0A 2DZSA 1R30A 2NX1A 1R46A 3G18A 1SQ7A 3TDFA 4UTKA 3W9ZA 5I3IA 1QMLA 2VFFA 1DQXA 5FESA 2LLEA 1WOBA 1KM1A 1OFRA 2DZVA 4FNRA 1CW2A 5HMSA 5D04C 2QUUA 4IUOA 5CZSA 1SU5A 2B4GA 1L2UA 1TPB1 1DQWA 2FFCA 3W76A 1QPRA 3W22A 2QDGA 1GVRA 2EPHA 3L65A 3WJSA 2VFGA 2H8ZA 1JRBA 1F6PA 1TQXA 4R34A 2DZTA 3OA3A 4LS2A 1FCVA 3NL6A 1DHPA 3P61A 1TIMA 3G8EA 5LSMA 4UMCA 4FNPA 2WKJA 3M5VA 4UR7A 4Y90A 1XBZA 2OCZA 1Z41A 4Q32A 5IBXA 4FXRA 1S3HA 4MUZA 2HTMA 4WZHA 4BR1A 5L6UA 1T0OA 1UB3A 2W6RA 1OYAA 1AMKA 4HN4A 1KA9F 4NJJA 1WDWA 4JDBA 1XM3A 4O16A 4OV4A 2E68A 3GVGA 1Q6OA 2V2CA 3F03K 3LXBA 3N9RA 5BW6A 2A1YA 5DELA 2A85A 5E0KA 3FKRA 3GR7A 2CZDA 3QFEA 3N2XA 2XN2A 2F84A 4LS0A 2FTPA 3FFSA 1MEHA 5DXYA 4MJZA 3THQA 2C19A 4K6AA 4EWND 1WOAA 2CZ5A 4ZQMA 2Z6JA 3NQ7A 4X2RA 3V75A 4QSHA 4LOCA 4AWTA 3O63A 3TC7A 3T4CA 3HF3A 4LS1A 4IOTA 3TJLA 5FI8A 3IIVA 3UD6A 4DF1A 1FCQA 3S6DA 3O05A 1AW2A 3VE7A 3PC0A 3HOJA 3FKKA 4RXGA 3NNTA 3NQGA 4ONVA 1MSSA 4GRSA 4P2VA 1ZALA 2PC4A 1LRTA 2ZZ2A 3SGZA 4FF7A 3G0UA 1YTDA 2VFDA 4EIVA 2I14A 3ZR4A 3TIMA 3TJXA 4GUFA 4OV9A 4MY8A 3IIXA 1GVFA 1BTMA 3M47A 3RFAA 5D38A 1X1OA 1YDOA 3C2FA 3KFTA 1VJIA 2CLEA 3QMRA 3W86A 1BWKA 1PV8A 2P1FA 3FEMA 5LHEA 4JS3A 5D2YA 4HNTA 1OFEA 3RF9A 4ZQPA 5SWUA 3LX9A 3SSJA 1G4TA 4IMEA 4ICNA 3UXDA 5AYYA 2ZYFA 4BK9A 2Y61A 3M6YA 4DO5A 1FXQA 4QAIA 3KOFA 1W3IA 2DP3A 3FLUA 3QPZA 3VKJA 3HGJA 3WJXA 4YWIA 3G3DA 2ABAA 1TPEA 1YTKA 2QCMA 3M5XA 1C8VA 3W1AA 6ALDA 4LC6A 1GG0A 2OMAA 1IIHA 4DPPA 5HINA 3O1NA 2Y85A 3M1ZA 1OF6A 4YXGA 4WXYA 1OFAA 3C6CA 3EWUA 2WSRA 5LNRA 1K3UA 1VLIA 3BPWA 3L66A 3DXIA 1R47A 1JCYA 2H3BA 3EXRA 5G1TA 3HPSA 4RK8A 2NWSA 5D37A 2A2IA 2FJKA 2QEZA 1TTIA 4O4VA 1Z44A 2PCQA 3EB2A 3IVSA 3TC6A 1B3OA 1SZGA 4O28A 5AYZA 2ZRXA 3A23A 1KBIA 3STFA 3G1HA 1A5CA 5EYWA 5HNRA 1SSDA 5F4XA 4XKYA 1LBLA 3BGGA 1LORA 3TX9A 3BLEA 5LGXA 1SZEA 4J9JA 2ZZ4A 4ZL1A 3N14A 3DKJA 1WAUA 3GXTA 5FF3A 4XTDA 2JKPA 3DFSA 2X1SA 3NOEA 4HIBA 4MLJA 4NNCA 3DU0A 1OHLA 3TSBA 1I4NA 1M5WA 4GFSA 5LHFA 2YDAA 4PEKA 4CQAA 4GNJA 1W5PA 1L9WA 2RH9A 3R13A 3W2KA 4UTWC 1SW7A 3NPWA 5IBXC 4HNVA 4DPQA 1LYXA 3LHVA 2W0UA 1UJPA 1PCKA 3P74A 1W54A 3E02A 3TQKA 4UUIA 3NYZA 3BW4A 1YLVA 4M6VA 2YZRA 4XUGA 2QCHA 3HO8A 3R5EA 3R89A 2XN1A 4XZ9A 5CZ0A 3N3MA 4XTIA 4JDYA 4HPJA 2VFHA 3QC3A 2J9XA 4RZ5A 1W37A 4NX0A 3CC1A 3M16A 5C5YA 3KX6A 1TPUA 3BV4A 3G1XA 3QRHA 4JTGA 5D2WA 2QCEA 2V9DA 3S1UA 1BEUA 1WV2A 5T26A 1M7OA 3I7RA 4AF0A 2G96A 1LROA 3CIXA 1VZWA 3S42A 1RVGA 5CSSA 2VFIA 4K7VA 2I9EA 1AL7A 2GJLA 3C61A 4RZ4A 4KWVA 4MZ1A 4U28A 3W1XA 1EB3A 2YW4A 2YXGA 4N9BA 5C54A 5K9DA 3IIOA 4E38A 4OHQA 1H5YA 3STEA 1WXJA 3P5ZA 1NFBA 1OVDA 3W2JA 5K3VA 3W1RA 4IWWA 4OE7A 3H53A 2YPIA 1DVJA 1QO2A 3VFLA 1C29A 1HL2A 1ZAIA 3O06A 1G7VA 4RR4A 1YXCA 3SR7A 2FB3A 4O10A 1KLYA 4K7YA 3LI0A 3ABOA 1KTNA 4DF2A 4A29A 3GR8A 2ZA2A 3C4UA 1KM3A 5U7SA 3L9CA 1GG1A 3LCXA 1I2NA 3KRZA 1H62A 4Y8FA 1R2RA 2X1RA 1IIGA 3I65A 3N2MA 1PCWA 2NUYA 4AEOA 3PBWA 1RPXA 3GNDA 2WV8A 4IJBA 3GXNA 3M44A 5HR6A 1W5QA 2NUWA 3UWWA 1V7YA 2A4AA 5E1QA 3ZS4A 3CWNA 1G4EA 3NPVA 5K9XA 1Q3NA 3Q58A 5AB3A 3NVTA 1H50A 1IF2A 3CB8A 1W5NA 4U4MA 4A2SA 1ZFJA 1GYLA 3BLFA 4MY9A 3UY8A 2ABBA 2B7NA 3ABSA 1XDMA 3U6WA 3QYQA 4LVAA 4E0CA 3SGUA 2R14A 1GVOA 1GZGA 3B05A 4LY8A 1KTBA 4LVDA 2PRMA 4Z0JA 4UMBA 2WNZA 1SO4A 4DELA 3GXPA 1ALDA 3LCFA 4LWWA 3DENA 2GQ8A 2VOMA 1IXNA 3WJYA 1EUNA 3E96A 1AL8A 3N9SA 2XN0A 4S1FA 3G0XA 2DORA 1DOSA 2QF7A 2OT1A 2RDTA 5EKYA 4O0ZA 3TMLA 4NZJA 1ML1A 4UTTA 3TQ0A 5H91A 1FBAA 3HJZA 2VENA 1XBXA 4JTTA 3B0UX 2YW3A 4E2DA 3GKFA 1LOLA 1Z48A 1TPC1 3M5YA 2ZBTA 5D33A 1OFBA 1EUAA 3IV3A 1U5JA 4HT3A 3G22A 3EX4A 3M43A 1HTIA 4JTJA 1TQJA 2B7QA 4M19A 1XDLA 2A7RA 1RZMA 1K7XA 4MVAA 3M5ZA 3B03A 1A5AA 3DHDA 3QH2A 1KFJA 3TROA 3DHFA 2CFFA 3PUDA 1OFDA 4K8HA 4M7TA 4GC4A 2FDSA 3EX2A 2J9ZA 4JTLA 3IGXA 2FB2A 1SW0A 3W7CA 4UTTC 3NAVA 4NXKA 2WNQA 6TIMA 4JX5A 2DZXA 5FEPA 2Z1BA 4ALDA 4GBUA 1K03A 1PE1A 4H3DA 5AHNA 3OVRA 1LTDA 3CHVA 2Q3OA 2B7OA 1DORA 3G1AA 5EMUA 2BSLA 2QDHA 4UR8A 1G7UA 2RDUA 2GPTA 3HQ1A 3NZ1A 3SY5A 1G69A 1K8YA 5AHEA 3LDVA 3A5FA 4JYFA 5HUPA 4XKYB 4QNEA 2ATSA 4EF8A 1X1ZA 3T7VA 1JR1A 4YLWA 1LDCA 4BI6A 5G5IA 5D05A 3ATYA 3T40A 1CI1A 4M6PA 3F4WA 3LB0A 3PBUA 1L6WA 1KV5A 3FJLA 1QOQA 2A7PA 1FWSA 1WQ5A 3JS3A 3W3OA 4AHOA 5KSWA 3FYOA 2RFGA 2G5WA 1FDZA 5BRBA 4O53A 4FNUA 1XI3A 1WYIA 5F4SA 4QIUA 3EEGA 5HWMA 1B57A 2AGKA 4PC8A 3DBPA 5BNKA 2BXVA 1JCJA 3STCA 5I3KA 4CNPA 4JTUA 3VCRA 4HHPA 1H61A 3TMQA 3W72A 2DZPA 3GIYA 4DBEA 1KV8A 5AHFA 2BTMA 2E09A 3A9IA 1ME7A 5KZDA 1FCUA 1FQ0A 5CPNA 1XXXA 4LVBA 2ZFAA 1LOQA 5DXXA 1JJKA 3EWZA 4TIMA 1WBHA 4PL2A 1FWNA 2ZTKA 2E6YA 5HQEA 4AAJA 3W75A 4NT0A 3IGSA 2NXGA 4AHPA 2TYSA 2ZQ0A 4N4QA 3UWQA 3G1VA 1XFBA 2V81A 1OYBA 3W1QA 3CU2A 3HGOA 4ORMA 1N8FA 1VGAA 2DZWA 4BFAA 1FXPA 2PRHA 4HKPA 4A2RA 3BG9A 4GXMA 4TX9A 2ZRWA 2IQTA 3LHZA 3TSMA 1VLWA 3L0KA 2Y7GA 4FXSA 3TW7A 2V5BA 3NQEA 1I45A 4GUIA 3W1TA 1J2WA 4IX0A 1ZENA 4HNNA 4IMDA 2WQPA 2QCFA 4EOUA 2A0NA 2G95A 4OQVA 3WK0A 3U2OA 1QPOA 2OZ0A 3W7OA 3W7DA 5L9FA 2O7SA 4LRTA 3BK0A 3P60A 4OGZA 3HG3A 2Q3RA 1GTEA 2QJIA 1ZNNA 2QJHA 3QZEA 4UFLA 2WSYA 2ALDA 3RLUA 1I2PA 3NPUA 3NQCA 1PVNA 4O54A 1KW1A 4I7VA 3VI2A 1KFEA 4WJEA 1FCBA 3PR2A 2WNNA 3W1PA 3HB9A 5CZTA 1XKYA 5TBOA 4O14A 3GDKA 2VFEA 1X7FA 2GUUA 3WK1A 3SFKA 4RV8A 4ZQNA 1S5VA 1TTPA 4UTHA 3MYOA 3UPBA 3DFQA 3MHUA 4LVGA 3W1NA 4C1KA 1JUEA 4A22A 3DZ1A 1ICPA 4NU7A 1KFKA 4W9TA 4IQLA 1JUKA 2OT0A 4QNWA 3TKFA 3B8DA 3L21A 3RK8A 2AQWA 5DCDA 3LTSA 4FHAA 1Q45A 3KAOA 4NJGA 5LZLA 3IIPA 5I3FA 1JQVA 3ABQA 1TPVA 4UTUA 4UTWA 4M7SA 4WY0B 3NGJA 1FWTA 3QQ1A 4FIQA 2BLEA 2Y7DA 3UWVA 1X6UA 3IVUA 1OX5A 2Y7EA 3RLVA 5ABTA 1D3HA 5I3JA 5DBTA 1XUZA 4UTMA 1CX9A 1VPXA 2Z6IA 5AHIA 1EP2A 1ONRA 3LTYA 4N6EA 2ZZ6A 5AHMA 2ZZ7A 3Q2DA 1T99A 1FWRA 1I2QA 1Q6RA 1YDNA 3S5OA 1QDSA 3O6CA 2F7FA 3NQDA 2QJGA 3TXZA 2PURA 3W7GA 4KKXA 3KHJA 3C8FA 3MWAA 1W1ZA 3QMTA 1VYPX 2NXIA 4UFMA 2KZHA 1ZAHA 1ICQA 3KXQA 1ZY9A 3TFXA 4RZ6A 5HJLA 4ORIA 3TFCA 1DBTA 4WQ6A 1GEQA 1QWGA 1YTEA 4PA8A 1S5TA 1QOPA 5U4NA 3B06A 4R33A 1UCWA 3T78A 4FX6M 2Y88A 3JR2A 3CT7A 1YXYA 2EGZA 4WY0A 3NQAA 2QAPA 4MKNA 5LKYA 4QITA 4O1BA 1P5BA 3QJAA 5DY2A 1QR7A 4FIRA 3TH6A 2AAMA 1W0MA 1VYSX 1Q6QA 4UTIA 3RMJA 2H3DA 2B0MA 2E6FA 2FLIA 1NF0A 1SR9A 1E51A 1G6CA 4FO4A 3LRLA 4TMBA 1NVMA 1F76A 5EA9A 2Y6ZA 4O11A 3LM7A 3O8AA 1V5XA 4MPQA 4OWGA 4JTFA 1EIXA 3DI0A 4LTSA 3WK2A 5AHLA 5FF4A 2QCCA 1JVNA 5CPLA 2PE4A 1W56A 1MO0A 3DFTA 5LGZA 2E1DA 1S5WA 2V0TA 2FPTA 4DXVA 3PG9A 2ZZ3A 3W7KA 5FF0A 1P0NA 3NM1A 1AW1A 2CLOA 1UBSA 2W79A 4NXSA 4UFIA 3PG8A 5FEWA 3PBYA 5G4WA 3I6RA 2C15A 5CPMA 3L68A 3W1MA 1JULA 3GB6A 1PIIA 3TCEA 1ZHAA 1JCXA 4ZQCA 2H8XA 3QSRA 3FJ6A 2DU2A 1UUMA 2VC6A 1M7PA 3GYEA 4NJHA 5BMWA 1N7KA 4JTIA 3R8RA 1P0KA 3MI6A 4X22A 5D2TA 4GUHA 3W70A 4O50A 1VS1A 3EKLA 3OEXA 5H2ZA 3PVFA 4JGDA 5F2IA 1KM2A 3CEUA 3M9YA 3ABRA 5K9CA 1Q6LA 1H7NA 3UNDA 3W74A 1EPXA 3TW6A 4FNQA 1OF8A 2BZNA 1J5TA 1YXDA 4Z1DA 5EPDA 3W7LA 4BI5A 3HG4A 2NX9A 3QEZA 1YADA 4NUWA 1I2RA 4PH6A 3DFOA 1TJPA 5D2XA 4JYDA 5FF7A 5HR7A 1BKSA 3I7QA 3DFPA 3UYCA 3NG3A 3W85A 4K36A 2C14A 4HNUA 3TA6A 1F2JA 5DCEA 1OK6A 3L0GA 8TIMA 5CG7A 1VCFA 3PSVA 4QM1A 5F4WA 1TYGA 3QM3A 5D2VA 2HS8A 3SECA 2Y7FA 3O15A 3C0JA 3G1DA 2YSWA 3L5AA 1SFLA 3PUOA 3EXTA 3E9AA 5D02A 3LBMA 4UC5A 4QISA 1UASA 3DKLA 4C1LA 2YYUA 3Q37A 1RD5A 1OX6A 2JBMA 2FPVA 4AVFA 4IX2A 1RQEA 5K4XA 3VE9A 3L5MA 3H55A 4JXCA 2Q8LA 1JCLA 2V2DA 3EX6A 4JX6A 4WUIA 4LNYA 3W2MA 5KZMA 3LCIA 5CKSA 3EWXA 2E5BA 1TREA 1QO5A 1YPIA 2A5HA 3QPYA 3L2IA 3LCWA 5KINA 2ZA1A 4PL1A 1KBJA 1JQXA 2EF9A 3SI9A 2GJNA 3HBLA 5BMXA 4QJ1A 4JYEA 1KTCA 3LV5A 2HSAA 1TRIA 2Y63A 3BW2A 2A21A 2NX3A 4UFHA 4K39A 1R2TA 1ZCOA 4EF9A 2V82A 1LCOA 3THAA 2V30A 3HIJA 4DF0A 2E5DA 3A22A 4N6FA 3F4NA 4H4IA 1VC4A 3NPXA 2P10A 1VH7A 1GPWA 5LNVA 4TR9A 4MYXA 2WJZA 2GQAA 1GVSA 2QCDA 2ISVA 2J24A 1ME9A 3MBDA 5G4EA 1DKWA 1FX6A 3ATZA 1VHNA 2TMDA 4P61A 4UTLA 3TE9A 3PUEA 2QR6A 3LHTA 3R2GA 5DBUA 3C2VA 3LOTA 1VYRA 3E12A 4JX4A 3P7YA 1T96A 3W7RA 2P0OA 3S0CA 3BARA 4HPXA 5K7JA 3W7NA 1ADOA 3IRDA 1TV5A 4CCEA 5K4ZA 3S5YA 2H6RA 3EWWA 4ADTA 3KVLA 3LXCA 3SW6A 3PBVA 3UZJA 3C2EA 4LT9A 3IIZA 2V2HA 1OX4B 1B4EA 4MFEA 4KFOA 2QCGA 3P80A 1HG3A 3NXFA 3LRKA 4XBKA 1VRDA 5GVJA 5CPOA 3W7IA 4NQ1A 1OABA 2YFOA 3MI3A 4Z1BA 4Q33A 5AFDA 2Z2UA 3M0ZA 3GKAA 4K8EA 4O17A 4AH7A 3MP3A 2V5LA 4ZMGA 1QCWA 1P1XA 5IM51 1NEYA 3MP5A 2ZCGA 4IXXA 4ZVJA 2RHGA 5EBUA 1TV7A 1F73A 3QSTA 3BGJA 3TU9A 3IGUA 2JGQA 1G4PA 3C52A 5G2HA 1H1ZA 1QAPA 4IMFA 3USBA 3W7HA 3TK7A 4CCDA 3TR2A 1LOSA 4JIQA 3QF0A 3P8IA 4RCXA 2BX7A 3QW4B 4TO8A 2ZZ5A 1YDVA 4RKAA 2CLLA 4MFDA 4BI7A 4JTSA 2CLHA 4Y96A 4AB4A 3CQ0A 2NV2A 2WO5A 3GDMA 4FNTA 4KFNA 4O8RA 2ZRYA 3EWBX 5KTLA 1TCDA 5D09A 3U8GA 4KWWA 2FIQA 1EP3A 4CQ9A 2Y89A 1MXSA 1A53A 3KRUA 4NNAA 1DV7A 3G8RA 3SIZA 1A5BA 4O15A 4TU1A 4WOZA 1TPDA 4GE8A 3MJYA 1NSJA 3NQ6A 1NF7A 3H54A 2C0AA 1BWLA 4LV4A 3LLDA 5BOOA 1NAL1 5AOUA 2B7PA 1GOXA 1F05A 4ZZ9A 1F5ZA 1LBFA 3LV6A 3QQ0A 1XCFA 2G97A 4LW7A 3GAYA 1ICSA 1TB3A 4Y6GA 2QAFA 3DFNA 3SZ8A 2R91A 3EWYA 2ZDRA 4O0KA 3TV8A 4FNSA 1TPWA 3GX9A 3N34A 3CTLA 3CEPA 1W5MA 2YYTA 2FQIA 2OJPA 4JTEA 4MYAA 3G1YA 2HMCA 1XC4A 3PB0A 3NDOA 4AXKA 1WBJA 2DJXA 3ZFHA 3NL2A 3B4UA 1KFBA 3FOKA 1F7BA 3MHGA 3HG5A 3LCLA 4JICA 2ISSA
chains in the Genus database with same CATH superfamily
4XAFA 2HS6A 3FXYA 3NQFA 2BOFX 2OLSA 4ZOCA 3R79A 2GSEA 3BLIA 2V5CA 3NSNA 3S5SA 4PB5A 2CKSA 4GX9A 2XFRA 2CLKA 3SQLA 1EX5A 3WNPA 1OYCA 3RO8A 3APTA 4JN6A 4K2SA 1NARA 1KWKA 1UA3A 3BG3A 3LHYA 3O07A 1XIGA 3HPAA 2FPYA 1K7FA 2CZVA 4CCCA 3IACA 2NQJA 2YOCA 3QV8A 3H7UA 2ZX8A 1L6SA 5FF2A 1MW2A 4QG8A 1PYMA 2ANUA 1OG0A 3AMGA 3NCOA 3VKKA 2RDWA 3VILA 5A5WA 4BWLA 4CN4A 2A7NA 2REQA 4GXWA 3AJXA 1YHTA 4LVFA 3I68A 4PMNA 1LJYA 2VT0A 3ZWTA 1VIZA 3DHUA 4IIEA 3COTA 3VX0A 3CV6A 5D32A 1IHIA 3SBFA 3PFRA 3RITA 3AHYA 3REQA 5F2LA 4ZO8A 4H7ZA 1TV8A 3N73A 4GCAA 1UWAA 2XFYA 5FSDC 3KUMA 3WD0A 2V8ZA 2C6QA 3W01A 5DY3A 1O95A 1B9BA 4A21A 3CASA 4TVUA 3VAVA 3W53A 3CPRA 2WKGA 3UXAA 3G3MA 1K77A 5CG0A 1IT0A 1OFQA 2E77A 3PZOA 4Z0SA 1QPNA 4O18A 1GOOA 1UR8A 3B0XA 1FWWA 4MJ4A 4S2CA 5JMUA 5D4YA 4IISA 4O1EA 1N8WA 3WQPA 3EX1A 4B3KA 3RLHA 3AUJA 3PF3A 4ADUA 1OX4A 3ZWSA 1DXIA 3UZ5A 4JTKA 5H8MA 4DO4A 3PAJA 5HUOA 1WAWA 3AHVA 1BTCA 1JZ5A 3DECA 4YVVA 3WF4A 3H70A 3URBA 2FZNA 3RPDA 1QASA 4WK9A 2PP3A 3GNNA 1I1XA 1QNOA 5D30A 3BG5A 3FJ4A 3OU8A 4ML9A 5IFTA 1B4KA 1H60A 3QW3A 4QG6A 1WDDA 4RXFA 3W27A 3W38A 1WZMA 2WPBA 1E71M 3WQFA 3LLXA 2YFNA 1SZFA 3T8QA 2A3CA 3NL5A 4UTJA 2VMFA 3BL3A 4IIDA 1P43A 3TCSA 1SUXA 2Z2BA 3FCPA 4UZSA 1IXPA 3TNOA 1V3MA 4V28A 4ZBCA 4UFKA 4RW5A 3TQPA 5IFPA 5FAJA 3UCQA 4KGJA 3PS7A 1ODZA 4PODA 3PJXA 5FEXA 2XM1A 1J9YA 3T1GA 1W9DM 1XIDA 1ZBCA 1ONWA 4JEQA 3UY7A 1SPQA 1YNPA 2J9YA 1DXFA 4WOQA 4RV3A 3AALA 1Y0EA 3CUZA 4H9XA 2QZRA 2J75A 1GTHA 5DLCA 2OU4A 2WWCA 3GSMA 3M0KA 3NO3A 4IICA 1E5JA 1HKVA 1XW8A 4YHGA 2FH6A 1X8FA 2OKOA 2EPOA 3W7MA 3IK4A 1SZNA 3DG3A 1Q4NX 5F1VA 4IXHA 2HVOA 3U2ZA 5HWNA 1B31A 1LLZA 3TUUA 3V18A 1HKIA 3P82A 4MDPA 5J8LA 3KDOA 1FDYA 4R53A 1Q2SA 2E7FA 4LAOA 2GSJA 5IHRA 3W83A 4H19A 1QFEA 3KEHA 4DEFA 4CD6A 2EAWA 4IZGA 1W1YA 4D1JA 3GFXA 1TRDA 3WQ6A 4CLMA 4AMAA 4MHBA 1IXQA 4DNHA 4YVPA 1HQTA 1KCLA 3ITXA 4X9SA 4W8LA 4ICCX 4JN7A 2CITA 3I7SA 4MNJA 4DX3A 1PDYA 4HYVA 3RU8X 1CXHA 1AK5A 3IV8A 4JQ2A 3QOKA 3BV7A 1QBAA 2D69A 3OZMA 3THUA 5FA5A 1SVDA 4Y8EA 2PGFA 2TODA 2X0YA 3IJ6A 4TV6A 3DN5A 4DUWA 3M7WA 3SCRA 2HRWA 1JZ6A 4JPGA 4WSHA 1K8CA 3HZ3A 2YBUA 4KRTA 3NTYA 5GNXA 3GDLA 3ME3A 4B91A 2QUVA 3QVQA 1EO5A 4AIBA 4JD4A 3N11A 1E5NA 1MEWA 3ITLA 5FJUA 4UOQA 1OFPA 6A3HA 4PTVA 2XH4A 6CGTA 1U30A 2OFJA 4L4MA 1B3ZA 1QWKA 2TPSA 4NJKA 3BAIA 2ATMA 5D8ZA 5M3WA 2Z24A 1MZHA 3A24A 1EA0A 5HMDA 4I9AA 5A2CA 2V5DA 1HIZA 4N4PA 1JF5A 2H9AB 2EPMX 2ZRZA 3GLCA 3HV8A 2WQDA 4HCHA 5A6SA 2FZMA 3KL5A 4JY8A 3EMZA 1XLCA 3C3NA 3L4ZA 2DZAA 3EXSA 1XYLA 4DJFA 4NI3A 4WKHA 2D22A 1MI3A 2JGYA 5ECVA 4Z2LA 4Z1CA 2NLIA 1H1YA 3GXDA 3ZYZA 3WQVA 1KGWA 4JNMA 3VYLA 5C7HA 1LG1A 3W1LA 2ISWA 3ZT6A 4WGHA 4S3GA 4EANA 5HMEA 1XR2A 1H7RA 2F61A 1WE5A 1XJBA 4CD8A 2VEPA 4P8UA 2UY2A 3OVPA 1CXEA 1TCMA 3TAOA 5HQMA 5LNSA 2QCDB 3UWYA 1ENUA 4Y9AA 1JCNA 4C6LA 1W9UA 2YX0A 7REQA 4AEEA 3MVTA 3QY6A 3GG1A 3PSWA 2H90A 4NVTA 5CC3A 1JAKA 1OK4A 1KQYA 2CLPA 3WZ0E 3S1VA 4A05A 3W0KA 1KM4A 3QV9A 4UNLA 4WD0A 1HFBA 3TN4A 1AZ2A 5A8PA 4UCGA 2WBGA 1D9EA 1SMAA 3LN3A 2BFGA 4C6KA 2XU2A 3W7PA 4HA4A 1IR1A 3E0IA 5C71A 4KH2A 3EOEA 2X1UA 1KQZA 2W3ZA 2NWRA 4C90A 3NQ2A 2X1TA 3OVQA 3BO9A 4I7UA 1V6TA 2VGGA 1UUOA 2JKEA 3VIPA 3T55A 1HGYA 4N02A 2FGZA 3VC6A 4GVIA 3MQTA 4F9DA 1EP1A 1YBQA 3MA8A 3RIKA 2ZUWA 3E6EA 4HOZA 4LV9A 3DYOA 4PB3A 3CL6A 2VRKA 1NOUA 2DIEA 4ADSA 1AH3A 3R12A 3PP7A 4AWUA 3WQ4A 1JUBA 1Y5XA 4HCLA 2JKAA 1AA1B 3W87A 4X3ZA 4HZ6A 2TSYA 1VCVA 1ISYA 4RE3A 4EVZA 1FHDA 1THFD 3S47A 4LCSA 2ZZ1A 4K1WA 4S3BA 1Y5WA 1O5KA 2XIMA 3PZQA 4JIRA 1PL9A 2NX1A 1SQ7A 3ZXWA 1QMLA 4KGLA 2LLEA 3LNPA 2HZGA 3N1AA 5HMSA 5HOSA 4OVXA 3RYSA 3UP8A 3G2GA 3VCNA 3V5CA 2ZVIA 4IUOA 1L2UA 1QPRA 4W88A 3C0SA 3W22A 1GVRA 1V93A 2VJXA 4A8RA 4GIYA 4OBSA 4PE8A 1TQXA 1G01A 3OA3A 3VM5A 4FOUA 3KBWA 1ECQA 3NL6A 5C9XA 5LSMA 1C93A 4FNPA 2WKJA 5I03A 4QR6A 1V51A 4Y90A 3UT0A 3WLTA 1Z41A 3M07A 2D0GA 5IBXA 3GC5A 3KP0A 1WDQA 2HTMA 1JPKA 3CZLA 4BR1A 4FR6A 1AMKA 5EGRA 3CNYA 2I5GA 3E0FA 4NJJA 3GXIA 4D71A 4OV4A 1IEVA 3LENA 3S46A 3N9RA 5MKGB 2HQAA 2D1ZA 1T40A 3K8KA 5BXPA 2CZDA 3QFEA 3FDKA 2XN2A 3ZIZA 3K8MA 2Y5EA 4GD0A 1MEHA 2OB3A 4GISA 3V3WA 2C19A 4K6AA 4I9TA 2VDGA 4X2RA 3GE7A 1FWJC 4QSHA 3V75A 3O63A 3U3HA 3AWNA 3OZOA 1UR9A 2ICSA 4LAKA 1LG2A 2BODX 3L7RA 3TJLA 5I07A 2IW0A 4V15A 1EC7A 3KBSA 3EZ4A 1EJWC 2XIJA 4Q8MA 4WIWA 1UPMB 1TWSA 3CMFA 5REQA 3CUGA 3KP1A 4ONVA 4GRSA 1T41A 2YL9A 4C65A 4PMDA 3SGZA 3G0UA 4PMRA 2VFDA 4WDTA 1UWIA 3TIMA 2ZUVA 4MY8A 1FWDC 4ATLA 4F9JA 1GVFA 3WH6A 3M47A 2UY3A 2CBUA 2RJHA 3PTQA 2CLEA 4GNVA 3MSRA 1PV8A 4FA3A 3M0YA 5DMLA 5D2YA 4HNTA 3RF9A 3W6MA 2R1PA 3VC5A 1X7IA 1MW1A 1R3TA 3HFTA 4ICNA 3C0LA 3UXDA 1E56A 2O55A 2WYSA 1FXQA 3D6NA 1RBOB 4NKCA 2DP3A 3VKJA 3HGJA 3H4WA 1P7TB 2HE8A 2QCMA 4B5XA 1C8VA 6ALDA 1AQFA 4WVXA 3VNJA 3H22A 1IIHA 1Y5VA 3LPPA 1OF6A 5IRPA 1OFAA 5LIXX 3AFBA 2WSRA 1VLIA 3DXIA 3HPSA 3OA5A 3BZGA 2X05A 5FJRA 1VFSA 1TTIA 2JIEA 1Z44A 2Y1HA 3EB2A 1UR3M 4PEEA 3TC6A 1B3OA 2BVTA 2ZADA 2QULA 3JZUA 2D0FA 4FOKA 2YL5A 1JYWA 5TF0A 9CGTA 5EYWA 4INFA 2OGYA 2CESA 2PF0A 2FZBA 3TX9A 1SZEA 3BLLA 4J9JA 3N14A 5D8WA 3DKJA 3C2YA 4M81A 4IFRA 3TC3A 3NOEA 4QXIA 1DJIA 5HQLA 2X42A 3KCLA 1MQPA 2GGEA 4PEKA 4E8GA 4MWAE 4CQAA 3B8IA 3MUAA 2J4GA 3WDIA 2RH9A 5A8MA 2UZ9A 4E4FA 4UTWC 2AQOA 1HJQA 1I0BA 4LBSA 4DPQA 1R3VA 3P74A 2GDVA 3TTOA 4Q8UA 3TQKA 2ZXAA 1YLVA 5T9CE 1CGTA 1H11A 1JZ2A 2QCHA 5ABFA 2YA1A 5C0QA 1E70M 4RNJA 4J1OA 4JDYA 2VFHA 1W37A 3UZXA 1F8IA 5C5YA 3VIKA 5A6BD 3KWSA 3SJNA 5D2WA 1F07A 2GWNA 4TUFA 4TTUA 4W4QA 1UG6A 3AXMA 3I7RA 3QXBA 1RVGA 4K7VA 3GH4A 2I9EA 1AL7A 2GJLA 4KWVA 3AU6A 3W1XA 2RGMA 2G8ZA 4ICMA 3VIGA 1H5YA 3N2BA 3I10A 1ZP4A 1EQCA 2YXXA 3W1RA 4Y9NA 2B31A 3EPNA 3N12A 4OE7A 1DVJA 1ZP3A 2VDHA 4QE5A 4YVXA 2PC8A 1QI5A 4MNLA 3EOUA 4RR4A 2DVXA 1RD6A 2FB3A 3GM8A 1US2A 4HHMA 4DF2A 3C4UA 1KM3A 5U7SA 3L9CA 2Q71A 2QW5A 2G3IA 7TAAA 3WENA 2X09A 1H62A 1R2RA 3I65A 4CD5A 2VGBA 2NUYA 3VINA 4AEOA 1MNZA 3T42A 3NURA 3PBWA 3L4XA 1RPXA 2NLYA 3K46A 4H9VA 1HKMA 4GK8A 1H1NA 3UWWA 4EPBC 3OQ8A 1G4EA 4AU0A 3NPVA 1Q3NA 2OO0A 4XZLX 3AYRA 3I4EA 2AKMA 1H50A 1W3LA 1ZFJA 2DH3A 1EHNA 2CCRA 4MY9A 5C9RA 5M17A 2B7NA 4UNIA 4CNTA 1A49A 3NGFA 4LVAA 3EB3A 2WC4A 1CGWA 3B05A 4LY8A 1N82A 1KTBA 3BAYA 1NFPA 2ZUNA 1SO4A 1H0IA 2WLZA 3B0YA 4GY0A 3BWWA 4LWWA 3ITVA 3PPCA 3VNZA 1V8EA 4PMZA 4WDXA 1EUNA 2PDGA 4O1FA 4H9MA 3E96A 4ML4A 1AL8A 3R1ZA 1BQGA 1V0NA 1V3KA 1XWYA 1I6NA 3UXIA 4LAUA 4DBUA 5FCZA 3TN5A 1C92A 4NZJA 4UTTA 3TQ0A 1HX0A 1FBAA 3HJZA 1GHRA 1XBXA 1RY8A 3B0UX 2DUZA 1V3LA 2ZBTA 1FFRA 5D33A 1EUAA 4GH1A 1CECA 2Z1WA 3IV3A 2P50A 4EWJA 4JFSA 2FZ9A 2GK1A 3SB0A 3EX4A 4ROQA 1TQJA 1I1WA 3GBEA 1GVYA 3B03A 3T4WA 1PBGA 2I17A 3PUDA 4M7TA 4GC4A 1GQKA 2FMNA 4C7DA 1OQFA 4ACYA 1ZBKA 2O9RA 1MW3A 2FB2A 1SW0A 3W7CA 4UTTC 5H1WA 4C6MA 1UWUA 2UWFA 3B9EA 3NAVA 1VEPA 1AQHA 1W3JA 1ZS2A 3E0WA 1DWHM 2ACRA 5FEPA 3BGAA 4GBUA 2ZDSA 4ALDA 4GZJA 1VKFA 2A3AA 4EAYA 4UR8A 1T7LA 4WSJA 3HQ1A 3KS6A 3GHSA 3A5FA 3CAWA 4NIRA 2ATSA 4EF8A 1X1ZA 4P7QA 1LDCA 5G5IA 1ZBVA 3T40A 2Z25A 3LB0A 1XLGA 4MM1A 1L6WA 2Z1SA 2A7PA 1OINA 1WQ5A 4YWSA 3ZMRA 3FYOA 3UXKA 1EJXC 1XI3A 1S46A 2VGIA 1DE6A 2ZE0A 1B57A 1XLAA 2AGKA 3K1DA 3DBPA 3C3UA 3TP4A 1C7SA 1JCJA 3STCA 5I3KA 2ADAA 3VCRA 2BB0A 4JZ5A 3W72A 2DZPA 1KBBA 5H6HA 4D6GA 1FCUA 4S3AA 2G3FA 1UQYA 5CPNA 2ZFAA 1LOQA 5DXXA 5AC4A 2VC7A 4ZTXA 1I60A 3H4GA 4K3ZA 2E6YA 2BXZA 2DT3A 5PTDA 4RZBA 2NXGA 4AHPA 4J3UA 2TYSA 5I24A 1E6QM 4N4QA 3G1VA 2C1GA 3KOXA 1XFBA 2V81A 3WLSA 2HCVA 3FHAA 3GHRA 3CU2A 1VGAA 2GLKA 1R9YA 5EB8A 4BFAA 2PRHA 4HU0A 3UG5A 3BG9A 1ZLPA 3LHZA 1VLWA 4UB9A 4FXSA 5CJMA 4ZOAA 3W1TA 1W1VA 1POJA 1J2WA 3O3RA 2HXUA 3BDKA 1E6ZA 4IMDA 5RUBA 2WQPA 4R5EA 1D8CA 1XQKA 4OQVA 5CZKA 4JIHA 1QPOA 2GK1B 1OB0A 3MC5A 4QDMA 4ROPA 4Q4PA 2O7SA 2ZIDA 2Z28A 1ZNNA 4H83A 3GIPA 4DUXA 1I2PA 3UVAA 1PVNA 4KWUA 1KW1A 3LA4A 1TJ2A 2VOTA 2NT1A 3SUUA 7XIMA 1XKYA 5TBOA 3POCA 5XIAA 3NO1A 4GABA 4W5UA 3LSCA 1S5VA 1CYGA 1TTPA 1YW1A 2G3JA 1ISZA 2EJAA 3DFQA 4LVGA 1JUEA 4HNLA 1SM9A 3DZ1A 4DJDA 3VFCA 1KFKA 1OCJA 1REQB 4QNWA 3KOWA 4DYKA 3MUCA 3LTSA 3MTWA 1Q45A 4FXJA 1BFNA 1EOKA 2V67A 5I3FA 3H2CA 4Q7BA 2DZBA 3W4RA 4UTWA 3A4JA 2GUYA 4M7SA 4IQDA 3QQ1A 1RXOB 2RGLA 3PZIA 4LPCA 1HGWA 2V3FA 1Q6GA 1OX5A 3BAJA 4PUDA 5DBTA 1XUZA 4UTMA 1J0YA 1GOKA 1VPXA 2IPGA 1EP2A 3AS1A 3SCWA 4BQ5A 3LTYA 2ZZ6A 2XM2A 4Q8PA 4KEUA 1T99A 3TWAA 1Y8BA 1I2QA 4K8GA 4DZIA 2PWUA 3O6CA 2PDKA 2F7FA 4UOJA 3TXZA 2PURA 3W7GA 1KKRA 4XAZA 2EXOA 1S2VA 1RUSA 3C8FA 1W1ZA 4MF4A 4MB5A 2J47A 4F40A 3ZOAA 3QR0A 1ICQA 3KXQA 5M2FX 4RZ6A 1E73M 5HJLA 1YEYA 4F0RA 4ORIA 5E9AA 4WQ6A 3CH9A 3R94A 4PA8A 3PANA 1GW1A 3B06A 3T78A 2ACQA 3JR2A 1YXYA 2CBIA 3NSMA 5D9PA 2DVTA 3BZJA 4KERA 4U5KA 4QITA 4O1BA 5DY2A 2NSXA 5HNUA 1EDGA 3S3GA 1ZZMA 3UYIA 1K4HA 1YQ2A 5CGMA 3ICJA 1OWQA 1NF0A 3PBMA 1NM9A 4FO4A 3LRLA 4GVGA 3OYXA 3TTQA 4HK7A 1GKRA 5EA9A 6TAAA 4WHBA 1HKWA 3A9BA 2PE4A 1MO0A 2C79A 3OHMB 3QV7A 3W25A 1E0TA 2OZ3A 3PG9A 3W7KA 1P0NA 3NM1A 4B5TA 3EPMA 3CQKA 4XKMA 2VWTA 2CLOA 4LEQA 4JBRA 4WEVX 3PG8A 5FEWA 2XWDA 4GKLA 3PBYA 1JNEA 4D6EA 2C15A 3L68A 1P0EA 3GB6A 4TV5A 4AD3A 4HZ7A 3FJ6A 1UUMA 4GHRA 3R8RA 1P0KA 1V08A 1C8XA 3HPFA 4FXFA 1NWTA 4XVEA 4O50A 3EKLA 3ZT5A 4DB7A 4HHLA 1KRBC 4JGDA 3KDNA 1KM2A 2A3EA 1U2YA 3ABRA 3SCPA 3V16A 1SR0A 3WX7A 4FNQA 2P8CA 5HAOA 2EG7A 3DBNA 2OLAA 3CUXA 4H7CA 4Z1DA 2NQ9A 5CLTA 3QEZA 1CCWB 4W8BA 3AMDA 4PH6A 3DFOA 3F5LA 4NZ3A 3OZPA 2IKGA 1BKSA 1UROA 3W85A 1U5HA 3AICA 5HANA 3TA6A 1F2JA 4ERGA 3QLLA 1CLXA 3W29A 5DCEA 2QDDA 3DYPA 6REQA 4Z2JA 4FAMA 2WBKA 3S1GA 4QM1A 1E9YB 4P7OA 4M0XA 1V6UA 3SFWA 4X2PA 1RP8A 3G1DA 3WLRA 3W28A 1SFLA 1L8NA 2F38A 5D02A 3A13A 1TMQA 1ZL1A 1RD5A 3RLGA 1OX6A 4DLMA 4AVFA 3MJMA 3L5MA 1VBJA 3H55A 4JXCA 2PBOA 2Q8LA 2OQHA 1JCLA 3SCSA 2V2DA 3SCNA 1BVNP 1VFFA 1K6AA 2E5BA 4JEJA 3GU9A 1TREA 1QO5A 3WH7A 4PUUA 3CQJA 2YLAA 1JQXA 4HB7A 4L1XA 3UXLA 1KTCA 2BOEX 1FWCC 3TN6A 4F4RA 3EOSA 3BW2A 2VZTA 4K39A 2GJXB 3BJSA 1XCXA 3NZQA 5I09A 1A3WA 4MKSA 2AL2B 3THAA 2FZ8A 2V30A 5DMYA 3A22A 4B4FA 1HJUA 1RP9A 2V5JA 2D2OA 2REQB 2DY3A 2V6AA 4GI4A 1VH7A 4BQ3A 1B0IA 1A3HA 2GQAA 3WDRA 5ABGA 1ME9A 1O68A 1K9EA 1XLEA 1VHNA 2TMDA 4UTLA 3PUEA 1XGDA 3LHTA 3R2GA 3C2VA 3E12A 2WMIB 3ZSSA 3BC9A 3AI0A 1AODA 1Z7AA 3S5YA 3FVMA 4ADTA 1GEHA 3UZJA 3GRIA 1XIHA 2PP1A 3BSMA 4DBSA 4PYSA 4UQ9A 1DWIM 4AZ5A 3LRKA 5I7GA 1JI1A 3AYVA 1VRDA 2FVLA 4ZTYA 5JQ9A 4AFYA 5I77A 5AFDA 3M0ZA 1W1IE 4AH7A 1UP2A 4UQEA 4MJ2A 1X8CA 2ZCGA 2RHGA 2WMJA 3QSTA 1XYCA 3H8AA 1CEOA 1MQQA 2Z27A 3TK7A 3TR2A 1LOSA 4RCXA 2WMKA 2BX7A 2J7CA 3SY8A 4ATDA 1DWJM 5HJYA 4H9YA 4HQVA 2D0HA 4MFDA 4IFKA 4JTSA 2CLHA 2PFHA 3WH8A 4LBUA 3XISA 3EWBX 3B8WA 5D09A 4LX4A 4CQ9A 5DQPA 1VF8A 4AC7C 3RJXA 3WNMA 1E15A 2VEFA 4NNAA 4AVOA 3KLKA 3G8RA 3MU7A 4J3XA 2A79A 4GE8A 3MJYA 3OG2A 3NQ6A 3H54A 2ZUMA 1WKYA 4JQAA 4HOWA 3CYJA 1YPXA 2G37A 3SCUA 4KWSA 1LBFA 2FTWA 3TLQA 3N6JA 3QQ0A 3C0QA 2J66A 4LW7A 3GAYA 3CV2A 1R3YA 2WHKA 2AMGA 3UJEA 2ESCA 3LNMA 3LBOA 4Q22A 4Y6GA 3UJFA 3GZAA 3ZM8A 3GX9A 3CTLA 1W5MA 2YYTA 4I5XA 4JTEA 1Q13A 1DTNA 2Z7KA 3NZGA 5DT7A 5E6YA 3B4UA 3FOKA 1F7BA 4YTRA 1DE5A 2PWFA 1E6RA 2VR5A 5AYXA 1VCGA 1NWUA 2XSXA 2ZA3A 5BXTA 1VHCA 2J62A 3PFMA 3LBCA 1JFXA 3R0DA 3N4EA 3REQB 3WG6A 1E0XA 4D2JA 1JYVA 3WQDA 3R0UA 3SCTA 1XLKA 1TVLA 3AJ7A 4MB4A 4FX8A 1XLMA 4DQWA 3WLHA 3ARVA 1LLWA 3OGRA 4LU0A 3LZ5A 4JTAA 3TONA 2C13A 3GH7A 3A21A 2EKCA 2HEJA 2GVGA 3ZO9A 1P0DA 3GIQA 4GUGA 4JFUA 3ZR5A 4JCLA 4W84A 2OGJA 3TNBA 2AKZA 1U5VA 4XZNX 1SO6A 2GUBA 3UQNA 4S23A 4WXZA 3W2NA 1BYDA 1SO3A 4JTQA 2VNCA 3R0KA 3O0FA 1NP2A 9RUBA 1VIWA 1L6YA 2XIOA 3QN3A 3SRHA 1QK0A 3G1FA 4LRSA 4QE1A 1Z42A 2E9MA 5AZ0A 4KCUA 1TTJA 3URAA 4IJRA 1DL3A 2XWEA 3IJQA 4IP7A 5A8OA 2CLIA 4BF9A 4RJEA 3VGDA 3AYSA 3Q45A 4I8YA 3CO8A 3P6LA 2ZX5A 4RX0A 3NZRA 2G50A 2VURA 4JR5A 4E3VA 3S6TA 1RQBA 3DC8A 1QTWA 1YBQB 2Y5SA 4S3KA 2OYMA 5CBBA 4ILSA 2YIHA 3WJZA 2AQVA 3WD1A 4DIAA 1HP5A 3LPOA 4XBJA 1WDRA 1QVBA 4LF2A 4R7JA 2C3ZA 3PZ9A 3TYDA 4S3CA 2NQZA 3GNRA 4KCTA 5E93A 1TE1A 5CH9A 2E9LA 4ECLA 3WJWA 3OB8A 3GUGA 4MIMA 1J6OA 3GYCA 4E3TA 3UGRA 2CW6A 3I3BA 1D7FA 1G67A 3AIUA 3L2MA 4XAPA 5JIPA 3H2NA 2J7HA 4PZVA 3IRSA 1BRLB 1W8SA 5LIWX 2R82A 3S5ZA 3NQMA 3WDPP 4AUBA 4NNBA 1QJWA 4Y9OA 1KM6A 3LGEA 1HL9A 4JKLA 5CBJA 2R94A 4C6CA 4Q4QA 4N7QA 3GTHA 2YZ5A 2P53A 4HGXA 4ATWA 4IPNB 3VKCA 2PCEA 4RDZA 3L67A 3VIFA 3LRMA 4MKVA 4GZIA 1OT2A 3FW6A 3PN8A 4ASTA 1W1B1 1JZ7A 3S1WA 4AD1A 4YNGA 3G24A 4Q8WA 3DH7A 4BHYA 1UH4A 4H8NA 3SCOA 1F6YA 3P3BA 1AW5A 2D2JA 5CPTA 3DCPA 3KL3A 3W6YA 4B5NA 5F2MA 4HSNA 4M1BA 4ZOEA 5BROA 3P84A 5CC6A 5AZ1A 5FJOA 4YTUA 1KFCA 4IGNA 1CZ1A 2Y70A 4IFKB 4CNSA 4Q8NA 1H7OA 5DX7A 1GNXA 3B04A 3ELFA 1AJ0A 2PDQA 3CS2A 1XBVA 2QNEA 4CVWA 1H7PA 1X96A 2A6LA 5EMJA 1DIOA 4F0MA 2ODOA 1AG1O 1GGOA 1TTQA 3DOPA 3CZJA 1X6LA 3T44A 2J27A 4UWMA 1I9CB 2XSBA 3NO5A 4OU1A 4LH8A 1M7XA 3W24A 5I3HA 4IQEA 4O1CA 3Q94A 3ANUA 4H01A 3BW3A 5DN1A 1F4AA 3U5UA 1TJ0A 2VI0A 3BQ5A 3IEBA 2BHYA 2P76A 5FACA 3AHTA 3RMEA 5EY5A 4FI4A 1P6BA 5AC6A 3A4AA 1E3ZA 4G7EB 4IT1A 2VXNA 5DANA 2Z26A 1PKLA 3BICA 3CQHA 4XK2A 3UG4A 5EL1A 4FX7A 1YNYA 4W87A 2NV1A 3HGRA 3PM6A 1VEOA 3UWZA 4W8AA 1WX0A 1D8WA 3W73A 3WBAA 4S2BA 3UJSA 1QNQA 3GG7A 5EMKA 4QROA 3QY7A 4GNKB 3W07A 2R8WA 1Q4WA 1ZCCA 1KC7A 3QFWA 5HPCA 1FDJA 1NWRA 2PLCA 1A80A 4O52A 3WBXA 4NY2A 1N55A 2YR1A 4FF5A 3YPIA 5I3GA 4QQ3A 3A47A 4US6A 2FHFA 2XZ7A 2PF8A 5GJMA 1T8XA 1BG4A 2NUXA 1CB7B 3FIGA 2PGWA 5GQBA 3ARYA 1E4MM 3TOYA 5TQLA 4LYPA 1BYBA 2X16A 5CSRA 1O94A 4R7WA 3A5VA 1WCGA 4OZOA 1NH6A 1KRCC 1UD8A 3WLNA 3LS9A 3N18A 1QI4A 1H41A 3U7VA 4IIFA 1VPYA 3VK5A 2DZUA 4FR1A 4B16A 4MOZA 1XFCA 1XIJA 5KMYA 3VIMA 4C6QA 4XQ6A 3HPZA 2X0HA 3DI1A 3OGVA 3FVDA 3P5YA 7ODCA 2YA2A 1XYBA 3IUIA 4A8LA 3QGVA 3OLGA 4H6QA 3G1SA 4ZQRA 4B92A 3UPMA 4MSSA 4N2YA 3WQOA 5HWJA 4MZ8A 3VNMA 3WDQA 4L5ZA 2GVLA 3HMJG 3CJPA 1QPQA 5BOEA 4A3UA 3VU2A 3OJGA 4C6DA 4Q6JA 3LLFA 4IMCA 2Z0IA 3W23A 3S2LA 1UKPA 2VKZG 2Q09A 3CIWA 2E6DA 1IE7C 4LALA 2VEMA 3VTRA 2OX1A 1PHQA 5E0FA 1H63A 3N2CA 3M7SA 1VFUA 2OXNA 1TJRA 3CT2A 2VCAA 3RCNA 2WSQA 4DJEA 1TMHA 8XIMA 3ARQA 1EWEA 1IZKA 4QAWA 2QPSA 2ONEA 4CGTA 1H7XA 3KLLA 3P8JA 3RCMA 3VD4A 3L4YA 3V35A 1C8YA 3G18A 2R1KA 4R27A 4UTKA 1HF6A 3V0TA 1DQXA 1UHVA 1V02A 4PR4A 1WOBA 4JL2A 1CW2A 1KXTA 3NIYA 1MRQA 2GVEA 4GJIA 9XIMA 2QUUA 1BKHA 1DQWA 2FFCA 3W76A 2QQ6A 3TTYA 3L65A 3WJSA 3VUSA 2QV4A 2H8ZA 1JRBA 1DXEA 3AQUA 6ENLA 4DJFC 3QTPA 4IG2B 4J3VA 3UBPC 3G8EA 1FA2A 2PGRA 3VD9A 4UMCA 2BVWA 2ACSA 3M5VA 4LEFA 3UG8A 4EPEC 1XBZA 3KE0A 1LT8A 3H21A 3B9AA 3JW7A 1JPMA 2PWEA 3FY1A 1S3HA 4MUZA 4AZGA 3NZPA 3QTGA 1IR2A 3NWRA 1T0OA 4L9XA 2RAGA 3SRFA 1OYAA 4IPPA 2BV9A 4HN4A 4C91A 1PX8A 2AGTA 4OKDA 5LXXA 2E68A 1Q6OA 3F2CA 3LXBA 1A5KC 3VKDA 2A1YA 1E9ZB 3FKRA 3N2XA 3WCZA 2BG5A 3THQA 4LYKA 1F8MA 1WOAA 2Z6JA 2HNEA 2GJPA 2P0IA 3TC7A 1A4MA 3T4CA 2OEMA 3HF3A 5REQB 3EEZA 3U57A 4IOTA 5FI8A 1C91A 1XP3A 4DF1A 1TVNA 1AW2A 4V2XA 3O6AA 5G1MA 3VE7A 3PC0A 3NXLA 4OTKA 4I3GA 4RXGA 3VKAA 4P2VA 4GQQA 2PC4A 4KIRA 2W62A 4EIVA 1YDYA 2I14A 3KBNA 3KRBA 4GKTA 4HU4A 3GFZA 1E43A 3WBEA 1L6FA 3WIJA 5D38A 2WM0A 3G77A 3W86A 1BWKA 1EJVC 1RLCL 3FEMA 3L23A 4JS3A 5JUVA 2WVVA 3LGDA 1OFEA 5DMNA 3N4AA 3QGKC 4ZQPA 4IMEA 4BF7A 1WKFA 1YE4A 3M6YA 4LUTA 4ZO9A 3IGHX 3T2QA 1P48A 4DO5A 4QAIA 3KOFA 1PWMA 2WWDA 1UA7A 3G3DA 1V7AA 1TPEA 4QJ5B 2JIWA 3W1AA 4KRUA 3KCOA 3IK2A 3WH9A 4ZE5A 2OMAA 1K9TA 5HINA 4MDOA 3CK5A 3GQYA 3GTFA 1NDZA 3M1ZA 1E6XM 4H2CA 4YXGA 2POZA 4GGBA 3C6CA 3OGSA 5LIUX 5LNRA 1K3UA 3L66A 1PZ1A 1R47A 3EXRA 5G1TA 4XZMX 2VYOA 3ZJKA 3PUGA 1UKTA 2QEZA 1PTAA 1SZGA 1LWHA 4Z1YA 4O28A 1WUEA 2ZRXA 3LYEA 2CXEA 2QDEA 2IPJA 3SCVA 1WB0A 2Z1XA 5A95A 5F4XA 4XKYA 5AYIA 4DI8A 4H41A 3TWBA 4DRSA 4HMDA 1WAUA 3GXTA 5FF3A 4FLSA 3T8LA 3G6MA 2C0HA 2X1SA 4HIBA 3ZQ9A 4NNCA 1IGWA 1ONXA 3TSBA 3UZWA 3T0TA 3CB3A 2QIIA 5AECA 3QY8A 1UR1A 2C7FA 3A3WA 4EACA 3EOOA 4GNJA 4M6UA 1W5PA 1MUCA 1JG9A 3VDGA 2QMJA 4F79A 4Q8QA 2YCJA 5IBXC 4I5RA 4HNVA 1LYXA 4HA3A 4CU6A 1X38A 2H9AA 3FYYA 2IKIA 3BW4A 2HISA 4MB3A 4Q4SA 3R5EA 4C6IA 1QT1A 1HNYA 1E4NA 4NX0A 1UWRA 1DIDA 1UMYA 1TPUA 3BXWA 8XIAA 3H2MA 3UR8A 2F6UA 3GHTA 1UD3A 1SFSA 4AF0A 3CIXA 4D6HA 3S42A 5CSSA 2PMQA 2FHCA 2VFIA 4EXBA 2WHJA 3C61A 2WCSA 3GVWA 4U28A 2YW4A 5C54A 1BF2A 4E38A 2J8FA 4G6CA 1ZJBA 4C6OA 1OADA 1GVEA 2PU1A 1US3A 4D6DA 1ITUA 4JOMA 5K3VA 2OZ8A 3K13A 1KRMA 4TX6A 4XAYA 4LFYA 1GKPA 1R85A 4H00A 1XRTA 3H53A 3VFLA 4M8UA 4PB4A 3R8GA 1T8QA 3WL0A 1YXCA 3SR7A 4KT2A 4O10A 1KLYA 2NQLA 3NDZA 1UZ1A 3N2MA 1PCWA 4PULA 4Q6XA 2VRJA 5MKGA 3DYMA 1TUXA 4IJBA 2BY3A 3BLOA 1J8VA 4DJDC 2F6XA 4ZCWA 3CWNA 2YB4A 1IF2A 4U4MA 1W5NA 3MUIA 2E40A 1GYLA 3MCNA 4A2SA 5C2GA 3UY8A 1AMYA 5ABEA 2WXDM 3AZRA 1QW7A 4HYWA 2F6KA 2Z00A 4H2HA 4E0CA 2VTFA 2R14A 3SGUA 2R6OA 5DEZA 4LVDA 2AAAA 4DELA 4CEUC 3GXPA 3ITTA 3PNZA 3QZAA 2GQ8A 5LIYX 3WQ8A 1RALA 2VOMA 3WJYA 3F4VA 3HV9A 1RAKA 3ARUA 5DRCA 2PDLA 4XB3A 3G0XA 2DORA 3KTXA 1J96A 2QF7A 1TWIA 2OT1A 1ISXA 3SN1A 2RDTA 4Z2IA 1V3HA 1B90A 2VENA 2PTYA 3TJ4A 4E2DA 2FTYA 2GFTA 1LOLA 1TPC1 1OFBA 2QJNA 1U5JA 4HT3A 4REQA 3QLDA 1HTIA 1UIOA 1X6NA 2QGHA 2BVYA 1XYAA 4H9ZA 1NY1A 2A7RA 1RBAA 3M5ZA 3AIVA 3DHDA 3EAUA 3MPGA 3QH2A 1KFJA 5JVLA 3TROA 3ISIX 1AD1A 3VOCA 3WEOA 4ZE4A 5CSUA 2FDSA 3BOLA 3EX2A 3CO4A 2ZUSA 4PSPA 4OUEA 1UWTA 2J9ZA 4JTLA 4C6BA 4AD0A 5A1AA 3FDGA 6TIMA 1CGXA 4JX5A 1R87A 2J7FA 4F2UA 3V0SA 3A12A 4YTQA 1K03A 4D8AA 1PE1A 3ZVIA 3UCDA 5AHNA 3OVRA 1LTDA 5IDIA 5HBFA 2Q3OA 3Q67A 2B7OA 3G1AA 3H2OA 4I9JA 1GPFA 1G7UA 4HCDA 3NZ1A 3SY5A 1UD4A 1K8YA 5AHEA 3LDVA 2PS2A 3T7VA 1JR1A 4YLWA 1CI1A 1LWJA 2PZNA 4TXEA 2W9MA 4URIA 4UQAA 1B54A 4AHOA 5KSWA 3WKZA 3M0HA 1FDZA 5KZ6A 4O53A 1KXHA 3PPGA 1XG4A 1JDEA 2OR2A 4M51A 1U22A 1C8QA 2MUCA 4U2YA 4NZ5A 2PGEA 2ZX6A 4DY1A 5BNKA 2BXVA 1HVQA 3WQWA 1X1NA 4AZHA 1UZ4A 3RXZA 1KGXA 4HTBA 4CNPA 4HHPA 1AVAA 2Y5JA 3PTKA 5FKYA 2P3ZA 2PI6A 1DQUA 1EGZA 4JIEA 1GW9A 3GIYA 4L6DA 2OYKA 1W3HA 2PDBA 4EX4A 3WLIA 1ME7A 1BLIA 3WQGA 1EKOA 1N8IA 1XXXA 4TIMA 4P7LA 3AS3A 4GGHA 1WBHA 1GOQA 4RDYA 1KCZA 1JGMA 1CNVA 5HQEA 4AAJA 1F61A 1DTUA 3W75A 2GJRA 1CXIA 1ECEA 2HBXA 2PD5A 1XD1A 3UWQA 1J79A 1OYBA 3W1QA 3N4FA 3HGOA 3GR4A 3N29A 2DZWA 2VM8A 4RW3A 2VUNA 4NF7A 2OSXA 4GXMA 4TX9A 2ZRWA 4IP5A 3TSMA 1X39A 2Y7GA 3TW7A 4QRNA 2IQDA 3NQEA 1I45A 4GUIA 4PUWA 3R25A 1JPDX 3TZNA 1RHCA 3WMBA 4NAFA 4HNNA 3AXKA 2QJJA 4IIGA 4EOUA 3GNOA 1V4YA 3UR7A 3WK0A 3U2OA 2D2GA 4LRTA 1NP0A 4I5UA 1D3CA 1JPIA 1J0KA 1TA3A 5A8NA 3QZEA 4UFLA 2WSYA 3NPUA 4GX8A 4O54A 5A6AA 4E5TA 4I7VA 2PTXA 3FA4A 4FMVA 3CZEA 4DI9A 1E6SM 1FCBA 3VM7A 3GW0A 2GWGA 1XPYA 2PDMA 5CZTA 2XUCA 3VUPA 4J4KA 4ZXLA 3ARSA 3GDKA 1ZUAX 2XH2A 2VFEA 4IIHA 1YNQA 1ITQA 3P14A 3N6QA 3R43A 3WK1A 1UZDA 4RV8A 4HU8A 1HJWA 2PTDA 2PDPA 1VFMA 4GFIA 4PCNA 4TX8A 3MANA 1RVKA 1J10A 4UTHA 3MYOA 1PB0A 4GI8A 4C1KA 4A22A 3K1GA 1ICPA 2I5IA 3MB9A 4NU7A 3MUY1 2EJ1A 1WDSA 3NEHA 3L21A 3RK8A 3RR1A 3ZVHA 3OPSA 2ZWZA 4LCRA 2GGHA 1JQVA 3SY1A 1TPVA 2XSAA 2YL6A 4GPNA 4J35A 4P8VA 4ZENA 5BOFA 1L6GA 2PSNA 2QXWA 2W5FA 3UWVA 1FWHC 1X6UA 1HP4A 3IVUA 3R10A 3RLVA 1D3HA 5I3JA 5E0CA 5AHIA 3L4UA 4KWOA 4N6EA 5HXMA 1Q66A 2HROA 4HZ8A 3V1HA 3ARXA 3S2JA 2E1WA 3QV6A 2O92A 1C9WA 1Q6RA 4PTMA 4BZYA 4E8CA 3GW3A 3NQDA 4B3ZA 4JFTA 4GC3A 3ECQA 3EDFA 2R1MA 3MWAA 3QMTA 3T81A 2DFAA 1JD9A 4F0KA 3CL7A 3AMKA 3TFXA 1E9IA 1DBTA 3I6TA 1B9ZA 1GEQA 3O2LA 4ZB2A 3MMDA 5H8UA 1QWGA 1R9ZA 3DIPA 5U4NA 2WVUA 4QX4A 4DM2A 4FX6M 4HJFA 4LAMA 2EGZA 4WY0A 1ESWA 1SMDA 4NI8A 2Q01A 2QAPA 1KO0A 2EG8A 5CJ5A 1P5BA 3QJAA 1QR7A 1ZB5A 1W0MA 3RMJA 1O5RA 3E0LA 2E6FA 2FLIA 3WBYA 3AS0A 1SR9A 1E51A 2F2HA 2HWGA 1UD6A 1C3FA 3PPHA 3LK6A 3PZUA 4JTFA 3DI0A 2BHZA 1Y65A 4P8XA 3WK2A 5AHLA 1JVNA 1W56A 5JBFA 3DFTA 2E1DA 4RE0A 2FPTA 4KRZA 1PEZA 1MRAA 3VMPA 4PBEA 4NZ1A 2W79A 2FYMA 4YTTA 1J93A 4LSBA 4PMYA 6REQB 4B2DA 3WF0A 1TFVA 2HK0A 3W1MA 1JULA 4ZQCA 2DU2A 3ZR6A 3MSGA 2Z2AA 3GBDA 3CUIA 4JQ4A 3KCJA 1ZPTA 4D6IA 3OEXA 3ABZA 4JTCA 1WPCA 2OKTA 4Z42C 1Z6KA 4HBKA 2I5QA 2ZX7A 5F2IA 4BS0A 4GH3A 5K9CA 1H7NA 1EPXA 4UTFA 1E1FA 2BZNA 2J8TA 1J5TA 5FSEC 1YXDA 3H2FA 3VNLA 2E25A 3HG4A 4FK9A 3RM8A 5GNYA 3S6OA 3KM8A 2QLYA 5D2XA 4QDWA 3DFPA 3UYCA 4IMAA 4HNUA 2UY4A 2WCAA 4B15A 2Z4GA 1F3WA 1VCFA 3HFYA 3QM3A 3SECA 2Y7FA 3UZZA 5I78A 1ZGDA 1DPMA 1MXGA 2YSWA 3GTIA 1DWAM 1UASA 3DKLA 1O1ZA 2YYUA 4AIEA 5CC7A 1S5NA 3BSHA 2CHOA 5A6KA 2FPVA 4IX2A 1ZRQA 5K4XA 1CGYA 4UR9A 2HXTA 3TVAA 1B1YA 2OELA 4B9ZA 4LNYA 3W2MA 5KZMA 5CKSA 3EWXA 1R3SA 1A0CA 4B4HA 5TD4A 7PTDA 4AZCA 4FZIA 4RPPA 4JFVA 4LB4A 1QI0A 3QPEA 2EF9A 3SI9A 4LY4A 3PNUA 3HBLA 4R3UA 1HL8A 3CUJA 2HV5A 3SAZA 3BURA 3LPFA 5C8BB 2NX3A 3ONBA 1R2TA 4C6FA 1MYRA 1IT8A 1LCOA 1EPVA 3NSXA 4FPSA 1LL6A 2ZWYA 3R11A 2GDUA 3R7MA 3WN6A 4KEVA 1RPKA 1MFVA 2P10A 8A3HA 1ITXA 1XC6A 4TR9A 4MYXA 2NVAA 2QCDA 4EAMA 2ISVA 2J24A 3MDUA 3QKZA 1DKWA 3ITOA 1FX6A 3HN3A 4P61A 2PBGA 3TE9A 1UH3A 2O56A 3OIHA 1VYRA 3P7YA 2DW7A 3AOFA 3W7RA 1S1PA 4JN8A 3OQEA 1ADOA 3IRDA 1MW0A 1TV5A 1GOIA 3UJRA 2BHUA 4GQGA 1EJRC 4CCEA 5K4ZA 3N2TA 3EWWA 1EYEA 4O8AA 4XX6A 1WZAA 3PBVA 1W8GA 3GD6A 2OQLA 3P80A 1HG3A 9XIAA 1U1HA 4PUMA 1LQ2A 4XBKA 3WQ5A 5GVJA 1Q8AA 4GIAA 2B81A 2XISA 1TX0A 1LLOA 2AMXA 4QSFA 2OWCA 2W63A 1RH9A 4CN6A 1UQZA 4ZMGA 3O9NA 3AIBA 3MP5A 4IXXA 4QDPA 4ZVJA 1CT5A 1TV7A 4FP1A 1F73A 1AH4A 4JQ1A 1G4PA 4XSLA 1SJCA 2GL5A 3C52A 3BAKA 4CU8A 2OWXA 2V3GA 3P8IA 4HD5A 4TO8A 1YDVA 4RKAA 4GYPA 1PIFA 1ZSXA 3QR3A 1WXYA 4GYJA 1IEWA 1BGGA 2X7WA 4BI7A 3AUOA 3CV7A 2HPIA 3CL8A 4Y96A 5HATA 4QLJA 3GDMA 4KFNA 4FNTA 1R5YA 1TCDA 5C2CA 4KWWA 2FIQA 4ERIA 5XINA 2F8QA 3PJUA 1FHVA 1DV7A 3N2OA 5LA0A 1SJAA 2QVHA 2V3EA 3AMLA 4PGLA 1TPDA 1B30A 2I56A 1FFQA 1NF7A 4LV4A 3Q4DA 4AW7A 3LLDA 2J6VA 4RNHA 4ZFCA 3UCCA 4F2TA 3GNXA 3VNYA 1F05A 2HDJA 2WC3A 1ADSA 2A3LA 1M9HA 4PUNA 2O4QA 2ZVRA 4S3DA 4DVOA 1G0CA 2Z7GA 3DFNA 3MWCA 1V0KA 3EWYA 1CGVA 3N34A 3CEPA 4MYAA 1PTGA 2OJPA 1W9VA 3CH0A 2ASHA 2C1IA 3PB0A 4AXKA 1WBJA 3ZFHA 3HG5A 4JICA 2CYGA 4CVUA 2ISSA 4IP4A 1SSGA 5LA2A 3GH5A 2RKXA 3NUKA 1HUVA 1A5SA 2QKFA 5DMMA 1I8JA 4UCFA 4BEUA 4AY1A 3RG6A 4OJYA 3PY2A 5C2XA 4BWLC 5BXSA 1MFUA 4EPKA 2ISFA 5GJPA 3V1PA 3MVIA 3ABXA 4HHHA 1R0MA 1H2JA 1JF6A 3NFUA 1UW9A 3O0KA 2YBVA 4GUJA 2WLYA 3BANA 2WZTA 3QYSA 1BWVA 3WSUA 2VEKA 3GK0A 1TWDA 3NQVA 5M1TA 1V3JA 2BXYA 2J78A 3VDBA 4R9XA 1WZLA 4P7RA 1SZRA 1F9CA 1KFWA 1XLFA 2VVSA 2G4FA 1W31A 4IH3A 2Q8ZA 5E5CA 1XQLA 4H9UA 1VD6A 2PDIA 2QPXA 4ZQOA 5ECUA 4L80A 5AN7A 1M53A 3PWGA 3NEVA 4ZO7A 3BVJA 3O6YX 1DJNA 2Y62A 2JK2A 1GUVA 5CXPA 2E6AA 1LM1A 2VCCA 1XUUA 5AC5A 3A3XA 1KR0A 2CPUA 2J7EA 3T0CA 1EWDA 3MI2A 1XBYA 1K8ZA 4E2VA 2BNJA 3HMCA 1IEIA 2HVNA 4QEHA 2BS9A 4UNKA 3WELA 1FH9A 1TPFA 4MUPA 1EEPA 4DUOA 1JYXA 1HO1A 3N3TA 3NA8A 5FJTA 4XBSA 3HG2A 3MW7A 4DJDD 1UKQA 4Q4KA 3EX3A 2EG6A 1SFJA 2TRSA 4AHQA 1CXKA 1F6KA 3LU2A 3CLWA 2CHRA 1TG7A 2IKHA 1EC8A 2YGYA 1BF6A 1SO5A 3K4WA 1E0WA 3S5NA 4HP5A 3WQEA 4C60A 2VR2A 4ZB0A 4W7UA 3OBKA 1JXJA 1NQKA 4MLRA 1F74A 1W32A 5BXRA 3PULA 1TIWA 4IQJA 4CQBA 2HVMA 4FLQA 3WFZA 3BTNA 1IYXA 1M6JA 1POKA 2E8ZA 1GVQA 4N9CA 1IXOA 3BMWA 3B0VC 1PO9A 3WH5A 4HPGA 1S2AA 1DJHA 1I75A 5LNUA 3SADA 3LCGA 5C9WA 3QR1A 3AO0A 3LGGA 3S8HA 5F2GA 3MMUA 1JCMP 3EKZA 1VR6A 3OG3A 5TIMA 4DO6A 1A50A 1S38A 4QCFA 4KPLA 4DJEC 5EMLA 4XG1A 3P67A 2EO7A 1UH2A 3W7EA 5KITA 1CGUA 2ZXQA 4MAZA 1OZMA 1Q6EA 1OIMA 2ZKMX 1V6XA 1GYNA 3LSBA 4Q8VA 4OUIA 2QCLA 1XLIA 1QBBA 4LUJA 4E2BA 3MKVA 1PZ0A 2HJPA 4UXDA 5E70A 4YTSA 4NZCA 1F4HA 2G41A 5E6ZA 3RGTA 1W9PA 3FS2A 3L0NA 3ALFA 1GVIA 4IJCA 4PCFA 3DGRA 3LUTA 5KEZA 3AROA 4YIWA 4POCA 1LUCA 2CLMA 2QGYA 1Z9AA 4HYRA 1Z89A 2BY0A 4NG3A 3EB4A 1BVWA 1XLHA 3EBVA 2GGJA 5JIWA 1BSIA 3WMCA 1K02A 3PTDA 1V0LA 2CZEA 2Z29A 2VZUA 4Q3MA 2EKGA 2P5NA 2KX9A 1RY0A 1A5MC 3C2OA 3PWAA 2D3NA 1H7WA 3VIHA 3MUXA 3W7QA 3W2LA 1Z32X 1H3GA 3KVJA 3LHWA 4F8XA 2GOKA 2FH8A 2VX6A 1QNPA 1KFLA 1K8XA 1MZRA 1VQTA 3PTMA 1CBGA 3RNDA 1TX2A 3WFLA 1CDGA 3VA8A 4LJ3A 4U33A 3WF1A 5JBEA 1RV8A 1RA0A 5G4HC 1K9FA 2YLLA 1AD4A 1BQCA 3USZA 4OT7A 4F0HA 2DEPA 2YL8A 4MY1A 5C9ZA 4IIBA 3URNA 3P81A 1OD0A 4O13A 1JD7A 2VEIA 4I7WA 1LWIA 3KVKA 3VNDA 5F1UA 1DJYA 1LZOA 3MP4A 4CNUA 4M29A 2E4TA 4O4WA 3RJYA 3AWOA 4MWAA 5A2AA 3AAMA 3SCQA 2CWNA 3APGA 1EO7A 1SW3A 3W88A 4QP0A 1I2OA 3L4VA 1FY6A 4F3HA 2PEVA 3PJTA 1DJQA 3EA1A 8CGTA 4WY0F 3GHUA 3SO7A 3FGCB 4LYRA 3D0CA 5E9XA 4L4OA 4M6QA 5BYWA 4M82A 3T6CA 4C7FA 2EHHA 2GOUA 3QBUA 4NRRA 1EQPA 2NXHA 4NJIA 3G0SA 4ZXOA 3K8LA 2C18A 2WMGA 1Y7VA 3NM3A 2Y0FA 3TAKA 3FXGA 3A4WA 5CBIA 1FVPA 3U2CA 4M80A 3RX2A 3CM4A 3WLJA 3W84A 3NDYA 4M1RA 1P4CA 2W4XA 4PRTA 4C7GA 2QHAA 5J5DA 4CQCA 1OJXA 4J3TA 4LUYA 4MZYA 3MYPA 1IGSA 3GVQA 3GZ3A 4YL2A 2V3DA 4J2MA 3L5LA 3B3DA 3TXVA 5DT5A 3T0BA 4K37A 1GQNA 4GQ0A 2J7DA 4YMZA 3UVIA 2XDFA 3SJ3A 3TSDA 4YCPA 3BOXA 4UMAA 1JIBA 4LUSA 5G2WA 2QMKA 4CN1A 3ANYA 3WLLA 2FJUB 3E49A 2J7GA 3LHUA 3STGA 4HTYA 1TO3A 2VD9A 4UQBA 2DSZA 1GWJA 1ZAJA 4LXFA 1OT1A 3UZYA 3PB2A 4PUEA 1V3IA 3SEPA 3IUHA 4JTDA 3KVMA 4O57A 5AC8A 3LD5A 2XFWA 4O12A 4AX7A 5DCBA 2J6XA 3PHAA 1R86A 1NTHA 1W5OA 2VZOA 1FHUA 1M04A 1A3XA 5ABFB 4QS6A 3GDRA 1EA9C 5H8PA 1V6VA 5AC7A 3P62A 3JRKA 3OBEA 4GYFA 1HO4A 1DYSA 3CWOX 3HPXA 1H0GA 3GAKA 2GQ9A 4JL1A 3IANA 2BVDA 4I90A 3VGEA 2W66A 1BD0A 4V1YA 2V63A 3H4XA 4E4PA 1XIIA 3M64A 3QMSA 1KM0A 3SSZA 1RQHA 1KLZA 3CIVA 1ZBWA 2ACUA 2ZRUA 3W7JA 2CU0A 3ANVA 1R30A 1R46A 1V6WA 3ZJ6A 3TDFA 4CU7A 4ZSUA 3V36A 3WMLA 3AYTA 2VFFA 5FESA 1JDAA 4NASA 4GLEA 1OFRA 1VJSA 4GQBA 4JCMA 4KESA 3GWQA 3M0JA 1DHKA 5D04C 5CZSA 1SU5A 1TPB1 4N0RA 4KETA 2IMRA 4M56A 2V5KA 2QDGA 4HK5A 1D7KA 4RDVA 2NQ5A 1F6PA 1O66A 3HM7A 2Y24A 4LS2A 1DHPA 1TIMA 4DYEA 1MUWA 4TVDA 2QPUA 3KW3A 4N42A 2I7GA 2DSUA 1CIUA 4Q32A 1FKXA 1QATA 4FXRA 1E3XA 3W02A 4WZHA 1H09A 2JFEX 4HNOA 5C9UA 3QC0A 1VB9A 4HMCA 1WDWA 2WNWA 3K2GA 3LEPA 4O16A 3BE7A 3GNPA 2BASA 3F03K 1XGZA 5BW6A 1PZ2A 5E0KA 1FH7A 3GR7A 3SM0A 1MXDA 2QV5A 4ACZB 3T09A 2X41A 4LS0A 3WDJA 1H5VA 3WYZA 4MJZA 4CUCA 1IWAA 1S1RA 5AY7A 1XF0A 3HQNA 4LOCA 4AWTA 1XH0A 4J2PA 1KR1A 2YDQA 3I3EA 3IIVA 1M65A 1FCQA 4WLCA 2QIWA 3RX3A 2GSHA 2RUSA 3HOJA 5ABHA 2PWHA 4PBGA 1GQJA 2XGZA 3NNTA 2DSWA 1MSSA 4UQDA 2JF7A 3SQMA 3SN4A 1EF3A 3ZR4A 3BAXA 3H2AA 4HMEA 4YYFA 4AEFA 4GUFA 3SGGA 4OV9A 2XIQA 3MO4A 1BTMA 1X1OA 2QVNA 7CGTA 1YDOA 3C2FA 3KFTA 3S9ZA 1JGIA 3QMRA 1NIUA 1CTNA 2POTA 5LHEA 2PTWA 1K6WA 1HKKA 5CSYA 4FOJA 1WO2A 5FL1A 5EMYA 5SWUA 3LX9A 5IDZA 1G4TA 3AXIA 2Y2WA 2ZYFA 3BCJA 2Y61A 3SUVA 2BP1A 2WM1A 1UOZA 2ZC8A 3R6IA 1R3WA 3VVGA 4NAEA 1W3IA 1S5MA 2XVGA 3QPZA 3WJXA 1JYNA 3H2EA 3RAOA 2Y8UA 3UW6A 3M5XA 3B8TA 1GG0A 3KWXA 5I0DA 2WZMA 3V7PA 4DPPA 3AIQA 3OBAA 1XPGA 4PBFA 4B90A 4WXYA 5JH2A 3EWUA 1JCYA 3AU2A 4UOZA 2NWSA 5D37A 2A2IA 3OO2A 4AD2A 1FOBA 4L1WA 3IVSA 1PX3A 5AYZA 5FOOA 3B8VA 3A23A 1KBIA 1UWSA 4WDUA 4E8DA 3G1HA 1LBLA 4RNIA 3FGCA 4DXXA 5LGXA 5BRQA 3F2BA 2PLKA 5CQ1A 3OYZA 4F48A 2CIPA 4XTDA 1ZTVA 3DFSA 4MLJA 4PMOA 4UZUA 3BLPX 3DU0A 1OHLA 1I4NA 1M5WA 4GI6A 4GFSA