3SZ8A

Crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia pseudomallei
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
279
structure length
264
Chain Sequence
SMNVAISPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIPFVFKASFDKANRSSIHSYRGVGLDEGLKIFAEVKARFGVPVITDVHEAEQAAPVAEIADVLQVPAFLARQTDLVVAIAKAGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQMAETTGGCPVIFDVTHSLQVLDLARAGIAVGIAGLFLEAHPDPDRARCDGPSALPLHQLEGLLSQMKAIDDLVKRMPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase 2
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 81
structure length 264
sequence length 279
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sz8A00
1WBJA 3E0IA 4JD4A 4ZVJA 2Y7DA 4UFLA 2YXGA 5TQLA 1B4EA 5I3JA 3STEA 1YDVA 2Y6ZA 1SZGA 3DENA 1H50A 4QM1A 4M6PA 3NGJA 1LRNA 3M43A 3TV8A 2WSYA 4OV9A 2HS8A 1IGSA 1OVDA 4YXGA 3W7KA 2BWGA 1KBIA 2I14A 3UWZA 3ABRA 3TSMA 1OFOA 2E6DA 2F7FA 3NQGA 2ZRZA 3QEZA 2B7NA 1TPEA 5L6UA 1ZAIA 1P1XA 1FDZA 3V1PA 3HG3A 1PHWA 2VOMA 2ZCGA 3A21A 4U28A 1VR6A 4NZFA 4WQ6A 5AN7A 4AVFA 2ATSA 3CIWA 3BV4A 3IIVA 5KZEA 1H51A 1RD5A 4IX2A 2FQIA 1LZOA 4GUHA 4JNMA 1H1ZA 3QRHA 4FEZA 2FPVA 3MHGA 3Q58A 2WJZA 1XM3A 1F2JA 2Y7GA 1ZENA 5AC7A 3MP3A 2C19A 2QJIA 4N9EA 5LHFA 4Q32A 1EWEA 3QJAA 1SO4A 4O54A 3DKJA 1QAPA 1QO5A 3EKZA 1B9BA 3P84A 1VCGA 3KVKA 4I7WA 4MZ8A 4K7YA 1GTEA 4R53A 1YTEA 4OU1A 3F03K 3DFTA 2Y85A 4O17A 3M16A 3W74A 1B3OA 3BW3A 2TSYA 1FUYA 4MZ1A 1C9DA 3BGJA 1UCWA 3A24A 3G18A 3LX9A 4JTHA 1FQ0A 2ISVA 2JGYA 2ZRXA 2HSAA 3L9CA 1QDSA 3FA5A 3LOTA 3YPIA 5FF7A 2B0MA 4LS2A 2VC6A 4LU0A 1GTHA 2PCQA 3W7QA 2BZNA 5K3VA 3QPZA 1JR1A 3LCIA 4JYDA 2QUTA 4WZHA 1ML1A 5G2HA 2WO5A 3P60A 3TMQA 1EUAA 1G67A 2VENA 5F4XA 3CC1A 3S6DA 3LRKA 3CT7A 2NUXA 4N4QA 5K9XA 1QNVA 3LI0A 4C1LA 4JGDA 3C4UA 3THAA 4XBKA 2FDSA 3L0GA 1SW0A 3GDTA 3NO5A 1S3HA 3NR0A 3Q94A 4H3DA 2KZHA 2YW4A 4NJKA 1W3NA 4MFDA 1KLZA 3WJSA 2JK2A 3L2IA 2A85A 3T78A 3M6YA 1GOXA 1H7XA 1WYIA 2Y88A 3NZ1A 5KSWA 3LCWA 3MI3A 5TIMA 3NQEA 3N19B 3UQNA 3UXDA 3OBKA 2A7NA 3SECA 1M7OA 3HPZA 4LV4A 1ONRA 3H55A 3UPWA 3PVFA 4GUGA 3GR7A 4N4PA 4AWSA 3DI0A 5K2ZA 3QH2A 4XUGA 3DFSA 2NWSA 1H7RA 3W07A 4GUIA 1FWSA 2X30A 3JS3A 1GVSA 3L66A 4HSOA 2BXVA 3TW6A 2VKZG 5AB3A 2PC4A 3DAQA 3B0VC 3VKJA 1ZJIA 4NQ1A 2NUYA 4UNKA 3SY5A 5U7SA 3W2JA 4O14A 1TPFA 2Q8ZA 2TRSA 4ALDA 3W71A 3WJXA 4N9DA 3T40A 2E6AA 2QKFA 1A53A 4QJ1A 3HPSA 3L65A 4FNTA 4BR1A 1JCMP 5CPLA 4HPJA 4PH6A 4JTKA 5LZLA 1XBVA 3U2OA 4NXSA 5G1TA 2ZA3A 2GJNA 2DZUA 4RZ6A 4N02A 4MFEA 1JUKA 5J5DA 5SWUA 4MY9A 3RK8A 2NX3A 2VEMA 4R7JA 3KRZA 5L9FA 3MP5A 2UV8G 3NQ6A 1WOBA 3W1XA 1TYGA 4K38A 4MOZA 3G24A 3C61A 3LXCA 4JTGA 5LSMA 4LUIA 1NSJA 5IBXA 4TIMA 2DJXA 2E68A 2CZEA 3OVPA 4FXSA 4HNNA 3EB2A 1B4KA 3W2MA 3W1NA 4WY0A 4AF0A 3HMJG 3C56A 2R14A 1TTPA 1FWRA 3B0PA 3TA6A 4UFKA 3STFA 4UTKA 3WK3A 1GVQA 1TPB1 5D03A 2A21A 1YXYA 1L6YA 1KTBA 2ZZ6A 2C15A 4JTIA 3W7EA 1H62A 2FFCA 1GJPA 4IPJA 1KFCA 3RMJA 3KRUA 3DH7A 3PSWA 2J24A 3CPRA 3QQ1A 1XL9A 3DFPA 1LBFA 2Y63A 4Q33A 5EMUA 3R8RA 3G8EA 2NXGA 1XCFA 1SPQA 1AG1O 1T8XA 4RK8A 1W5MA 2IQTA 1V7YA 3E49A 1A50A 1HL2A 2NXHA 2HS6A 4IJBA 4LV9A 2O7SA 3NXFA 1NFBA 5AC6A 1I2OA 3KVMA 5LKYA 3L5MA 2Q3RA 5CSRA 1HO1A 4QISA 3EWWA 4UTWA 3MUXA 4BFAA 3A23A 1K03A 4E2DA 1GQNA 2ALDA 1PV8A 3R13A 3KRSA 3PS7A 3P5YA 3HQ1A 4JN6A 4LVGA 3IIXA 1GVOA 3NQDA 2C14A 3PWAA 1G4TA 5D2YA 3DBPA 3KFTA 1S5TA 3W7RA 2J9YA 3CM4A 3G8RA 2Z6JA 2X1UA 3KOFA 4O57A 2HTMA 4DO4A 2FTPA 3FFSA 2VFHA 3QFEA 2NWRA 2FPYA 3ABQA 2YGYA 5FEZA 5G4WA 3IV3A 4RJEA 1SR9A 4JX4A 5G2WA 3SR7A 5G5IA 2OJPA 1A5SA 4TX9A 4O16A 1J5TA 4QIUA 5EBUA 4O1CA 4EF8A 1E51A 3ZS4A 2QCGA 3O8AA 5CZ0A 5C54A 1ZHAA 4DPQA 1UASA 3W2LA 2XFWA 1VCVA 4LY8A 4IMFA 3C3NA 2I9EA 1B57A 1XXXA 3B03A 1OFEA 3HG2A 2W79A 1MXSA 4H6KA 3OIXA 3QF0A 3PB2A 5DELA 1WQ5A 2H6RA 1A5BA 4GC4A 3M41A 2E5DA 3KAOA 5T26A 3SGUA 4WY0B 1W3TA 4AF0B 5D02A 3KVLA 2OT0A 3TFCA 3GK0A 3HB9A 1IIHA 3CEUA 4A2RA 3A5FA 3MHUA 4JTLA 4TO8A 3UWQA 3NPUA 3EWXA 4LVBA 4BF9A 1TRIA 3BK0A 1M6JA 4CQ9A 4A3UA 1QPQA 2ZZ3A 2ZRWA 3TW7A 2G96A 3QW3A 3LGEA 5HNRA 5FF4A 4JICA 3N14A 1IF2A 4WOZA 5G1YA 3W1LA 2NX1A 4JX6A 4JTFA 1TCDA 4S2BA 4RR4A 3LCLA 3SGZA 3PBWA 3BGGA 4EOUA 3W87A 4X22A 2LLEA 1UJPA 4FNSA 1VGAA 4NVTA 1OFPA 2JKEA 1RV8A 3LCHA 3M5ZA 5CPOA 3T55A 3IVUA 5DN1A 1GYLA 3NAVA 4NX0A 4UXDA 1TIMA 4AEOA 1JRBA 1VRDA 4O53A 4DPPA 1TMHA 4WOQA 2JBMA 2X1TA 2Z2UA 3O6YX 3LLFA 3KHJA 3BVJA 4IOTA 2DP3A 3GB6A 1SO3A 4MJMA 3LTYA 1KFBA 5LNRA 2WOQA 1NVMA 2NXIA 1OFBA 1XI3A 5EL1A 4MIMA 1WX0A 3L68A 3P67A 1W8SA 2YYTA 3WK0A 4XKYA 3S9YA 5BMWA 3NL2A 3TIMA 4E2BA 4UFJA 2QAFA 1UUMA 3P7YA 4GWEA 3EWUA 2QAPA 3U6WA 1YTKA 2Z6IA 3PSVA 5LNUA 4I9AA 4RLIA 4A21A 3NQCA 4N6FA 3HGJA 1DJNA 1EP2A 4Y90A 2VXNA 3M47A 1XBZA 2H90A 5ABTA 4O28A 3TQKA 1IIGA 1I2RA 4UR8A 3S1WA 3W70A 5AHIA 4ADSA 5F1VA 4GJ1A 5AYXA 1ICSA 3TAOA 1OK4A 1DKWA 5C5YA 2D73A 1P0NA 3CWOX 4UTJA 3CEPA 1TV5A 4UC5A 1QFEA 3LHYA 5KMYA 2ZYFA 3W9ZA 1YADA 3G3MA 1JQXA 3A5VA 4M7TA 2C16A 3LXAA 4JX5A 1TTJA 3T7VA 3FJLA 5D2VA 4DXVA 1SSDA 2C18A 3O63A 3MYOA 2V5LA 3RLUA 2O7QA 3C2EA 4OV4A 1RQHA 1TPVA 3DHFA 5DCBA 5DBUA 5KTLA 5GVJA 1K7XA 2FJKA 4XQ6A 1FWWA 1K8XA 4O19A 3HOJA 1VLWA 2WSQA 2QJHA 2V0TA 1PHQA 3MMTA 3N73A 3PG8A 4JIQA 2GVGA 3W85A 2X1SA 4JXCA 2FB3A 4LTSA 2ZRVA 4GBUA 3TFXA 2C6QA 2Y7FA 3LTSA 4MUZA 4X9SA 3DZ1A 2Y70A 2ZZ4A 3OA3A 4HT3A 5KITA 3PAJA 3DGRA 3W73A 1AL7A 2AAMA 3N2XA 2VEPA 3IVTA 1W3IA 1G7UA 5FEWA 4NUWA 3W7OA 5KINA 1I4NA 1GEQA 3AO0A 3TQ0A 2DZTA 2QCNA 3S1UA 3P8IA 3P62A 3Q2DA 1IXPA 1ME9A 2YFNA 4ZL1A 3PF3A 5F1UA 3A22A 3W1TA 1R2SA 3HBLA 4LOCA 4ADTA 3SFKA 3DFNA 2ZFAA 1OFDA 5K4XA 3IEBA 2NUWA 3I7QA 4O1BA 4K7VA 3IIOA 4XKYB 4DBEA 3SSJA 3JRKA 4WY0F 4CCDA 3W75A 3LCFA 2NV1A 4LS0A 3L5AA 2V2CA 5HWNA 3E9AA 1O60A 1LYXA 5LGZA 4C1KA 4MVAA 4NXKA 5FEXA 1LDCA 1SO6A 4TMBA 3EWYA 5C55A 2A6LA 2R91A 3C2RA 1F76A 4MLJA 2QDHA 1TREA 1IXQA 3W1MA 1QCWA 3H53A 5EKYA 2H3DA 2CWNA 1GZGA 5D2WA 3SIZA 5CSSA 1AW1A 3MI6A 3GZ3A 1OHLA 3ZFHA 3TSDA 3BARA 1LOQA 2VEIA 2B7QA 3NNTA 5D38A 2E1DA 2E6FA 3NZRA 4NJGA 4EVZA 2BX7A 2ISSA 3S0CA 4FXRA 3EX3A 3TNOA 4IXXA 2XN2A 4Z1CA 2WV8A 3TJLA 3FKKA 1PIIA 2WNQA 1F74A 1FXQA 1XFBA 3GR8A 3GDRA 2CZFA 3ATYA 2BTMA 4UMAA 3L21A 3W7MA 2Z0IA 3IIZA 1TB3A 1EA0A 4CCCA 1JUEA 1W5PA 1X8FA 4DF1A 3UNDA 2ZZ5A 1ME7A 4JR5A 3NQ2A 5U4NA 5FF0A 5A5WA 2YZRA 1EUNA 1RVGA 1XBXA 3NL6A 3GNNA 2RDWA 2HMCA 1YPIA 2RH9A 8TIMA 5D33A 4N2YA 1JCJA 3TX9A 3CWNA 1ALDA 4HIBA 4J9JA 3WK1A 3UY7A 1OX4A 5MHBA 3EXSA 2QCMA 3D0CA 3F1QA 2FLIA 2GPTA 2ZBTA 1MEWA 4NT0A 3W22A 4ZZ9A 2PRHA 1K8ZA 1JCYA 4WX2A 2V9DA 3G0SA 4LWWA 3VFLA 1K7EA 1W0MA 4TR9A 1SO5A 4LC8A 1Q3NA 4LVAA 2QCCA 1PCKA 4RZ5A 4POCA 1KFLA 3G1FA 3M0ZA 3HGRA 3LCXA 1LORA 4KFNA 4WXZA 4JYFA 2V8ZA 4ML9A 2ZDRA 2QCLA 3U8GA 3BO9A 5HUPA 1N55A 3BG5A 6ALDA 3S8HA 1LOSA 3ABSA 2RKXA 4KFPA 3STGA 3GNDA 1D3HA 1R47A 3O05A 4MKNA 2AQWA 4RXGA 1F5ZA 2V2HA 2H3BA 4IMGA 3HG5A 3G1AA 2VFFA 3NG3A 1OF6A 1SU5A 2A1YA 3STCA 1OYAA 2QUUA 4IWWA 4HNTA 1HUVA 3OG3A 1YDOA 3NOEA 3TSBA 3LHUA 1ME8A 4L4MA 3K30A 4UMCA 1CI1A 2G5WA 4B5NA 1PE1A 2V2DA 1WBHA 2P1FA 3I7RA 4FIRA 3BLEA 3NDOA 4DO5A 5D37A 2ISWA 5HUOA 4CNPA 4XZ9A 2CLLA 3W7PA 1ZFJA 1OFRA 4QSHA 1P5BA 1L9WA 3IGSA 4FHAA 2Q3OA 2ZRUA 3B4UA 3GDLA 3LRMA 4UFHA 3LHWA 4NNAA 1F05A 5LNWA 1GYNA 3W1QA 2VFIA 3G3DA 3GVGA 1S5WA 5F4SA 5K7JA 3GXPA 1SZFA 2OT1A 4OHQA 4RV8A 2E09A 3M1ZA 2BLEA 1FDJA 3KX6A 1ICPA 4UCGA 5DXXA 1TPH1 1LCOA 1O5XA 2Q8LA 4P61A 1X6UA 4IXHA 1KV5A 1TV8A 2WSRA 3P80A 4JTSA 2CLIA 2EF9A 3RNDA 2E5CA 4JTUA 3C6CA 4N9BA 4WUIA 3TDFA 4D2JA 4HSNA 5K9DA 5AHNA 1OABA 1VS1A 5CZSA 4AWTA 3S5NA 3RU6A 7TIMA 1OX4B 1Y0EA 1L6WA 3QQ0A 3O07A 4PODA 1YXDA 3G1HA 5HJLA 5C6MA 4IX0A 2QEZA 2V5BA 1LRTA 5DXYA 4UR7A 3VE7A 2OZ0A 5EPDA 4NNCA 5K9CA 1AW2A 4UTLA 5FESA 2G97A 1D9EA 1OX5A 1XDLA 4ORMA 4JY8A 4HN4A 1A5CA 4UIOA 1JCXA 3SW6A 4ICNA 4YMZA 5CPMA 1ZCOA 4GNJA 1GPWA 4DF2A 3OHIA 4MLRA 5D05A 3TCEA 1BWLA 3R89A 3GKAA 4G1KA 1PL9A 1SZNA 4JDYA 5D32A 3W1PA 4PL1A 4IMEA 1LRQA 1MEIA 1XDMA 1DHPA 4O15A 5AHMA 2GQ9A 2E77A 1FWNA 1MO0A 4NNBA 4MZYA 3LLDA 3GIYA 3N9RA 1SW3A 4NX5A 2JGQA 4W9TA 4NJHA 5A8GA 5F2GA 1DJQA 5AHLA 3BG3A 1A5AA 3I6RA 3NQFA 4TMCA 1SUXA 2OX1A 2DZVA 3GDMA 1W5QA 5CZJA 1TQJA 4OQVA 4QNWA 4M5PA 4JS3A 1H7OA 4KWVA 3ELFA 3O1NA 4UNLA 4O0ZA 3LHTA 4YL2A 1LLWA 3PR2A 3CU2A 3EX6A 2DZWA 1G69A 2QCDA 1K3UA 4K8HA 4IQLA 1W37A 2I1OA 4FO4A 1NAL1 3USBA 3P74A 4LVFA 1MEHA 4AWUA 4XTIA 3G1SA 1KM1A 3SZ8A 3WJYA 3RLVA 1EB3A 4Z1BA 5FF2A 1QOPA 2Y7EA 3EX2A 4OWGA 1EX5A 1VHNA 3OVQA 5BW6A 3L5LA 1F7BA 3P81A 3TXVA 3MYPA 1XUUA 2CU0A 1SZEA 3W2KA 2A4AA 3THQA 1F6PA 2TYSA 4CQAA 3TJXA 4UTUA 2YSWA 2CW6A 4S2CA 3NEVA 1BEUA 3G1YA 5LNSA 4JTEA 1T96A 4KFOA 2YDAA 4YWIA 4O13A 2DZXA 5D04C 4Z1DA 3ZR4A 1S5VA 3UWUA 5I3GA 3LI1A 3FKRA 4HPXA 3NVTA 3L0KA 1H5YA 3HIJA 1GT8A 3N3MA 1EPXA 1TRDA 3C8FA 1H63A 3GYEA 4MPQA 2J6XA 3G0UA 4DELA 4O1AA 3FIGA 2DJLA 1UUOA 3G1DA 3VI2A 3LERA 1ZALA 6TIMA 5HR7A 1QMLA 1YTDA 4E0CA 5F2IA 1QOQA 2OCZA 3EX4A 4ZQCA 2R94A 3QC3A 3IIPA 4ZQNA 1MSSA 2VELA 4NJIA 3W7JA 3GXNA 1KM2A 5CPNA 1OJXA 1M7PA 1QPNA 4X2RA 5E0KA 3C52A 3LCGA 3G1XA 3PBUA 1OFQA 3MI2A 4O12A 3TROA 3TMLA 3LHVA 3UZJA 1FDYA 3CLMA 4GUFA 3S1XA 4HNVA 2A6NA 3LM7A 3P61A 1VYRA 4DEFA 1AMKA 1TPDA 4JIPA 1WDWA 2J9XA 1RQBA 1KM4A 4K37A 3S5ZA 2X16A 3W7NA 3P5ZA 3PC0A 1WV2A 3M9YA 2W0UA 3CB8A 3QZEA 1GG1A 2R8WA 1G7VA 2W6RA 2QCDB 4JDBA 1P0KA 5LGXA 3G1VA 4ORIA 3FLUA 4O0KA 3BG9A 2H8XA 2GJLA 1VLIA 1W31A 4GFSA 3EXTA 1L2UA 1JQVA 5AYZA 3UD6A 1KM5A 3DHDA 3QSTA 1FX6A 2WQPA 4E38A 4Y8FA 3CHVA 5F4WA 4QNEA 4YCPA 4O4VA 4R33A 3UY8A 2DZPA 3TC6A 3W2NA 3GX9A 1YYAA 4FB7A 3W86A 1VYSX 2WKJA 3GKFA 5EY5A 1HTIA 1R46A 5LNVA 1OK6A 1H61A 4RX0A 3CIXA 3UWVA 2C1HA 5H91A 3UWYA 3LBCA 2EPHA 1LBLA 1WAUA 4NZJA 1K7FA 3NQ8A 3BW4A 2A7PA 1VCFA 1DORA 1DVJA 1TV7A 5BNKA 2BSLA 3GAYA 1DQWA 1V5XA 2B7OA 3IGXA 5CZTA 5AYYA 3T44A 3R5EA 1K02A 1HG3A 1OG0A 4LC6A 3EKLA 4CCEA 3E12A 3HGOA 3BW2A 4K6AA 1LLZA 3F4NA 3LRLA 5KZMA 1FCVA 2NX9A 4CQ8A 2GQ8A 3L0NA 5DY2A 1OYBA 4UMBA 4MY1A 2CLKA 1T0OA 3Q37A 1QO2A 4IUOA 1RQEA 4KKXA 2H8ZA 4LRTA 3VCRA 4O18A 2A0NA 4HHPA 4DF0A 1TO3A 4FX8A 3MHFA 3G0XA 4O50A 5BRBA 1R30A 4AMAA 2PURA 3LV6A 5TBOA 1YPFA 4UFMA 4AXKA 1HFBA 1I2NA 3I7SA 5AFDA 2CLHA 3S5OA 4XTDA 4I7VA 4WD0A 4Z0JA 2RDUA 2ATMA 2XN1A 2J9ZA 1Q45A 3FYOA 3P82A 5HR6A 1JRCA 4RKAA 1KM6A 1VYPX 3BPWA 4EWND 3FEMA 3NM3A 3O6CA 3HJZA 1I45A 1KTCA 4FX6M 3W1AA 3FYPA 3NQMA 2RDTA 4UTHA 1KFKA 1KM3A 3I65A 4ONVA 5E1QA 4LS1A 3NA8A 3WJZA 3M44A 5I3FA 1YXCA 1GVFA 4CNOA 3N34A 4P2VA 3W6YA 2B4GA 2TMDA 3OVRA 3HO8A 1X1OA 3NPWA 3TH6A 4PEKA 2CLFA 4A22A 1GWJA 4M7SA 4QQ3A 2EHHA 1OF8A 1EWDA 1H1YA 1FY6A 5EYWA 1X7FA 2GQAA 2YFOA 4QITA 1R2TA 1TTIA 4BI5A 1IXNA 1DQXA 2ZTJA 3RF9A 1XKYA 5DCDA 1XC4A 1ZNNA 3M5XA 1DBTA 3W72A 2JKPA 4MYAA 1VC4A 1XBYA 3QMTA 5KZDA 1EIXA 1AL8A 1CW2A 3TK7A 3PBVA 4Q4KA 1WOAA 3PBYA 4AH7A 1ICQA 1U83A 5D09A 3GXTA 3PB0A 1KBJA 4BI6A 1G4SA 4OT7A 3NQAA 3UPBA 4IPIA 1F6KA 3G22A 3E96A 1RZMA 3C2VA 3MO7A 1NEYA 2P10A 3MWAA 2J27A 3MJYA 3V75A 2GOUA 1Q6RA 1R2RA 1Q6OA 1I8JA 4FNUA 3DFQA 4PTNA 3DKLA 2C3ZA 4BWLC 4MYXA 4PC8A 3DXIA 2B7PA 4ADUA 3UWWA 4LW7A 4OBTA 3S5YA 3NL5A 2ZA1A 3O06A 1XUZA 2ABBA 3PUEA 1G4EA 4O4WA 4RZ4A 2RFGA 2ZA2A 4PL2A 3TQVA 1C29A 2QCEA 4BI7A 2Z1BA 4AHQA 3O16A 1ZY9A 3MBFA 3W7LA 1UB3A 3ZWTA 1SQ7A 5DBTA 1TQXA 3BLFA 5EA9A 4LT9A 3B8DA 2G95A 3IVSA 2YPIA 4DO6A 1TJPA 2GVLA 2P0OA 2CFFA 5FF3A 1O94A 5F2LA 2FIQA 1G6CA 2ABAA 4FNRA 4UTTA 2FB2A 2F84A 3INPA 2EAWA 2RHGA 1PS9A 4L4LA 3LB0A 3W1RA 1SFJA 2QF7A 5I3KA 5FI8A 4TU1A 2YX0A 3B04A 3B06A 1RPXA 3HG4A 1W54A 5J5RA 4EIVA 3TKFA 1X1ZA 3E02A 5AOUA 4DBDA 3W3OA 4AHPA 1VZWA 4HNUA 2CZDA 5HQEA 2YYUA 2NZLA 3B0UX 2QDGA 4FF7A 2C0AA 3P8JA 4WXYA 3C2OA 4ZQPA 4U4MA 5DY3A 3OEXA 1W56A 3MBDA 1N8FA 5D2XA 1Q6QA 4UUIA 5I3IA 1LM1A 4ZMGA 1AW5A 5BOOA 3LDVA 1P4CA 1O95A 1PVNA 1TPWA 4NU7A 2Y62A 4K8EA 4M6QA 1VJIA 1H60A 4JTJA 2E5BA 4JTTA 1TPUA 3EXRA 4K39A 3EWZA 1H7PA 3W7IA 3DFOA 2ZZ1A 4DQWA 1LP6A 1L6SA 1VPXA 1KV8A 3W7DA 3RFAA 1KFEA 2X1RA 3MP4A 3PUOA 3M5VA 1O4UA 3W2UA 2ZRYA 4GUJA 2YW3A 4RXFA 1LBMA 2Y61A 3H54A 2GUUA 4FNQA 4X3ZA 1TSIA 4M19A 3N9SA 2C13A 3QPYA 4OGZA 3NPVA 2Y89A 3W88A 5G2IA 4NJJA 3O15A 1KLYA 1TJRA 3NQVA 3DU0A 4GXMA 3LV5A 3IRDA 2WPBA 2XN0A 4XBSA 2ZQ0A 3C2FA 3QM3A 3ANYA 3NL3A 3M7WA 4LRSA 1N7KA 1TTQA 2CLEA 2VFDA 1EP1A 4O52A 4MY8A 2WNZA 5D30A 1LROA 5E93A 3W84A 1SW7A 2E6YA 2QCFA 3QYQA 1FWTA 1ADOA 4RCXA 3BLIA 3WJWA 4AAJA 5FEPA 2OMAA 1H7WA 3C0JA 3NPXA 1Z48A 3QSRA 2QUVA 3PM6A 1VQTA 1QPOA 1DOSA 5HINA 4O1DA 1OYCA 2A5HA 3UZ5A 3LBMA 3S42A 2QCHA 3VNDA 3TC7A 1JUBA 3QW4B 3R2GA 3TAKA 2ZZ2A 4JEQA 1I2QA 1SFLA 3WFAA 2DORA 5AHEA 1AK5A 3N2MA 2YR1A 1H7NA 1G4PA 1D3GA 3NYZA 4Z1AA 1QWGA 2AGKA 4A29A 1C8VA 1TPC1 1Z41A 4AB4A 1JULA 4JY9A 5F2MA 4LUJA 2A2IA 3ATZA 1NF0A 4O11A 3TU9A 5DCEA 4QAIA 5AHFA 1I2PA 3S1VA 3NQ7A 3I68A 5H2ZA 4FIQA 1IXOA 3FJ6A 4Y9AA 2V81A 3HF3A 2GVJA 1KTNA 4I7UA 4JYEA 2QJGA 4OE7A 1W5OA 3UYCA 2ZTKA 1F73A 1K8YA 1QR7A 2VEKA 2DU2A 1OX6A 3UXAA 4GRSA 4HKPA 4N6EA 4KWWA 3QMRA 1CX9A 2NV2A 1FCBA 4FNPA 5DLCA 2PRMA 3NM1A 1GG0A 3JR2A 4Y6GA 1W1ZA 3DI1A 1BWKA 4YCOA 5D2TA 2EKCA 3KXQA 2PE4A 3CTLA 3F4WA 4ZQMA 4N9CA 2YCEA 1J4EA 1KM0A 3SJ3A 3QMSA 1JCLA 1KFJA 2PRLA 1FCQA 4MJZA 2V82A 2WNNA 1UBSA 1OFAA 5HMSA 2NLIA 2CLMA 4UTTC 2CLOA 4FX7A 4IMCA 4ZQRA 3FOKA 5AC8A 4CLMA 1GVRA 2DZSA 1YDNA 3T4CA 1O5KA 3ZWSA 4M6VA 3SI9A 4O8RA 4Z08A 1LOLA 1MZHA 4YLWA 1Z44A 1YLVA 4UFIA 1DV7A 5CKSA 3ABOA 3TE9A 1RR2A 1EEPA 2A7RA 5HWMA 2VFEA 1FCUA 1WA3A 4PCFA 3VE9A 5C2XA 5CG7A 1SSGA 4Y96A 1VH7A 3EX1A 4IGHA 1JJKA 1W5NA 2CZ5A 1KA9F 3EWBX 1J2WA 1Q6LA 5LHEA 4PA8A 4WJEA 4CNNA 2JKAA 3W7CA 5IBXC 4AHOA 2V30A 5K4ZA 4A2SA 4XWUA 1DL3A 3B05A 4LNYA 3W83A 4UTIA 1HO4A 2ZZ7A 4H4IA 2VFGA 3PUDA 4BWLA 1WXJA 1VHCA 3LXBA 3FS2A 3KVJA 3W1UA 1FBAA 1FXPA 3A9IA 5BMXA 1BTMA 1JCNA 1LTDA 1THFD 3GAKA 1JVNA 3HGSA 3LHZA 3PG9A 3W7GA 5G4EA 2X2GA 5I3HA 3TXZA 3W76A 1Z42A 5CGQA 4PFMA 3LTPA 1U5JA 1ZAHA 3EEGA 4O10A 2EGZA 3W23A 3IGUA 2QR6A 3M5YA 3PULA 4IMDA 3WK2A 5HWJA 4BK9A 4EF9A 3L67A 2FPTA 3GLCA 1T99A 3HPXA 3O6DA 3CQ0A 3R12A 3MW7A 4ZQOA 1ZAJA 4LVDA 3W7HA 1M5WA 3TR2A 5IM51 3AJXA 3GDKA 3TUUA 1KW1A 4GE8A 1EP3A 1BKSA 4S1FA 2J88A 4R34A 3PY2A 1NF7A 4UTMA 4K36A 1PCWA 2TPSA 5HULA 4UTWC 1QPRA 4Z0SA
chains in the Genus database with same CATH superfamily
3BAJA 3BLLA 1JYVA 2ADAA 1TWZA 4Z2KA 4MJ4A 3EPNA 5TQLA 1B4EA 5I3JA 5DT5A 1H50A 1G01A 7XIMA 3IUDA 1QK0A 2VT0A 2VCAA 3RG6A 2HS8A 1MUCA 4L1WA 3C5QA 1OVDA 3W7KA 1F61A 3GZAA 3WSUA 3ABRA 4D1JA 2F7FA 4W8LA 2ZRZA 2Z7KA 4EE9A 3QEZA 3CH9A 2J13A 2CERA 2IQ0A 4Q7BA 1SM9A 3ZJKA 3LPGA 4HPHA 5JBEA 7REQA 4PMYA 4NZFA 4WQ6A 1UHVA 3ZT7A 4D6HA 1GHSA 4BF5A 4CN1A 1ZSXA 1RD5A 4IX2A 4WSKA 4JEJA 3MHGA 3Q58A 4RDYA 4U3CA 1CZ1A 3EGJA 2V3EA 5AC5A 2O55A 4N9EA 5LHFA 4Q32A 1HVXA 3QJAA 3LLXA 2IKJA 3DKJA 4EX4A 1W9XA 3UG3A 5FJTA 3WF3A 4PCSA 3KVKA 3GVWA 4GXWA 2OSWA 4K3ZA 2Y85A 3XINA 3ISIX 4L61A 3FXGA 4O17A 1B3OA 2TSYA 4MAVA 3CUXA 2YCKX 3QTPA 4MZ1A 1UCWA 3A24A 4DZ5A 5DMNA 4JTHA 1FQ0A 2JGYA 2ZRXA 3GR4A 4HJFA 4DX3A 2PDPA 4OTKA 1GKQA 4FK9A 3LOTA 1YE6A 2FZ9A 3ORWA 4LS2A 2PCQA 3SM0A 1KKOA 2PWHA 3QPZA 1ZTVA 2ZUSA 1ML1A 5G2HA 2VC9A 2JQXA 3P60A 1RBAA 4P7QA 1G67A 1JXJA 3KDOA 5F4XA 3CC1A 5A8MA 5HBFA 5K9XA 3FVDA 4XAZA 4C1LA 4F0HA 3C4UA 1XYMA 1NWUA 8A3HA 3THAA 4WR3A 2FDSA 4J40A 1SW0A 2XH7A 4H3DA 4NJKA 4MFDA 2DV0A 1W3HA 4CN6A 3NZ1A 4AYGA 1GORA 4D6EA 3GU1A 4AD2A 1E1CA 3B8IA 1VFFA 3HPZA 1QBAA 3VC6A 3H55A 3UPWA 1BSIA 4Q4SA 3L4YA 3PVFA 4GUGA 3XISA 5K2ZA 4P7RA 3AIVA 3A4JA 5ECVA 2NWSA 1POKA 3AHVA 1FWSA 4XSLA 2X30A 4HSOA 5AB3A 3CYVA 3DAQA 1ZJIA 2PDKA 1WKEA 3UESA 3B8VA 3HPFA 2Q8ZA 3P2VA 2TRSA 3RYSA 4XG1A 3WCZA 1P0EA 1A47A 4QJ1A 2NVDA 3BZGA 1N8WA 1EJRC 4RDWA 1JCMP 4YTQA 3EMCA 4PH6A 5LZLA 3U2OA 4NXSA 1DJXA 4XZIA 2ZA3A 4JTQA 2GJNA 4KEZA 4D71A 2VDIA 2QXWA 1JUKA 1BYCA 4K1GA 4M29A 3MV11 3S6OA 4GY7A 3VDHA 4K38A 4GPNA 3G24A 3AROA 3C61A 4GX8A 4JCMA 3QOKA 1E0XA 5LSMA 4GFIA 1VPYA 4C5ZA 3E74A 4Z17A 1SYTA 3C56A 3SRKA 1TTPA 3B0PA 4NZ3A 4P7NA 4B5XA 3PTKA 3V1HA 3GXDA 1GVQA 2YCLB 1TPB1 5H1WA 3IRSA 2Z1VA 1XG3A 3H2FA 2A21A 2WJDA 5CSYA 4QTGA 3WIJA 2FFCA 1GJPA 1I75A 3REQA 2WMIB 1V0KA 4IPJA 5DMLA 3RMJA 4B5SA 3DH7A 3PSWA 2J24A 2X2YA 3M6DA 3XIMA 1BHGA 3UBPC 3ME3A 2J7HA 3R8RA 1IZJA 1CDGA 4UR9A 2IQDA 1SPQA 4AIEA 2L5HA 4IFOA 4B4FA 1W5MA 2IQTA 3E49A 4X9YA 2HS6A 1UYQA 1E5NA 3F5KA 3NXFA 3KVMA 5CSRA 2PU0A 2OZ3A 4QISA 4UTWA 4HMDA 4J27A 4E2DA 2ALDA 1OD8A 1EJXC 3P5YA 3HQ1A 3NWRA 1Y5VA 2I17A 3IIXA 5I79A 4GHRA 3KFTA 2DY3A 3W7RA 2WJFA 3G8RA 2Z6JA 5C7VA 3KOFA 4O57A 3FFSA 4X61A 1XYZA 4K8GA 2YGYA 2IKHA 4RJEA 2Y24A 1GVIA 1E43A 3V3WA 1RLDA 8CGTA 3GM8A 3FGCA 3WD4A 5CZ0A 5FAJA 3W2LA 4W85A 3C3NA 1XXXA 1RA0A 4M0XA 4P8UA 1XC6A 3CZ8A 4CU8A 4ZOBA 3OIXA 4IQEA 3T9PA 5H8UA 1A5BA 4MF4A 2OO6A 5T26A 1IR1A 2WWDA 2W5FA 2EJ1A 3PPGA 2CXEA 1M3UA 5I6SA 1B3YA 1IIHA 1IV8A 1S2VA 1J0YA 2CKSA 3CEUA 4X0VA 3UXLA 3A5FA 3KLKA 3NPUA 3EWXA 4LVBA 4PR4A 4Q8QA 3BK0A 4G7EB 1ADDA 1M6JA 4CQ9A 1V02E 1UWQA 3VD9A 2G96A 2JIEA 4V27A 2YXOA 3MV01 5HNRA 5FF4A 3N14A 3W1LA 2NX1A 2GSEA 5HOSA 3OLEA 1GQKA 5ABHA 3H2OA 2IKIA 3MB9A 1GKPA 4X22A 4MMWA 1MVYA 4PE8A 2J79A 3LCHA 1KBLA 5HA7A 5DN1A 4HZ7A 2F38A 4ERGA 1JRBA 1EC8A 4GQ0A 4WOQA 3SO7A 2YZ5A 4FSAA 3LLFA 1IWBA 2XVNA 1WAWA 4FLQA 3TLQA 1NVMA 2NXIA 1OFBA 2QV5A 1J5SA 1BGGA 1FHUA 4JZ5A 1W8SA 2YYTA 2D2HA 5GJMA 2KX9A 2VCCA 1K8CA 4EWJA 5IXEA 3RX3A 1W2PA 5BMWA 3MA8A 3NL2A 5I3DA 3GTNA 4UFJA 1O5RA 3L4XA 2Y4SA 1ISZA 4QSFA 3QBUA 2Z6IA 2CBIA 4I9AA 1U30A 3NQCA 4N6FA 1FFRA 3HGJA 5HMDA 4XAGA 1RLCL 1U5VA 1XBZA 2H90A 4O28A 2PUZA 1I2RA 3SDOA 3S1WA 2XH0A 4H9UA 5AHIA 2Z24A 1PIGA 4XX6A 1OK4A 2XFFA 3CEPA 1TV5A 4MWAB 1QFEA 3LHYA 3T6CA 3WLJA 1OGSA 3A5VA 4DZAA 4H7CA 3T7VA 1FWDC 3NO1A 5D2VA 5AZ1A 3VA8A 4C6PA 4LJ3A 3O63A 1V6UA 2V5LA 1BXBA 1TPVA 3DHFA 3H24A 3VABA 4IHCA 3BWWA 2FJKA 4XV0A 4PMJA 4O19A 1VLWA 3WLPA 4ZEPA 2V0TA 4A3YA 1PHQA 3PG8A 2FGBA 3KZSA 2GVGA 4C6IA 1NOFA 3VDGA 3LENA 1AQ0A 4LTSA 3WLRA 1R3SA 3OZPA 4V2XA 3CV6A 2Y7FA 1H0IA 3PZQA 3LTSA 3VIKA 2VQTA 2ZX8A 4Q8WA 4A35A 1MQPA 4F4RA 3MUIA 3I3DA 3BLPX 3DGRA 1PTDA 1X1NA 3W73A 3N2XA 1DJZA 2VEPA 4HJWA 1H11A 4QX4A 2E7FA 1GEQA 4JQAA 3TQ0A 3RIKA 5KEZA 4J2PA 2EXOA 4DM2A 3KHDA 1ME9A 4ZL1A 5HNTA 1QOXA 3PF3A 4CD7A 3QHNA 3UFYA 4LOCA 2HEJA 4ADTA 4AZ7A 1UG6A 3ZQ9A 3OYXA 3IJ6A 2NUWA 3N4AA 1K9DA 1TVPA 3BCJA 4WY0F 3THDA 4CCDA 1XSJA 5CBJA 4LS0A 1H2JA 4IFKB 1W1YA 2OWWA 1QHZA 2BY1A 4GGBA 5C70A 3IARA 3IAQA 4DUOA 4A8RA 4YIWA 1LYXA 1W2VA 1DQUA 1IR2A 1E4IA 1YBQA 3RPTA 3NO3A 2F2KA 4TMBA 4PBEA 3WL0A 1E73M 3Q67A 3QFWA 4XD4A 1JIBA 1TREA 3GSMA 3H53A 4WLCA 3FJ4A 1GZGA 4GKTA 3T1GA 2C79A 1S39A 4Z42C 4ZO7A 3M64A 2Y1HA 4NY2A 3DYOA 4U5IA 4Y2WA 3M0JA 1ZU8A 3R25A 1LOQA 1G94A 2VEIA 2PMQA 3NNTA 3IJQA 3NZRA 4NJGA 3K4AA 2XZ7A 2BX7A 3S0CA 4JIIX 3SUSA 5A6AA 1E0TA 3CUZA 4YTSA 6ENLA 2ON3A 3TONA 4IXXA 2R1PA 4EXQA 1F74A 1J0IA 1XLAA 1UD4A 4GZEA 1PAMA 3GDRA 1W9PA 2CZFA 1NQ6A 1I60A 1W17A 3CHEA 2MANA 3L21A 1F07A 1I6NA 2Z0IA 4GVHA 1F6YA 4MNJA 3MMUA 1VIWA 3AIUA 4PSRA 3U2EA 5AVHA 2YZRA 1NFGA 3BDKA 2PLMA 3G6LA 1ZJAA 1LQAA 4N2YA 3CXOA 1JCJA 3MPGA 4BZYA 2OZTA 1KBBA 1US0A 3WK1A 4X63A 2RJGA 2PTDA 2FLIA 3F1QA 2XH2A 2ZBTA 2PTXA 1MEWA 4NT0A 3G0SA 3RCYA 1WUEA 3UZZA 1UWRA 1JPIA 2VGBA 1PCKA 4LQ1A 2ISFA 3LN3A 1TV4A 4POCA 4RZ5A 2JF7A 1EL3A 5EMKA 4HNLA 4KFNA 5CBBA 4LUTB 1E0WA 2ZXQA 4F0LA 4HYVA 3U8GA 3WD1A 5BOFA 1I9CB 3W38A 3L2LA 4F40A 3STGA 3GNDA 2QHAA 5BWAA 3O05A 3H21A 3MUAA 4RXGA 1NWRA 2H3BA 3LYEA 4IMGA 3VM5A 5MKGB 3NG3A 3AMKA 2A1YA 4P8WA 4ASTA 3OG3A 3GFXA 4LEFA 6XIMA 1YDOA 1B3ZA 3NOEA 3TSBA 1PO9A 1ME8A 4UMCA 4S3FA 1CI1A 1QNSA 2G5WA 3GH5A 4MPKA 5T8GA 3I7RA 3ZLGA 1XLHA 2D1ZA 2ISWA 3B3DA 2CLLA 3SCRA 3WQCA 3W7PA 5I24A 4NHVA 4FR6A 3WH5A 1A80A 1L9WA 1AA1B 1SZRA 5M03A 2ZRUA 3B4UA 1KGXA 4H6RA 1GYNA 4L64A 3G3DA 5F4SA 1JEZA 3BOLA 1XS2A 4W8BA 3RO8A 1FDJA 1ICPA 4UCGA 4DUWA 4GI4A 4ROQA 4H9XA 4P61A 4H2CA 1X6UA 4E3VA 4PBFA 3W24A 1TV8A 4JTSA 2CLIA 1QTWA 3VOCA 3ONBA 3VNLA 4DWSB 5AHNA 3V0UA 2WANA 3ARVA 1KXHA 4UZSA 2J6VA 4AFYA 3B40A 2OLSA 3RU6A 3PUGA 3QQ0A 3O07A 4PODA 3O7UA 1PYFA 3SRDA 3VK5A 3G1HA 5C6MA 2QEZA 4OECA 1W3JA 4NNCA 1YX1A 2YBUA 4UTLA 1UR1A 5FESA 1C91A 3EA2A 4HN4A 1A5CA 3QTGA 1JCXA 2YCJA 1EF2A 4TUFA 4AD3A 2HNEA 4ICNA 4YMZA 5CPMA 4WEVX 4MB3A 3S6TA 4DF2A 2AL2B 3E2SA 1AH4A 1DE6A 1BWLA 1VAHA 1LLOA 1PL9A 3SIMA 3NUKA 2D24A 6CGTA 1LWJA 3RX2A 1ZPTA 4QLJA 3MCOA 2Q8XA 1XLDA 3CUFA 1MO0A 4G56A 4NNBA 4MZYA 3GIYA 2Z28A 4AMCA 1JD9A 4GYJA 1SW3A 4W9TA 3GXMA 3ARRA 1XIGA 1OSEA 3T08A 4TMCA 1SUXA 3GBDA 2QT3A 1GOWA 3RLHA 4KWVA 3ELFA 2VOTA 3O1NA 1LL7A 3SCVA 3ITTA 5I2UA 1V93A 4Q6JA 2DIJA 1K3UA 2PDMA 4WCJA 3WDRA 1NAL1 1OWQA 1ONWA 3CPGA 4AX6A 4Z1BA 5HJXA 3KS5A 4Q22A 5HK4A 2EKGA 4NIRA 1JDCA 3EX2A 1EX5A 7ODCA 5BW6A 4QJ5B 3L5LA 4AY7A 3T4WA 3DYPA 4GCAA 2WSPA 4P8VA 4CQAA 4C91A 2YSWA 2CW6A 3NEVA 3G1YA 4GQGA 5LNSA 3MWCA 5XIMA 1E0VA 2GVEA 2YDAA 3KOZA 4IPPA 4YWIA 1KKRA 4CQDA 3TC3A 2DZXA 4Z1DA 3UG5A 3ZR4A 1S5VA 3APYA 3I4EA 4M80A 3RDKA 4U33A 2BVDA 3NVTA 1GT8A 4C6LA 1TRDA 3U5YA 1GUVA 1C7TA 4MPQA 4S3DA 1A3WA 1RA5A 2DJLA 4KEVA 1S5MA 3VI2A 3LERA 5HQMA 3GHSA 2R94A 1EJVC 4H7ZA 5BXRA 3IIPA 4NJIA 2I16A 3Q65A 1QI0A 4C6DA 1QPNA 3I10A 3UW6A 2HXUA 3FDKA 3PBUA 3TMLA 1UJQA 2VDHA 3UZJA 3HFTA 4U10A 4A3HA 1NDVA 2AGTA 3N13A 3LM7A 1VYRA 2CZVA 4DEFA 4D6IA 1L6GA 1FWCC 1WDWA 3C3UA 5BCAA 3CZGA 4K37A 3KBSA 2ZICA 4B3LA 3M9YA 1BGAA 3QZEA 3GG8A 1UBPC 2QCDB 1E6SM 4HMEA 3FLUA 3AWOA 3BG9A 2H8XA 1EQCA 4R85A 1W31A 3TYAA 1E9LA 5EMLA 3GH7A 5AYZA 1J0KA 4GH3A 1KM5A 1UWSA 3F4VA 2J66A 1ZZMA 4PYSA 2OQYA 4HOZA 1U2YA 4F0MA 2V68A 3D6NA 4HP5A 2VX7A 4YCPA 4R33A 3TC6A 2PS2A 3WQEA 3GX9A 4LUYA 5JIWA 1YYAA 3W86A 2WKJA 1OK6A 4K1WA 4RL3A 5H91A 3LBCA 1WAUA 4EANA 3BW4A 2ODOA 3VDCA 4NZ1A 1V5XA 1XH0A 4OOUA 2XSAA 2VDGA 1EBGA 2YOCA 3R6IA 5AYYA 2CKRA 4QQUA 4LC6A 3E12A 2DUZA 2A3BA 1CLXA 4DJDC 4UMBA 4MY1A 1T0OA 4KKXA 4XAFA 1PWLA 1DTNA 1AQMA 4FX8A 3QKEA 4C6JA 3U2ZA 4Q8NA 3C0SA 1R30A 2I5IA 2ASHA 2PURA 4IM4A 1QI5A 1ECEA 4UFMA 1XIBA 2VZTA 2CLHA 3S5OA 4I7VA 4DHGA 3SN4A 1OEPA 4AWEA 5E9XA 1Q45A 1RJPA 4ZSTA 4P7OA 1XD0A 3WDQA 3NM3A 3HA1A 3O6CA 5H6HA 1KRAC 4FX6M 1TMLA 3W1AA 2POZA 3UZXA 4HA3A 5I03A 1E9IA 3CZJA 3W6YA 2A3LA 1WDRA 2J4GA 3VNJA 3HO8A 1TIWA 1XSKA 4MNMA 1UIPA 2GJXB 1KXQA 3O9NA 4GO9A 4R88A 1YDYA 4AZGA 4M7SA 1WXYA 3VZYA 4XKMA 1EWDA 1X96A 1J2BA 3HQPA 2J7DA 1K6AA 4G7FA 4RW3A 3RRAA 1R2TA 4JPGA 3OGRA 4BI5A 1DQXA 1XH2A 3RF9A 1XC4A 5A8PA 3KE0A 4NZ4A 1Q85A 1J79A 2PP3A 4E8DA 3U4AA 2JEQA 1VC4A 4TX8A 3QMTA 5KZDA 3MQTA 2J8FA 4F9JA 3IJ7A 1XYLA 4HYWA 3CL6A 2WHLA 4NAEA 2FZMA 1SJBA 5CGTA 3VIPA 4I90A 7CGTA 3EOUA 1QW7A 3NQAA 4KETA 4IPIA 1F6KA 3N3TA 1VFOA 1JZ3A 3B9OA 1NEYA 3MJYA 3R4IA 5E9AA 1Q6OA 1C3FA 3DFQA 4PTNA 1ITXA 4KERA 3DKLA 2V69A 2C3ZA 1H5VA 4MGGA 2ZX6A 4MYXA 3UWWA 3K46A 4QE1A 2A79A 4GZJA 2ZA1A 3O06A 4QEHA 4AU0A 3V7PA 4RZ4A 1EX1A 1H4PA 1P6WA 3DEQA 1F8MA 7REQB 3MBFA 2ALRA 4RNHA 4WJXA 3W7LA 2Q71A 1UB3A 3WNPA 5DBTA 3BLFA 3WH7A 4BJHA 1T40A 2HPIA 2IXVA 4R9XA 4US5A 4XZWA 2C91A 5D8ZA 3H2EA 5F2LA 1ENUA 2ABAA 4FNRA 2WMGA 4C6EA 2VGGA 1KCXA 2I5GA 4L4LA 3MO4A 1SFJA 1QNQA 5I3KA 4BQ3A 1V08A 4CEXC 3NGFA 3NZGA 4TU1A 3B06A 4W89A 1WKFA 1RPXA 3HG4A 4ZXOA 2HBVA 3E02A 2BVTA 2WMKA 2G3MA 1VZWA 2CZDA 4PSPA 1CLVA 4A4AA 1JDAA 2PA6A 1HJVA 3LZ3A 1KFWA 3CQJA 3W82A 4FF7A 1HL9A 4ZQPA 1W56A 3MBDA 1N8FA 5LA0A 3GE7A 4H8HA 4UQ9A 1JF5A 2GGHA 1Z3NA 2HE5A 2YIHA 4ZMGA 2VVSA 1R7AA 3R8HA 2P3EA 3ITYA 3LNMA 5FAGA 3VIJA 3G77A 1BVZA 3RAOA 2XGIA 1H60A 4JTTA 4K39A 1CB7B 3EWZA 4Y9NA 4D6CA 3QQWA 2VX6A 1B30A 3AMLA 4M24A 1UKQA 4GUJA 2Y61A 3H54A 4FNQA 4X3ZA 1TSIA 1RK6A 4OGZA 1J6OA 3MDUA 3SAZA 4YYFA 1TJRA 4OKDA 4GXMA 1Z89A 1XLKA 2WPBA 3IAPA 1JPKA 1IE7C 2ZQ0A 1UH4A 5TF0A 4GISA 4A05A 2HPMA 2D2OA 2O0TA 1MW3A 1N7KA 1TTQA 2Y5EA 1EP1A 4UOZA 3N9KA 3ZIZA 3IJ8A 1LROA 3EPMA 4TVUA 1SJCA 4R27A 1XLBA 1ADOA 1FWHC 4QP0A 1NM9A 2TODA 3NPXA 3QSRA 3PM6A 1FWEC 1QPOA 9XIMA 5D9OA 4E5TA 3CV7A 4S3BA 4O0QA 5FSDC 2QCHA 3OU8A 3VGGA 3QW4B 3GVRA 4JEQA 1ZP3A 4AY8A 3N2MA 4XD6A 1G4PA 3NYZA 4QLLA 4CD8A 1W1B1 4PMOA 3W6LA 5EU9A 4NI3A 3E1F1 1F3EA 3BICA 3H2NA 2GGJA 3ATZA 4JHZA 3ZR6A 4DJFC 1RSCA 3S1VA 3VUPA 2Z25A 4C7FA 1VFHA 4UZUA 4RPPA 1UH2A 2EQDA 1TVLA 1IXOA 2FZDA 2V81A 1KTNA 2VEFA 1QXLA 2D0GA 4M3PA 4OE7A 3BCDA 4HA4A 3VD7A 3LK6A 2UY3A 2YLAA 2PF8A 4KWWA 2FHBA 3QMRA 1CX9A 1FCBA 1VBUA 3CUJA 5CC7A 2PE4A 3CTLA 3BANA 4ZB5A 4JKKA 3SJ3A 1IT8A 1JCLA 3ZJ8A 9RUBA 1UBSA 1TMQA 5HMSA 4FX7A 2P8CA 1M1BA 4CLMA 2DZSA 3GYCA 2Y5SA 3JW7A 3WQ4A 4NRRA 4LYRA 1TX0A 4I8DA 3JZEA 2XFRA 4Z08A 1LOLA 3AYSA 1K6WA 2NSXA 3HMCA 4UFIA 5CKSA 1RR2A 3CZKA 2FGLA 2OYKA 3VMPA 2W4XA 1EJTC 2CZ5A 1KA9F 3EWBX 1J2WA 5GNXA 4QDPA 4PA8A 4WJEA 3W7CA 5IBXC 3UZWA 2NLYA 4XWUA 1LT8A 3TCSA 3VX0A 4UTIA 3HTWA 3V36A 1HO4A 2QUNA 4EACA 4ZOEA 1E40A 2G3IA 4OOZA 3PZMA 4TVDA 4L9ZA 4B2DA 1EZ2A 3RM4A 3SBFA 1CTNA 2D2GA 1FXPA 5BMXA 3CUGA 1C90A 3VNYA 1BTMA 1LTDA 1THFD 3MS8A 3HGSA 3BAKA 3PG9A 4MADA 2X2GA 3WF2A 3S9IA 3M0VA 5RUBA 1EA9C 3EYPA 3LTPA 4E4FA 1ZAHA 4J35A 2QR6A 1XW8A 4JFUA 3M5YA 3BMVA 3S2LA 3NSXA 3HPXA 1T99A 2DH2A 3ARXA 4ZQOA 3IACA 4NRSA 2Y8KA 1MUMA 1M5WA 5AVNA 4GYPA 1EP3A 3K1DA 3ARQA 1K4HA 1MFVA 2TPSA 3UJEA 1PB0A 1UMLA 3E0IA 3AXHA 4XVEA 5BU6A 3CV2A 2Y7DA 2YA0A 1V0NA 4L5ZA 5MF5A 1M9HA 3RGTA 3STEA 3CUIA 2Y6ZA 1SZGA 3DENA 4D9PA 3T0DA 3C8NA 2QLYA 4H1ZA 3NGJA 4OV9A 4PGLA 2ZUTA 4KW2A 1IGSA 1L6FA 4WHBA 4YXGA 2QV4A 4DJDD 2BWGA 4S3GA 1X7IA 1E72M 3UWZA 4E4PA 3GIPA 2Z29A 2GZXA 5C2GA 2B7NA 5CAHA 4GBDA 1RK5A 2AAAA 4HK5A 5L6UA 1ZAIA 2OGJA 3PTQA 2VR2A 3HG3A 1PHWA 1M65A 2VMFA 4KRTA 5JIPA 1E3XA 2VOMA 1AJ0A 2ZCGA 4ZOAA 1SMAA 3AU2A 3UYIA 2QNEA 2XG9A 1OQFA 3BV4A 3VGBA 5DO8A 4OUEA 4GUHA 4JNMA 1B3XA 2FPVA 3AALA 2WJZA 1XM3A 3CTTA 6XIAA 1JZ5A 3MP3A 1HT6A 2BY0A 3SCPA 2NVCA 4O54A 3FSTA 3AC0A 1QAPA 4A8LA 3RN6A 3SCQA 3P84A 1VCGA 4BEUA 4ERAA 3L4WA 3N6QA 4I7WA 5CCZA 4MZ8A 3UF9A 4ZGYA 4R53A 1LG2A 1M68A 1DHKA 3AXMA 4D1IA 5BWFA 1XR2A 2R9RA 3LX9A 2ISVA 3ZXWA 1FRBA 4X2PA 4C6NA 2PTYA 3FA5A 3YPIA 5FF7A 3S2MA 3W7QA 2WWCA 4IGMA 4GINA 2V6AA 5C7HA 2BZNA 3UA4A 3KBNA 3LCIA 1SJDA 4QHRA 3AHTA 3TLLA 2C71A 2WO5A 1EH9A 2XGBA 2YCLA 4AD5A 5JVLA 2OPJA 2VENA 3LRKA 3WLOA 1QNVA 3WLHA 4J1OA 1QI3A 2WMIA 4XBKA 1E5JA 3GDTA 3ENLA 2YW4A 3KS6A 3OIHA 2JK2A 1C8XA 3CAQA 1GW1A 1H7XA 1WYIA 3TVAA 3MI3A 2X1IA 1JYWA 1QW8A 4QBXA 1EEXA 2A7NA 3AJ7A 1RP8A 4WDWA 4A8NA 1A49A 4N4PA 4AWSA 4LPCA 4F0SA 3M4HA 2DQWA 2QVHA 3W07A 2D0HA 3G2GA 1GVSA 2UY4A 2BXVA 2VKZG 4WDTA 2X7WA 2PC4A 1UPMB 4TV5A 4GX9A 4NQ1A 4TVCA 2NUYA 2MUCA 2PDJA 4UNKA 2GGGA 3W2JA 3IJDA 1DWAM 1JNDA 3OP2A 3E38A 4IICA 3UXIA 2QKFA 2GGIA 3NTYA 3HPSA 5EBAA 5IFTA 3PPHA 4BR1A 4XIMA 2E67A 5CGMA 1HW6A 1CXFA 4EK7A 4K2SA 2DZUA 1KRBC 2DPEA 1M41A 4MFEA 4N02A 5J5DA 5SWUA 1J0HA 4QGCA 3RK8A 2NX3A 4R7JA 3KRZA 2OU4A 3EOSA 1E0UA 2XUCA 2DH3A 1RBLA 1ITUA 4R5EA 4DAFA 3S9ZA 4JTGA 4QXIA 1DPMA 3HV9A 4TIMA 4ATWA 4B90A 2E68A 4MTVA 3RJXA 2WLZA 3CJPA 2WJEA 3OVPA 3DHUA 4HNNA 4NAFB 1VJZA 3W1NA 4S39A 3QV8A 3WG6A 2I56A 4ICMA 1Q5MA 4HPGA 3K2GA 2EPKX 1BQCA 1XSIA 4G7EA 4X0NA 1YXYA 4JTAA 2ZZ6A 2C15A 4NASA 4JTIA 3W7EA 1QNOA 1H62A 4IP7A 3OPSA 1UW9A 1NQKA 2CBUA 3FHAA 3URAA 2OEMA 5BXPA 1GONA 3B8UA 3QQ1A 2J62A 2X0SA 4Q4QA 1LBFA 2PTWA 3EKGA 4Q33A 3AAMA 1XCFA 4LYPA 1D2KA 3DOPA 3VNIA 3V0TA 3KCJA 2PWVA 1AG1O 1EGVA 4IL2A 2QF8A 3LGDA 2XHYA 2FHFA 4LV9A 1X98A 2O7SA 1NFBA 1F4AA 1I2OA 3KCOA 1L8PA 2W63A 2HNHA 3L5MA 1HO1A 3GTFA 1J9YA 3A23A 1K03A 3R13A 3GNXA 4HN8A 3WL1A 2OSXA 4QAWA 3RRXA 4NYUA 1S5TA 2J9YA 4Z1YA 2E9LA 2HTMA 2FTPA 5A6SA 1XCXA 3THUA 3QFEA 3UJSA 1Q63A 5G4WA 3IV3A 1HJSA 3NSNA 2CEQA 5G5IA 1A5SA 2GLKA 4LBSA 2TAAA 3IANA 4O16A 3WUGA 2VUYA 1BRLB 3SURA 3WEMA 5EBUA 1LWIA 3ZS4A 1ZJHA 2Y0FA 4XB3A 1JCTA 2DSVA 1AJZA 1DWFM 2D69A 1VCVA 3TTQA 4IMFA 2NSOA 4MWAA 4IIDA 3HG2A 5JMUA 4JIHA 2QW5A 3B8SA 1CGWA 4RE4A 4DJFD 4E4UA 2H6RA 4F3HA 4GC4A 2WSKA 2XVLA 3SGUA 4WY0B 4GH1A 2IPJA 3KVLA 2OT0A 2J7CA 4QG8A 3HB9A 3D5HA 4A2RA 1AH3A 4P8XA 3PK7A 1KNWA 4TO8A 2PWUA 1OGGA 4PUNA 1XWYA 4HHMA 3VD5A 2D0FA 4RE3A 3S47A 2ZRWA 4MM1A 3TW7A 4JL1A 3QW3A 3RO6A 1S5NA 3QGVA 4JTFA 4OJYA 2ZKMX 5FJPA 4AVNA 3LCLA 4US5D 3CMJA 3PBWA 3S2JA 1CENA 2OX4A 3I6EA 2QJJA 3DECA 1DIEA 5D4YA 5CPOA 3T55A 3KLLA 5IHSA 1GYLA 4NX0A 4GLEA 7TAAA 1TIMA 5CJ5A 1Q7MA 2BGQA 4DPPA 1E4MM 1MW0A 3CO8A 2X1TA 3O6YX 1XIFA 4MKVA 4HK6A 1VBGA 3GB6A 2ANUA 4MJMA 1P7TB 1KFBA 5LNRA 2WOQA 4J3SA 2NT1A 1XI3A 1BD0A 4C65A 5EMMA 2Z1WA 1I0BA 4EPDC 1HKWA 2WZIA 2BXYA 3TIMA 3NZQA 3BL3A 4IFKA 3A64A 3EWUA 2QAPA 3U6WA 3ZJ6A 1YTKA 2E9MA 2G3NA 4C60A 5PTDA 2VXNA 3ARZA 4WKAA 5ABTA 3WX7A 3B97A 4IMAA 1NFPA 3K5XA 4ADSA 5F1VA 4GJ1A 5AYBA 1LQ0A 3W9ZA 1YADA 2IPWA 5FIPA 3MJMA 1OT2A 4L6DA 2YA1A 1RAKA 3U0HA 3CMFA 1VFTA 3PTDA 1XIHA 5DCBA 4XQ6A 3KL3A 3W37A 3P6LA 1MW2A 2X1SA 1XG4A 3B9EA 4QS6A 5GJNA 2FB3A 1H1NA 3TOYA 3QLDA 1TZ7A 1CPUA 5C71A 3O6AA 4MUZA 2WC7A 4X60A 2ZZ4A 4HT3A 2Z1KA 2WHJA 5KITA 3PAJA 3KTSA 3R7MA 1QHPA 1AL7A 2AAMA 3IVTA 3VIGA 1R9ZA 3WQ8A 3W7OA 3AO0A 1G9HA 2DZTA 1G1YA 3P8IA 2YFNA 2PWDA 5F1UA 2PDBA 1RUSA 2AL1A 3AISA 2ZE0A 3DFNA 1OFDA 5K4XA 1E6XM 4RZBA 2VX5A 3GQYA 4B91A 1RJRA 2XSBA 2PDGA 1LQ2A 2VWSA 4LUTA 3L5AA 3GG1A 3W28A 2D22A 1TKKA 3E9AA 1G0CA 3VOHA 3UR8A 3D3AA 3ZR5A 5LGZA 2PWFA 3QV7A 3WF1A 4GKLA 2A6LA 2R91A 4ATLA 1LWHA 3MSYA 4MLJA 2QDHA 1RVKA 5MKGA 3BOFA 2W9MA 1J0JA 5DMMA 5EKYA 1DJYA 3V18A 4UQBA 4CN4A 5D2WA 3FN9A 4GQQA 3BAYA 5IRPA 3LGGA 3MI6A 4PUJA 3ZFHA 2YXXA 3TSDA 2AOSA 2GDUA 1HF6A 3WH6A 4UB9A 3AIWA 2ZXAA 2C0HA 1D8CA 4FXRA 2AKZA 4Z1CA 2WV8A 1PIIA 4GXPA 4L6OA 4CGTA 2WVSA 4IG2B 3IUIA 4KT2A 3S83A 2BTMA 2J25A 1PWMA 3LG3A 2INEA 1TB3A 3F5LA 1EA0A 4QE4A 2PZNA 1W5PA 4WSHA 1YEYA 4JR5A 5U4NA 5FF0A 4PMZA 3KBMA 1EUNA 1OCQA 1XBXA 2OO0A 4GO8A 3GNNA 4DWSA 1E4LA 1GKRA 1YPIA 2RH9A 3M0IA 3VOJA 3TX9A 1MQQA 3NSMA 2G41A 1Q6FA 3ES7A 2POTA 4L80A 1ALDA 3UP8A 1FWAC 2CWXA 5MHBA 3EXSA 2QCMA 3D0CA 3IK4A 3CNYA 3SUVA 3QGKC 1K7EA 2VZSA 1B1YA 4LC8A 3CL7A 5CPSA 1Q3NA 5CC3A 3NZPA 1KCLA 3LCXA 1UZDA 1E6ZA 1A5MC 5D9PA 4JYFA 2V8ZA 3WQVA 1CLKA 3VAVA 2QCLA 2AL2A 2P88A 1N55A 4ZE4A 1OM0A 2B31A 1PTGA 2RKXA 1ISXA 3H7UA 4AY1A 4DLMA 1D3HA 3CAWA 4RDZA 3N2OA 1KRMA 2PDFA 4MKNA 2AQWA 4RNJA 3HG5A 4KCWA 1SU5A 1UC5A 2QUUA 4IWWA 4CQCA 3BUVA 4HNTA 4Y9PA 3LHUA 4OBRA 3K30A 4KRZA 4W86A 1J96A 1PE1A 2CHOA 2P1FA 1TV3A 4PRRA 1RBOB 2PGWA 4DO5A 5HUOA 3VIOA 4CNPA 1Q2SA 2R24A 1SVDA 3SQMA 1B90A 4HTBA 2R82A 1P0DA 3NQBA 3GDLA 5LXXA 3URBA 4UFHA 3LHWA 4WVXA 2VD8A 1F05A 2VFIA 4FI4A 1S5WA 3AHZA 2E09A 3ERPA 1PSCA 3HM7A 4ENLA 2PDQA 2IS7A 2WLYA 1AODA 1O5XA 2DFAA 2DSKA 4DYJA 1X6LA 4XO6A 3VOIA 4IXHA 2WSRA 5A6BD 2ZUWA 4CKQA 5JUVA 4W7WA 3HURA 1KWKA 2FTWA 5BROA 2ZVRA 4GOAA 3LU2A 5BZAA 5HMEA 5HQLA 4HSNA 3VGHA 1NU5A 4L4PA 2W3ZA 1PYMA 4GACA 1OX4B 1Y0EA 4JFWA 2OVLA 4W93A 1WUFA 4WKHA 4PTWA 1YXDA 1K70A 2V5BA 2GK1B 1R5YA 2BBFA 1AW2A 1IZKA 3U7VA 1XDLA 3IS4A 4ORMA 4JY8A 4DBSA 4FMVA 1ZCOA 2R1KA 3SGGA 3FCPA 3ANUA 4GNJA 4DUVA 4MLRA 2CPUA 3P0XA 3EWDA 4OZOA 4G1KA 4JDYA 4HPNA 5A6TC 4HHLA 3VINA 2FHCA 3V5FA 3GC2A 4PCTA 5D32A 3AHXA 3W1PA 1A0DA 1V6YA 3QKZA 4IMEA 3LUTA 3AICA 1X97A 5AHMA 3OOQA 3EOOA 2P0IA 2V67A 3GS6A 1CXLA 3BXWA 4NJHA 3PJWA 3VYLA 1UA3A 4A3QA 1DJQA 3BG3A 3I6RA 1R3QA 1R86A 3VIIA 3GDMA 5CZJA 5HJYA 1TQJA 5JH2A 1A0EA 4JS3A 4CU6A 3QGAC 1Y5WA 5CSUA 4JBRA 4O0ZA 4ATDA 2DDXA 2WKGA 2VTFA 4Q4OA 1LLWA 3EX6A 4EXAA 2DZWA 4MG4A 1YNYA 2QCDA 4HCLA 4K8HA 1P0BA 3I6TA 3GTIA 1YRRA 2I1OA 2QQ6A 1BQGA 3O2LA 3BAXA 1EIBA 4PTXA 2E0PA 3M0XA 3GWQA 3SZ8A 1K77A 3AZSA 1PZ2A 1RCXB 5AECA 1UR0A 2VVNA 1VHNA 2OR2A 3W2KA 1SZEA 1RXOB 2A4AA 1KBKA 1F6PA 2OXNA 4LEQA 3ZVIA 3FA3A 1OGBA 2I5QA 3OLGA 1S2UA 3S1GA 1MMFA 3BC9A 3CQHA 1XGEA 3CL8A 4JFTA 2HE8A 2ZX9A 3TZFA 3OZOA 1CGUA 4O13A 5D04C 1W9VA 4AUBA 1LT7A 5I3GA 4HPXA 4UQAA 1PTAA 2OWXA 2DT3A 3C8FA 3GYEA 4H8UA 2DQXA 2P3ZA 3G0UA 3UERA 1MUWA 3CHCA 3FIGA 2OZ8A 1ZALA 2Z00A 4E0CA 1QOQA 2OCZA 4PB3A 3B0XA 1O6IA 5REQB 4DUXA 4ZQNA 3QV9A 2VELA 3W7JA 4H7VA 4NILA 3OB8A 1XX1A 5CPNA 1PPIA 1J12A 2C1GA 3ALGA 2XVGA 4PBGA 5E0KA 1QASA 3G1XA 2OQLA 4O12A 3TROA 3QN3A 1EJ7L 3WMCA 3CLMA 3N04A 2J77A 1JYNA 3S1XA 3T2QA 4DLFA 1A5UA 4GI8A 2OEKA 5HMFA 1X38A 1OC6A 2WM0A 4LBUA 3OHMB 3WLMA 2J9XA 3WBWA 5IHRA 3VKBA 1CT5A 3WELA 3S5ZA 2X16A 4LF2A 1XIIA 1WV2A 1TV2A 4HQVA 1XGDA 2CYGA 3CB8A 2R8WA 2W6RA 3G1VA 5M2FX 1EHAA 4ORIA 2GJXA 1DXEA 3A3HA 3H7RA 1VLIA 3V4BA 3EXTA 2Q02A 3R79A 3PZNA 1L2UA 3UJ2A 4ZO8A 3DHDA 1S38A 2NT0A 2PD9A 4Y8FA 5F4WA 1YNPA 4U2YA 4ICCX 2V5KA 2JFEX 4O4VA 3UY8A 4D6GA 3QY8A 2ZXDA 1HKMA 3GKFA 4RX0A 1ONEA 3UWVA 1T6MA 2EPHA 2OFJA 4S3CA 1F4HA 1H09A 1DVJA 3KL0A 5BNKA 1N8IA 3UXKA 1AZ1A 3GAYA 1DQWA 1KGUA 3T44A 4Q4RA 1HG3A 5IOBA 4GGHA 4CCEA 1NARA 1XLJA 5A2CA 4K6AA 1EBHA 4CVWA 3LRLA 2CETA 3BMWA 2WK2A 1U1UA 1M01A 1OB0A 2CLKA 3Q37A 1GNXA 1NY1A 1PX3A 1PBGA 3QR3A 3BQ5A 4O1EA 2RAGA 4HHPA 1OD0A 4KGLA 1FWGC 3MHFA 4O50A 4CNTA 2E4TA 2XFYA 4AMAA 4M82A 1CBGA 5TBOA 2J8GA 1HFBA 1OCNA 3I7SA 3E3HA 4I5UA 5HNNA 4CVUA 4WD0A 4UBPC 3WQGA 3P3BA 2ATMA 2J9ZA 1OINA 3SUUA 4P5UA 1JRCA 1I45A 2WCAA 3FYPA 3NQMA 1N82A 1JZ8A 3N11A 4ONVA 3NA8A 3QVQA 3N1AA 5I3FA 1GVFA 3N34A 4HZ8A 2BHUA 4G8TA 3TA9A 3TH6A 4GY0A 3L23A 1EHNA 2WBKA 2EHHA 1WKDA 3G5EA 1D3CA 1ONXA 1UR2A 2VYOA 1MI3A 1SFTA 1IYXA 1FY6A 1S2AA 5EYWA 1TZ9A 3IJLA 1LJYA 1TG7A 3DUGA 1TTIA 2ZXBA 1DJGA 2PWGA 1AVAA 2CNCA 3E0WA 3APGA 3M5XA 3W72A 3RR1A 1VBRA 1E9YB 1RCOB 1RH9A 4H41A 1AL8A 1CW2A 3TK7A 2GFTA 4Q4KA 3FX4A 4AH7A 2WAGA 1ICQA 5M17A 2RJHA 1CGVA 3UPBA 1MDRA 3MWAA 4F8XA 1UKSA 1R9YA 2XTKA 1OCJA 4H9TA 3N6JA 3TJ4A 3E0VA 3DXIA 4OBTA 5H8PA 3KW3A 4DNMA 2ABBA 2QZRA 4O4WA 2QJMA 2YKKA 2ZA2A 3NVDA 1C29A 4BI7A 1Z69A 5EMYA 1TWDA 1SQ7A 1TQXA 3FW6A 4YTRA 4LT9A 4ACZB 5LA1A 2YPIA 1EDTA 4D72A 1DJHA 3KOXA 3KP1A 3R0DA 2CFFA 5E09A 1V6XA 4ZE5A 1A5OC 1EJSC 4GJJA 2F2HA 2F84A 1DE5A 3GNPA 1PS9A 4PMUA 3W1RA 3URNA 1E55A 5A2BA 5FI8A 4KCUA 2YX0A 4C6KA 1UR8A 3AS1A 3TKFA 1X1ZA 5FJUA 4DBDA 3W3OA 4AHPA 1MNZA 4HNUA 2CHNA 5HQEA 1JZ6A 2NZLA 4HA1A 3EPOA 2IPGA 2QDGA 3HQNA 4JQ3A 3P8JA 1QBBA 1OZQA 4U4MA 1CB2A 1Q6QA 1TZZA 1GJWA 3AI0A 4H01A 3V16A 3TYEA 4UUIA 1HP4A 1LM1A 5BOOA 2VZVA 1O95A 4S23A 1NOUA 3DX5A 4HOXA 1VJIA 5B80A 1Y7VA 3OW1A 2G3FA 2E5BA 3EXRA 1H7PA 3W7IA 1HKIA 4PMNA 4DQWA 5CXPA 3W7DA 3RFAA 2X1RA 1KR0A 3MP4A 3M5VA 1O4UA 1KCKA 3PZOA 4RW5A 5FJOA 5E5CA 2ZRYA 4H8VA 4D8AA 4RXFA 1LBMA 1NH6A 2GUUA 2HK1A 2C13A 2Y89A 4CNSA 3W88A 5G2IA 3O15A 4ZFCA 4GVGA 3DU0A 1O7AA 2HVNA 1Q2RA 3DHPA 3L12A 1FKXA 2XN0A 4XBSA 5EFFA 4QDMA 3QM3A 1DWGM 2WCGA 1EQPA 1O66A 2R1MA 2YLLA 2CLEA 1UD3A 1KC7A 2MNRA 4MY8A 2WNZA 5D30A 1M7JA 4RUBA 2E6YA 1XH1A 3EMZA 2QCFA 3TW9A 4RCXA 5FEPA 2OMAA 1Z8AA 3G6MA 3UCDA 5HINA 4O1DA 3MKKA 1G5AA 4E3TA 1OYCA 3BCFA 1UUQA 3LBMA 2ZC1A 4V33A 4C7DA 3GXFA 3AS0A 3SN0A 1JUBA 3R2GA 3TAKA 4DI9A 4AD0A 1I2QA 4AZHA 3WFAA 2I57A 4H04A 5AHEA 3T8QA 4AEEA 2AGKA 3OTRA 3STPA 1BG9A 2BGSA 4ZO6A 4A29A 1C8VA 1TPC1 2IPFA 4WGHA 3ALFA 4JN8A 1DWIM 2VGIA 1JF6A 4O11A 4PMQA 4KESA 3H8AA 1TA3B 2D20A 3ZZ1A 1C92A 4DB7A 4I7UA 3PFMA 1UKOA 2QJGA 1W5OA 1CGXA 2ZTKA 3AU6A 1QR7A 1OX6A 3UXAA 4GRSA 1SJAA 1F3TA 4JQ4A 3CYJA 5I02A 2YB1A 3QXBA 4PN2A 1XYCA 5DLCA 1GG0A 2FZ8A 1BWKA 4NYYA 5D2TA 2EKCA 2O9OA 4HVXA 1HN1A 1J93A 1VRXA 4G2DA 1GVEA 2W61A 2V82A 1QRQA 1E6RA 1Q7ZA 1KQYA 3EEZA 1GJUA 2DSZA 3W81A 7PTDA 2VRJA 1GVRA 3DERA 4JTCA 2E8ZA 4IT1A 3IJIA 1AH0A 1QU4A 3WQPA 1O1ZA 1VPQA 5GPRA 1Z44A 4IJCA 3ABOA 3ITLA 3CBWA 5HWMA 2VFEA 3OQEA 1WA3A 3VE9A 2QDDA 1GCYA 2IKGA 3EX1A 1JJKA 3RPDA 1MNSA 4DJEA 4FR1A 4MNLA 4KQNA 2CCRA 2ZX5A 1GOOA 1QVBA 2WB5A 4LNYA 1FHVA 3DN5A 1XP3A 3VZXA 1X8CA 4BWLA 2W92A 3OVGA 3SFWA 4GNKB 3OYZA 3FS2A 2E8YA 3W1UA 3BLOA 2EG8A 2HZGA 1JCNA 1PKNA 4B5UA 1CNVA 4IP5A 1PZ3A 5C8BB 1JVNA 3CT2A 3GO2A 4W5UA 3WLQA 2CBVA 3LY0A 3UG8A 3DDMA 4BEQA 1ZB5A 5I07A 4GI9A 3KEHA 3GFZA 5CGQA 4L7ZA 2EGZA 3W23A 3PULA 5CC5A 4IMDA 5HWJA 1HNYA 1KB3A 3M7SA 4EF9A 3GLCA 2YA2A 2PWEA 4QCEA 1ZAJA 3WLLA 4LVDA 3FVMA 4LBRA 3TR2A 5IM51 3AJXA 3GDKA 1MZRA 3TUUA 1KW1A 4S1FA 2R1LA 2J88A 6TAAA 5HULA 4YNGA 4UTWC 4Z0SA 1WBJA 2J7GA 1UR4A 4UFLA 3DYMA 2YXGA 2PF0A 1NP0A 1MQRA 3C2YA 1QHOA 3G1RA 1UD8A 3AUOA 4M6PA 1LRNA 1VENA 3M43A 3TV8A 1FOBA 1C8QA 1Q13A 3GRIA 2GSJA 3EZ4A 3TSMA 1OFOA 3NQGA 4DXKA 1I1XA 2XINA 1JYXA 1FDZA 3KOYA 3RM8A 4FAMA 4IIHA 3BSMA 1W1VA 4MB5A 3WD0A 1UC4A 3MUY1 4B15A 3A21A 4U28A 3BE7A 5E0FA 4AVFA 2ATSA 3CIWA 5DANA 4UOQA 2PDNA 5KZEA 2PGRA 2BVYA 2FQIA 1LZOA 1BWVA 1H1ZA 3QRHA 1F2JA 2Y7GA 5AC7A 3RCNA 2QJIA 3A9BA 1EWEA 1U33A 4Y9MA 1QO5A 4DWDA 1B9BA 3KWXA 3USZA 2OOFA 2NQLA 1E3ZA 4PFHA 2UBPC 1GTEA 4V1YA 1YTEA 3F03K 3TTEA 4IPNB 4BQ4A 3M16A 2XIOA 3W74A 1FUYA 2XWEA 2XIIA 3MU7A 3BGJA 3G18A 3S5SA 4TV6A 5LA2A 2B0MA 4I5RA 2VC6A 4LU0A 4C7GA 1GTHA 3B9NA 1JXKA 3PP7A 4NAFA 1R8LA 2QUTA 3ITOA 3WLIA 4Z2HA 2DIKA 3MUZ1 3S6DA 2HK0A 4XISA 5B7YA 1V6VA 3GVVA 1OG6A 3MANA 2VJXA 4DJEC 2PLJA 4AZIA 1AZ2A 3LMYA 3SCWA 2E3ZA 1S3HA 3NR0A 5AC4A 1BAGA 3Q94A 3PPFA 4FPSA 3ABZA 3WJSA 3L2IA 4NP7A 3MZNA 2A85A 1JAKA 3T78A 4HU0A 1ISVA 1GOXA 1EC7A 3LCWA 5TIMA 2FGZA 1EYEA 3QOMA 4M6UA 3N19B 3AIBA 3OBKA 3SECA 1M7OA 4LV4A 1ONRA 3T0BA 1ZGDA 3GR7A 1TFVA 3DI0A 1JZ7A 3OGVA 3RMEA 3DFSA 4GUIA 5F7UA 1EKOA 1V03A 3L66A 4IQDA 4ZFMA 5DEZA 2Y8UA 3VKJA 4DM1A 1B2YA 3SY5A 4FALA 1TPFA 4NL1A 4ALDA 4N9DA 3T40A 2E6AA 4XD5A 2REQB 3L65A 1O12A 3VGFA 4XAYA 3WQDA 1H3GA 2XJ7A 5G1TA 3NEHA 3VFCA 4M8UA 1S2TA 4MY9A 4UNIA 1BRLA 1CXKA 1DWJM 2VEMA 3GHTA 3MP5A 1WOBA 4E8GA 1TYGA 3GG0A 3HJEA 3TJIA 3UR5A 4MOZA 2PBOA 4MDOA 4XZNX 3LXCA 3UU0A 1UD6A 1R87A 3WNKA 4REQB 2XPKA 5FA5A 4FXSA 3EB2A 3W2MA 2Z1XA 2R6OA 1XRFA 4E6MA 2OKTA 4WY0A 3TYZA 3SQSA 2ZVIA 2QS8A 3LMZA 3HMJG 1FWRA 4R7WA 2RGLA 4J3XA 3RM9A 1JPDX 4PMVA 4UTKA 3WK3A 4MB1A 3T0CA 4IQJA 5D03A 1H49A 1A0CA 1L6YA 3VIHA 1XLCA 1HJWA 4AZCB 1UD2A 1U1JA 3CGTA 4C1NB 1KFCA 1UP3A 4OIFA 3U48A 3KRUA 4PB5A 1A5NC 1IHIA 2CHRA 1OZMA 3DFPA 2DZBA 2FVLA 5D8WA 5EMUA 1GW9A 3G8EA 3BAWA 2NXGA 1J8VA 1ESWA 4V15A 2VR5A 1EXPA 1W9BM 1V7YA 5FL0A 4OUIA 3ARSA 2BG5A 1GGOA 4DZIA 2NXHA 1VEMA 3QPEA 5AC6A 3AQUA 3BLKA 1UD5A 3BJTA 3EWWA 1P7TA 1GQNA 1PV8A 1XQLA 3KRSA 3PS7A 4LVGA 4W4QA 1MW1A 1GVOA 3NQDA 2C14A 1XIJA 2BODX 3MDWA 4LGXA 3GUWA 2X1UA 4DO4A 2QIWA 3VVGA 1P48A 2NWRA 1B0IA 4I6VA 2D3NA 2WZEA 5FEZA 1KGWA 4ZCWA 3Q4DA 3SCSA 1BVNP 2BASA 5G2WA 3SR7A 3R94A 3A13A 4PUEA 4QIUA 4O1CA 1E51A 4KEMA 1POJA 3H70A 3O8AA 5C54A 1ZHAA 4DPQA 1UROA 1BG4A 4E2VA 3RPMA 2I9EA 4I9TA 3B03A 2W66A 1OFEA 3WBAA 4TQTA 3A3XA 4H6KA 3CMGA 1WQ5A 3UR7A 1HJQA 3BV7A 3M41A 2E5DA 2OELA 3KAOA 3UEQA 2VURA 3IK2A 4JFVA 3AYRA 4AF0B 2Z7GA 4J4KA 3GK0A 1JL8A 1UQYA 3QY6A 1PX8A 3MHUA 4JTLA 3UWQA 4CNUA 4E8CA 4IIBA 1QPQA 1OY0A 5D9MA 2ZZ3A 3FAXA 3F7JA 4HA0A 5AKQA 3B8WA 3GC5A 5CAKA 3HPAA 1IF2A 5G1YA 4JX6A 1WZKA 4S2BA 4DYKA 1HX0A 4KS0A 3SGZA 3KCLA 2V5DA 2FH8A 3BGGA 4EOUA 4XO7A 3W87A 1V3LA 3UCCA 4OBSA 4KF1A 1VGAA 3QY7A 1OFPA 4QS5A 3IVUA 3NAVA 1V6TA 3QR1A 4HNCA 1WZLA 3SN1A 3SSZA 2PDCA 2VRQA 4CD4A 4O53A 2OOGA 1IZCA 3O0KA 3VXGA 4F79A 2DP3A 3MSDA 4YVVA 5HXMA 1SO3A 4YPJA 3N15A 3LTYA 1W3KA 4GI6A 3AFBA 3WDHA 5EL1A 3WUBA 2GOKA 3H6OA 1WX0A 3L68A 3P67A 3WK0A 3S9YA 1IT0A 2NQ9A 4YHGA 2BVWA 4UQEA 2QAFA 3VGEA 3RJYA 1UUMA 1A4LA 4FP1A 2OEJA 2W91A 4RLIA 4A21A 3AS2A 3M47A 1VBHA 3TQKA 1IIGA 3EB3A 3W70A 2VC7A 4KGJA 1ICSA 3TAOA 4IH3A 4ZENA 5C0QA 4GCXA 4ZTXA 2PEVA 4UC5A 5KMYA 1EDQA 1HKKA 1JQXA 4M7TA 2VZOA 1JPHA 1TTJA 3AS3A 1R3YA 3D46A 4DXVA 2DT0A 1SSDA 2Q6ZA 3M0HA 2C18A 3MVTA 3MYOA 5DT7A 2QMJA 1RQHA 2PDUA 1UKTA 5DBUA 1FTXA 5GVJA 1E9ZB 3VPLA 1K8XA 2CESA 5AZ0A 3HOJA 3CH0A 4DIAA 1V7AA 3POHA 1E71M 2PU1A 2QJHA 2WSQA 3N73A 4BKNA 1PXGA 2ISDA 3W85A 3TN5A 1K9TA 3ZVHB 1CGYA 4JQ1A 1TWIA 2J7FA 3ZT5A 3O0FA 4JXCA 4IG2A 2DVXA 4HSHA 5JU6A 2EPMX 2INZA 2XIJA 2FJUB 2ZRVA 2VQUA 2XU2A 3ARYA 4XSMA 3OA3A 3SQLA 2VM8A 4MKSA 4Q8VA 4KWOA 3PJUA 3H22A 4G5DA 1VJSA 2JE8A 5FEWA 3S2NA 5KINA 1I4NA 4PUDA 5TAOA 3I3EA 1LL6A 5ABEA 2A3HA 2GSHA 3K13A 2QCNA 4EAYA 2BB0A 3S1UA 3Q2DA 1IXPA 2HISA 3A22A 4URIA 2AMGA 1IEWA 4PCNA 1NWSA 3HBLA 3SFKA 3VU2A 4LYQA 1VFUA 4K7VA 4XKYB 1EGZA 3JRKA 3BLDA 2P5NA 3OBEA 3LCFA 2NV1A 3WNLA 1DJIA 5HWNA 1PKLA 3DGBA 3M0KA 1M03A 4MVAA 4NXKA 3KOWA 4FZIA 3WMBA 5FEXA 1LDCA 1W8GA 3VKCA 2V3FA 3PZIA 5C55A 4HTYA 1DXIA 3C2RA 4ZO9A 3K1GA 1IXQA 1WKYA 4LCQA 4HMNA 1JDEA 1KXVA 3DIPA 3N17A 4DRSA 4EPKA 2D3LA 1ZBCA 1X6NA 3SIZA 5CSSA 1AW1A 1IWAA 3GD6A 1S1RA 3IPWA 4J2MA 3BARA 4YJ5A 4KPLA 5D38A 4B9ZA 3CASA 3ICJA 3VOGA 5I23A 1R85A 4EVZA 2ISSA 4Z2IA 3EX3A 1B9ZA 2YL8A 3TNOA 1MXDA 3TJLA 4IISA 1A4MA 1NWTA 3A4WA 1XFBA 4GYFA 3GR8A 2WKLA 1Z32X 1BKHA 3PPCA 1K1DA 4RNIA 3ATYA 2VP8A 2YBVA 4UMAA 4DJED 4GIYA 1HGWA 4DN1A 1JUEA 1XIEA 1LL4A 3VKDA 4CCZA 4DF1A 5CZKA 2ZZ5A 3U4FA 3NQ2A 3K8KA 5A5WA 1RALA 5CG0A 3FEQA 1TELA 3NL6A 2WHKA 4HYRA 4IZGA 1TVNA 2RDWA 4GK8A 5D33A 1S46A 4D6JA 3WEZA 5I5RA 1XICA 1RPKA 1OX4A 1QNPA 2PRHA 1K8ZA 1P6CA 1NDYA 3HFYA 2V9DA 2XSXA 4LWWA 3VFLA 3WBXA 1V79A 1SO5A 2GK1A 3SCTA 3HQOA 4LVAA 1W9DM 2F6KA 1KFLA 3COTA 3G1FA 1IGWA 3HGRA 4HU3A 4K68A 2WXDM 4W7UA 4HB7A 3AXIA 2PODA 4L6HA 5A6KA 4WXZA 4ML9A 1EPVA 2XDFA 1QK2A 4FOKA 1YIXA 5HUPA 4V1XA 3WNOA 1E70M 3S8HA 3ABSA 3AIEA 4KFPA 2P50A 3AWNA 1R47A 3IJ9A 1DIOA 4WDXA 5J8LA 3A47A 5BOEA 4JIRA 4AZ6A 1JZ4A 1DIKA 3WY1A 4PB4A 3STCA 1AMYA 4S3EA 1EJWC 1ZRQA 2HWGA 4L4MA