3SZPA

Full-length structure of the vibrio cholerae virulence activator, aphb, a member of the lttr protein family
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
290
Chain Sequence
MKLDDLNLFRLVVENGSYTSTSKKTMIPVATITRRIQALEDSLNLRLLNRHARKLTLTEAGERFYKDCSPLLERLASMTEEITDECRGASGRIRISAPSNLTKRMMMPMFNAFMEKYPDIHIELMMSNQADDLDPTEWDVIFRVGPQRDSSLIARKIGEVKDILVASPQYLSSHPQPTHAEELHQHQLLKGYPLLKWQLTNSQGETVVNSDRGRFQASALNVVRSACSEGLGITLMPDVMLREFLEDGSLVQVLSDWSSNPRDIYMLYNHKDHQPEKVRLFIDFVIGYHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of AphB, a virulence gene activator from Vibrio cholerae, reveals residues that influence its response to oxygen and pH.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transcription
molecule keywords Transcriptional regulator, LysR family
total genus 84
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3szpA01
3.40.190.290 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3szpA02
1ZHFA 2FMLA 4GXOA 4EGZA 4WWCA 1LJ9A 1JXSA 1YTYA 5CVVA 2HTSA 3L7WA 2YSRA 1FBSA 5H20A 4M6XA 4CHUA 1I5ZA 4CDGA 4HW0A 4EVIA 3L9FA 2FQ3A 3RDIA 4ON0A 1U5TB 3HTUA 4Y17A 1ZRDA 4WXDA 1Z7UA 4HDVA 1BJAA 1I1GA 4HOBA 1H0MA 5LHHA 2E7XA 2PLYA 2PEXA 2KRFA 2OQRA 4IJAA 1PUEE 1KU2A 4I2OA 5D5XB 3E6CC 2V1UA 5D8LB 2JSCA 1ON1A 1YW8A 2L3DA 1U5TC 2F5EA 2FOKA 4O3MA 4G7OF 1BI1A 2X4HA 3DQVC 2VE9A 1XDUA 2V1DA 3IHUA 3ZPLA 1TW3A 3EETA 1S29A 2ZJ2A 1C0WA 3FMRA 1JGSA 5J6XA 3HRSA 3V4GA 5AIQA 1BIBA 1UFMA 1QNTA 1HW2A 2IA0A 2A3SA 1A04A 1P4WA 3MCZA 2OZ6A 4CGZA 1SMTA 3J81K 1O3RA 4M9ZA 2BYVE 1OMIA 2V6CA 4BAYA 2QLZA 3BP8A 2XAHA 1F9NA 2J5PA 4YIIA 1D8KA 4LJZF 3KP7A 4HBLA 1G3WA 1BI2A 1LNWA 1EH8A 3BDDA 3H92A 3F21A 2HQNA 4MTDA 3ULQB 4U88A 3JTHA 1R00A 3HTSB 1DPUA 2HFHA 4LG0B 2DT5A 1B59A 1ZLJA 2XRNA 1G6NA 1TBXA 5IT3A 2J5OA 2ZBKA 5LHGA 2PMUA 4GGGA 3I4PA 3KEOA 2RV8A 3WE2A 5HLIA 4ZH4F 4A5NA 3RYPA 6PAXA 2NNNA 5D5VB 4E70A 1T2KA 2A61A 4ESJA 3FX3A 2G9WA 5KK1A 2IRFG 3GF2A 2UZKA 1B1BA 4NQWA 1ZYRF 4QLCU 2LDUA 1G3SA 1U3EM 2KKOA 1FP1D 3HRTA 3GFIA 1WRJA 2K27A 2G7UA 3V7SA 4YIFA 3K69A 1Y0UA 2NYXA 5DDGA 3FZVA 4EJVA 1OPCA 2JT1A 1AWCA 3SHFA 2FRHA 2LNBA 3R60A 1HSJA 4B8XA 2HWVA 1ZGAA 1O57A 2LF7A 1T39A 2L4MA 2D1HA 3QU6A 3ZN1A 3T5XA 2IW5A 1TNSA 3DKWA 2FXAA 4ENJA 5F64A 4EJUA 2RN7A 3R4KA 4I01A 4NHJA 3DFGA 2VODA 2DAOA 2GAUA 2YX4A 2XIGA 2ACJA 2O61A 1KA8A 3SQNA 1B9NA 1J2XA 1FSHA 4ETSA 4Y15A 3G3ZA 3J80Z 1PDNC 2QENA 3U2RA 5K1YA 5ILUA 4KUMA 1SD7A 2D1VA 4WXCA 5JR3A 2V1XA 5DEQA 4A6DA 1PP7U 4IF4A 4PCQA 2XAFA 2K02A 1WSUA 1EH7A 2VXZA 2MA3A 5CVIA 3ECOA 2M87A 4CXFA 1LEBA 3Q9SA 1YQAA 4P96A 5HDNA 5D5UB 4UVCA 5ICEA 1E2XA 4NB5A 1RNLA 1R22A 1J5YA 4BHBA 2HS5A 2W57A 4MGRA 3D0SA 4BXUA 3MZHA 4LMYA 1SAXA 2JPBA 1OKRA 3I59A 3T0YA 1XD7A 5E1XA 4M9XA 2RDPA 3IWFA 3HUGA 4U0WA 4HDUA 2CFXA 5H6RA 4OIRF 4EV0A 3DPTA 5EEGA 1W5TA 2EB7A 1FLIA 4EMSA 1F1ZA 4HX8A 1G3YA 2STTA 4P9UA 2ETHA 2E1CA 4P5OA 1FY7A 2EV6A 3EYIA 3RKYA 3ISPA 3JSPA 4ESBA 2L02A 2DK8A 2A69F 1R5GA 1CF7B 2XKOA 1FPQA 3DXJF 2F2EA 3I58A 3WGIA 2FE3A 4RB0A 1XN7A 3MZYA 4KN7X 1FBQA 1FBUA 1LDDA 2Q2EA 4ZYEA 2O03A 3O2PE 3KETA 5E1ZB 5AONA 1IUYA 3F22A 2EFPA 1ZGJA 3J80K 1QPMA 2CQKA 3Q5FA 3E5QA 3TO9A 1R5HA 4I09A 4HA8A 2LF8A 1YLFA 2VC0A 1I27A 3F8FA 4O6JA 4RS8A 1LB2A 4N9IA 3ABUA 1I6XA 2KJCA 3PFIA 4Z2YA 1SFXA 1D8JA 1IN8A 3E6DA 4AIJA 4LB5A 4S04A 1SFEA 4ENMA 3AAFA 1O3TA 1XGOA 5BPIA 1P6RA 2BV6A 4L0ZB 2HR3A 1IN5A 3GWZA 1P4AA 1SD5A 3K1NA 1YFHA 3KZZA 2R7FA 5CVUA 1WQ2A 4KNYA 1XSDA 4L9JA 2W84A 4FT8A 3C3WA 1VTNC 1XMAA 1STZA 2EA2A 1REPC 3H3UA 2PQ8A 4LLGF 1F5TA 3F8CA 4CO8A 4UVBA 1LDKB 4ZYGA 5FD6A 1ZG3A 4RAYA 1P4XA 2RNJA 1IN4A 2HZTA 4Q47A 2QQAA 2MH9A 2DI3A 1ZRCA 1YS6A 2A6HF 2ESHA 4M73A 3CJNA 2RVCA 2ZMEB 2ADUA 2FU4A 3K0LA 1CF7A 3FXQA 4M71A 3MAJA 3HYIA 1R36A 1R1VA 1MDMB 2P5VA 2UXNA 2EJRA 2ZFWA 3S2WA 2E1NA 2EWNA 2XUBA 5A2QK 2QZ8A 3E6BA 2P8TA 1KU9A 4K2EA 4FHTA 2W85A 4LD5A 4OMZA 2CWEA 2MLGA 3B02A 3NQOA 1Z05A 2JRTA 3L00A 5E17F 4KIFA 3R0JA 1MKMA 3ZP5A 3BZ6A 3KP2A 3T8TA 4OIOF 1TW2A 4LK1F 3I64A 2CYYA 1S7OA 2D2WA 2PN6A 3WODF 1O7LA 1R58A 5H6QA 2EFOA 4I98B 3IKVA 3I59B 4LK0F 4HF1A 1W4MA 3J81Z 2IA2A 2M45A 1W7PA 3QP5A 1QQIA 5CVRA 2VONA 5F6FA 1DUXC 1FOKA 1QZYA 4WF2A 4KDPA 1S8NA 3SZTA 2AS5F 4L18B 1HKTA 1Z1DA 2E7WA 1HW1A 1ZREA 2FBKA 1U8RA 3FWEA 3LQRA 5LEKA 1O3SA 3LA3A 1U6GA 2CO5A 2P4WA 4RB3C 2IVMA 2RKHA 1K78B 4L9VA 5FFZA 2EFWA 3P9IA 2OQGA 4XLPF 4A5MA 2ZNZA 3I54A 1FNNA 4RAZA 4KICA 2DU9A 1EV7A 4U0VA 2QWWA 3HOSA 3RTRA 3T1BA 2ZO4A 4GCVA 3RI4A 1IW7F 1IXRC 2K86A 3U1DA 4WXHA 2O6GE 3IKTA 1IRGA 4HLXA 1GHCA 2QVOA 4QBAA 2RGVA 1KGSA 4IHSA 1TQPA 2Q8KA 3GEZA 1IXSB 1ZG5A 3RKXA 1K78A 5CYVA 1BM9A 1J7KA 2HTJA 4M72A 2DPUA 2ISZA 4P9FA 1D3YA 1WWXA 1T38A 1MD0A 1W5SA 3M7GA 2QUFA 1BOAA 3O6BB 5K5RA 1R1TA 5DUKA 5D5WB 5LRSA 3JTGA 5E18F 4KT5C 4YFKF 1XGSA 1F4KA 3GX4X 1FC3A 3K1PA 4BNCA 1FP2A 3QOPA 1WKMA 2DK5A 1XSXA 3MEXA 1IXCA 2FBHA 2H09A 3Q9VA 1GXQA 1Z6TA 4UNOA 4LFUA 3CUOA 3JW4A 4CYDA 2EK5A 4AVPA 2EFNA 3SFZA 3V8KA 2K7LA 4B09A 4KA4A 4YFXF 1TQIA 3NRVA 4XSXF 1Q1HA 2YR2A 1OYIA 5HS9A 1BC8C 2O3FA 3DEUA 5HDKA 3N4MA 4JK1X 3K1MA 3ROUA 4WK8F 1QBJA 5E8IA 3V8LA 2UWMA 5HLHA 5K5OA 5D8KB 1UHWA 3WGHA 5HS8A 2VBZA 4I0BA 1YIOA 3TDUC 4HV5A 1MDMA 5FLXZ 2EA4A 4IXAA 5ED4A 5LLQA 4LLNA 3WG9A 5BOXA 1ZLKA 2M5WA 1TQMA 1XB4A 1KU7A 2MBFA 1SD4A 5AIPA 2Z33A 2IA1A 5HVQC 2W24A 1QZZA 3RIRA 3ZMUA 3I53A 2HKXA 5CVJA 2XROA 1RZ4A 3HFUA 3GW2A 3WGGA 5FGMA 3IL2A 1HBXG 4BQAA 3RPUA 4PZJA 2H27A 4EQQA 2XKPA 3IRQA 3FMQA 3EYYA 4L9NA 4QWQA 3BPVA 2HOEA 2C6YA 4G7HF 1Z6RA 5CLSA 2EV0A 4KMFA 1LEAA 2IP2A 4JVCA 5J8CA 2TDXA 1DDNA 5D6FA 2UXXA 3P7NA 2P5KA 3WU1B 2P7CB 4HX4A 3QPHA 1S6LA 5J8FA 2VBWA 1FYKA 1HKSA 2WV0A 3GFMA 3LA7A 5DUIA 5LGUA 2DPDA 3CO7C 5L3BA 2FMYA 2IJLA 5DYMA 1UB9A 2EFQA 3BJAA 1W7PB 1XMKA 2AXLA 3GXOA 2PJPA 4HAMA 1KQ9A 5TRDA 4JQFA 2VBYA 2HGCA 3FM5A 2KIUA 4XRFA 3F8NA 4FX4A 4R1HA 4A0ZA 1K6OA 4HQEA 3IRRA 4L5IA 5HS7A 2JZYA 3C7JA 2H94A 2KJBA 4G9YA 1ZAOA 3CUQC 1ULYA 4EM2A 1IF1A 4HF0A 2CW0F 3M8FA 2YX7A 4I0AA 1BC7C 2GA2A 2K4BA 1T6SA 2MLKA 4I7HA 4PGGA 3E6MA 2YPRA 4MQ9F 1W7PD 2LKPA 2VOOA 5BS6A 2DBBA 1O3QA 3GFJA 4MHGA 4AIKA 1KU3A 1RI7A 3KP3A 3SZPA 3ABTA 3DP7A 2XAQA 2DQLA 3CUQA 2GZWA 4I02A 2NRAC 2OZUA 4TV7A 3LQQA 4G6DA 1NHAA 1ZRFA 2ESNA 1Z9CA 1BIAA 2FEZA 1MGTA 2ELHA 3KCCA 5EEHA 2HKOA 5DCFA 5LGTA 4CZZA 2CSOA 4UV8A 1XGNA 4R8HA 3ZMDA 3DF8A 1MJ9A 1R23A 2Z99A 1ON2A 3F3XA 1BI0A 4BH9A 5DV5A 5LRRA 2PBIA 1UCRA 5DD8A 4H0EA 1H9GA 4MTEA 2MD5A 4EJOA 1IN6A 4EGYA 1IAWA 4UHTA 3JSOA 5IT9K 4GO1A 4EJTA 3QPTA 2M8EA 1KQ0A 5ICFA 4JVDA 4Q5SF 2NS0A 3KFWX 4PDKA 1ONVA 3WTXC 2P5LC 1T98A 3FXRA 1K7AA 2W25A 3R0AA 2A07F 3F8BA 1QGPA 5LHIA 4ZYDA 3M9AA 3JAMZ 2VC1A 1U78A 3WTSC 2IPQX 3RPQA 1USTA 4OINF 5L3EA 4OOIA 5LEJA 4RGUA 4KN4X 3TO7A 1GXPA 3HSRA 1JHHA 3F23A 2BEOA 3TQNA 2GXGA 2VBXA 2ZCWA 5ILSA 1KQ8A 3PQKA 3I71A 3M1EA 3HRUA 3LWFA 4AIHA 1FT9A 3PQJA 4IRIA 4GYIA 3BPXA 3REOA 3T8RA 3SXYA 5ICGA 4XLNF 2PFBA 1TNTA 1SFUA 3G73A 3ELKA 3TKYA 4IHTA 4M74A 2A68F 1CGPA 4YG2F 4RGXA 4G7ZF 1L0OC 3IWZA 1JE8A 3LA2A 1LDJA 4ENNA 3OV8A 3QP6A 2Z5UA 1J0RA 3LSTA 4JBAA 4WX9A 3P9CA 3ZN0A 1B6AA 2LSOA 3C18A 4LB6B 2FBIA 2K4JA 1LQ1A 4HX7A 5K5QA 4N0BA 3DV8A 5DCMB 2OBPA 3F6OA 4M9SA 4P55A 2MC3A 3GO5A 2WWYA 1HXDA 2FNPA 2DQRA 3CUQB 4KIBA 3V7CA 5D4RA 3QU3A 3P9KA 4ZZLA 3GZ6A 2F5CA 3QAHA 3J7AO 1S3JA 3H3ZA 1ZH5A 4A12A 2WTEA 1J59A 2XGXA 2XASA 4JVIA 4KYWA 4A0YA 1SD6A 4BYYA 5L3FA 3ZMZA 1HQCA 3KEQA 3E5XA 5ILVA 2VT3A 4A0XA 5LBQA 3BOQA 5KVRA 2QQ9A 3IC7A 3QRFF 2OD5A 1SMYF 2QQBA 3GUDA 3COAC 3N97A 5HDGA 3E97A 2XV4S 1T0FA 1OYWA 1R1UA 3BJ6A 4U0YA 5JI6A 4RGRA 3VOEA 2OA4A 2P6SA 3BWGA 1KYWA 1YW7A 4GYGA 2O8XA 3VFZA 2QBYB 4IVNA 3TOAA 3MQ0A 3NEUA 1U2WA 1RUOA 3VODA 1QO0D 5TJJA 2QBYA 3RKWA 2PI0A 4AWXB 2VT2A 3FF5A 4FX0A 2VE8A 2FNAA 2XAJA 1PP8F 4G8XA 3FHZA 2ZNYA 1TTYA 3KZYA 4RGSA 1OR7A 5E1WA 4ESFA 3HSFA 3FMSA 1OYYA 2JTVA 3R6SA 2CGPA 1XCBA 3EDPA 4XSZF 1ZG1A 1XSVA 5JFRA 1IN7A 3HHHA 1FYMA 1HKQA 3TO6A 5D4SA 2COMA 3WTUC 2HDCA 2V9VA 2L54A 3V7RA 2DTRA 2RC4A 4BHPA 4EM0B 1V3FA 3GLXA 1ZN2A 5FFXA 1DP7P 1HSTA 1FSEA 2ZXJA 4MEXF 2ZKZA 3ZMVA 2GQQA 2L4AA 4HYEA 3E3VA 5DCMA 4R79A 1ODDA 5HLGA 4HF2A 4HV6A 2Y48A 1YYVA 1B4AA 2X0LA 5BQTA 4ASNA 2D45A 2F5DA 3BY6A 4L5JA 4UUVA 3CLOA 3K9TA 5FLXK 1S7AA 3F6VA 4UXNA 5CJ9A 4RB1A 3F8MA 4BHCA 2H6CA 1RUNA 1MZBA 3K2ZA 4EM1A 3CO6C 2Q0OA 3WTZA 5FB2A 1EH6A 2F5FA 4MQVA 3WTVC 1BI3A 4LG0A 3GYHX 4G94A 5F1RA 5ICCA 1USSA 3BROA 4PGHA 1H9TA 3W6KB 3WU0A 2P6TA 3KP4A 1J9IA 2GIVA 3ZMTA 5ERIA 3GZ5A 1JHFA 2DFIA 1FX7A 5L3CA 4U7DA 4OMYA 2A5YB 4UV9A 3LAPA 1MJAA 3L09A 3WTWC 2KIFA 1BBYA 4HLYA 2YU3A 3E5UA 2XVCA 3FM3A 2HYGD 1K79A 5JHUA 2GWRA 2JPCA 5L3DA 3HOTA 3MWMA 2GA1A 1G4DA 2P7VB 2STWA 2PG4A 2GXBA 2QM3A 2XHKA 4Q4ZF 2BBYA 5L3GA 1Z91A 1TLHB 3MFKA 2FA5A 2H6BA 3W6JB 2DW4A 2RQPA 3R61A 5E20A 5FD5A 1GVJA 4ZZDA 2R7DA 1FYLA 3LFKA 3B73A 3ML6A 1XCVA 4XBFA 2VOPA 3GVAA 3HHGA 1J75A 1U5TA 5BPDA 2Y75A 3ERED 4LLLA 3BJOA 4A2UA 4HQMA 3V8JA 3I5UA 3KP6A 4OIPF 1P92A 2A6EF 1XGMA 3FXUA 4D0PA 5HOOA 2NAZA 3TOBA 3HSEA 4Q48A 4AD9A 1FWZA 5E8GA 1X3UA 1I1SA 3HIFA 3EUHA 1ZARA 2BGCA 2MH2A 5DD4A 2B0LA 2Y0MA 2DO7A 1B9MA 4OIQF 4OU0A 3VEPA 3CTAA 3LAJA 2BE5F 4WCGA 4S05A 3L2CA 5JVTA 1IZ1A 4CICA 4UVAA 3GFLA 4U7BA 5LGNA 2EV5A 3KLNA 3TDZC 1KYZA 3ECHA 4L9TA 3D5LA 2KIMA 2FF4A 2NNYA 1YS7A 1AOYA 3KE2A 3VB2A 1L3LA 5BMZA 2HEOA 2OAZA 4KIGA 1G3TA 1YG2A 2CG4A 1LVAA 3WTTC 2Z3YA 1XDSA 3U9GA 3RYRA 5A2QZ 1D5VA 4KMUX 3KLOA 4LGWA 4MEYF 1YW9A 1P2FA 2Z9OA 1IRFA 3C1DA 2OU2A 4DQ2A 2ZMEA 3JAMK 2L01A 1DPRA 4MNUA 4DNCA 2FSWA 5FO5A 4L0YB 2XAGA 4IPAA 1HW5A 4Y13A 3O3KA 3CDHA 1BN5A 1RIOH 2QYOA 2HXRA 4M6YA 4HZFA 1R7JA 3WE3A 1O7FA 2M1BA 5IT9Z 3ZMSA 3F72A 4EJWA 2VN2A 1YO5C 4F7ZA 3M8EA 2WC2A 5D6EA 4G6QA 2DLLA 3OOPA 4IRHA 3RJPA 3WTYC 1UHMA 3HRMA 2ISYA 1V4RA 4A6EA 3I0TA 4IRGA 2HQRA 2HYFA 3TGNA 4RB2C 4ZYHA 2R3SA 2PMHA 2IT0A 1E17A 1FZPB 3ZQ7A 4ENKA 2O0YA 2V79A 3EQLF 2G7HA 4O5VA 3KP5A 4KFCA 3DPLC 1MJBA 1WI9A 4YFNF 4N9HA 2M30A
chains in the Genus database with same CATH superfamily
1ZHFA 2FMLA 4GXOA 4XNFA 4EGZA 2K9LA 1QHHD 4BY7J 4WWCA 3IO6A 2DOJA 1LJ9A 1D0ZA 1JXSA 3VE1B 4G12A 1BR2A 1YTYA 2R92J 3L2UA 2DOAA 5CVVA 3CCMI 5EYFA 1VNDA 2HTSA 2ID6A 3K70D 1B0HA 2FIXA 3K02A 3L7WA 4FJPA 2YSRA 3IFAA 1FBSA 2LH9A 3FJGA 4F19A 4F22A 5I56B 2GFEA 5H20A 4YEJA 1J09A 4M6XA 1FCKA 5CC2A 4CHUA 1I5ZA 3EF7A 3E78A 2X85A 4CDGA 4IL6C 2KP6A 2LOOA 4LP2B 4HW0A 2A5SA 4EVIA 1X2NA 3L9FA 2BY0A 5FTIA 2FQ3A 3RDIA 4ON0A 3CLQA 2OTJI 3GTPJ 1VQKI 4ESWA 1U5TB 3ZCOA 2EIJH 3HTUA 2X1EA 4Y17A 4IQ4A 1GTKA 2AYSA 2ECCA 1ZRDA 3KEIA 1NNKA 4WXDA 4V2FA 1Z7UA 4HDVA 1BJAA 1I1GA 4HOBA 1H0MA 9ANTA 1A8FA 2MC4A 3OYDA 1GVCA 3PPOA 5LHHA 2JVHA 3VYSB 2ZXWH 4ZDLA 2R5YB 5GTHC 2E7XA 2PLYA 1TL8A 1K9ZA 3TKDA 1UMQA 1VQ6I 1MXUA 2PEXA 2KHMA 3R7XA 5GPCA 3CDIA 2KRFA 3OYNA 2OQRA 3DLAA 5TPAB 1RPWA 4IJAA 1URSA 1PUEE 1KU2A 2LTPA 4I2OA 4DZ1A 5D5XB 3E6CC 4KPTA 4EQ9A 2V1UA 5D8LB 2JSCA 1HDPA 1ON1A 1YW8A 1N7XA 4C0RA 1FBEA 2L3DA 1R9LA 1U5TC 1PDAA 3PO2J 2F4IA 2F5EA 1PVEA 2FOKA 4O3MA 1SBPA 4G7OF 1Z7NE 1BI1A 1V54H 2X4HA 2LREA 1QRYA 3G3KA 2REJA 3OELA 3DQVC 1DPPA 2VE9A 3UKGA 2QVUA 2W82A 1XDUA 2V1DA 3IHUA 3ZPLA 1TW3A 5GAHJ 5K2YA 3IB1A 2CRGA 2OPTA 1S29A 3EETA 1IMDA 3MKLA 2ZJ2A 3MP6A 4P1LA 4RDUA 3JREA 2NVYJ 1C0WA 4E7KA 2M34A 3FMRA 1B1HA 1JGSA 2BHYA 5J6XA 3U1KA 5CMKA 5CQGA 3HRSA 3TCHA 3H5NA 3V4GA 2OC6A 2WBBA 2Y7WA 4O94A 5AIQA 5J1UA 5HNFA 1H45A 1SD3A 1FJ6A 1BIBA 3SETA 3VLUA 3K01A 2VGQA 1UFMA 1QNTA 3BR6A 1B3LA 3A09A 3CESA 2CUFA 2VJIA 1HW2A 2IA0A 3HOXJ 3PU5A 3SERA 3H6WA 3PD8A 2L5QA 4I9DA 2A3SA 2BW3A 1A04A 4M3EA 4A3DJ 1P4WA 1QZEA 3MCZA 2DMQA 5EF6A 2KISA 2Z23A 2GH9A 4C30A 3SJMA 1ZQ3P 4DCXA 3UORA 3GTJJ 2OZ6A 4GBWA 4CGZA 5DTDA 1SMTA 1FTZA 3J81K 1O3RA 4M9ZA 2BYVE 2P0SA 4R73A 1WI3A 4KT6A 4ZEDA 1OMIA 2IGKA 5GPAA 5KCMA 5CKTA 1PUFA 4C2UA 1FTJA 3T66A 2V6CA 1D1BA 4BAYA 2I5UA 1CQTA 4EQ7A 2QLZA 3BCBA 3BP8A 2XAHA 1F9NA 2J5PA 4YIIA 4PC9A 3UA8A 3TP3A 1D8KA 1OCZH 3C34A 2NWJA 1OQYA 4LJZF 5H8QB 4NC7A 1DGWY 4NDLA 3KP7A 2R7WA 5LTCA 1MBKA 4HBLA 3NWTA 4XOTA 3C31A 1G3WA 1BI2A 1LNWA 1EH8A 3BDDA 3H92A 3K4BA 1MQDA 3E4RA 3F21A 4LVQA 2I4BA 3BG6A 2HQNA 2F8DA 2DDKA 4MTDA 1DP3A 1Y1VJ 1XOCA 3ULQB 2FNCA 4U88A 1MBEA 1URDA 3LUZA 4LG3A 3JTHA 1R00A 3HTSB 1DPUA 2IS2A 2E5ZA 2HFHA 2HOAA 4GXSB 2A6TA 3OO8A 2GLOA 2MKZA 3BR1A 5F1QA 2HOTA 4LG0B 4YU0A 2DT5A 3TL4X 1B59A 5J16A 1OCOH 3HB9A 3LSXA 2F48A 1AMFA 1ZLJA 2OTLI 2XRNA 4JWXA 5F04A 4GWSA 1G6NA 2ELJA 3CMYA 1B3HA 1TBXA 1OFCX 5IT3A 2WKYA 2I6EA 4BDLA 3OYGA 4ZYAA 4IKFA 4QSDA 4GD5A 2J5OA 4ZDMA 1MMAA 4D9JA 1B8IA 1BR1A 2F6CA 1NV5A 4X9TA 2ZBKA 4OHNA 5EQAA 4DZPA 4AS4A 3G1LA 2PMUA 3PUBA 5LHGA 5IOYA 4GGGA 1B4ZA 3I4PA 1E3OC 1R1NA 1SW2A 2VT5A 2X6YA 3V89B 3W15C 2VPOA 4XKPA 4M3DA 4LN5A 2LRDA 1JT0A 4MBPA 3Q27A 3KEOA 5TP9B 2RV8A 3BR5A 4PUSA 3W2VA 5H8QA 1ZJLA 3WE2A 5I57A 1AU7A 2XXRA 1VQ9I 3HN0A 4RK9A 2VI6A 5HLIA 3HDDA 4ZH4F 4A5NA 2DDAA 2MG4A 3RYPA 3I56I 6PAXA 3C4MA 2QGUA 3O97A 2BXZA 4PFTA 5FHNA 2NNNA 1D9QA 4GWWA 5D5VB 2F97A 4E70A 4BJTA 1T2KA 2JJ7A 2A61A 4RPNA 3UP9A 4ESJA 3FX3A 1PB8A 2G9WA 3ILUB 5KK1A 3FATA 4YKPA 3OENA 2ZXHA 2ZJPF 2F7AA 1Y1ZA 2E2IJ 2FX0A 4JX4A 4OAZA 4OETA 3RLFE 2IRFG 3GF2A 2UZKA 1EYKA 1PUFB 1B1BA 4NQWA 5B70A 3GTKJ 1ZYRF 3IL1B 4H65A 2V1NA 4QLCU 2LDUA 3ABKH 1OISA 1ETOA 3AG2H 3MUQA 4RPOA 1G3SA 1U3EM 3H6TA 4OESA 1M1EB 2IXSA 2IA4A 4M6VA 1IXGA 5IZZA 2KKOA 2GIZA 1FP1D 1EF4A 1MXWA 4ZS9A 3HOYJ 1MXYA 5B3SH 3HRTA 3GFIA 1WRJA 2K27A 3GZNB 3ZXSA 2Y7RA 2Y0SA 2G7UA 3A01B 1FQDA 1XVXA 3V7SA 4U4SA 1RKMA 2QKMB 2WV1A 5IY5H 3K70C 2QS2A 4BDRA 4NMYA 1ZGWA 5IM2A 3MN2A 1FPLA 4GOTA 4YIFA 3OL4A 3K69A 2WB1A 3S17J 2IS6A 1Y0UA 2BHZA 2NYXA 4O8MA 4P47A 4UABA 5DDGA 3FZVA 2X6XA 3TCGA 3KJ7A 4QPOA 3WHCA 4UY8I 3TEPA 2Y0SN 1OPCA 4EJVA 1KZ8A 1TWHJ 4IO3A 4PJ0C 4R2FA 1R6RA 2JT1A 1AWCA 2YU9J 3SHFA 1YCJA 4N6PA 2FRHA 4RA2A 2LKSA 4H45A 3IX1A 1M5DA 2LNBA 3R60A 2RKMA 4DXUA 3G6EI 1HSJA 1T56A 1FQFA 4B8XA 5ICQA 3FKIJ 2HWVA 2FBPA 2XWVA 5CMCA 1ZGAA 3A3CA 1O57A 2LF7A 2RF1A 1T39A 3CFXA 2L4MA 2D1HA 3FVOA 3QU6A 3NAUA 2V3QA 2DA1A 3ZN1A 3VXCA 4QSEA 5B7DA 3T5XA 3OYJA 1D1AA 5LOMA 4U22A 2IW5A 3O28A 1TNSA 2P0WA 2W1OA 1EZOA 3DKWA 2FXAA 4ENJA 3V5AA 3FVKA 5F64A 3S9LC 1USYE 3K4MA 3I4NJ 4EJUA 1FTLA 2CU7A 2RREA 1VFEA 5J1DA 2RN7A 3BG3A 2QEXI 4HEA2 1D4NA 4CCNA 2G29A 3R4KA 4I01A 4NHJA 3DFGA 2VODA 3M3YJ 2DAOA 5ET8A 3EHSA 2GAUA 2YX4A 2XIGA 1WJFA 3F11A 2WYKA 2ACJA 1SC7A 1Y6IA 4B3AA 4BDMA 2M0MA 2KZVA 2WY8Q 2O61A 3BKIB 5M3MJ 1KA8A 3SQNA 1B9NA 3HGGA 1OLAA 1J2XA 1JT6A 3OS1A 1VDWA 1FSHA 4ETSA 4PF6A 2N8GA 4Q0CA 2HZDA 3KBRA 5KZTA 2NS8A 4MFEA 2IEKA 2H99A 5DT6A 5KAIC 4JDFA 1PB9A 4Y15A 2OWSA 4F55A 2ZNUA 2VLAA 3G3ZA 3J80Z 1PDNC 1MPDA 4C2MJ 5ITPA 5JLXA 4OVJA 4BQOA 4PDHA 2QENA 2AXTC 2MSYA 3V8XB 3K6XA 3U2RA 1EJ9A 5K1YA 1EH3A 5ILUA 4NG7A 4KUMA 1D0XA 3HKZN 1HOMA 2XXXA 1SD7A 5K7HA 2D1VA 2B65A 3H5AA 4WXCA 4F92B 5JR3A 2H98A 2DVCA 2V1XA 3GMEA 4FISA 5DEQA 2ZXTA 4A6DA 1PP7U 2MABA 4XN0A 4F3BA 4IF4A 3V83A 3OMYA 5K2XA 3NOHA 4PCQA 2XAFA 4NF5B 2K02A 1WSUA 1H3DA 3LOCA 3KN8A 1DSNA 5GAGJ 2JN6A 1EH7A 3OYMA 3FK6A 4XLAA 3IOWA 2VXZA 4KJZA 3B6TA 2MA3A 2WA0A 1LEVA 2I48A 3ZOBA 4RBOA 2LMDA 2KFDA 5C3EJ 5CVIA 5HNHA 3ECOA 1QVSA 2I0CA 3IH3A 3DBLB 1ATGA 1IQ7A 4FAJA 3HOZJ 1MBGA 3DBRB 2M87A 4CXFA 1LEBA 3Q9SA 1QA6A 2DA4A 1YPNA 3BTIA 1YQAA 3EPZA 1JTYA 4P96A 5HDNA 2I49A 3IB0A 3E79A 5D5UB 2NOOA 5CMBA 4C1UA 3PFYA 4ZEKA 1OQHA 4WXJA 4P56A 1XT8A 3CVGA 1T8IA 4R6YA 4UVCA 1Y3PA 4ZEIA 2X51A 2OJTA 1X3WB 5ICEA 1E2XA 2R5ZA 3M3KA 3DEWA 4NB5A 1RNLA 4PFUA 5I84A 1R22A 4GX6A 1J5YA 4BHBA 2HS5A 1YTVA 4G68B 2W57A 4MGRA 4P1EA 5JK4A 1WCMJ 1Y8RB 3SDFA 3BBRA 4BE2A 3D0SA 4BXUA 4QSCA 3MZHA 4LMYA 2DWIA 2F34A 1BL0A 3JRHA 1SAXA 4YMAA 2JPBA 2QVVA 1OKRA 1FPJA 4P3LA 3I59A 2GBYA 2JQ7A 1WH5A 3T0YA 3OOAA 5E3NA 1XD7A 5E1XA 4HG2A 2CEXA 5AA2A 2DFFA 4FTHA 1HC8A 1NH8A 4M9XA 1TWGJ 2WAQA 3CCJI 5I3SA 2RDPA 3OOUA 2LG4A 1AH5A 2WX9A 4IB2A 2WY7Q 3IWFA 3HUGA 1JW1A 3FV2A 4U0WA 4NTLA 4HDUA 1MG1A 2CFXA 5DVJA 3EUKL 3N26A 4O3BA 5DTBA 3A1YA 3B6CA 5H6RA 5J1YA 2VPLA 1N3XA 3MKWB 2ALUA 3PTYA 4YB6A 4OIRF 3SZGA 3PUWE 4EV0A 1US5A 1GV8A 3PMXA 3DPTA 3MVXA 1O64A 5EEGA 4BJ6C 1QPIA 3C2HA 1TWYA 3MVWA 1W5TA 1SW1A 3U92A 2EB7A 3U21A 2GQ1A 1OIBA 1QUIA 4ZJZA 1TWFJ 3FXKA 1FLIA 1A40A 4DXCA 3FISA 1F1ZA 4EMSA 2RNGA 4D7NA 2QKLB 4D7MA 4HX8A 1G3YA 4F2QA 2STTA 1H43A 4PCDA 1HSLA 2KQZA 4P9UA 2DA6A 1JKOC 1FBDA 3QUJA 2ETHA 4IOCF 2DA5A 2E1CA 1BW5A 4P5OA 1FY7A 2EV6A 4GDFA 3ONQA 3EYIA 2PYYA 5AA2D 2PJRA 1JEUA 2OZZA 3CFLA 1IJWC 3RKYA 3MPLA 1YJWI 3P7IA 2UYEA 5KCJA 3ISPA 1BP5A 3JSPA 4ESBA 4R2BA 3AG3H 2L02A 2F6GA 2DK8A 2D5WA 2A69F 1Z7ME 1R5GA 3QYBA 2F4MB 4XRSG 5DYHA 4XLFA 1CF7B 3RYDA 1IO2A 2XKOA 1SEUA 2R93J 1LBVA 3DPUA 1FPQA 3PL8A 1RRJA 4PF8A 3U72A 3DXJF 2F2EA 2I3VA 1LFIA 3I58A 3L6GA 2XGDA 3J7YJ 3WGIA 1ZIUA 3B8BA 3QODA 2ME6A 3RNNA 2FE3A 4THIA 2HZLA 4QPQA 4RB0A 3PSIA 3CQZJ 1XN7A 3MZYA 3RZOJ 4KN7X 3IUOA 1D5YA 1E3PA 1FJLA 1FBQA 1FBUA 4D5FA 4QFNA 1LDDA 1IC8A 2IGNA 2Q2EA 3SEQA 4ZYEA 3K4JA 3QMFA 3WAFA 2O03A 1LLSA 4ELOA 3O2PE 1YRNB 2DE4A 3KETA 5I56A 2ZYMA 3FD3A 3PD9A 5E1ZB 5AONA 4C3IJ 1IV6A 1IUYA 2FQ4A 1I6BA 3F22A 2EFPA 2L5VA 1ZGJA 4MAGA 5FTHA 3J80K 1QPMA 1MSEC 2OCUA 4FE7A 2CQKA 3Q5FA 1H8AC 3E5QA 3GTGJ 5LFAA 3TO9A 2X1CA 1R5HA 2E5NA 4I09A 3CCSI 4BGDA 3HO7A 3DU6A 4RK2A 4N17A 2O7OA 4HA8A 2B3BA 2CZHA 2ZMEC 1IRXA 2LF8A 3MZ8A 4G68A 4RY1A 3CHGA 1YLFA 3Q29A 2L7KA 4DJAA 1ZR2A 4HSRA 1ZKBA 4KR5A 2DA7A 2HU9A 2VC0A 1PBPA 4NBQA 5C44J 1FBCA 1YYZA 2ZZVA 1BKAA 3UNGC 1NH3A 1FW0A 1I27A 4F3PA 3F8FA 4O6JA 3HGYA 1FPFA 3BZCA 4RS8A 1LB2A 5I59A 4N9IA 3ABUA 2CV1A 2QFLA 4RJZA 1I6XA 4GBVA 5I2KB 4PJMA 2KJCA 4HPQA 2XB5A 3PFIA 2BXYA 3DTIA 4NNJA 2PFZA 4Z2YA 3B50A 3EKIA 1SFXA 2VUMJ 1GR2A 3OMBA 4G2ZA 3HG9A 1WJBA 2F5XA 1NV6A 1D8JA 5L9OA 2AQFA 3S3OA 1FTTA 1IN8A 3E6DA 4AIJA 2GRVA 4LB5A 4S04A 1SFEA 3DBHB 2WBDA 4U2RA 5HBCA 4ENMA 1QGXA 3AAFA 1O3TA 2L9SA 4GWYA 4NF4B 1XGOA 2L0KA 3AXFA 5BPIA 1P6RA 4QXDA 2BV6A 4L0ZB 2HR3A 1IN5A 4NF5A 3GWZA 3CI8A 2I10A 1V5EA 1VZ0A 3IK6B 1P4AA 1SD5A 3SESA 3K1NA 1FRPA 4IY6A 3K7AJ 3FXOA 3CSBA 1TFDA 4KD5A 1YFHA 3KZZA 2QSHX 3JYRA 2R7FA 5CVUA 1Q1KA 3U8QA 1JGGA 1WQ2A 4KNYA 2EH3A 4MJOA 4BU2A 1XSDA 4YAHX 3TCFA 3ABMH 1WHUA 5TGTA 4L9JA 1AHDP 2Z8EA 2W84A 4G4PA 3TMOA 3DCFA 2H8WA 4FT8A 4GFBA 3C3WA 1VTNC 1XMAA 3CC7I 1STZA 3BR0A 2EA2A 2Y9ZA 1REPC 3H3UA 3QIMA 2JA2A 2PQ8A 4LLGF 1D0YA 3HOWJ 1LFBA 2QSXA 4ZC3A 1F5TA 2ZYOA 3F8CA 4CO8A 2R7RA 4E7LA 4U4XA 2R71A 2HI3A 3BLYA 2B3FA 4UVBA 2XWIA 1LDKB 3RSNA 4ZYGA 1USYH 1LFHA 5ICTA 4OYVA 4F3SA 4R72A 5FD6A 1TC3C 1ZG3A 4RAYA 1P1OA 5GTIC 3A2KA 1MPBA 1P4XA 2E2HJ 5EQ9A 1ETWA 2HYJA 2RNJA 4XICA 3H1CA 1FQEA 3R6UA 4E7JA 2UYFA 3KX2A 1IN4A 2DMUA 2HZTA 2CQ7A 4Q8RA 4Q47A 1RETA 3E0JB 4PFOA 2QQAA 2JA5J 5DEXA 3EUHC 2MH9A 2DI3A 1D9VA 4GF8A 3W2AA 2OWTA 4PE5B 3PMVA 4NWDA 1ZRCA 1YS6A 4I8CA 2V84A 2A6HF 1YZ0A 2ESHA 4M73A 3I9V2 3CJNA 2RVCA 2ZMEB 3L2RA 3I3VA 4QFKA 3H3GA 1Y20A 3CCLI 3A29A 2LP0A 2ADUA 2CQXA 2FU4A 2B4LA 3LSPA 4PJNA 4G8HA 3K0LA 4IGRA 5HM4B 1CF7A 3FXQA 2LBFB 1JW5A 1Q35A 4M71A 3MAJA 1HDDC 1IIWA 3HYIA 2KRHA 1R36A 1R1VA 1LKXA 1MDMB 1ANFA 2P5VA 2UXNA 4CCKA 1IRZA 1JUPA 2EJRA 1ACIA 1A7LA 4OWDA 2ZFWA 3S2WA 2ZJRF 1YX5A 3TPAA 1FTKA 1VQOI 2KQRA 2E1NA 3MBPA 3Q0WA 2PJRB 1LBWA 4NHBA 1S9HA 2EZIA 2HNHA 2EWNA 2Y69H 5I2NA 2XUBA 1UG2A 2QZ8A 3LSIA 5A2QK 2R7OA 2HZKA 1GUUA 3E6BA 3CP8A 2P8TA 1KU9A 4K2EA 4FHTA 2W85A 2H1KA 3MMYB 1VQLI 2AQEA 4ELQA 5HPQA 4FCYA 3PPNA 4LD5A 4FBPA 4OMZA 2CWEA 2MLGA 4OWRB 4XRMA 3G3FA 3W9WA 4F29A 3B02A 3NQOA 1W36C 1K4TA 4KCCA 4LA9A 2XA5A 1RR7A 1Z05A 2JRTA 3L00A 3A01A 5E17F 2H4IA 4KIFA 5L9MA 3R0JA 1DTGA 1I3AA 2M7AA 1B6HA 1MKMA 3ZP5A 1FPIA 3ZQCA 2QQ8A 3BZ6A 3VSKA 3KP2A 1GT0C 4RXLA 5EYHA 3PSFA 3T8TA 4BUPA 1H88C 4OIOF 1TW2A 1WVRA 2K85A 4LK1F 3TW6A 4B4CA 2IS4A 2HQ0A 3JZJA 3AKZA 4PAFA 3TELA 4JSDA 2CUJA 3I64A 1R5ID 2CYYA 1QW0A 2XXQA 1S7OA 2D2WA 2PN6A 3BT9A 3WODF 2FOWA 3M1CA 4X1DA 1O7LA 1R58A 2PMZA 5H6QA 1LFGA 1E3HA 4A3EJ 2EFOA 2CEYA 3BR2A 3RQIA 3SDGA 4I98B 3IKVA 3IR1A 3RQTA 2DMTA 5TISC 3I59B 3HEFA 2E1OA 3S1MJ 5BWJA 1MMGA 3S15J 4NF0A 4LK0F 4HF1A 2W4SA 1QVTA 3AL0C 1LAXA 1XI6A 1W4MA 1POTA 2QF7A 3JCUC 1X58A 3J81Z 4NWCA 2IA2A 2ELKA 1G2HA 2M45A 2EIKH 1W7PA 2RAEA 3QP5A 4ELPA 1MIJA 2Y2ZA 1B7HA 4IZZA 3TFLA 1QQIA 4JP0A 1WH7A 5FKKA 3TTMA 1BLFA 5CVRA 5JEIA 4QFLA 2VONA 5F6FA 1DUXC 1FOKA 1EYJA 3OL3A 1FTMA 1TT5B 4LQ5A 1QZYA 3AFHA 4FE4A 3TW7A 4WF2A 4GRKA 1F9BA 4KDPA 1S8NA 5DW8A 3TP0A 3SZTA 2FHYA 2AS5F 3OD7A 4L18B 1F36A 2VKEA 1HKTA 5GAEJ 1Z1DA 1VI0A 2E7WA 3K4KA 1HW1A 1ZREA 2D3IA 4JXIA 1R9TJ 2F4OB 4A93J 2E35A 3ZQQA 2FBKA 1U8RA 3FWEA 1BR4A 3LQRA 5LEKA 1O3SA 2ZYNA 4II2A 3LA3A 1MM7A 5FRNA 4ITVA 1MRPA 1U6GA 2CO5A 4XXUA 3MP8A 1G8XA 2HQAA 2VQGA 4V19K 1P1NA 5EHSA 2LR8A 2P4WA 4CZCA 4RB3C 1OCTC 3A0HC 2IVMA 1VQ4I 2RKHA 4JX6A 2CH0A 1K78B 1MQJA 2XWOA 3G7WA 1RR8C 3MZ9A 2D5VA 4U23A 3I5OA 4A3BJ 4L9VA 2Q2AA 3G2BA 4N4NB 5FFZA 2EFWA 2F78A 3P9IA 2B63J 2OQGA 3KN7A 3KOTA 4ECFA 2O7IA 4XLPF 4A5MA 2CZIA 1X2MA 2NVUB 2ZNZA 3UR3C 1N84A 2F7BA 5ET5A 3I54A 2O84X 2XAUA 3K2DA 3KBZA 1FNNA 1FMWA 4KICA 2DU9A 2LFBA 4RAZA 3Q0UA 4RLQA 5EYRA 1QKAA 3BFTA 4GL0A 2XXVA 4HSTA 4POWA 3T9XB 4N8YA 1EV7A 5IOZA 4XLHA 3T9UA 2DMNA 4E7ZA 5B1AH 2L7ZA 3O8HA 2ECBA 3MQ9A 4GFRA 3E9XA 3CCQI 2THIA 1LFUP 2PX9A 2H5YA 4N15A 4U0VA 1KA0A 2QWWA 3K6VA 3HOSA 3RTRA 3LSRA 1Z77A 3T1BA 2WBMA 4D5CA 2DXIA 1RYOA 2X26A 2BW3B 2ZO4A 4GCVA 2R0QC 3RI4A 1IW7F 5FKNA 1IXRC 2K86A 5IP7J 3RT6B 3U1DA 4DGWB 3ZQIA 1UTBB 4K3FA 3KC1A 3FBIB 4WXHA 3IKTA 2O6GE 4HLXA 2O9LA 1IRGA 1MY4A 2DN0A 4Z6YA 3OSQA 1GHCA 4IOAF 1QHGA 4QFPA 3CC4I 2CUZA 2QVOA 4A3KJ 4DIQA 1JJ8C 4XKNA 4QBAA 2RGVA 1XX5A 1FEXA 1KGSA 3KJTA 4AYBA 4GWUA 1FIPA 1FTAA 4IHSA 1K61A 1OVBA 3BTLA 1JUMA 1TQPA 2FD5A 1SVLA 3HBLA 2Q8KA 1Y39A 1H76A 1MY3A 3GEZA 3OIQA 1CE2A 2Q8JA 1SAUA 1IXSB 3H5RA 4UUTA 4KITB 1ZG5A 3RKXA 4BKXA 5CYVA 1K78A 3GTMJ 1E0EA 1I6AA 3B7DA 3FUZA 1BM9A 1J7KA 3W6VA 2HTJA 2XXTA 3B6WA 4M72A 1KWHA 3FHNA 2VKVA 3ASOH 2DPUA 3FXJA 3GLLA 4P9FA 4FQGA 1D3YA 1UELB 1WWXA 1P7JA 1KZHA 4CCLA 1VQ5I 4OVTA 2VKHA 3RPUD 3S9EA 4ND9A 5I58B 4DYCA 1SW5A 2PT1A 2QSGX 3M3FA 2PCRA 3QUFA 1T38A 1MD0A 2KL4A 3DEEA 2HVQA 4OVPA 1W5SA 4PSWA 4BEHB 1WFXA 3M7GA 2QUFA 4Y4RA 3IO4A 1BOAA 3HZJA 1JJ6C 3O6BB 2DVZA 4JSOA 1YI2I 3GYYA 2ZZWA 4IO7A 5ELVA 5IYDJ 2EZLA 5K5RA 1R1TA 5DUKA 4BXFA 5D5WB 1U8BA 4S0HB 3W3CA 1LB9A 5LRSA 2E2JJ 2JA7J 4MCOA 3JTGA 3KZIC 3KYCB 1DPEA 5E18F 2VOZA 4KT5C 4YFKF 1XGSA 3QXMA 5E3MA 1F4KA 3BC8A 4P0IA 1BJZA 3GX4X 1FC3A 3K1PA 1LBCA 2ZB9A 4BNCA 3LFUA 3D5SC 2R8TA 1FP2A 2KLOA 4MLOA 1MQHA 3OYAA 3T22A 3QOPA 1WKMA 2DK5A 1XSXA 2JRMA 1MH3A 1IXCA 2FBHA 3MEXA 1VQNI 4RM2A 2H09A 3Q9VA 4EF1A 1GXQA 1P9QC 2KLFA 1Z6TA 2DJIA 4LFUA 3CUOA 1Y1WJ 4UNOA 3H3VK 2K3PA 2E1SA 3JW4A 1ERDA 4CYDA 1ZELA 1BK4A 1MY0A 4YKIA 5CPRB 2W00A 2Q89A 2EK5A 4AVPA 3K00A 1N7WA 4P8BA 4QFOA 3FDYA 2EFNA 3SFZA 3V8KA 2K7LA 4B09A 2VXDA 5I57B 2R7QA 1X1BA 3DKYA 3HPHA 4KA4A 3QAXA 2K9MA 4YFXF 2FUG2 1TQIA 2QSFX 3NRVA 4XSXF 1R71A 1JQFA 1Q1HA 2O69A 1YE9A 2P81A 2YR2A 3CIJA 3O9PA 3RUMA 3S9NC 1OYIA 5HS9A 1NKXA 1SVXB 1BC8C 2O3FA 3DEUA 4BEHA 1JETA 3MPKA 3PPPA 4BDZA 2XGCA 4H6DA 4NF8B 1VQPI 4XORA 4XOPA 5HDKA 3N4MA 1SYHA 4W1UA 2XPWA 1ZLQA 3LSJA 4JK1X 2BJIA 1YX3A 2VQCA 5TU0A 3K1MA 1YHQI 2QS3A 3ROUA 3UK4A 4WK8F 1QBJA 3OR2C 1B46A 2O7UA 4R75A 5E8IA 2DQVA 1M5BA 3V8LA 4HNUA 4UA8A 2UWMA 4PP0A 4J01A 2HDWA 1PBQA 1PEBA 1IV8A 3LSGA 5HLHA 1PYVA 5K5OA 5AA1A 5D8KB 1UHWA 2OK2A 4JBZA 3WGHA 5HS8A 1ETVA 2XPUA 1OR7C 2L9RA 3JR9A 2VBZA 3CCUI 1B58A 2RCAA 3VDXA 3IOTA 2AO9A 4I0BA 1Y56A 3OXNA 4GQOA 1YIOA 3TDUC 4OAYA 3VYUB 5IZ3A 4HV5A 4O7MA 1UHSA 1MDMA 3HHFA 2UVGA 3D4GA 4FETA 2XSJC 3I55I 3MVPA 3USDA 2IBDA 5FLXZ 2EA4A 5H8HA 3CDLA 1XVYA 3SEVA 3OYBA 4LUBA 4DBRA 1IITA 4HS7A 2REGA 1AKHB 4IXAA 5ED4A 5LLQA 4LLNA 3WG9A 3FVNA 5BOXA 1IXIA 4IX7A 1ZLKA 1U9NA 2M5WA 1TQMA 4H8JA 3L1PA 3AG1H 4J00A 2VASA 3E7LA 4IEJA 1XG1A 1XB4A 1NV4A 1KU7A 2MBFA 3H9QA 5FJ8J 2KT0A 4XKBA 5F1JA 1B5HA 1OCCH 1SD4A 2F6PA 5AIPA 1US4A 2Z33A 4O7IA 4X0GA 3WHBA 2O6AA 2IA1A 5HVQC 2W24A 3LV0A 1QZZA 5IYBJ 4RM3A 3RIRA 1DCUA 3ZMUA 3I53A 4XKVA 1IMAA 1FBFA 1D1CA 2HKXA 5CVJA 2XROA 5M5YJ 1HCRA 4YRVA 3QYFA 2QMWA 1AIVA 3O6IA 3O8GA 1RZ4A 4NE4A 3HFUA 4F1YA 3GW2A 2GOMA 4UB6C 2DOFA 2AIXA 1R4MB 1T0FC 3WGGA 2Y7KA 5FGMA 4LITA 2DYSH 5J4VA 2DE3A 5E3LA 2DOEA 3IL2A 4HE2A 1HBXG 4BQAA 1TFAA 3OYFA 2DS9A 1SYIA 1LFPA 4N8GA 3MWBA 3RPUA 4PZJA 2RQQA 2H27A 4EQQA 2XKPA 2M4GA 3IRQA 3FMQA 1FPEA 4BBRJ 3EYYA 4L9NA 2D21A 4DI4B 1SQYA 2ANJA 4QWQA 1O63A 3BPVA 5LDZA 2XXWA 2R7ZJ 1LBYA 2E36A 3MZBA 5CI5A 1NI9A 1IUDA 1SFKA 2QRYA 1MW7A 1WJDA 2HOEA 1VFDA 2C6YA 4G7HF 1Z6RA 1GV2A 3G1MA 2UVJA 3MYUA 3PUVE 4MNPA 3HCQA 3OSGA 3G3IA 3TAJA 5AE4A 1P1WA 2XX7A 1LCFA 4MH5A 5CLSA 2EV0A 5EG0A 4KMFA 1LEAA 2IP2A 2PVUA 4JVCA 3IOVA 2LK2A 5J8CA 2TDXA 1DDNA 1N3WA 5D6FA 2UXXA 3P7NA 3VXBA 1NUZA 4ISUA 2P5KA 4IR8A 4OMBA 4V2GA 3ZS6A 3WU1B 2P7CB 1JKPC 4HX4A 4Y52J 1FQBA 4PBHA 5KDTA 3QPHA 1Z7LA 5J47A 3MJNA 4XKQA 2KPMA 5JTYB 3W9VA 1S6LA 5C4JJ 5J8FA 4PFWA 2RC7A 4XLEA 2VBWA 5DUIA 1HKSA 2WV0A 3GFMA 3LA7A 1FYKA 4XM3A 5LGUA 1K9YA 2DPDA 3CO7C 4J19A 1A54A 5L3BA 1MNEA 2FMYA 2CJJA 2IJLA 3OR1C 5GADJ 5DYMA 1UB9A 2UVHA 2CUEA 1S7EA 2EFQA 4PQJA 1O7TA 4FIMA 3ONMA 3ZQLA 4PE3A 3K4LA 4NUBA 3BJAA 3DELB 3H6VA 3RCOA 4IO5A 1W7PB 5K7ZA 1OQGA 1XMKA 4IO6A 2AXLA 4GRIA 2P1SA 4DXBA 5CBSA 4GXAA 5H8FB 3S3NA 2JMWA 5IZ1A 4BY1J 5EGOA 3GXOA 3JRDA 1HF0A 2PJPA 1NUWA 4PTKA 3CMEI 3K10A 3K4NA 4HAMA 5E79C 1P1UA 1PB7A 3JRFA 1UAAA 3ECRA 1F43A 3OEMA 4NC8A 2PT2A 1DMBA 1KQ9A 1QVUA 5TRDA 3MVZA 4GWXA 2Y7PA 1Y4TA 3QSLA 2LAOA 4JQFA 2NUVA 1N77A 2QJEA 2VBYA 3RGYA 2RCBA 3TYHA 1R6ZA 3FIWA 4MF3A 2HGCA 4R6HA 4I6ZA 2HXIA 3BQYA 2AL4A 3FM5A 3FXLA 3CD6I 3D5RC 3FIRA 3FVGA 2KIUA 1U9OA 4XRFA 3SYTA 5AA4A 2Z22A 2BY2A 1XS5A 4JOMA 3F8NA 5EGOB 2XGEA 2CW8A 2HEUA 4Y7NJ 1B2HA 4PFPA 5H8FA 1YOVB 4AVZA 2DT7B 3HL2A 4FX4A 4A3IJ 4R1HA 4A0ZA 1NV2A 2CZLA 3H0GJ 1K6OA 4OA4A 4HQEA 2LY1A 3IRRA 4PSXA 2HOSA 2NOJB 4L5IA 1NUXA 2ZYKA 5HS7A 2JZYA 3C7JA 4ZDPA 1YXIA 2H94A 2KJBA 4G9YA 2F3DA 3ERMA 3OYCA 4FEDA 1ZAOA 3ZQGA 4ZZAA 2W7NA 3H36A 3CUQC 1ULYA 1S5LC 2VQLA 4EM2A 5CBRA 3RQ4A 3S93A 4AB6A 1VQ8I 4DYRA 1IF1A 4HF0A 2EILH 2ABHA 2COBA 2CW0F 3M8FA 2YX7A 4I0AA 3OIPA 1BC7C 3N6TA 2GA2A 3T9HB 2K4BA 1V5GA 5JHFA 1ZTYA 1T6SA 2MLKA 3VYRB 2ZNTA 2UXAA 4P11A 3DLNA 4I7HA 3IORA 4PGGA 3E6MA 3ZR8X 1ZK8A 1P99A 2YPRA 4N6KA 5I7IA 5KDTB 4GWZA 3VVEA 4MQ9F 2XB0X 2GXAA 4H5GA 2L2OA 4XQFA 1W7PD 1W5CC 2LKPA 2ZXIA 5BS6A 2DBBA 2VOOA 2EIMH 1O3QA 3GXAA 3GFJA 1I3QJ 4MHGA 3KC0A 4AIKA 1ENHA 1KU3A 4CCMA 1RI7A 3HOVJ 1NNFA 3FXMA 3G71I 2W48A 2ZSHB 3KP3A 3SZPA 5IP9J 1JVXA 4BXXJ 3ABTA 2E0SA 2F35A 3RTWB 3BIHA 4E4HA 3C2BA 1CB6A 4ELRA 2CFOA 4PAIA 2DFEA 2E19A 3DP7A 4H8IA 1IGNA 2XAQA 3PIOF 2DQLA 1X19A 4BS9A 3UGWA 3CUQA 3S14J 3CF2A 1SI1A 5DVIA 2GZWA 4I02A 1MY1A 2NRAC 4LONB 1RDZA 3GZGA 4B47A 3CCEI 3T96B 3ODBA 2OZUA 4TV7A 3CSGA 4ZECA 3LQQA 4G6DA 1NHAA 3PNTA 1ZRFA 4YICA 4Q30B 2ESNA 1Z9CA 1II5A 2X7QA 5F7VA 1BIAA 2DTZA 2QS1A 1B3GA 4ZE8A 3VLWA 5EDNA 2FEZA 1EA3A 1V55H 2X1DA 1MGTA 1LVKA 2ELHA 3KCCA 4ABZA 3ZSFA 4PBQA 5EEHA 2DODA 2LYCA 3X2QH 5L8DA 4YB5A 4OTEA 3UN6A 4ZEFA 1UTHB 2Y5LA 2HKOA 1IEJA 1HSEA 4PGNA 5DCFA 2O1MA 5LGTA 2OBGA 2VKDA 2CSOA 4CZZA 2KR0A 1BOBA 3M3LA 4ZZEA 3C33A 4MHFA 4UV8A 3GBBA 1XGNA 1B4HA 1QJMA 4R8HA 3ZMDA 4F1UA 5A5LA 5EQ7A 3FGSA 3OSRA 3DF8A 3Q25A 1MJ9A 1B3FA 1R23A 2MYSA 2R7TA 1B7UA 1EU8A 2QL3A 2Z99A 4CYCB 3ILTB 4XKRA 2JWTA 3TTRA 2WAEA 2X6OA 1ON2A 4PFIA 2WB1N 4GLIA 1EKEA 1WJEA 3F3XA 1MNDA 4AQ4A 4ONYA 1BI0A 1INPA 4BH9A 5DV5A 2DP8A 5LRRA 4CCOA 3DLLF 3VFJA 2IAIA 2DA2A 1PC3A 1WZ2A 2PBIA 1UCRA 5DD8A 2NS7A 4H0EA 4HRIA 3LSWA 1H9GA 1X1PA 4MTEA 2MD5A 1Y3QA 4A3JJ 2EINH 4OFOA 3SEWA 4EJOA 3PM1A 1IN6A 4EGYA 1IAWA 4UHTA 3JSOA 3QWLA 4BQQA 5JVGF 1Y1MA 5IT9K 2LY9A 3C36A 4GO1A 4IHVA 1NH7A 5FKMA 4EJTA 1B51A 2V4JC 3QPTA 5IP6A 2M8EA 1KQ0A 2K9NA 5ICFA 2AHQA 4JVDA 1I39A 2ZSIB 4DI3D 4Q5SF 5B66C 4BACA 3RTFB 3KFMA 4I3YA 5I2KA 2DWAA 4IY5A 2NS0A 3B6QA 3D4CA 2MD0A 3KFWX 4PDKA 4YB7A 1ONVA 1TT1A 2B4MA 2DE2A 5M5WJ 1WDNA 1SANA 4MLVA 3PPQA 3MP1A 3WTXC 2P5LC 3A02A 1T98A 5F0FA 3FXRA 4AU7A 4B3XA 1K7AA 3LR1A 2W25A 3R0AA 2WADA 5EQ8A 2A5WA 2A07F 1MQIA 2E1MC 3F8BA 1QGPA 3K6UA 4NF8A 5AA4B 2Z16A 4DW6A 5LHIA 4ZYDA 3CC2I 5DM7F 1BIYA 1Q9DA 2XX9A 4WKMA 4RAFA 3I6VA 1WJCA 3M9AA 1FSAA 3JAMZ 1B0LA 2VC1A 4OENA 4MO7A 1U78A 4KISA 3WTSC 3TZAA 2IPQX 4E0WA 3RPQA 1MS7A 4XKCA 5IYCJ 2DSFA 3RPLB 3ZKLA 1USTA 4YKJA 4OINF 1HA8A 4LOCA 5L3EA 1QUKA 4XL9A 4OOIA 2R7SA 1FPDA 5LEJA 4RGUA 4KN4X 4YIRX 3TO7A 1YRNA 1GXPA 3K0VA 3HSRA 1JHHA 3MZ1A 2HVSA 5F08A 1ETKA 2F3BA 3F0CA 3F23A 2BEOA 3GLBA 2L9NA 3TQNA 2NVTJ 2GXGA 2VBXA 1SFOJ 1MSFC 1JNFA 1BTJA 2ZCWA 3DWLE 4OVRA 5ILSA 1QUJA 1FIAA 2VD2A 1KQ8A 3KG2A 1GV5A 3PQKA 4AC0A 3I71A 4M1VA 3M1EA 1UG0A 3IV5A 4U1ZA 2HHMA 3HRUA 3LWFA 2F5VA 1Y4CA 1OLTA 2HAUA 2PFYA 4R9FA 1Z0XA 4AIHA 1D3KA 4G8MA 1FT9A 3PQJA 4XRSA 1KONA 1XTAA 4I62A 1TP4A 2L7FP 2M0CA 2HXWA 4IRIA 3TODA 4GYIA 4C3JJ 3BPXA 3E1SA 3REOA 1A5JA 3OYEA 3T8RA 1H89C 3SXYA 3V42A 5ICGA 4HTGA 1K6YA 4XLNF 4KYEA 4E7IA 3DTKA 4MFDA 2PFBA 1TNTA 3OY9A 1SFUA 3PGFA 3G73A 3ELKA 3TKYA 4IHTA 4H0WA 4HCYA 3PMWA 4LATA 2XSDC 1A31A 2RC8A 4M74A 3GBAA 5ET6A 2A68F 1ZBMA 1CGPA 3IH2A 3S1QJ 4YG2F 4FATA 3NWSA 3TQWA 4RGXA 2BVLA 3A03A 4G7ZF 1L0OC 2UVIA 2VPNA 5FLMJ 1SW4A 4EXLA 2Y5KA 5M2VA 5I5PA 2E1MB 4KCDA 4EXKA 3ZRGA 3IWZA 3LA2A 1LDJA 4ENNA 1TWAJ 1JE8A 3KPHA 1N75A 3OV8A 3QP6A 2B9SA 3CFZA 1OMPA 4OFLA 2EZHA 2Z5UA 1URGA 3JRAA 4EF2A 1J0RA 1S7YA 3D1RA 3OYLA 3LSTA 5FROA 4JBAA 1UIVA 2M7BA 4WX9A 3P9CA 1UIUA 2CMOA 3BFUA 4KHZE 3ZN0A 1B6AA 2VB6A 2LSOA 3BZKA 3HPGA 3HPIA 4EUOA 3CR9A 1ELJA 3C18A 1AWBA 3R26A 4LB6B 3IB2A 2FBIA 2K4JA 1LQ1A 1JP4A 2V4CA 4HX7A 4CUGA 3HUGB 1P7IA 2Y30A 5F27A 5K5QA 2CZKA 4N0BA 4XTCQ 3DV8A 5DCMB 2OBPA 2IS1A 3F6OA 3M07A 4M9SA 4DBQA 2F7CA 4F91B 4P55A 3G3JA 4IGTA 2MC3A 2YS9A 1PJRA 3GO5A 2WWYA 1XHYA 4E0XA 1HXDA 2FNPA 2L9VA 2VP1A 3KOSA 1RYXA 4F93B 4OXVA 2DQRA 1LSTA 1M5FA 2E34A 4BQNA 3CJRB 1O4XA 2HVRA 3CUQB 2JJKA 2R7VA 1APLC 4KIBA 3V7CA 1UJ8A 3IAZA 2XXHA 2FIEA 4GIZA 1FOYA 2IGMA 3LMMA 5D4RA 3FASA 4M4GA 2NVQJ 3LBSA 1B72A 3QU3A 3P9KA 3ZGKA 4ZZLA 2V26A 3GZ6A 3H06B 3FJ7A 2F5CA 3QAHA 3J7AO 2VJ4A 5JLWA 3BR3A 1S3JA 2XXPA 3EHUA 3H3ZA 1ZH5A 2DCEA 4A12A 4N91A 4G8NA 5IZ3B 4FORA 1FPGA 2PMZN 1AL3A 2WTEA 1MBJA 3IAM2 1AKHA 1IMCA 1J59A 3JRBA 2XGXA 2XASA 3SEXA 5L9SA 4JVIA 2ZNSA 3J7ZI 4B44A 4A0YA 4KYWA 3VVDA 1SD6A 4BYYA 1DGRM 3RPWA 4DDDA 3TUSA 5L3FA 1IXHA 3ZMZA 3HSTA 4DOZA 2A05A 1HQCA 4QHQA 1B8IB 2BOLA 2JSPA 3KEQA 3A0BC 2O5RA 3GBGA 3JRIA 3E5XA 5IPAA 5ILVA 3DP4A 4U1OA 2VT3A 4AIDA 3C32A 5CQEA 4TQUQ 3B6AA 1XS9A 1G59A 4A0XA 5LBQA 3BOQA 2Z1DA 5KVRA 2QQ9A 1FQCA 1MY2A 1Y8QB 4JB7A 3IC7A 3PNYA 3QRFF 4MX6A 2OD5A 1SMYF 3VWBA 4BDQA 2QQBA 3GUDA 3COAC 3WU2C 3N97A 2K9QA 5FRMA 2VQHA 2EBIA 5HDGA 1P1QA 2LC2A 3E97A 3MKYB 4IHYA 1NFTA 2DYXA 4M3FA 3L2WA 2V93A 2XV4S 1T0FA 4POXA 1OYWA 1R1UA 2HPGA 2R7XA 1LAGE 4OFJA 3GTLJ 1DU6A 1B3EA 1YJ9I 2IGOA 3BJ6A 4U0YA 1IG7A 1LAFE 4X1BA 5JI6A 4RGRA 3VOEA 3DTEA 2JUCA 2OA4A 1FOXA 1QULA 2P6SA 1CNQA 3BWGA 2ONSA 5H2FC 1KYWA 1YW7A 1Y0NA 4UUSA 2TCTA 4GYGA 2O8XA 1XMXA 3S2HJ 3BIGA 3VFZA 4A3LJ 2QBYB 4QRZA 5EYGA 4GL8A 4IVNA 3TOAA 1MNMC 3H03A 2EZKA 3MQ0A 1M5EA 3VPRA 2H1LA 3NEUA 1JKRC 5CRYA 4PK4A 4XIDA 2UV1A 1ITYA 1U2WA 3HOUJ 1RUOA 3VODA 3MVYA 2Q9TA 1QO0D 5TJJA 2AL5A 3DKXA 4M3GA 5CMMA 3PNVA 2QBYA 3RKWA 4MMPA 2PI0A 3F9KA 2V3UA 4N13A 4AWXB 4OVQA 5FHMA 2VT2A 3FBPA 3H6UA 1BW6A 4G77A 2HPIA 4O3CA 3UIFA 3ZQHA 2M3AA 4GWOA 3FF5A 2CV0A 4FX0A 5F24A 2VE8A 3VV5A 2FNAA 2XAJA 2LLKA 1PP8F 3LSLA 2DJNA 4G8XA 3FHZA 2Q88A 3FV1A 4RYAA 1NNPA 4LZ7A 3WAEA 2ZNYA 1TTYA 2XXUA 3KZYA 4RGSA 1A8EA 2ONKE 3LSMA 1OR7A 1NMUA 5E1WA 1OJLA 3G1OA 5B1BH 4WEDA 4ESFA 5JTYA 1WODA 3HSFA 2Y9YA 4D1QA 2VPRA 3HXLA 3FMSA 3O6GA 4IHXA 3QYEA 4DIGA 3JRCA 1OYYA 2L7MP 2JTVA 3R6SA 3QOEA 3RY3A 1NV3A 3U94A 2CGPA 1XCBA 3EDPA 4XSZF 3LL7A 1S9TA 4H67A 2BY3A 5EG0B 1W0TA 1G0HA 4A3CJ 3ESWB 1R9QA 1DBZA 4LIVA 5DM6F 1ZG1A 4UB8C 1XSVA 2Q8MA 5JFRA 2P3NA 1IN7A 2P3VA 4RNSA 3HHHA 1ZMGA 3K6GA 1FYMA 1HKQA 1QU3A 4XK4A 4M3BA 1LUJB 2QS4A 3TO6A 3BCAA 4AYBN 2FYIA 4NF6B 2NXNB 3PUFA 4BDNA 3N05A 2OCCH 4FE8A 2KRCA 3KGCA 5D4SA 3U65A 2JUGA 2COMA 3SFIA 3WTUC 1POY1 1FBGA 1SPIA 2XXKA 2XXIA 4I1DA 2DA3A 4F39A 3VYTB 2V25A 3S16J 1RKTA 2HDCA 3OYIA 1MM6A 1JUSA 3K6WA 1D9YA 5TPAA 1RKWA 1VSOA 1Z3XA 2V9VA 2L54A 2NOGA 3V7RA 2DTRA 2RC4A 2GM4A 5ITOA 4C1TA 1B72B 3FXBA 1BA5A 1TXFA 1RC9A 3TMGA 4DE8A 2VL8A 4BHPA 1IMEA 4I40A 3K4CA 2R5YA 4DLDA 4OZ9A 4EM0B 4NC6A 1V3FA 3SDBA 1VFCA 1MQGA 3GLXA 3D1NI 2DXRA 2PMSA 2Q74A 2YJPA 2CQNA 1IMFA 1ZN2A 5FFXA 1DP7P 3C9HA 1HSTA 1UTBA 2WAQN 3KSXA 1FSEA 2ZXJA 4MEXF 2F36A 3ROJA 3S4UA 2ZKZA 3QPSA 1T0KA 3ZMVA 4H5FA 2GQQA 3CCYA 2L4AA 2XF7A 3E3VA 4HYEA 2GHBA 5DCMA 1S72I 4R79A 4F31B 2K5CA 4CSWA 1ODDA 3OYKA 5HLGA 2V6EA 3N5LA 3GCMA 1NK3P 4HF2A 1A36A 4PETA 2PX1A 2ICWG 1ZKGA 4HV6A 2Y48A 1YYVA 1B4AA 2X0LA 1JTXA 4EATA 2X48A 4OQOA 1LBZA 2VIXA 5BQTA 4R6KA 4ASNA 2D45A 3EHTA 3KEYA 1FQAA 2F5DA 3BY6A 4L5JA 5H8HB 4PFBA 4UUVA 3CG3A 3CLOA 3K9TA 4CA0A 2WYPA 5FLXK 4LZ5A 1W1WE 1S7AA 3F6VA 4UXNA 2B7EA 5CJ9A 3L2VA 1Z3YA 4XKWA 4RB1A 4BBSJ 1GLNA 3PIPF 4KFQA 3VLVA 1SVMA 4CH7A 3F8MA 4BHCA 4NF6A 1ZU0A 2VJJA 2H6CA 1RUNA 3RT8A 2BY1A 1MZBA 3K2ZA 4EM1A 1A99A 2Z8DA 4KQPA 4L5EA 3A4CA 3S2VA 3S3MA 3CO6C 1NV7A 4BLAA 2Q0OA 3QK6A 1AOVA 1TT0A 3WTZA 3H0DA 5FB2A 2DWHA 3N6UA 2Y84A 1EH6A 2F5FA 4MQVA 2LKXA 4EQBA 4W97A 1EZPA 4E7SA 3WTVC 2FA7A 4BJ5C 1FJ9A 2GHAA 4N07A 3IJOB 1BI3A 4OEUA 4OVSA 4BDYA 4LG0A 3GYHX 3T0JA 4ANJA 4G94A 1RDXA 5F1RA 5ICCA 1USSA 5C4XJ 3OO6A 4NEDA 2K40A 2RC9A 2XXYA 3C2GA 3N94A 3EN3A 1A6QA 4RLFA 3BROA 4A3MJ 3Q3SA 4PGHA 1H9TA 4N81A 4IO4A 3I4MJ 4A3FJ 3W6KB 3OO7A 3WU0A 4BE1A 1JVYA 1YAEA 2P6TA 3WG7H 1N78A 5FBPA 5HLTA 1MDP1 3KP4A 3TEDA 1J9IA 2DXYA 2H8RA 3EUAA 2FJ1A 2GIVA 3ZMTA 3THIA 5ERIA 3U93A 3GZ5A 1JHFA 2DFIA 2X7PA 3U1OA 3QYTA 2DMPA 2XF5A 2OX3A 1EYIA 4MIJA 3LSFB 1FX7A 2M2EA 5L3CA 3QPLA 5A5XB 4HCWA 3K2AA 2KMUA 4U7DA 1N04A 3ABLH 5J40A 2RINA 2XPVA 2KZGA 4PJLA 4OMYA 4XFEA 4ZEBA 2A5YB 4UV9A 3H7MA 4OERA 5IAIA 2H25A 2CW7A 3HJEA 3LAPA 4IO2A 4X1EA 1MJAA 3L09A 5FKLA 2OJED 3LNQA 4BE0A 1JW4A 4UUSB 3WTWC 2HCAA 3RPLA 4N4OB 2KIFA 1IDZA 4MEVA 4KYSA 4XEQA 1Y3NA 2QPQA 1BBYA 4HLYA 4PFYA 2CQQA 2YU3A 3SEUA 3MKZA 3E5UA 2XVCA 3FM3A 3TTKA 2HYGD 2O51A 4LQ2A 1K79A 4ZE9A 1IDYA 2CS3A 5JHUA 2GWRA 1OLCA 3NARA 4P9KA 2JPCA 5L3DA 3HOTA 2KDOA 5KNLA 3MWMA 2GA1A 5FKOA 3MAMA 3PV0E 5J3LA 1G4DA 2Q2CA 1W36D 1B40A 2XF6A 1ETXA 3BQZA 5I58A 4Q5TA 2P7VB 2STWA 2PG4A 5EEAA 3M8JA 4A69C 2GXBA 2QM3A 5H8SA 3VDFA 2PBWA 2XHKA 4MLQA 3MD2A 4C9YA 2E71A 4Q4ZF 2BBYA 5K7FA 2FVZA 2I58A 2OF7A 5L3GA 2XD2A 2XRLA 4X8RA 5ISUA 1Z91A 1TLHB 4BL0B 3MFKA 3J7AY 1DTZA 2M8GX 2FA5A 1MBHA 2H6BA 1G0IA 4P1WA 1MPCA 3DM0A 4JWYA 4ZTJA 3W6JB 4E7HA 2DW4A 4LIUA 4OEVA 1XC5A 2OV7A 2LD5A 2H9BA 2RQPA 3CJTB 5I2NB 3R61A 1UQWA 3K4UA 2KDZA 5E20A 2JVGA 3LSKA 2BJJX 3O29A 3C35A 1T08B 3H9GA 2VHAA 5FD5A 4N4UA 2YUSA 3RZDJ 3DP8A 4AS5A 1GVJA 3AG4H 4ZZDA 2ISZA 4YMBA 3S2DJ 2HDDA 2R7DA 1Q1VA 1NV1A 1FYLA 3LFKA 3B73A 4CYCA 1XC1A 3IFCA 3TTLA 4F2OA 5BUUA 2LBFA 3L6HA 3JRGA 4II3A 4EEFG 3SKPA 5E3OA 3ML6A 1J1NA 1XCVA 1OCPA 4Z7EA 4QF9A 1FPBA 1VR5A 2DDBA 1A55A 4XBFA 4NQ8A 5HODA 4YKKA 5DEXB 3CMMA 3PUXE 3KIOA 4JWOA 4XR6A 2VOPA 4H46A 2MFZA 3GVAA 3PPRA 3HHGA 5F0CA 5H8NB 1M5CA 3E3KA 1LBXA 1EZ9A 1YITI 4MFIA 2DFHA 3IH4A 1T33A 2LVSA 1U5TA 1J75A 2VD3A 1A35A 2ZJQF 3ASNH 5BPDA 2JA8J 2VJ5A 2Y75A 1Z21A 3S8PA 2UUZA 3BTJA 3OS0A 5ESYA 1I50J 3ERED 3RKQA 3O6HA 1ZTRA 2V3TA 1R49A 4HE1A 2V9KA 5CM6A 2X9DA 5EHMA 2QMXA 3IOUA 4LLLA 4IQJA 3BJOA 2M8CA 4CCJA 3OWTA 4KYDA 4A2UA 4Y3OA 1NUYA 1SI0A 1K4SA 2W7YA 1X4PA 2DWJA 3JV9A 4HQMA 4GX3A 3TQLA 4HNVA 2QVRA 4L17A 1SVOA 3V8JA 5DS9A 5IKBA 4NN3A 3I5UA 2Y7IA 3KP6A 4ZTFA 4PJJA 3VVFA 1B5IA 4OIPF 4U21A 4ZDOA 1VE4A 1SDXA 4DYQA 1WVJA 3BG7A 1P92A 1XGMA 2A6EF 3IAS2 1WGXA 3FKJA 2ID3A 4KI0E 1ORKA 1FTOA 2R4GA 3PO3J 1LE8B 3FXUA 3G3GA 1MXXA 2XD3A 4D0PA 2G93A 5BNGA 5HOOA 2NAZA 1NG7A 2I3WA 3DP6A 2XC7A 3TOBA 3PUYE 1Z67A 1MDQA 4PAKA 4B48A 4RAGA 1ZR4A 1NG6A 3OEKA 1HLVA 4PFRA 3S1RJ 3HSEA 4Q48A 2LY2A 3OIOA 1LE8A 4AD9A 1VQMI 2ZZXA 4XIGQ 1FWZA 3L2QA 1IMBA 3CRBA 3H4ZA 1V5FA 1LPQA 2OCEA 3M8UA 5E8GA 5T3JA 1X3UA 2BZTA 1YIJI 2BVMA 1I1SA 1MMSA 3S32A 1JKQC 3AL0B 3HIFA 1FOWA 3EUHA 1ZARA 2BGCA 2MH2A 1X3ZB 4XLCA 1GVDA 2I0BA 4HE0A 4I76A 5DD4A 1X1DA 2B0LA 3SEYA 4B1RA 4TLMB 3OYHA 2Y0MA 1B1XA 4F3QA 2DO7A 4RMNA 2OWZA 1B9MA 4OIQF 4F1VA 4HNTA 1N76A 1LGBC 4OU0A 3VEPA 3CTAA 3LAJA 1U0JA 2BE5F 2EPFA 4KXPA 3A3UA 4WCGA 4PDDA 2OLBA 1DOTA 3RN8A 3GTOJ 1K83J 1NL5A 2YLNA 4S05A 2ONRA 5FHOA 4XONA 3L2CA 2HFBA 1ETYA 3LSHA 5JVTA 1I6HJ 4BDOA 2R9JA 1IZ1A 4CICA 1NNTA 1R4NB 2M4KA 4UVAA 1GGGA 2EQRA 1W0UA 5H8NA 3GFLA 2E60A 2MW8A 2XDVA 5LGNA 4U7BA 1B9JA 1FPKA 2EV5A 4NGUA 4O3AA 1NTCA 3KLNA 5DVFA 2A5TA 5KAFC 4DZJA 4F52A 1B52A 3TDZC 3DU5A 3KN3A 1KYZA 5EJCA 4WEPA 3ECHA 2V7FA 4E6KG 2Q1ZB 5ET7A 1B5JA 3G4SI 4L9TA 3TTNA 2P2AA 3D5LA 5M3FJ 1YJNI 2HPMA 2KIMA 2FF4A 2NNYA 4F18A 1YS7A 1FMVA 3BTCA 3P5JA 3CCVI 1AOYA 4H1XA 2Q2EB 4B43A 3MC2A 3KE2A 1MMDA 3VB2A 1L3LA 3H35A 3MSTA 3CCRI 5BMZA 3KYDB 4HXVA 4NAPA 1JEVA 2HEOA 2OAZA 4KIGA 1MH4A 4FECA 1G3TA 1YG2A 1KA1A 1MBFA 3S1NJ 2CG4A 1X1AA 3LC8A 3EQ1A 4H4KC 3LUYA 1LVAA 3CMAI 3WTTC 1DQUA 3PUZE 3Q0VA 2Z3YA 3Q26A 3ZKKA 1XDSA 2WAFA 5FLVA 5B5EC 3U9GA 3RYRA 3OS2A 4TOZA 5KCJB 2ME0A 2X6WA 5A2QZ 1JI8A 2MGQA 1D5VA 5IGAA 2XWKA 3ZQFA 4KMUX 5LD2C 3KLOA 4LGWA 3G3HA 4NX1A 4C3HJ 4R9GA 3S9MC 1ETQA 1UZCA 1DK4A 4MEYF 4XN3A 1YW9A 2I8DA 2K9SA 1A6IA 2JA6J 2O68A 1P2FA 3E13X 2WEFA 4X04A 2R7UA 3HKZA 2Z9OA 4F3GA 1T95A 1IRFA 2R6GE 3C1DA 3CP2A 2OU2A 4X48A 5EZGA 4G68C 4DQ2A 1AA7A 2ZMEA 4IO9F 3W2WA 3JAMK 1OVTA 2L01A 1DPRA 2ZFUA 4MNUA 3Q28A 4RA1A 3KSJA 2QCOA 4DNCA 4A3GJ 1B7ZA 4N6DA 1RESA 1VF9A 2HAVA 4TLLB 3T9VA 2FSWA 4HW8A 5FO5A 4L0YB 4MNIA 2XAGA 3T93B 2YPNA 4IPAA 1WPKA 4G61A 2V9PA 1HW5A 4Y13A 3O3KA 3CDHA 1BN5A 2O8KA 3PJRA 1RIOH 2CV2A 1X4OA 1B05A 3KYLA 3GTQJ 1FBPA 4ESXA 2QYOA 5EZHA 2HXRA 4M6YA 4HZFA 1UTHA 4Y33A 1R7JA 5F0HA 1LAHE 3TDJA 4FASD 4I3EA 4PGPA 5AA2B 4QSHA 5KHDA 1LBBA 4LZ8A 2DT6A 1TZLA 1WJAA 2Y31A 3CF5F 3WE3A 1S50A 1O7FA 2M1BA 2A5TB 5IT9Z 2NXOA 4P0GA 1XPXA 4QTRA 5M5XJ 3KZGA 4FEBA 4MNCA 3ZMSA 3BG5A 3F72A 1MXVA 3IJXB 1B32A 1WJ5A 4EJWA 4NQWB 3I3LA 2VN2A 3HM5A 1YO5C 4R74A 2HQ5A 4F7ZA 2XHDA 3M8EA 2JK3A 2WC2A 2Z2SB 5D6EA 2G0EA 4G6QA 5A5XA 1TWCJ 4IHWA 2XX8A 5GP9A 2DLLA 3CZ6A 2QA4I 4DCYA 3OOPA 3OSFA 2I4CA 4IRHA 1VQ7I 3RJPA 1H44A 1IUFA 3WTYC 3CJQB 2Z8FA 1UHMA 3HRMA 2O1LA 4X6AJ 3M4OJ 2ISYA 3VSLA 2NVXJ 1V4RA 4XF5A 4A6EA 3HV1A 4UACA 1LB8A 1MMNA 3CG1A 3I0TA 4IRGA 1Y9UA 2KIQA 2CMPA 2M9HA 3SEZA 5J4YA 5J1RA 2R5ZB 2K3FA 1DU0A 2OUMA 4I99C 1I6QA 3O66A 4NF4A 4Z0IA 2HQRA 2GOXB 5TP9A 4AB5A 1NV0A 5AA3A 4AUXA 2IEEA 1I69A 2HYFA 3TGNA 4EDPA 1OCRH 4RB2C 1X1CA 1GDTA 4ZYHA 2R3SA 3FJMA 2PMHA 4OANA 2HXOA 2IT0A 4GVOA 1E17A 4MIMA 1FZPB 1LCTA 3ZQ7A 3HC7A 4XMYA 4ENKA 4AM3A 2O0YA 4JYKA 2V79A 4YELA 4U87A 5I59B 3EQLF 2DYRH 1N0TA 2G7HA 1POGA 4O5VA 4JX5A 4GX4A 3MW0A 3OO9A 3QQAA 4YZZA 1NK2P 1FBHA 4G6TB 2ZC2A 1QKBA 3KP5A 4KFCA 3DPLC 1MJBA 1WI9A 3FBNB 3TBIA 4YFNF 4N9HA 3EPEA 4C2TA 2TRTA 1N25A 1RDYA 2M30A 3FK7A 2ZMBA 3H9JA 3O2AA 1MXZA 3IP4B 1L5TA 3BG9A 4QIWN
chains in the Genus database with same CATH topology
1ZHFA 2FMLA 4GXOA 4EGZA 4WWCA 1LJ9A 1JXSA 1YTYA 5CVVA 2HTSA 2FIXA 3L7WA 2YSRA 3IFAA 1FBSA 4F19A 5H20A 4M6XA 4CHUA 1I5ZA 4CDGA 4HW0A 4EVIA 3L9FA 2FQ3A 3RDIA 4ON0A 1U5TB 3HTUA 4Y17A 1ZRDA 4WXDA 1Z7UA 4HDVA 1BJAA 1I1GA 4HOBA 1H0MA 5LHHA 2E7XA 2PLYA 1K9ZA 2PEXA 2KRFA 2OQRA 4IJAA 1PUEE 1KU2A 4I2OA 5D5XB 3E6CC 2V1UA 5D8LB 2JSCA 1ON1A 1YW8A 1FBEA 2L3DA 1U5TC 2F5EA 2FOKA 4O3MA 4G7OF 1BI1A 2X4HA 3DQVC 2VE9A 2QVUA 1XDUA 2V1DA 3IHUA 3ZPLA 1TW3A 3EETA 1S29A 1IMDA 4P1LA 2ZJ2A 1C0WA 3FMRA 1JGSA 5J6XA 3HRSA 3V4GA 2WBBA 4O94A 5AIQA 1FJ6A 1BIBA 1UFMA 1QNTA 1HW2A 2IA0A 2A3SA 1A04A 1P4WA 3MCZA 2OZ6A 4GBWA 4CGZA 1SMTA 3J81K 1O3RA 4M9ZA 2BYVE 1OMIA 2V6CA 4BAYA 2QLZA 3BP8A 2XAHA 1F9NA 2J5PA 4YIIA 4PC9A 1D8KA 4LJZF 3KP7A 5LTCA 4HBLA 1G3WA 1BI2A 1LNWA 1EH8A 3BDDA 3H92A 3F21A 2HQNA 2DDKA 4MTDA 3ULQB 4U88A 3LUZA 3JTHA 1R00A 3HTSB 1DPUA 2HFHA 2MKZA 4LG0B 2DT5A 1B59A 5J16A 1ZLJA 2XRNA 4GWSA 1G6NA 1TBXA 5IT3A 2J5OA 1NV5A 4X9TA 2ZBKA 5EQAA 4AS4A 5LHGA 2PMUA 4GGGA 3I4PA 2VT5A 2VPOA 4LN5A 3KEOA 2RV8A 3WE2A 5HLIA 4ZH4F 4A5NA 3RYPA 6PAXA 2NNNA 1D9QA 4GWWA 5D5VB 4E70A 1T2KA 2A61A 4ESJA 3FX3A 2G9WA 5KK1A 2IRFG 3GF2A 2UZKA 1EYKA 1B1BA 4NQWA 1ZYRF 4QLCU 2LDUA 1G3SA 1U3EM 5IZZA 2KKOA 1FP1D 3HRTA 3GFIA 1WRJA 2K27A 2G7UA 3V7SA 5IM2A 1FPLA 4YIFA 3K69A 1Y0UA 2NYXA 4P47A 4O8MA 4UABA 5DDGA 3FZVA 4EJVA 1OPCA 1KZ8A 2JT1A 1AWCA 3SHFA 2FRHA 4H45A 2LNBA 3R60A 1HSJA 4B8XA 2HWVA 2FBPA 2XWVA 1ZGAA 1O57A 2LF7A 1T39A 2L4MA 2D1HA 3QU6A 2V3QA 3ZN1A 3T5XA 2IW5A 1TNSA 3DKWA 2FXAA 4ENJA 5F64A 4EJUA 5J1DA 2RN7A 3R4KA 4I01A 4NHJA 3DFGA 2VODA 2DAOA 5ET8A 2GAUA 2YX4A 2XIGA 2WYKA 2ACJA 2O61A 1KA8A 3SQNA 1B9NA 1J2XA 1VDWA 1FSHA 4ETSA 4PF6A 4Y15A 3G3ZA 3J80Z 1PDNC 4PDHA 2QENA 3U2RA 5K1YA 5ILUA 4NG7A 4KUMA 1SD7A 2D1VA 4WXCA 5JR3A 2V1XA 5DEQA 4A6DA 1PP7U 4IF4A 3NOHA 4PCQA 2XAFA 2K02A 1WSUA 1EH7A 2VXZA 2MA3A 1LEVA 5CVIA 3ECOA 2M87A 4CXFA 1LEBA 3Q9SA 1YQAA 4P96A 5HDNA 3E79A 5D5UB 4P56A 4UVCA 5ICEA 1E2XA 4NB5A 1RNLA 1R22A 4GX6A 1J5YA 4BHBA 2HS5A 2W57A 4MGRA 4P1EA 5JK4A 3D0SA 4BXUA 3MZHA 4LMYA 1SAXA 2JPBA 2QVVA 1OKRA 1FPJA 4P3LA 3I59A 3T0YA