3SZPA

Full-length structure of the vibrio cholerae virulence activator, aphb, a member of the lttr protein family
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
290
Chain Sequence
MKLDDLNLFRLVVENGSYTSTSKKTMIPVATITRRIQALEDSLNLRLLNRHARKLTLTEAGERFYKDCSPLLERLASMTEEITDECRGASGRIRISAPSNLTKRMMMPMFNAFMEKYPDIHIELMMSNQADDLDPTEWDVIFRVGPQRDSSLIARKIGEVKDILVASPQYLSSHPQPTHAEELHQHQLLKGYPLLKWQLTNSQGETVVNSDRGRFQASALNVVRSACSEGLGITLMPDVMLREFLEDGSLVQVLSDWSSNPRDIYMLYNHKDHQPEKVRLFIDFVIGYHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LysR family
publication title The crystal structure of AphB, a virulence gene activator from Vibrio cholerae, reveals residues that influence its response to oxygen and pH.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transcription
total genus 84
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3szpA01
3.40.190.290 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3szpA02
2UZKA 2Y75A 1O3QA 2XVCA 2XAFA 2E1CA 4A2UA 1CF7A 3H3ZA 4HQEA 5E18F 4OMYA 3FXRA 4FT8A 1XGNA 3HIFA 4FX0A 2VT3A 4LK1F 3V7SA 5IT9K 3GFIA 2L54A 3REOA 1T38A 3Q9VA 2LDUA 4KYWA 4M73A 2AXLA 1U78A 2HS5A 5L3BA 2D2WA 1BM9A 1PP8F 2GXGA 4A5MA 1O7LA 3GZ5A 1QBJA 2JZYA 3HRUA 4MGRA 2F5CA 4IPAA 4JVCA 3C18A 1BIAA 2ZJ2A 2ESNA 3TO9A 3HFUA 4M72A 1T6SA 3CUQB 4XLPF 2XKPA 5LGNA 4WX9A 2UXNA 3BOQA 2CO5A 5LEJA 1IN8A 1FSEA 1Z6TA 5ILSA 2HTJA 4XBFA 4XSZF 3E6MA 4EJOA 4HAMA 3JAMZ 4U0YA 1IN7A 4A6EA 5LBQA 3Q5FA 4ESJA 5BQTA 2DPDA 3L2CA 4EJTA 1SD5A 1R58A 3RKYA 5HLGA 2QZ8A 4YIFA 5BS6A 4L0YB 2V1UA 2PMUA 4MHGA 2KKOA 3RTRA 4WK8F 2BBYA 3JTGA 3CUQC 4HA8A 2FXAA 2QYOA 3KLOA 1PP7U 4I02A 2RDPA 4MTDA 4O3MA 3RKWA 3GX4X 5LLQA 2JSCA 4Q48A 1O3SA 3WTXC 2A3SA 5BMZA 4P96A 5CVRA 1J2XA 3VODA 4OU0A 1BJAA 3BP8A 2OAZA 1QPMA 3KP4A 2VBWA 1LEBA 1S29A 2JT1A 4IRIA 2XAQA 3VB2A 3I59B 3Q9SA 1U2WA 2D45A 3CUOA 1WWXA 5CLSA 3V8LA 4ENNA 3EQLF 5HS7A 4ASNA 3R6SA 1F1ZA 1EH7A 1K6OA 2IT0A 1CF7B 4MQ9F 3CJNA 1BBYA 4ENKA 2PEXA 2YU3A 1XB4A 5DCFA 1R22A 4L5JA 1G3TA 2VBYA 1XN7A 2FOKA 4HV5A 1G3WA 3ABUA 1Z91A 3EETA 2FMLA 2L3DA 2X0LA 5CVJA 2BV6A 4NQWA 1WKMA 1YS7A 2PMHA 3I5UA 2QUFA 4IHSA 4RAYA 1XSDA 2P5KA 3IHUA 4LMYA 2R3SA 1ZAOA 2PN6A 2O6GE 4RB1A 4KFCA 2VN2A 3F6VA 5HS9A 2EFWA 3GFMA 4YIIA 3KZZA 1R36A 4KICA 4S05A 2ACJA 2FRHA 3GXOA 1S6LA 2WTEA 3NRVA 2HXRA 4AVPA 1J7KA 1KU9A 2ETHA 4ZYDA 5K5RA 2W85A 3IRRA 3WTYC 1D8JA 3LA2A 1V3FA 2EWNA 3M8EA 1YYVA 3QP6A 1W7PA 4YFXF 1MJBA 4HX7A 1EH6A 4RGXA 4MNUA 4HBLA 5BOXA 1VTNC 1IXCA 2ELHA 3WGIA 1HW1A 3P9KA 1O3RA 5E8IA 4M6YA 4XRFA 4UVBA 3C1DA 1FWZA 1ZRCA 1FSHA 5ED4A 1MZBA 4ZZLA 2O8XA 1FNNA 3CLOA 4R79A 1HW5A 4BHBA 3AAFA 4CO8A 1W7PD 5JFRA 4RGUA 2RGVA 4I7HA 1PDNC 1JHHA 1HBXG 4EJWA 2DLLA 3JSOA 4EVIA 1STZA 2G7HA 1YLFA 2HTSA 1J9IA 4I01A 2ZO4A 1BI3A 5ILVA 2MH2A 3HTSB 3HRTA 4IF4A 2RKHA 1KYZA 5H20A 3LSTA 5K1YA 4CDGA 4JVDA 3U2RA 3ML6A 3ZN0A 2L01A 4BNCA 1FY7A 2HDCA 1TQIA 2HYFA 4KMFA 2UWMA 3ERED 3TQNA 1P4AA 3TO6A 2QQAA 3RJPA 3EYIA 5AIPA 1OR7A 3BROA 4WXCA 3WGHA 2WV0A 2ADUA 4IJAA 2ZFWA 3BPXA 1ZRDA 2P5LC 1S7OA 3SZPA 3T5XA 4RB2C 5JHUA 2OA4A 1TNTA 1KYWA 3F8FA 1OYYA 1ZN2A 2OD5A 3WU1B 1IXSB 3V7RA 2QVOA 2IA1A 2FNAA 4YFKF 2P7VB 1DPUA 2FF4A 2JPBA 2R7FA 3RI4A 4KA4A 2HGCA 1LDDA 3H92A 2WC2A 2TDXA 3DQVC 5ICFA 4O6JA 3VOEA 5D5UB 3MZYA 5E1XA 2FEZA 3F22A 2K4JA 3LQRA 1XSVA 1ZYRF 1W7PB 4HV6A 3RYRA 5FD5A 5BPIA 3I53A 5EEGA 1AOYA 2HR3A 3HSEA 5FFXA 2W84A 2MA3A 3TOAA 2EV0A 4N0BA 1W5SA 3L9FA 4CYDA 2EJRA 4OOIA 3FHZA 1B6AA 3B02A 3F8BA 4ETSA 1SAXA 4Y13A 4IXAA 1FZPB 5D8KB 5AIQA 2Z3YA 2FBHA 1G3SA 1FP1D 2FMYA 4DNCA 2F5EA 1FYKA 2LSOA 2D1HA 1HQCA 2MLGA 3R61A 2HYGD 2EFQA 3T1BA 5DUIA 2IA2A 3EYYA 2OZUA 2KIFA 4GCVA 2YR2A 5D4RA 5HDKA 4QBAA 1Y0UA 5J6XA 5HOOA 2ZMEA 1IN4A 3ZMSA 4G8XA 2OBPA 4RB3C 1SD4A 4EMSA 4A5NA 2HWVA 1XCVA 4JVIA 3KP3A 4MEXF 2IJLA 4ESBA 1F5TA 2FSWA 4RGRA 1YG2A 1S8NA 1KQ0A 3MWMA 1BC8C 3E97A 4K2EA 2W57A 3IC7A 1XDSA 2Z33A 4P9UA 4GO1A 6PAXA 1QGPA 3I4PA 3WTSC 1UFMA 1XSXA 4Q5SF 1SFXA 2VE9A 4CHUA 3E5QA 2JRTA 5LHHA 2Q0OA 3R60A 5DYMA 2QQ9A 1ZG5A 4U7DA 4RB0A 3E6BA 3HSFA 4FHTA 1HKSA 3DKWA 4I98B 3NQOA 3QPHA 5EEHA 1REPC 2XIGA 2XROA 1B59A 3SFZA 5DCMA 1I1SA 2VE8A 1ZREA 2GA1A 3TGNA 5L3GA 5CJ9A 5HLHA 3FX3A 5BPDA 1U3EM 2RV8A 2FE3A 5DV5A 2XV4S 4UV9A 2X4HA 1TW2A 3E5UA 4U0VA 3W6JB 4IRHA 3IRQA 2UXXA 4PDKA 2DQRA 2E1NA 4HDVA 1LEAA 2PI0A 5CVUA 1T39A 2XASA 4FX4A 1ON2A 3FMSA 4I0AA 4F7ZA 4A6DA 2DPUA 1BI1A 3VFZA 1J75A 2YSRA 4M6XA 4KIGA 4UV8A 1IN6A 5HVQC 5D5XB 1RNLA 4P5OA 3TO7A 3SHFA 5J8FA 1I1GA 1BC7C 1LDKB 5JVTA 1FC3A 1TTYA 3F6OA 2XAHA 1I27A 5F6FA 4JQFA 2ZMEB 1HKTA 1GVJA 3ZMTA 4HF0A 3ZMZA 2MC3A 1R1TA 2NAZA 4B8XA 2YX4A 3ECOA 1KU2A 1EV7A 4OIPF 3L00A 2KIUA 1OPCA 1ZLKA 2H6BA 4GYIA 1U5TA 1H0MA 3O2PE 4NB5A 4A0XA 2O3FA 1G6NA 5JR3A 2WWYA 2OQRA 4B09A 1G4DA 5K5OA 5JI6A 1SFEA 3GEZA 2Y0MA 2CQKA 1MGTA 4AD9A 2IRFG 5E20A 3S2WA 5H6RA 3I0TA 2YPRA 1R00A 1XMAA 2XUBA 1OYWA 5E8GA 5ICCA 2Z5UA 5K5QA 2IP2A 5E17F 1TNSA 1FOKA 3C7JA 3ZN1A 3BJ6A 2PFBA 4N9HA 4BXUA 4KN7X 2L02A 2M5WA 4PCQA 4PZJA 1JXSA 5DCMB 2C6YA 3EDPA 4BH9A 3QP5A 3OV8A 4CXFA 1FYLA 4EM1A 2O0YA 4WWCA 2Q2EA 2RVCA 1QO0D 3ZMUA 2XRNA 2QQBA 3BDDA 5DD4A 3M7GA 2KRFA 4HF2A 4HLXA 2JTVA 2FQ3A 3BY6A 1FBUA 4MTEA 1HXDA 1LJ9A 2NYXA 5H6QA 1YW7A 2ZXJA 2IPQX 1LDJA 3WTWC 4H0EA 4R1HA 3IKTA 3RPQA 3M1EA 4L5IA 3KLNA 3B73A 3M9AA 3IWZA 3ZMVA 3F23A 1KQ9A 2A61A 2P6SA 4EJVA 3F3XA 3HHGA 4BQAA 2CYYA 3QAHA 1YFHA 3M8FA 2BEOA 3IKVA 3V8KA 1HW2A 3KP6A 3EUHA 3TKYA 2OU2A 3FF5A 3K1PA 2P8TA 3K1MA 1U5TB 1KA8A 1FLIA 1QQIA 4HLYA 1ZRFA 1C0WA 1SMTA 2EV5A 3ZMDA 2BYVE 1XGMA 2QWWA 1R1UA 3ULQB 2GWRA 3FZVA 3ZP5A 3QPTA 3QOPA 2EK5A 1HSJA 3DF8A 1JE8A 3MQ0A 2DT5A 1DP7P 1JHFA 1HSTA 3T8RA 2L4MA 2ZNZA 5D4SA 4ZYHA 4I09A 5CVVA 5E1ZB 2ISYA 3LA7A 3KP7A 2PG4A 2XAJA 3MAJA 1Z9CA 1U5TC 4L9NA 3O3KA 4BHCA 3TDUC 3SZTA 1G3YA 2H27A 4LLNA 1BI2A 3RPUA 1E17A 1BOAA 4DQ2A 2COMA 2P6TA 3DPTA 1T98A 3SXYA 3F8CA 2BGCA 3MFKA 3J80Z 2M8EA 1TLHB 1DUXC 3LQQA 3KFWX 3K0LA 2RN7A 2ZNYA 1LQ1A 5HS8A 2HZTA 2HQNA 3KZYA 3E6DA 1FBQA 3HUGA 1P4WA 3GVAA 1YTYA 3G73A 5LGTA 2ZCWA 4UXNA 4BYYA 3I58A 2EFOA 3NEUA 4GXOA 1XMKA 4S04A 3F8NA 1W5TA 3J7AO 4UVCA 2J5OA 4G6DA 1DPRA 3WE3A 2NRAC 2VOPA 1Z05A 2H6CA 3FMRA 5HDNA 1KGSA 3KE2A 2DI3A 4KIFA 3G3ZA 5KVRA 1QNTA 4AIHA 3HRSA 2VOOA 4P55A 3HHHA 1B9NA 4LB6B 3C3WA 5ICGA 3GUDA 2STWA 1GXQA 2GQQA 4A0ZA 1Z7UA 2DFIA 3WTZA 4AWXB 4TV7A 3ABTA 1O57A 1RI7A 3CUQA 4HW0A 2NNYA 2GIVA 1BN5A 1I6XA 5FLXK 3KCCA 4I2OA 2HEOA 3KP2A 3HOSA 2A69F 2IVMA 3HYIA 5LEKA 1YO5C 4OINF 1ZGAA 3MCZA 4EGZA 1MDMA 2A6EF 1LNWA 1P4XA 4LLLA 4ENMA 4L9TA 2Z99A 2IW5A 3CDHA 1W4MA 3JTHA 1S3JA 2A68F 2CG4A 1OMIA 4HOBA 4N9IA 1IXRC 2M45A 1FYMA 2ISZA 4IVNA 2M30A 1WI9A 2CSOA 4KN4X 2LF7A 5J8CA 5D5VB 1IAWA 5FD6A 5IT3A 4HZFA 5D6FA 1O3TA 5KK1A 3J81K 4OMZA 5LHIA 2KJCA 2QENA 3KP5A 1CGPA 1E2XA 1B9MA 4P9FA 3N4MA 1RUNA 2OZ6A 1RIOH 4JK1X 3WGGA 1IRFA 1I5ZA 1HKQA 4M9ZA 1FT9A 4RS8A 1RZ4A 2Q8KA 2GAUA 3V7CA 3COAC 2GXBA 4LLGF 3QU3A 4KUMA 5A2QZ 4Z2YA 2V1DA 1XGOA 1NHAA 1KU7A 2AS5F 5DEQA 5CVIA 5D5WB 3GLXA 1P6RA 2RNJA 1J59A 1PUEE 4HYEA 3QU6A 1D3YA 4LG0A 3LAJA 2HQRA 1UHMA 4OIRF 4ENJA 1IN5A 2MBFA 3O6BB 5E1WA 1OYIA 1SD6A 3WE2A 1MJAA 3ROUA 3K9TA 2DK8A 1FPQA 5LRSA 5DUKA 4CGZA 2EA4A 2DU9A 3ELKA 3DEUA 1XDUA 4UVAA 5D8LB 1ZGJA 3CO6C 1T0FA 1JGSA 1YQAA 4IRGA 2R7DA 1F9NA 4HX4A 3J80K 1U8RA 4NHJA 1BI0A 1IZ1A 1XCBA 2FBKA 1FX7A 5FO5A 1KU3A 1OKRA 3VEPA 3LAPA 4LFUA 1MDMB 1SMYF 1S7AA 1V4RA 2DK5A 5LHGA 2VODA 3I54A 2BE5F 3I64A 4ZH4F 1R23A 4G7HF 2HOEA 1A04A 2QLZA 3FWEA 3FM3A 2RC4A 3GFLA 3LA3A 1LVAA 1USTA 3DPLC 2IA0A 4QWQA 4U88A 5DD8A 4EJUA 2D1VA 2A07F 4A12A 2G7UA 4M9SA 3LFKA 4HX8A 1H9GA 4XLNF 2CGPA 3JSPA 1IRGA 4Y17A 2K86A 2V1XA 2QM3A 1UHWA 4KNYA 1TQMA 5HLIA 4L9VA 1F4KA 5L3FA 4UUVA 2FU4A 2OQGA 2VBZA 2XKOA 5FGMA 4WXDA 4EQQA 5ICEA 1ZHFA 1YIOA 2P4WA 3BZ6A 1FBSA 2EV6A 4M71A 3WTUC 1ON1A 2V6CA 3PFIA 4YG2F 5L3EA 3RYPA 1FP2A 3R4KA 1B4AA 3MEXA 1MKMA 1R5GA 2W25A 5FLXZ 2CWEA 2CW0F 2EFNA 1QZZA 1L0OC 2V9VA 3GFJA 3W6KB 4LG0B 3CTAA 1WQ2A 2NNNA 2M1BA 1RUOA 3KEQA 1X3UA 2H94A 2V79A 1YW9A 3HSRA 4ZYGA 3P7NA 1IF1A 3BWGA 5F64A 3QRFF 1ULYA 3WODF 2XAGA 5L3DA 3DV8A 2QBYA 3BJAA 4PGGA 2L4AA 2P7CB 3U1DA 2XHKA 3R0AA 4O5VA 3RIRA 3GYHX 4KDPA 1ZLJA 5FB2A 3KETA 5HDGA 2F5FA 1USSA 3E6CC 1IW7F 2ZBKA 2W24A 5ILUA 3J81Z 4R8HA 4WCGA 3FMQA 1EH8A 3D5LA 2FA5A 3N97A 4M9XA 2EFPA 2NS0A 4I0BA 4OIQF 1P92A 2PQ8A 1SFUA 1IUYA 4U7BA 1MJ9A 4OIOF 5A2QK 1GXPA 4E70A 3CO7C 3F21A 1L3LA 1XD7A 3E3VA 3WG9A 1B1BA 2DAOA 4EM2A 2E7WA 3H3UA 4JBAA 4MEYF 3FXQA 2A6HF 2LNBA 2VC0A 3OOPA 1J0RA 4PGHA 5IT9Z 4G94A 1YS6A 2XGXA 3FXUA 1U6GA 2DO7A 5CYVA 4EGYA 3TOBA 3IWFA 4EV0A 4GYGA 3F8MA 4AIKA 2HFHA 4ON0A 1MD0A 2LKPA 4RAZA 4G7OF 3ZPLA 5D6EA 2PBIA 3JAMK 4Q4ZF 2E7XA 1Z1DA 2HKOA 4A0YA 3IL2A 4L0ZB 2GA2A 2KIMA 1WRJA 2VC1A 4WXHA 1J5YA 4LK0F 1R7JA 2A5YB 1DDNA 3ECHA 2F5DA 5AONA 3R0JA 2P5VA 3ZQ7A 3DXJF 4UNOA 4BHPA 2VXZA 3RKXA 2PLYA 5ERIA 4QLCU 4LGWA 1XGSA 3I71A 4G6QA 1T2KA 2VONA 1SD7A 2EA2A 3KEOA 4EM0B 4D0PA 1BIBA 1D5VA 4KT5C 1Q1HA 3P9IA 4CZZA 3WU0A 3E5XA 3PQKA 2B0LA 3HRMA 1K78A 2QBYB 5TRDA 2F2EA 1UB9A 1K79A 4BAYA 4L18B 5LRRA 3T0YA 1ODDA 3JW4A 2K7LA 2RQPA 1P2FA 1D8KA 3RDIA 4ZZDA 3P9CA 1GHCA 1TW3A 2HKXA 1AWCA 4AIJA 3HOTA 4RGSA 2STTA 2DW4A 4G7ZF 5L3CA 2FNPA 3BJOA 2LF8A 3L7WA 4M74A 1ZARA 2DTRA 2Y48A 3K2ZA 4UHTA 4U0WA 1R1VA 2ESHA 3DP7A 4KMUX 3WTVC 3T8TA 3GZ6A 1ONVA 4ZYEA 3BPVA 3V8JA 3ISPA 3GWZA 3LWFA 4XSXF 1Z6RA 1QZYA 4LB5A 1TBXA 4G9YA 3GO5A 3GW2A 2DBBA 4Y15A 4HF1A 1K7AA 4LD5A 2FBIA 3TDZC 2DQLA 1ZH5A 2K4BA 3GF2A 1O7FA 5TJJA 5DDGA 2H09A 3U9GA 5F1RA 3V4GA 1LB2A 3L09A 4YFNF 3PQJA 2M87A 1UCRA 4HQMA 4HDUA 2GZWA 2CFXA 2MH9A 3HTUA 3SQNA 2O61A 4IHTA 3F72A 2VBXA 1ZG1A 4Q47A 5LGUA 2PJPA 2JPCA 2MD5A 3MZHA 2KJBA 4GGGA 4L9JA 3WTTC 2K27A 4MQVA 4WF2A 4LJZF 3D0SA 2ZKZA 3DFGA 1ZG3A 2Z9OA 2O03A 5FFZA 3K1NA 1R5HA 2MLKA 3FM5A 1KQ8A 4KIBA 1H9TA 2VT2A 3K69A 1WSUA 1TQPA 2J5PA 1YW8A 2YX7A 4ESFA 2G9WA 4CICA 3I59A 2K02A 2EB7A 1K78B
chains in the Genus database with same CATH superfamily
2ZXWH 3M3KA 3NWTA 2UZKA 2TCTA 3CJQB 2Y75A 3K6UA 1O3QA 5JK4A 2XVCA 2VB6A 2XAFA 1A31A 2Y7PA 3FISA 5ITPA 2E1CA 3OOUA 4X04A 4A2UA 3KZIC 1K9YA 1CF7A 4OZ9A 3H3ZA 2E35A 4MO7A 5E18F 4HQEA 3M8JA 2XD3A 4U1OA 5EYGA 3TCFA 4OMYA 1YAEA 1OLTA 4GFRA 1X1DA 3FXRA 4FT8A 3OL3A 3O8GA 4B48A 4PBHA 1VF9A 1XGNA 3HIFA 4BXXJ 4FX0A 4U2RA 2VT3A 4LK1F 2GOMA 3DKYA 2HPGA 4M3GA 3V7SA 5IT9K 4XKPA 4IO9F 4KISA 2JVGA 3GFIA 4O3BA 2L54A 1FQEA 1A54A 2DSFA 2L7KA 2AXTC 1I50J 3REOA 1T38A 3Q9VA 3BR0A 4ELPA 3MWBA 4QHQA 3ODBA 2LDUA 4DI3D 1TXFA 4A3JJ 1Z7NE 3R26A 4F39A 1GTKA 5DM7F 2DMNA 3CFZA 1MBEA 2XGEA 4KYWA 4M73A 2AXLA 1V55H 4D9JA 1ETQA 1U78A 2HS5A 3FJGA 5L3BA 3T66A 3DEWA 2D2WA 4N8YA 1BM9A 1PP8F 5TU0A 1APLC 4V2GA 1AA7A 4BY7J 3BR3A 2FVZA 3PM1A 2M8GX 5KDTB 2GXGA 4A5MA 2WAQN 4A3DJ 1HSEA 3JR9A 1O7LA 3GZ5A 4ND9A 1QBJA 2JZYA 2NVYJ 4JXIA 3Q25A 3MUQA 2L7FP 2QVVA 3RQ4A 3HRUA 5HLTA 4F29A 4MGRA 2ZZVA 1B58A 2WB1A 2F5CA 4IPAA 4JVCA 3ZQLA 3C18A 4XXUA 3DP6A 4BBSJ 1BIAA 2ZJ2A 2ESNA 3TO9A 1VQKI 4M72A 3HFUA 4NF4B 1DGWY 2IGOA 1T6SA 1ERDA 3CUQB 2K9SA 4XLPF 1OVTA 2XKPA 3OIOA 5LGNA 4WX9A 2UXNA 2KISA 3BOQA 2CO5A 2VI6A 1SPIA 5LEJA 1IN8A 3PMVA 1FSEA 1Z6TA 2BHZA 2HTJA 5ILSA 4XBFA 3Q0UA 2XWOA 4XSZF 2CEXA 3E6MA 4EJOA 4HAMA 3JAMZ 2QSHX 1O4XA 4I6ZA 4XLAA 3LR1A 4U0YA 3BFUA 1IN7A 4A6EA 3H06B 4II2A 5CKTA 1FSAA 5LBQA 2JA6J 4GF8A 3Q5FA 4ESJA 2CZLA 3CSBA 3PNVA 5BQTA 2DPDA 4QFKA 3L2CA 1S5LC 3EUKL 4EJTA 3AL0C 1SD5A 3BR1A 2RREA 3FD3A 3BBRA 3IFAA 4OVSA 5EQ7A 4BACA 1R58A 3RKYA 3CCUI 3D4CA 4QPQA 5HLGA 2LKXA 2QZ8A 4FISA 4L5EA 2H9BA 4ECFA 5AA4B 4YIFA 3HPIA 4NMYA 4DIGA 5BS6A 4EEFG 4L0YB 5HODA 1UIVA 1IXGA 2YU9J 2V1UA 2PMUA 4XN3A 5H2FC 3ESWB 3JRFA 4MHGA 1YPNA 4OENA 3CC7I 3CCMI 5FRNA 3CSGA 3B6WA 4XKRA 4LIVA 3W2WA 1TP4A 2KKOA 1LUJB 3B6AA 3RTRA 2R0QC 4RK9A 4WKMA 4WK8F 2BBYA 5CBRA 1KA0A 3JTGA 3CUQC 4HA8A 4XIDA 1ELJA 5JEIA 2P3NA 2FXAA 3SEUA 2QYOA 3KLOA 1PP7U 4I02A 2RDPA 3JRDA 5E3NA 2OBGA 1N7WA 5ET8A 4F1VA 1Y39A 4KQPA 3K4LA 4MTDA 3OS1A 1BK4A 4O3MA 1UJ8A 3RKWA 2XAUA 3GX4X 1HLVA 3OD7A 5LLQA 5FKMA 3MZBA 2JSCA 4PAKA 1OCZH 2A6TA 4Q48A 3QYEA 4UUSA 2R8TA 1O3SA 3TMGA 4FATA 1N3WA 4I3YA 2R7XA 1OCPA 3WTXC 1SD3A 4ONYA 2R7WA 4RK2A 2UVGA 2MC4A 5H8HB 2A3SA 5BMZA 2WV1A 2NOOA 3HOXJ 4P96A 2AO9A 5C44J 4C0RA 5CVRA 2DTZA 1J2XA 1NV7A 1B2HA 4LZ7A 4OYVA 3T96B 3S3MA 3VODA 4OU0A 3OS0A 4MLVA 1Y3NA 3B6QA 1BJAA 5C4XJ 5HPQA 2I4CA 1A40A 3BP8A 2OAZA 1QPMA 1X2NA 2PFZA 3HO7A 2COBA 2XSJC 3KP4A 2VBWA 5HNFA 1LEBA 3SEQA 1NV5A 1USYE 1S29A 2ONSA 3E3KA 1MDP1 3S93A 2QGUA 3GZNB 5IP6A 2F7AA 4BU2A 3C2GA 1B8IA 3FIRA 1D9YA 3BTLA 3TELA 2PX9A 1DTZA 2JT1A 1N7XA 5TGTA 4OVQA 4IRIA 2XD2A 3VLWA 3S9MC 2XAQA 3VB2A 2YJPA 3I59B 3Q9SA 1U2WA 1FCKA 4NG7A 5CRYA 3MKYB 4DXUA 2A5WA 3DLLF 3OIQA 2D45A 1AH5A 1MPCA 4Z7EA 3CUOA 1WWXA 5CLSA 3QK6A 1WFXA 2X1CA 4RAFA 3V8LA 1GT0C 5EYRA 2DWJA 4KCDA 4ENNA 3EQLF 5HS7A 4ASNA 3E79A 4XLFA 2F48A 3VYUB 3CMAI 1NK3P 3R6SA 1SQYA 2CUZA 4HCWA 1F1ZA 1OMPA 3SDFA 1EH7A 2R92J 2JN6A 1K6OA 3FATA 4GWSA 2GLOA 2IT0A 1RPWA 4I8CA 4Q30B 1CF7B 4MFEA 1SAUA 1JUPA 5HNHA 4MQ9F 3F11A 1MPDA 2F6GA 3CJNA 1BBYA 4ENKA 2E1MC 3M1CA 2PEXA 2F36A 2YU3A 1XB4A 5DCFA 1WH7A 1R22A 4M3BA 4L5JA 4DBRA 1B05A 4GX4A 1G3TA 2VBYA 2WB1N 2OZZA 1XN7A 2O7UA 2FOKA 4HV5A 3OYCA 2H4IA 2E2HJ 2XA5A 1G3WA 2O1MA 2XXPA 3ABUA 1Z91A 4PJ0C 3V8XB 4NF0A 4DYRA 5EZHA 3C36A 3EF7A 3EETA 2FMLA 2L3DA 4PSXA 1BKAA 2X0LA 2EZIA 3P5JA 2B4MA 3H0GJ 5CVJA 3UIFA 2V9KA 2BV6A 3CCQI 1O64A 4NQWA 4PC9A 1BR1A 1WKMA 4WEPA 1GV8A 4YB7A 4ESWA 1YS7A 2KLOA 2PMHA 4W97A 3O2AA 3I5UA 3OMBA 4MMPA 1GDTA 2LK2A 3OYGA 2QUFA 4IHYA 4G68A 1WPKA 3IAZA 1B32A 3E4RA 3H35A 3LSKA 2OCEA 2QKMB 4IHSA 4RAYA 1XSDA 1I39A 2P5KA 1K6YA 3QXMA 1FBCA 1ZTYA 2DVZA 4OVJA 3IHUA 4LMYA 1TT1A 1DTGA 2R3SA 1ZAOA 2PN6A 4YB5A 2O6GE 2BY2A 1VI0A 1P1OA 3HSTA 1W0UA 1IV6A 4N6PA 2O51A 4GIZA 3A29A 4RB1A 4KFCA 2VN2A 2JMWA 4YAHX 5IP9J 3F6VA 5HS9A 5IM2A 3JRHA 2EFWA 3PPRA 3MVPA 3J7AY 3GFMA 4LQ5A 4HXVA 1R6ZA 1IMBA 4YIIA 4HE2A 3KZZA 4GWZA 1LVKA 1NV1A 2F6PA 2Q8JA 1R36A 4KICA 2DFHA 1ZKGA 3EKIA 4S05A 1PEBA 4C1UA 2ACJA 2LREA 5J4YA 4KT6A 2FRHA 3PGFA 1M1EB 4W1UA 4KD5A 4X9TA 2PCRA 4P1EA 1R1NA 3GXOA 2LC2A 1S6LA 2WTEA 1LFGA 3DLNA 3NRVA 3UNGC 1S7EA 2HXRA 4V2FA 1FMWA 4AVPA 1WDNA 3LSXA 1J7KA 2BY1A 4Y4RA 1GR2A 1KU9A 5EQAA 4NF8A 2ETHA 4N15A 3KGCA 1PC3A 1ITYA 3CFXA 1UMQA 2L9RA 3MMYB 3TTRA 2ABHA 2DMQA 1B46A 5JLXA 2HNHA 1LFUP 1W0TA 4MNPA 1IUDA 2KHMA 1MPBA 3E0JB 5I56B 2FX0A 4ZYDA 2VLAA 1VFDA 5K5RA 2W85A 3IRRA 3LSWA 3MVXA 4OMBA 2I5UA 1H76A 2HOTA 3WTYC 3NAUA 3Q26A 1D8JA 2D5WA 3LA2A 1V3FA 1SW2A 1J1NA 3G7WA 4HCYA 3GZGA 3RQTA 1POGA 2EWNA 5F1QA 3K4NA 3M8EA 3AKZA 4FASD 1YYVA 2NS8A 3QP6A 1W7PA 2R7QA 4PJLA 4YFXF 1CQTA 1MJBA 3RN8A 2VJJA 5EF6A 4AM3A 2CQXA 1T0FC 4P0GA 4HX7A 3KZGA 4H67A 1EH6A 3S1RJ 3TP3A 4RGXA 2E71A 4MNUA 1QVSA 1Y3PA 3R6UA 4HBLA 2YS9A 4UUSB 5BOXA 2XPVA 1A99A 3MPKA 1EA3A 1VTNC 1IXCA 2WY7Q 3A02A 3QPLA 2ELHA 4XRSA 3F0CA 2CH0A 1UTHA 1Y20A 4R73A 3Q0WA 3WGIA 4MCOA 1HW1A 3P9KA 2H99A 1POY1 3IJXB 4NDLA 1O3RA 5E8IA 3LSIA 2H1LA 4M6YA 2OCUA 2XPUA 4XRFA 3HDDA 2DT6A 1EZOA 1RKMA 4UVBA 3HPHA 2R5ZA 2DWAA 3GCMA 3C1DA 1FWZA 1JP4A 2FD5A 1ZRCA 1FSHA 1IEJA 1P99A 3UA8A 2RAEA 3G3KA 3IO6A 2EIMH 5ED4A 1MZBA 4ZZLA 1JKQC 4C2TA 4YKKA 2O8XA 4B47A 5E3OA 3FV1A 3T0JA 4N91A 5J1DA 1B40A 1FNNA 1UIUA 3CLOA 2DXRA 4R79A 1VQOI 5KCJA 1HW5A 5IYCJ 2EQRA 4BHBA 1B8IB 3AAFA 1IXHA 2Y7IA 4CO8A 2XXXA 1W7PD 5EZGA 1NV0A 5JFRA 4FBPA 4JB7A 5IZ3A 4KYEA 5C3EJ 2RF1A 3FK6A 4CA0A 4BXFA 3B6CA 4RGUA 4ZECA 2RGVA 1R5ID 1P7IA 1TZLA 4I7HA 1PDNC 4IQJA 1G2HA 4XICA 1JNFA 3OWTA 2Q2CA 3KN8A 5I56A 1JHHA 1CB6A 1HBXG 3FXLA 4EJWA 2DLLA 3JSOA 2F7BA 2CV0A 2EZHA 3QODA 2XPWA 4EVIA 1SW1A 4F55A 1STZA 1W36D 3BG6A 2G7HA 3U94A 1YLFA 5AE4A 2HTSA 4A3CJ 1J9IA 4Q8RA 4A3IJ 4I01A 2ZO4A 1YRNA 4DZ1A 1BI3A 4I3EA 5ILVA 1YHQI 3SYTA 1ETXA 4OFLA 4F2QA 1MBJA 2I6EA 1JTXA 3OYFA 4YICA 3S2DJ 5F0CA 2BHYA 3QWLA 2MH2A 5B1BH 2CZHA 1V54H 5TP9A 3HTSB 2Y5LA 3HRTA 4IF4A 2RKHA 1QU3A 1KYZA 4RM3A 5H20A 3LSTA 3PSFA 2W82A 1QKAA 5M5WJ 5K1YA 4CDGA 1MM6A 1YJNI 3QYTA 3U2RA 3ML6A 4FIMA 3ZN0A 4JVDA 4P9KA 2REGA 3JRAA 1TFDA 4A69C 2L01A 2JWTA 4BNCA 2FHYA 4R6HA 1FY7A 2HDCA 2HVRA 3A09A 1LBXA 2WY8Q 1TQIA 2HYFA 4NQWB 4XQFA 1ZR4A 1FTJA 3UK4A 4KMFA 2UWMA 3ERED 3TQNA 4GQOA 1IRZA 1P4AA 3TO6A 4PF8A 2OJED 2BY0A 2QQAA 1NUYA 4RPOA 1KWHA 2F5XA 3RJPA 5EDNA 3FASA 4ZEDA 3EYIA 1N76A 3L2RA 4AS5A 1ETOA 5AIPA 3FDYA 1SVOA 5A5LA 1OR7A 2M4KA 4A3GJ 1FQCA 3K0VA 1S50A 1I6AA 3BROA 4WXCA 4CSWA 3WGHA 2WV0A 3IH4A 2ADUA 3K70D 4IJAA 1IRXA 3FJ7A 3G3FA 3GYYA 3P7IA 5EYFA 5CBSA 3VVFA 2ZFWA 1DMBA 3BPXA 1ZRDA 2P5LC 2PJRA 2BXYA 3G3HA 5B5EC 1S7OA 3SZPA 1UG0A 1BOBA 3T5XA 2LYCA 3CCEI 2HCAA 2JJKA 3LUYA 4XKVA 4RB2C 4QFPA 4MLQA 1MW7A 2ZC2A 5JHUA 1FW0A 2DODA 2OA4A 1D9QA 3DTIA 3MC2A 1TNTA 1KYWA 2OC6A 3F8FA 4ZTJA 3LNQA 1OYYA 2ZXHA 2HVSA 1FPDA 1ZN2A 1GV2A 2OD5A 3WU1B 2Z8FA 5GPCA 4OERA 3HOUJ 2K9LA 1IXSB 3EPZA 2QVOA 3V7RA 2IA1A 2Q74A 2FNAA 4YFKF 3WHCA 4M3EA 1B5JA 1R9LA 2P7VB 3C4MA 1DPUA 3OY9A 1HOMA 2FF4A 3RGYA 2Y5KA 3RT6B 2JPBA 4PE3A 2R7FA 3RI4A 4KA4A 3FIWA 4PK4A 4YU0A 1IITA 2E1OA 4M3DA 2HGCA 2MYSA 1LDDA 3H9GA 3OELA 4O7MA 3H92A 2WC2A 5F1JA 2TDXA 3DQVC 3E9XA 3S9LC 4XRSG 3LC8A 4NF8B 1NG7A 3BG5A 1MH4A 3CESA 1R4MB 1UG2A 2CMPA 2NS7A 5ICFA 3GTGJ 4O6JA 3VOEA 1B1HA 4XK4A 1ZKBA 4DGWB 4JWYA 5D5UB 4QPOA 3MZYA 5E1XA 4B44A 4F3GA 4ZC3A 4RNSA 3ZQHA 1TWYA 4ZEFA 4C1TA 2FEZA 5M3FJ 2NVTJ 4GX3A 1X1BA 3F22A 3OYNA 2K4JA 3GLBA 3LQRA 2F7CA 2P2AA 1XTAA 3TP0A 3IK6B 2QVUA 1XSVA 2CUJA 3AG4H 1ZYRF 1W7PB 3RSNA 1VQMI 1LLSA 1B1XA 2XWVA 2CJJA 2Q88A 1MRPA 2IGKA 1A55A 4HV6A 3RYRA 5FD5A 4RDUA 5BPIA 1R4NB 1TFAA 3I53A 5EEGA 1AOYA 2HR3A 3HSEA 3RPWA 1BIYA 5FFXA 2W84A 1FBEA 2MA3A 3TOAA 4BE1A 5H8SA 2KZVA 2EV0A 1PUFA 3N6UA 1Z77A 1W5SA 3BR5A 3KX2A 3L9FA 4N0BA 4CYDA 4OWDA 4PFBA 3OYAA 1UTHB 4XM3A 3W6VA 1WVRA 1MNEA 2EJRA 4OOIA 3SFIA 1G8XA 4AC0A 3FHZA 2HAUA 4QFLA 3N94A 3ZS6A 4PAIA 3MSTA 1B6AA 2OK2A 4UABA 3B02A 5IOYA 3F8BA 4ETSA 4NWCA 1SAXA 4G61A 4ZEIA 2R5ZB 4Y13A 2AYSA 4IXAA 1JJ8C 3IOVA 3IR1A 1FZPB 3D5RC 1PVEA 3IFCA 2IAIA 5D8KB 1EKEA 3HEFA 4YRVA 5AIQA 2Z3YA 2V26A 3EHUA 5L9SA 2FBHA 1Y8RB 1G3SA 1IXIA 1FP1D 1U9NA 1XS9A 1SYIA 2OTJI 2FMYA 4DNCA 3FXJA 3H9JA 2F5EA 4H45A 1FYKA 5GP9A 2LSOA 2D1HA 1HQCA 2MLGA 5IZ3B 3R61A 1X1PA 3FVKA 2HYGD 3LSGA 5M5XJ 2EFQA 2VQLA 3ECRA 3T1BA 5DUIA 3TTMA 2IA2A 3EYYA 1K4SA 2LOOA 1X1AA 4M3FA 2OZUA 4XLHA 4NF5A 1Z3XA 2KIFA 5EHMA 3TEPA 4IO3A 3LSJA 2YR2A 4GCVA 4C9YA 5D4RA 3SDGA 4LVQA 4BUPA 2L7ZA 1YRNB 3PUZE 4POWA 3G3IA 3FK7A 4CYCA 3L2VA 1HC8A 1Y1ZA 3QUFA 2IEKA 1JKPC 4JP0A 3H3GA 5HDKA 4QBAA 5DTBA 2QA4I 3CF2A 1Y0UA 5J6XA 2AL4A 5HOOA 2XSDC 4XLCA 2V84A 2ZNUA 1IGNA 2ZMEA 1IN4A 3ZMSA 4AYBA 2DYRH 4G8XA 2OBPA 3LOCA 1MIJA 2PBWA 4RB3C 1SD4A 2ID3A 5TP9B 4EMSA 4A5NA 3H03A 1LAGE 2HWVA 4LITA 1XCVA 2VIXA 4JVIA 2K3FA 3KP3A 4C3IJ 3GTOJ 4MEXF 1F36A 3RTWB 2IJLA 1GVDA 5FHOA 3DWLE 3GLLA 4HSTA 5GADJ 3H5NA 4ESBA 5H8FA 1F5TA 3K00A 2ZXIA 4U22A 2FSWA 2QQ8A 3S1NJ 1A8EA 3A3CA 2FIEA 3PUVE 3KJ7A 2F35A 1NNPA 5K7ZA 4RGRA 1YG2A 1S8NA 1KQ0A 2DYSH 2R7RA 3BLYA 3CMYA 3MWMA 1BC8C 3E97A 3LUZA 2GXAA 1B5HA 3A03A 3K4CA 4KITB 2XGCA 3DKXA 2LVSA 2Y0SA 2L9NA 2B4LA 3MD2A 1B7UA 4FJPA 1QUIA 5K2XA 4K2EA 2W57A 2K9QA 5FKOA 4PFYA 4XFEA 2M3AA 3IC7A 1XDSA 2RC9A 2Z33A 2RQQA 2XXRA 3BFTA 3EUAA 4P9UA 3CF5F 3QMFA 2JQ7A 4GO1A 1MXUA 3LBSA 2JA5J 2V93A 6PAXA 4G4PA 5CQGA 1QGPA 4BDLA 3I4PA 1QRYA 3WTSC 1UFMA 1UELB 1XSXA 5J3LA 4Q5SF 2Q2AA 4ISUA 4BBRJ 5FTIA 1FPEA 1WGXA 1PB7A 1SFXA 3PUXE 3KFMA 2VE9A 2L0KA 4CHUA 2XC7A 2QL3A 4F1UA 2DDBA 1JUSA 2LY1A 3E5QA 3CR9A 2JRTA 3ABLH 3PUBA 5LHHA 1JEVA 2Q0OA 3KC1A 3R60A 3E7LA 2OV7A 5DYMA 2QQ9A 5I7IA 1D1CA 1ZG5A 4U7DA 1N04A 2XXYA 2OTLI 1VNDA 2F4OB 3N05A 4RB0A 3E6BA 2M7BA 4II3A 4J01A 2FUG2 1FPFA 4E7ZA 1LB9A 1O7TA 2WKYA 4I40A 3HSFA 4O3CA 3R7XA 2O5RA 4FHTA 1RYOA 1HKSA 3DKWA 1BL0A 4I98B 3NQOA 3QPHA 5EEHA 1REPC 2XIGA 5LOMA 1WJDA 4BJ6C 2KRCA 3WG7H 1ZIUA 3KSXA 3QIMA 2XROA 1IV8A 4TLMB 1B59A 2KDOA 2WBDA 4A3FJ 3SFZA 3FXBA 5DCMA 1I1SA 2VE8A 3M3FA 2AQFA 1FTOA 1P9QC 1MXXA 1ZREA 1BLFA 2B3BA 2WA0A 3G3GA 2GA1A 3TGNA 3OEKA 3DPUA 2UV1A 5L3GA 4LONB 3KPHA 1GV5A 5CJ9A 5HLHA 4AS4A 3FX3A 4GVOA 2HZDA 5BPDA 1TT0A 1U3EM 2LY9A 2RV8A 3OMYA 2CV2A 2GM4A 2FE3A 5DV5A 2XV4S 1QVUA 4UV9A 4XLEA 1USYH 3FV2A 3O6IA 2DE4A 2X4HA 2NVXJ 2F3BA 2CZIA 4B3AA 1TW2A 3E5UA 4U0VA 3W6JB 4IRHA 2FYIA 3HG9A 3KOTA 4MH5A 4NAPA 4D5CA 4F19A 3IRQA 4HEA2 1T0KA 2LY2A 1VE4A 2UXXA 4PDKA 1VQPI 4BDOA 5FBPA 3S4UA 5LD2C 2DQRA 2DDAA 3M8UA 1PUFB 2JVHA 1XI6A 2E1NA 4HDVA 1LEAA 1MBKA 2PI0A 2VKDA 3QOEA 1PBQA 1ZBMA 4N4NB 4MFIA 5CVUA 1II5A 4QTRA 3OR2C 1DK4A 1T39A 1VQ8I 3I55I 2XASA 2EILH 4FX4A 1ON2A 2VJ4A 3FMSA 3IUOA 4RM2A 3C32A 3G1MA 4I0AA 4F7ZA 4A6DA 3LV0A 2DPUA 2G29A 1QKBA 1BI1A 3D5SC 2FOWA 2DJNA 3K6GA 3VFZA 1D4NA 1J75A 3OYBA 4OVTA 1BTJA 1E0EA 2YSRA 1JEUA 4M6XA 3SJMA 5KCMA 5CQEA 5LFAA 4KIGA 3QPSA 4UV8A 1IN6A 5DTDA 2ZJRF 5HVQC 5DYHA 5D5XB 2JRMA 3VFJA 1X4OA 2IGMA 1RNLA 4A3MJ 4P5OA 3TO7A 3C35A 1LAXA 3KYCB 2OWTA 1NV2A 3KIOA 1BW6A 3I6VA 3IV5A 2TRTA 4BLAA 1RDZA 3SHFA 1SEUA 4NF5B 3DCFA 4K3FA 3M07A 3M3LA 4C30A 1X19A 2OWZA 4HE1A 4UY8I 5J8FA 2VQCA 2DXYA 4P56A 2V4JC 5IKBA 1I1GA 4IKFA 1BC7C 3L2WA 1Y1WJ 4TQUQ 1LDKB 2GBYA 1FC3A 2NOJB 5JVTA 4BQQA 2ZYOA 4NN3A 2DA6A 1FTAA 4YKIA 2DMPA 3ONQA 1M5EA 1TTYA 3F6OA 3J7ZI 2XAHA 1B7HA 1I27A 2CFOA 4FTHA 3VLVA 3KYLA 5IPAA 2QKLB 5F6FA 4UUTA 2AHQA 2QF7A 4J00A 3RZDJ 4JQFA 4MFDA 1FRPA 4N6DA 4WXJA 2ZMEB 3SEVA 3RQIA 1HKTA 4FE8A 2LRDA 3TCGA 1GVJA 3ZMTA 3JV9A 4HF0A 4JOMA 3ZMZA 4FAJA 4IHXA 2MC3A 1B52A 3GMEA 3NARA 1R1TA 4GWOA 4MNCA 1P7JA 2NAZA 4B8XA 3S3NA 3PO3J 1FTLA 2RINA 4LATA 2Y2ZA 1VSOA 1R9QA 4MIJA 2YX4A 3ECOA 2I0CA 4O7IA 3PPOA 4IGTA 2OCCH 1KU2A 3RCOA 2M2EA 1SBPA 1WJCA 1EV7A 1X1CA 5H8FB 4HTGA 4OIPF 5FHMA 3L00A 1IMCA 2KIUA 3FBIB 2E2JJ 1F43A 4LZ5A 1OPCA 2HAVA 1ZLKA 4RLFA 4JSOA 4YZZA 2H6BA 3MN2A 2R93J 3U21A 5F08A 2PT2A 2HDWA 3HKZN 1K83J 4GYIA 1U5TA 3GXAA 3RNNA 5J40A 2I0BA 1H0MA 2X6XA 2A05A 3ZRGA 1MNDA 3O2PE 1H45A 3DEEA 1LCFA 4NB5A 2GRVA 4A0XA 4F3QA 3U93A 3LSHA 2O3FA 5GPAA 4B1RA 1YZ0A 2CZKA 3OO6A 1MY2A 1G6NA 4ZE9A 2E60A 2EBIA 4MF3A 5JR3A 2WWYA 4QSHA 3MZ1A 2OQRA 4B09A 1G4DA 5K5OA 1PJRA 5JI6A 1SFEA 3ZR8X 3PUYE 1G0HA 2ELJA 3GEZA 3VYSB 1OCCH 2CQKA 2Y0MA 4BKXA 2CU7A 4FEBA 4GWWA 3OIPA 1A6QA 1RR8C 2W4SA 2DOFA 1MGTA 1TWHJ 4F52A 4AD9A 4M6VA 3PTYA 2IRFG 4EQ7A 4GOTA 5E20A 1NNTA 3S2WA 5H6RA 1U0JA 3I0TA 2VD3A 3CCYA 2YPRA 1MNMC 3EN3A 3T9VA 1R00A 1XMAA 2XUBA 5JTYA 1OYWA 1AU7A 3W9WA 4GL8A 1ENHA 5E8GA 5ICCA 4HS7A 2Z5UA 1MH3A 3SDBA 5K5QA 2IP2A 1AIVA 5E17F 4RPNA 1TNSA 1FOKA 5DEXA 3C7JA 3HB9A 3PUFA 4NBQA 3ZN1A 2CUFA 3IOWA 3BJ6A 1WJFA 2PFBA 2VPRA 4G8HA 5CMCA 1LBWA 2JK3A 2HPIA 4N9HA 3H7MA 2CQQA 4BXUA 4F31B 2DCEA 4XORA 2A5TA 4R75A 4X8RA 3TEDA 2XXTA 4KN7X 4NHBA 3CCLI 1V5EA 3CJRB 2L02A 3GBGA 2ZFUA 1DSNA 4PJNA 2M5WA 1D3KA 1UHSA 4IY6A 4XR6A 1LFPA 4PCQA 1MXVA 4PZJA 2QS1A 3IORA 4PFOA 4Z6YA 1JXSA 5DCMB 3BQYA 5E3MA 4IHWA 4P3LA 2C6YA 3T22A 1FBHA 3EDPA 4BH9A 2XXHA 3QP5A 2Z8EA 2X1EA 4QSEA 3DU5A 3TFLA 3THIA 3OV8A 2F34A 4RLQA 4CXFA 4GD5A 4ELQA 2NOGA 1FYLA 3DELB 3LSMA 4EM1A 2ZXTA 1YE9A 2JSPA 5I5PA 3E1SA 1IMFA 2O0YA 5JLWA 4WWCA 2P1SA 2Q2EA 4D5FA 4JDFA 2RVCA 1QO0D 2BW3A 3ZMUA 1R71A 2XRNA 3DBHB 4OESA 3LSLA 1NKXA 1QHGA 2AL5A 4KHZE 4P47A 4XKNA 2E5NA 1FPBA 3LL7A 2YLNA 2QQBA 3RUMA 4TOZA 1LE8A 1ZJLA 3BDDA 3VDFA 4G77A 2IXSA 5DD4A 3VYTB 3M7GA 1Y8QB 4U87A 2KRFA 4HF2A 3TBIA 3V89B 4HLXA 3CD6I 2JTVA 2FQ3A 3BY6A 5CMKA 1FBUA 4MTEA 4RA1A 1HXDA 3VVDA 3CP8A 5DT6A 2OUMA 5ET5A 1LJ9A 1RKWA 1IUFA 3BG9A 2NYXA 2DMTA 2DOEA 2W00A 3OYKA 1LBBA 2DYXA 3CIJA 5H6QA 3RYDA 1YW7A 2PT1A 2ZXJA 3Q29A 1RRJA 2XF7A 5I2NA 1MBFA 2IPQX 4A93J 2Y69H 1LDJA 3JCUC 4MBPA 4N4OB 1NK2P 3WTWC 5DVJA 4H0EA 4R1HA 3IKTA 2LH9A 3RPQA 3VSLA 4E4HA 4GDFA 2NXOA 2DA7A 3M1EA 5ET7A 5A5XA 4L5IA 3KLNA 3B73A 1YXIA 3M9AA 2FIXA 3IWZA 2DFEA 4MNIA 1I3QJ 3ZMVA 3F23A 5J16A 2M9HA 2R6GE 2RCAA 2X9DA 1HDPA 4NC7A 1G59A 3SKPA 4E0WA 1KQ9A 1LKXA 2A61A 2P6SA 2H25A 2M0MA 4EJVA 3F3XA 3HHGA 3X2QH 1D0ZA 3L2QA 4BQAA 3M3YJ 3CRBA 4IOAF 4EF1A 1FJLA 3PU5A 2CYYA 3QAHA 4Y33A 1Y6IA 3OYDA 1YFHA 2QS3A 1MY3A 1MMNA 3HJEA 5F24A 1NV4A 3M8FA 2ZNTA 4BDZA 4IEJA 5FKKA 3BZKA 5IYBJ 1WJ5A 1VFEA 4MEVA 3T93B 2BEOA 2LAOA 4CUGA 2UYEA 1YCJA 1IJWC 3IKVA 4A3BJ 1NTCA 3V8KA 5M5YJ 1HW2A 1UQWA 4OTEA 4I76A 3FGSA 3KP6A 3S3OA 2VJIA 5B66C 3MPLA 5IP7J 3ZQFA 3VXBA 3ZKLA 5FTHA 4MX6A 4DW6A 1G0IA 3OSFA 1LCTA 1EF4A 1Z3YA 2IA4A 2X6WA 1X3ZB 1ETWA 1Z7LA 2CV1A 4N6KA 2VQHA 3CJTB 3EUHA 1H43A 3TKYA 3IAM2 2OU2A 3FF5A 3K1PA 3RLFE 4ITVA 1R49A 4DDDA 4DLDA 3CCRI 4U1ZA 1PDAA 3KG2A 4HNTA 2P8TA 3AFHA 5ELVA 3K1MA 5M2VA 1U5TB 1US5A 1KA8A 1FLIA 3GTQJ 1QQIA 2LFBA 4HLYA 2L9SA 3USDA 1ZRFA 4OHNA 1C0WA 4H8IA 2BVMA 2M0CA 1SMTA 2X1DA 2EV5A 3ZMDA 2H8RA 1DGRM 4Z0IA 3CMMA 2BYVE 1XGMA 5DS9A 3OS2A 2HPMA 1MQJA 4AUXA 4I9DA 2QWWA 4NEDA 2E2IJ 4X1BA 1Y1VJ 3HXLA 1R1UA 3ULQB 4DYQA 2GWRA 3FZVA 3ZP5A 3QPTA 4B43A 1JW1A 1SI1A 1DQUA 3QOPA 4JX6A 1Y4CA 2EK5A 1HSJA 3DF8A 1JE8A 2ZSHB 1AWBA 2K3PA 1LBZA 3HOVJ 3QUJA 3UORA 3MQ0A 1JKRC 3MAMA 2DT5A 1DP7P 3A3UA 1JHFA 1HSTA 1QUJA 3IL1B 2WAFA 5JTYB 3T8RA 4QXDA 4HW8A 3EQ1A 5J47A 2CW7A 3OYHA 1XVXA 2A5SA 2KL4A 2VKEA 3BCBA 2L4MA 4UB6C 2ZNZA 5D4SA 5DEXB 4JX4A 3TODA 3OR1C 3UR3C 4CCOA 3JRIA 3CC2I 4KFQA 4ZYHA 4I09A 5CVVA 4R9GA 3BT9A 4F91B 3MVWA 4OXVA 1MBHA 2K85A 5E1ZB 4M1VA 4PGNA 2ISYA 2A5TB 3LA7A 2IS1A 2HZKA 4ZEKA 2L9VA 3KP7A 5GAGJ 4I1DA 2PG4A 2DJIA 2XAJA 3MAJA 4LOCA 2LKSA 1AKHA 4F3PA 1E3PA 1QVTA 1Z9CA 2WEFA 1Z0XA 4PDDA 1U5TC 4L9NA 1VQLI 1B7ZA 3OXNA 3GTLJ 3O3KA 5I57A 4BHCA 3TDUC 2MABA 1H8AC 1VQ7I 2BY3A 3SZTA 1ETYA 2LD5A 2V1NA 5ISUA 1G3YA 3WAFA 4FORA 2H27A 4LLNA 4NGUA 3H6TA 4ELOA 1BI2A 2OPTA 2VXDA 2EPFA 1Y9UA 3RPUA 1E17A 3UP9A 1Z7ME 1EZ9A 4POXA 3QAXA 5HM4B 1BOAA 2GIZA 1D1BA 1SW4A 4PBQA 5B70A 1D5YA 3ZQQA 2HQAA 4X0GA 4DQ2A 3G2BA 2Q2EB 2COMA 2P6TA 3B8BA 2FQ4A 4JBZA 5CC2A 2BZTA 1JGGA 2BW3B 3DPTA 2ANJA 2MGQA 4KI0E 2UVHA 1T98A 3SXYA 1DOTA 3F8CA 2BGCA 2WBMA 3MFKA 1DBZA 4GWUA 3I3VA 4XKWA 3J80Z 2M8EA 2XXKA 1TLHB 2ME0A 1LE8B 2GOXB 1DUXC 1IMDA 3Q0VA 3FBPA 3LQQA 4ABZA 2PX1A 3SERA 3KFWX 2AQEA 3K0LA 3L2UA 3SEYA 2DS9A 1V5GA 3BC8A 5ICTA 4OAZA 4YIRX 1CNQA 5LDZA 1QGXA 2RN7A 1SANA 1WCMJ 2ZNYA 2Y30A 5HS8A 1LQ1A 2VKHA 1RYXA 2XX9A 2HZTA 3KEIA 2HQNA 3HGGA 3KZYA 1K4TA 4GWXA 3TW7A 3E6DA 2XXIA 1OVBA 1FBQA 4F22A 1US4A 3ONMA 2JJ7A 3K4BA 3DBLB 4R9FA 4R72A 2EINH 5I2NB 3HUGA 3RPUD 1FQAA 1P4WA 2IS2A 2GH9A 1IO2A 4IOCF 3GVAA 2QJEA 4NC6A 3BTJA 4PFPA 3NWSA 3BCAA 1D9VA 1YTYA 3DTEA 2DVCA 2NWJA 1A5JA 3G73A 5LGTA 1QUKA 2ZCWA 4UXNA 4BYYA 2V9PA 4MJOA 2XX7A 3I58A 2EFOA 4E6KG 3NEUA 3FJMA 4H1XA 3DLAA 2DP8A 4GXOA 5CMBA 2PMZA 5DW8A 1XMKA 2HFBA 5K2YA 1U9OA 4R6YA 1UTBA 2JUGA 4S04A 2CEYA 3F8NA 1W5TA 1B4HA 2GFEA 3J7AO 3OOAA 1JTYA 4BY1J 1NFTA 3ABMH 4UVCA 2J5OA 1OCRH 3S8PA 2O6AA 3JREA 3KC0A 4G6DA 1B3GA 4PJMA 3PNYA 3EHTA 1DPRA 2R7UA 3EPEA 1LBVA 3WE3A 4KPTA 3CLQA 3FVGA 2NRAC 1HF0A 2VOPA 1EH3A 2KFDA 2AIXA 1Z05A 2E34A 1ORKA 2H6CA 4E7HA 3FMRA 2L7MP 2DN0A 5HDNA 1KGSA 1NNKA 4PGPA 2NVUB 4E7KA 2PFYA 3MVYA 2L5QA 3KE2A 1A8FA 2DI3A 4IL6C 4KIFA 2KIQA 3G3ZA 5KVRA 1H44A 1N3XA 1TWGJ 2X6OA 2YPNA 3CQZJ 1QNTA 4AIHA 1D0XA 1ETKA 3A1YA 3O97A 1N75A 4B4CA 2XWKA 3MVZA 1DP3A 4FQGA 3HRSA 2KDZA 2VOOA 4XOPA 5CPRB 4P55A 4GL0A 4EXLA 4KJZA 3PUWE 2KPMA 4LN5A 3H36A 3BR6A 3HHHA 3BTCA 2KZGA 5FROA 3H0DA 1B9NA 4LB6B 5ICQA 1FQBA 3C3WA 4CZCA 2EIJH 5ICGA 3ZQCA 3L6HA 5ET6A 5GAEJ 1P1NA 3GUDA 2HOSA 2STWA 2P0SA 1OLAA 2DA5A 2LP0A 1D0YA 3K2DA 1GXQA 2GQQA 4A0ZA 2DFFA 1MY1A 4LP2B 4O8MA 2XB0X 3SZGA 9ANTA 2QMWA 1Z7UA 2DFIA 2E5ZA 3OO7A 3U92A 4BEHA 3WTZA 1WJBA 4AWXB 4E7IA 1MXWA 1R6RA 2X48A 4MLOA 4XOTA 4DJAA 3L1PA 4OANA 3G4SI 2Y9YA 5AA2A 2WAEA 4TV7A 5IZ1A 3ABTA 1O57A 3TDJA 4ZDPA 4DCYA 2CQ7A 5KZTA 5J4VA 1AHDP 1Z67A 3HZJA 5KCJB 2Z22A 4XNFA 3TTLA 1RI7A 1OJLA 3CUQA 1SFOJ 1GGGA 4HW0A 2NNYA 5FKLA 1LGBC 2GIVA 1BN5A 4G68B 1I6XA 3KN3A 3ZQGA 1GLNA 1SVLA 5FLXK 3TAJA 3KCCA 2LMDA 4XN0A 4I2OA 5IGAA 2HEOA 3LSFB 1VQ9I 4O94A 3KP2A 3HOSA 2A69F 3DP4A 2IVMA 1TWCJ 3HYIA 1TL8A 1IC8A 4X6AJ 3J7YJ 3ZSFA 3W15C 5LEKA 1YO5C 3SEWA 4RBOA 1NV6A 2XF5A 2QFLA 3GBBA 4OINF 1LSTA 1FIPA 4CH7A 1ZGAA 3MCZA 1FOXA 3ILTB 1W36C 3IB0A 4EQBA 4EGZA 3TQWA 3K4UA 2YUSA 1MMDA 2E19A 1MDMA 3B6TA 1RKTA 2CS3A 1JI8A 2A6EF 4OFOA 1LNWA 1P4XA 1NMUA 4BDQA 2EIKH 4LLLA 4ENMA 3I4MJ 1H3DA 1P1UA 3KEYA 4L9TA 3V83A 4PFTA 4HNUA 1AKHB 2Z99A 1FBPA 4QFNA 5AA2D 1URGA 1Z21A 3KBZA 2IW5A 3CDHA 3MYUA 1AL3A 2Z23A 4AU7A 5I57B 1W4MA 3JRGA 3JTHA 3PO2J 3MZ8A 3KJTA 1SVXB 4Y3OA 2D21A 3W9VA 3CG1A 2HXWA 4BE2A 1S3JA 3I4NJ 2A68F 2CG4A 1JW5A 5AA1A 3KBRA 1OMIA 2VKVA 4HOBA 1HDDC 1QPIA 1Q35A 3S32A 3I56I 5TISC 4GBWA 4N9IA 4IO5A 1XG1A 4XKBA 4KCCA 1IXRC 2M45A 3VDXA 1FYMA 3N6TA 4LUBA 2ISZA 2G0EA 2JUCA 1KZHA 3I3LA 2HVQA 3CDLA 4J19A 1F9BA 3WU2C 1HSLA 4D7NA 2HZLA 3IX1A 4IVNA 4BDRA 1LFHA 2M30A 1WI9A 2CSOA 3OSRA 4KN4X 4NNJA 2LF7A 4U4XA 3MKWB 5J8CA 1TC3C 2ZNSA 5D5VB 1IAWA 5FD6A 4ZE8A 5IT3A 2PJRB 4HZFA 4YELA 5D6FA 2DA2A 1O3TA 2HXIA 3HPGA 1MS7A 1BR4A 3NOHA 2XWIA 5KK1A 4OWRB 3K70C 4A3LJ 3J81K 2Z1DA 2MG4A 5F27A 4OMZA 2XXVA 1URDA 4QIWN 1QJMA 2V3QA 5DVFA 1AMFA 5J1UA 4IO7A 3K02A 4C2UA 3PJRA 5LHIA 2KJCA 2QENA 3CCJI 4GRKA 3KP5A 1I6HJ 2KMUA 1INPA 5J1RA 4UA8A 1CGPA 1E2XA 1B9MA 1ZTRA 2HEUA 2IGNA 3HUGB 5JHFA 4P9FA 1YYZA 3N4MA 1RUNA 4DI4B 5BNGA 1WJAA 2OZ6A 1RIOH 1Y3QA 3MBPA 2THIA 2WYPA 4F2OA 1ZELA 2O68A 2ZYNA 4N13A 4JK1X 1FIAA 2UYFA 4ZEBA 3WGGA 2QSFX 1IRFA 1I5ZA 3S2HJ 1B51A 1HKQA 1YTVA 3U72A 4M9ZA 2XX8A 1FT9A 1FBDA 4AQ4A 2DDKA 4RS8A 1E3HA 1VQ6I 1UTBB 2P81A 4FCYA 1RZ4A 4U23A 2Q8KA 2GAUA 3V7CA 3K4KA 2QEXI 2FNCA 3COAC 2X51A 3U1KA 4EATA 2GXBA 1XHYA 3H6WA 1OR7C 4LLGF 3AG3H 3KOSA 4P0IA 5B7DA 3ZQIA 2R7ZJ 3S9NC 2ZMBA 2XB5A 1ACIA 2XXQA 3QU3A 3K10A 4KUMA 5A2QZ 4Z2YA 5IOZA 2R5YA 3MJNA 2V1DA 1BW5A 4WEDA 1XGOA 1NHAA 1KU7A 2AS5F 3PD9A 2Y84A 1WODA 5DEQA 2VGQA 2X7QA 1UZCA 3GBAA 3H1CA 2F4MB 5CVIA 5D5WB 3GLXA 1OLCA 3BQZA 1VR5A 3OYJA 4JWOA 3OO9A 3H5RA 3N26A 1XC1A 1MXZA 2VUMJ 2X7PA 3HN0A 4BQOA 4JWXA 4R2FA 3TYHA 3MW0A 1P6RA 4NC8A 4D1QA 2RNJA 1J59A 1PUEE 1JQFA 3AL0B 4L17A 1S9TA 2KQZA 4HYEA 1K61A 1S7YA 5FRMA 3RPLA 3QU6A 2ZYKA 2DWHA 4IGRA 4CCJA 2I58A 1D3YA 3H9QA 4LG0A 2HQRA 3LMMA 3LAJA 2V3TA 1UHMA 4OIRF 1D1AA 1IN5A 4ENJA 1EYIA 1NG6A 2MBFA 1JVYA 3O6BB 1SVMA 4PAFA 4CCKA 1ZMGA 2DOAA 5E1WA 3C9HA 4H46A 1OYIA 2OLBA 4PETA 1LAHE 1SD6A 2LG4A 3WE2A 1N77A 1MJAA 3ROUA 3K9TA 3UKGA 4BEHB 3C33A 1DU6A 3CHGA 4BDNA 2QVRA 2DK8A 2Y9ZA 1FBGA 1FPQA 5LRSA 5AA2B 5DUKA 4CGZA 1Y0NA 2EA4A 2DU9A 4F18A 3C34A 5GTHC 3ELKA 2JA8J 3DEUA 2V7FA 4KYDA 5H8QA 2O84X 2HHMA 3IJOB 3D1RA 2MW8A 4AYBN 5C4JJ 1XDUA 2E36A 5L9MA 4UVAA 5D8LB 2D5VA 1BP5A 2GHBA 4PFIA 1ZGJA 3CO6C 1T56A 1T0FA 5I58A 1JGSA 2O9LA 1YQAA 4IRGA 2R7DA 1F9NA 1S9HA 4HX4A 3J80K 1U8RA 4XEQA 5CMMA 4NHJA 2QRYA 3TUSA 1BI0A 2LLKA 3GTKJ 1IZ1A 1XCBA 2BJJX 2N8GA 4HPQA 4ZZAA 1L5TA 2FBKA 3Q3SA 3TW6A 3OL4A 2ME6A 4N17A 1FX7A 2DMUA 5FO5A 1ANFA 5IY5H 1KU3A 4DXBA 4CYCB 4H0WA 2DE3A 1OKRA 3VEPA 4EUOA 3LAPA 4LFUA 2DQVA 1TWFJ 4GRIA 1OCOH 5KHDA 1MDMB 1SMYF 1S7AA 1V4RA 2ONKE 4QSCA 2DK5A 4HE0A 2Z16A 1FEXA 1R9TJ 4KYSA 5LHGA 2VODA 3L6GA 4BL0B 2DWIA 2F78A 2Y0SN 3WHBA 3IOTA 4IY5A 1FQDA 3K2AA 2I8DA 2ZZXA 3ZCOA 3I54A 1QULA 2BE5F 3I64A 3VYRB 3ZXSA 1T8IA 4ZH4F 2F3DA 3TQLA 1R23A 4G7HF 1YJWI 2HOEA 1A04A 2QLZA 3FWEA 3FM3A 3MP8A 2RC4A 3GFLA 2EH3A 4F3BA 3HHFA 3PMWA 2K5CA 2ZB9A 3LA3A 4BDYA 3ZKKA 1LVAA 1USTA 2Q1ZB 1LBYA 4NTLA 1ZLQA 3DPLC 3PV0E 2IA0A 2O7OA 4QWQA 5B1AH 3DM0A 3OYLA 4U88A 5DD8A 4EJUA 1YJ9I 2D1VA 3CDIA 3ASNH 1B9JA 4XIGQ 2V25A 4LZ8A 1XVYA 4U4SA 3C2HA 2A07F 1FTMA 4A12A 2G7UA 1MDQA 3D4GA 4M9SA 1MQDA 3RY3A 3LFKA 1N0TA 3G1LA 2MKZA 4HX8A 1H9GA 2EZKA 4XLNF 1ZQ3P 2KLFA 2CGPA 3D1NI 3JSPA 1IRGA 2K9NA 1WZ2A 1PBPA 3CMEI 2LBFA 4Y17A 4Q5TA 4XKCA 2K86A 4D7MA 2Q89A 4PP0A 1LBCA 3G3JA 4X1EA 1W1WE 3BTIA 1JUMA 2E1MB 4AIDA 1H88C 2V1XA 1I6QA 2QM3A 4O3AA 3O66A 3IH2A 1UHWA 3HBLA 4KNYA 1TQMA 5HLIA 1FPJA 3TL4X 1KA1A 4L9VA 3MZ9A 2I48A 2R9JA 4DE8A 2ZMEC 1F4KA 5L3FA 3VPRA 4OAYA 4H4KC 1NV3A 3DTKA 2Q8MA 4UUVA 2B63J 1B5IA 3TTKA 2VPNA 1SI0A 4ELRA 2FU4A 2RC8A 4YMBA 5E3LA 3HOYJ 4G2ZA 3T9HB 2OQGA 2BVLA 1LAFE 2VBZA 5K7HA 2PYYA 4PUSA 4YKJA 3FXKA 3H6UA 2XKOA 2X6YA 4H5GA 2NUVA 1AOVA 5FGMA 4RYAA 4BS9A 5CI5A 3RZOJ 2DA3A 5I2KA 3BG7A 4I99C 4WXDA 3SESA 4EQQA 1BJZA 2HXOA 2B3FA 1XMXA 2VASA 4A3EJ 2ID6A 4C2MJ 3G1OA 5ICEA 1ZHFA 1YIOA 4S0HB 2M4GA 2P4WA 1JJ6C 1FTKA 2CW8A 4AB5A 3E13X 3JRBA 3HGYA 3ROJA 3A4CA 3BZ6A 1P1QA 2RKMA 3K4JA 1FBSA 2EV6A 4M71A 3FVOA 3WTUC 1ON1A 3ZGKA 3K6XA 1MMAA 3K4MA 2B7EA 2V6CA 3RKQA 1FJ9A 2Y7RA 3A0BC 2ICWG 3PFIA 2R5YB 1YIJI 1IQ7A 1JKOC 2E1SA 4ANJA 1RC9A 4PDHA 4UB8C 5AA3A 2LTPA 4YG2F 1NI9A 4JYKA 1ZGWA 3PD8A 3K6WA 4ZS9A 5L3EA 1HCRA 1T08B 3RYPA 4PCDA 1FP2A 3R4KA 4H8JA 1B4AA 3MEXA 1MKMA 3A0HC 2IS4A 1FTTA 1R5GA 3OO8A 5EQ8A 4ZTFA 1B3HA 2BJIA 1B3LA 2W25A 5FLXZ 1NH8A 4PFUA 4DYCA 1EU8A 2CWEA 1IIWA 1NUXA 2R7OA 2CW0F 2EFNA 3PPNA 1QZZA 1GVCA 3BR2A 1L0OC 4YKPA 2V9VA 1Q9DA 2I3WA 1A6IA 3RPLB 2O8KA 1URSA 3CP2A 4QSDA 5CM6A 3GFJA 1KZ8A 3W6KB 5H8NA 2OX3A 4LG0B 3TMOA 1QZEA 4GWYA 3CTAA 1WQ2A 2L2OA 4QF9A 2NNNA 2W7YA 4B3XA 1EYKA 1QHHD 2M1BA 1YI2I 3GTJJ 4NX1A 3PL8A 4XF5A 1B3EA 1RUOA 3KEQA 2ONRA 1OQYA 1X3UA 2EZLA 2H94A 3BIGA 4E7JA 4H5FA 4MAGA 4QRZA 2V79A 1M5CA 1YW9A 3S1QJ 3HSRA 4PJJA 1JETA 4G8MA 4ZYGA 1IDZA 3P7NA 4G8NA 4N4UA 5H8QB 3CI8A 1Y56A 1NNFA 3FUZA 1P1WA 1T95A 2DOJA 1NH7A 1FQFA 1IF1A 1X4PA 3BWGA 4G12A 4RJZA 3MP6A 3I9V2 4THIA 3O6GA 5F64A 3SEXA 4CCMA 5I58B 2BXZA 3PSIA 3HOZJ 2OWSA 3JZJA 3QRFF 3S2VA 3QQAA 2MFZA 3KYDB 4PE5B 4I62A 1ULYA 4RA2A 5T3JA 3VV5A 1X2MA 1A36A 3WODF 4PQJA 2XAGA 5L3DA 3DV8A 4XL9A 2RC7A 4N81A 1J09A 4Y7NJ 1K9ZA 2QBYA 3FXOA 3BJAA 4PGGA 2L4AA 1FTZA 2M8CA 2CRGA 4R6KA 3TCHA 2P7CB 2R7VA 3U1DA 3OENA 5L9OA 2D3IA 1SC7A 1OFCX 2XHKA 3R0AA 4O5VA 1MY4A 1RR7A 4P11A 1I6BA 3RIRA 1FOYA 3GYHX 4KDPA 1B0HA 3I5OA 4YMAA 3A01A 3V42A 5L8DA 3PFYA 1M5DA 1ZLJA 3O8HA 5FB2A 3KETA 1FMVA 5HDGA 2F5FA 3FHNA 3HCQA 5ITOA 1OQGA 3U65A 1USSA 2H8WA 1ZR2A 3KN7A 2HDDA 3E6CC 2NVQJ 5IAIA 3ERMA 1IW7F 3IOUA 4ZDLA 3H4ZA 2ZBKA 2I3VA 3TKDA 2W24A 5ILUA 2UVIA 3J81Z 2VQGA 4C3HJ 5EEAA 4R8HA 2O1LA 4WCGA 3W2AA 3FMQA 1EH8A 3VE1B 1NH3A 5FHNA 1ZK8A 3CCSI 3D5LA 4HRIA 4BGDA 4ZDMA 2FA5A 3N97A 4ESXA 2Z8DA 2GHAA 1JW4A 1N84A 4M9XA 2EFPA 3MKLA 2NS0A 4I0BA 4OIQF 1P92A 2IS6A 1O63A 4YB6A 3T9XB 4C3JJ 1SYHA 3CVGA 3AG2H 4IO6A 2PQ8A 3S1MJ 5GTIC 3A2KA 1SFUA 1IUYA 4MIMA 4U7BA 5FLMJ 1MJ9A 4OIOF 5HBCA 2XHDA 3IH3A 3JYRA 5A2QK 1FPIA 4DOZA 1XPXA 4E70A 3CO7C 1GXPA 3F21A 2KR0A 1LFBA 2LBFB 1L3LA 4GLIA 4XMYA 4OETA 3BG3A 1XD7A 2OF7A 3E3VA 2R7TA 3WG9A 4EDPA 1DCUA 1B1BA 4CCNA 2L5VA 4FETA 5EYHA 3UGWA 1SW5A 2XRLA 1LEVA 2OJTA 2DAOA 4EM2A 3FKJA 1MXYA 4XRMA 2F5VA 2E7WA 3H3UA 1Y1MA 4JBAA 3G6EI 5J1YA 1XT8A 4FE7A 4MEYF 3FXQA 3VWBA 2Y31A 3KSJA 2JA2A 2A6HF 2LNBA 2VC0A 3OOPA 1J0RA 4EQ9A 3EHSA 4N07A 4PGHA 4G6TB 3O9PA 5IT9Z 1H89C 2F97A 4G94A 4P1WA 3ZOBA 4Q0CA 1YS6A 2X85A 2XGXA 3FXUA 1U6GA 3CC4I 2DO7A 2G93A 3O29A 5CYVA 3PPQA 2B65A 2M34A 5I2KB 3CG3A 4OVPA 2HI3A 3OEMA 4OEVA 1NUZA 4EGYA 2I10A 3TOBA 4GFBA 3IWFA 4PTKA 4EV0A 4CCLA 2WBBA 4GYGA 1TWAJ 3F8MA 3OYMA 2RCBA 4AIKA 2E0SA 2HFHA 2ELKA 3VXCA 4ON0A 5IZZA 1WHUA 1MQIA 1VDWA 2H5YA 4QFOA 1MD0A 4F3SA 2LKPA 2IEEA 5TPAA 1FPLA 4RAZA 4G7OF 1EJ9A 3ZPLA 5BWJA 1N25A 5DVIA 4FECA 1YX3A 4BE0A 1B4ZA 3HM5A 2QMXA 5D6EA 4DBQA 4FE4A 5DM6F 2PBIA 2VOZA 1LFIA 4AVZA 3JAMK 1EZPA 1RETA 2Z2SB 1PB8A 4Q4ZF 1XS5A 5I59A 2E7XA 1Z1DA 2ECBA 4LQ2A 2HKOA 4A0YA 3OSQA 3IL2A 2KQRA 1NL5A 3U1OA 2KT0A 4L0ZB 3AG1H 1IMAA 1DPEA 3OYIA 4PF6A 2VT5A 1RESA 1FOWA 2XXWA 3G71I 3IB1A 3DBRB 3S16J 3SEZA 1B6HA 2GA2A 2KIMA 5KAIC 1WRJA 1A7LA 1Y4TA 2REJA 4GX6A 2VC1A 3UN6A 4WXHA 1YITI 1X58A 1J5YA 3HV1A 4LK0F 1R7JA 3MKZA 3BKIB 1I3AA 2A5YB 2V4CA 5H8NB 1YX5A 3FBNB 1DDNA 3ECHA 3FXMA 5EQ9A 2F5DA 2O7IA 5AONA 1IG7A 2HQ0A 4GXAA 5EG0A 5EGOA 4NF6A 2DA1A 1VQNI 3R0JA 1JVXA 2B9SA 2P5VA 2CUEA 3ZQ7A 3DXJF 3B7DA 3IB2A 2KP6A 4UNOA 4BHPA 2FBPA 4IR8A 1WI3A 1B72A 2VXZA 3RKXA 4IHVA 2PLYA 2Y7KA 2IBDA 2FA7A 4RAGA 5ERIA 4QLCU 3Q27A 4RXLA 2UUZA 1HA8A 4ZZEA 4LGWA 2RNGA 4M4GA 1XGSA 2P3VA 4HSRA 1B3FA 3I71A 4OA4A 3SETA 4G6QA 1T2KA 2WADA 2VONA 4GBVA 3S17J 4IB2A 5M3MJ 4H65A 1SD7A 2XDVA 2NXNB 4FEDA 2EA2A 4NE4A 3KEOA 3TTNA 5A5XB 3FKIJ 1MY0A 4EM0B 3CZ6A 2HYJA 4HG2A 4D0PA 1BIBA 1D5VA 4KT5C 1Q1HA 1Q1KA 3P9IA 1ZU0A 4CZZA 4XTCQ 3WU0A 4IZZA 3M4OJ 2DT7B 3E5XA 2JA7J 3H5AA 3RT8A 4KXPA 3PQKA 2W7NA 2B0LA 1JT0A 3HRMA 1XX5A 2X26A 3PPPA 2GQ1A 2VPLA 1K78A 4DZPA 4F93B 3LSRA 2QBYB 5JVGF 1DPPA 4NWDA 2F4IA 5TRDA 1MM7A 2F2EA 1UB9A 1K79A 4F1YA 4BAYA 4L18B 5LRRA 2HOAA 3T0YA 1ODDA 3JW4A 3C31A 4GXSB 2K7LA 2RQPA 1M5BA 1P2FA 3K7AJ 1VFCA 3A01B 4AB6A 1D8KA 3RDIA 4BJTA 4ZZDA 5F04A 1XC5A 3P9CA 3W3CA 3IP4B 1Q1VA 2H1KA 3QYBA 1IDYA 1TW3A 2HKXA 4PSWA 1GHCA 1AWCA 4EXKA 4AIJA 3HOTA 5IYDJ 4RGSA 5F0FA 1MBGA 4LA9A 3O28A 2ECCA 2ZYMA 2STTA 3ASOH 2DW4A 4R2BA 4G7ZF 5F0HA 5L3CA 4NUBA 2FNPA 3BJOA 4ZYAA 1S72I 2QS2A 1WH5A 2LF8A 3L7WA 4KR5A 4IQ4A 1T33A 3LSPA 1BR2A 1WJEA 4M74A 3V5AA 3QSLA 1MG1A 2ZJQF 4JSDA 3VLUA 1ZARA 2DTRA 4P8BA 2W48A 3C2BA 5KAFC 4DXCA 2Y48A 3K2ZA 2Q9TA 2QS4A 5I84A 1W5CC 5KDTA 2R7SA 3Q28A 3GTMJ 2I4BA 3E78A 4UHTA 1QW0A 1RDYA 2F8DA 3DP8A 1SDXA 1IMEA 4BJ5C 1VQ5I 2UXAA 1V5FA 4F92B 4X1DA 3CFLA 4U0WA 4BQNA 1PYVA 2WYKA 1R1VA 3B50A 1DU0A 4NF4A 1FBFA 4OEUA 2CQNA 1I69A 2ESHA 1TT5B 2DXIA 3DP7A 4KMUX 4IX7A 4ZDOA 3MQ9A 2VJ5A 3TZAA 3W2VA 3BZCA 3WTVC 1U8BA 1OCTC 5ESYA 1POTA 2K9MA 2WX9A 3T8TA 3GZ6A 3HL2A 4NQ8A 3FVNA 4UACA 1WVJA 1B0LA 1LB8A 2VD2A 1ONVA 3LFUA 3JRCA 2LR8A 4ZYEA 1A35A 1JT6A 1KONA 4DIQA 1GUUA 3N5LA 3BPVA 3PMXA 3V8JA 2WAQA 3ISPA 5FLVA 2XF6A 3GWZA 1PB9A 4X48A 3VSKA 2V3UA 3LWFA 4XSXF 4LG3A 1Z6RA 1QZYA 4LB5A 1TBXA 4Y52J 4G9YA 5E79C 1SFKA 3GO5A 3PIPF 4OQOA 3GW2A 4E0XA 3IAS2 4MHFA 3EUHC 5GAHJ 2DBBA 4Y15A 2HQ5A 1K7AA 1QA6A 1LPQA 4HF1A 1NUWA 4DCXA 4LD5A 2FBIA 3TDZC 2PVUA 4N8GA 3WAEA 2FJ1A 2DQLA 1ZH5A 1XOCA 2QSGX 3IO4A 4E7LA 2K4BA 3GF2A 4R74A 1MSEC 4RY1A 4ZJZA 2VL8A 4HNVA 1O7FA 5TJJA 4E7SA 5B3SH 5AA4A 3VVEA 4EF2A 1MSFC 4TLLB 5DDGA 3BIHA 2F6CA 1MMGA 2HU9A 2CMOA 2H98A 1BA5A 2ZZWA 2H09A 4P1LA 1ETVA 3MP1A 3U9GA 3CCVI 5I3SA 2V6EA 5F1RA 5TPAB 2ALUA 3T9UA 4PFWA 3V4GA 1LB2A 2DE2A 4BDMA 3L09A 4YFNF 1ATGA 3PQJA 2M87A 4OFJA 4YEJA 1UCRA 4HQMA 4HDUA 5I59B 3F9KA 2KRHA 3ILUB 4G68C 2GZWA 2CFXA 1FJ6A 2MH9A 1OISA 3HTUA 4RMNA 3O6HA 3SQNA 2O61A 4PFRA 2XXUA 3DU6A 4IHTA 5EHSA 4IO2A 3F72A 2VBXA 3ABKH 2XGDA 3QYFA 1ZG1A 4Q47A 1UAAA 1MQHA 5LGUA 4A3KJ 2MD0A 2QCOA 5EJCA 2PJPA 2VP1A 3K6VA 2VHAA 2JPCA 3HOWJ 2MD5A 4DZJA 1CE2A 4V19K 3S15J 1MMSA 3H6VA 1MQGA 2P0WA 2DA4A 1E3OC 2O69A 5H8HA 1VZ0A 2QPQA 2R71A 1X3WB 2KJBA 4GGGA 3MZHA 1OIBA 3S9EA 4JX5A 4L9JA 2PMZN 3WTTC 2I49A 1FPKA 4IO4A 5EG0B 5EGOB 3AXFA 4NF6B 2K27A 4MQVA 2QSXA 1EYJA 4XONA 1VQ4I 3S14J 3K01A 4WF2A 1RDXA 1M5FA 2R4GA 3HC7A 3GTPJ 2M7AA 1B72B 5LTCA 3RTFB 2ZJPF 4LJZF 4OVRA 3D0SA 1N78A 2ZKZA 1FPGA 3DFGA 2PMSA 1ZG3A 2Z9OA 2O03A 5FFZA 2MSYA 4LIUA 5F7VA 3K1NA 1R5HA 2MLKA 3FM5A 4H6DA 5KNLA 3PNTA 3OYEA 1KQ8A 5BUUA 3U8QA 4KIBA 1H9TA 2VT2A 3TPAA 3K69A 1WSUA 1TQPA 2J5PA 3PIOF 1YW8A 2YX7A 4ESFA 5K7FA 2G9WA 3OSGA 2VPOA 4CICA 2W1OA 3H3VK 3I59A 2ZSIB 2K40A 1YOVB 2Y7WA 4XKQA 1OQHA 2BOLA 3HKZA 5FJ8J 4U21A 2UVJA 2K02A 2EB7A 5FKNA 1K78B
chains in the Genus database with same CATH topology
2UZKA 2Y75A 1O3QA 5JK4A 2XVCA 2XAFA 2E1CA 4X04A 4A2UA 1K9YA 1CF7A 3H3ZA 4HQEA 5E18F 5EYGA 4OMYA 3FXRA 4FT8A 4PBHA 1XGNA 3HIFA 4FX0A 2VT3A 4LK1F 2HPGA 3V7SA 5IT9K 3GFIA 2L54A 3REOA 1T38A 3Q9VA 2LDUA 4DI3D 4KYWA 4M73A 2AXLA 1U78A 2HS5A 5L3BA 2D2WA 4N8YA 1BM9A 1PP8F 2FVZA 2GXGA 4A5MA 1O7LA 3GZ5A 1QBJA 2JZYA 2QVVA 3HRUA 4MGRA 2ZZVA 2F5CA 4IPAA 4JVCA 3C18A 1BIAA 2ZJ2A 2ESNA 3TO9A 3HFUA 4M72A 1T6SA 3CUQB 4XLPF 2XKPA 5LGNA 4WX9A 2UXNA 3BOQA 1SPIA 2CO5A 5LEJA 1IN8A 1FSEA 1Z6TA 5ILSA 2HTJA 4XBFA 2XWOA 4XSZF 2CEXA 3E6MA 4EJOA 4HAMA 3JAMZ 4U0YA 1IN7A 4A6EA 1FSAA 5LBQA 3Q5FA 4ESJA 5BQTA 2DPDA 3L2CA 4EJTA 1SD5A 5EQ7A 3IFAA 4OVSA 1R58A 3RKYA 5HLGA 2QZ8A 4YIFA 5BS6A 4L0YB 2V1UA 2PMUA 4MHGA 2KKOA 3RTRA 4WK8F 2BBYA 1KA0A 3JTGA 3CUQC 4HA8A 2P3NA 2FXAA 2QYOA 3KLOA 1PP7U 4I02A 2RDPA 5ET8A 4F1VA 4MTDA 1BK4A 4O3MA 3RKWA 3GX4X 4PAKA 5LLQA 2JSCA 4Q48A 2R8TA 1O3SA 4I3YA 3WTXC 2A3SA 5BMZA 4P96A 5CVRA 1J2XA 1NV7A 3VODA 4OU0A 1BJAA 3BP8A 2OAZA 1QPMA 2PFZA 3KP4A 2VBWA 1LEBA 1NV5A 1S29A 2JT1A 4OVQA 4IRIA 2XAQA 3VB2A 3I59B 3Q9SA 1U2WA 4NG7A 2D45A 3CUOA 1WWXA 5CLSA 3V8LA 4ENNA 3EQLF 5HS7A 4ASNA 3E79A 4HCWA 3R6SA 1F1ZA 1EH7A 1K6OA 4GWSA 2IT0A 1CF7B 4MQ9F 3CJNA 1BBYA 4ENKA 2PEXA 2YU3A 1XB4A 5DCFA 4GX4A 1R22A 4L5JA 1G3TA 2VBYA 1XN7A 2FOKA 4HV5A 2XA5A 1G3WA 3ABUA 1Z91A 4NF0A 3EETA 2FMLA 2L3DA 2B4MA 2X0LA 5CVJA 2BV6A 4NQWA 4PC9A 1WKMA 1YS7A 2PMHA 4MMPA 3I5UA 2QUFA 4IHSA 4RAYA 1XSDA 2P5KA 1FBCA 2DVZA 3IHUA 4LMYA 2R3SA 1ZAOA 2PN6A 2O6GE 3A29A 4RB1A 4KFCA 2VN2A 3F6VA 5HS9A 5IM2A 2EFWA 3GFMA 4HXVA 1IMBA 4YIIA 4HE2A 3KZZA 4GWZA 1NV1A 1R36A 4KICA 3EKIA 4S05A 2ACJA 2FRHA 4X9TA 2PCRA 4P1EA 3GXOA 1S6LA 2WTEA 3NRVA 2HXRA 4AVPA 1J7KA 1KU9A 5EQAA 2ETHA 4N15A 4MNPA 4ZYDA 5K5RA 2W85A 3IRRA 3WTYC 1D8JA 3LA2A 1V3FA 4HCYA 2EWNA 3M8EA 1YYVA 3QP6A 1W7PA 4YFXF 1MJBA 4HX7A 1EH6A 4RGXA 4MNUA 4HBLA 5BOXA 1VTNC 1IXCA 2ELHA 3WGIA 4MCOA 1HW1A 3P9KA 1O3RA 5E8IA 4M6YA 4XRFA 4UVBA 1JP4A 3C1DA 1FWZA 1ZRCA 1FSHA 5ED4A 1MZBA 4ZZLA 2O8XA 3T0JA 4N91A 5J1DA 1FNNA 3CLOA 4R79A 1HW5A 4BHBA 3AAFA 4CO8A 1W7PD 4FBPA 1NV0A 5JFRA 5IZ3A 4RGUA 2RGVA