3SZPA

Full-length structure of the vibrio cholerae virulence activator, aphb, a member of the lttr protein family
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
290
Chain Sequence
MKLDDLNLFRLVVENGSYTSTSKKTMIPVATITRRIQALEDSLNLRLLNRHARKLTLTEAGERFYKDCSPLLERLASMTEEITDECRGASGRIRISAPSNLTKRMMMPMFNAFMEKYPDIHIELMMSNQADDLDPTEWDVIFRVGPQRDSSLIARKIGEVKDILVASPQYLSSHPQPTHAEELHQHQLLKGYPLLKWQLTNSQGETVVNSDRGRFQASALNVVRSACSEGLGITLMPDVMLREFLEDGSLVQVLSDWSSNPRDIYMLYNHKDHQPEKVRLFIDFVIGYHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of AphB, a virulence gene activator from Vibrio cholerae, reveals residues that influence its response to oxygen and pH.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transcription
molecule keywords Transcriptional regulator, LysR family
total genus 84
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3szpA01
3.40.190.290 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3szpA02
3GXOA 4ENKA 5FLXK 1SMTA 4N9HA 1JGSA 1DDNA 4A5MA 1PP7U 4XLNF 1K6OA 1LEBA 3K2ZA 3DPLC 4M6XA 2AS5F 4FX4A 2WWYA 5DUIA 5HLHA 1FC3A 3ROUA 3WTVC 4Q5SF 2LSOA 1HW2A 2W84A 1MJBA 4RAYA 4CGZA 2DQLA 1O7LA 3WU0A 1OR7A 1WRJA 1BI3A 4S05A 3EDPA 1T0FA 3ZN0A 5ERIA 2XRNA 3G73A 1EH6A 3J80Z 1W5SA 3HHGA 3ZQ7A 3BDDA 5L3EA 4M74A 2CQKA 3CUQC 2CO5A 4HF1A 5H6QA 4H0EA 4M71A 2HKOA 2P6SA 4IF4A 2HOEA 3WTTC 4A5NA 5LHIA 1IXRC 2GIVA 2A69F 2A68F 1XDUA 5DDGA 1XSDA 3F6VA 5LGTA 1D3YA 1PP8F 3KLNA 4XSXF 4G6DA 1ODDA 4LG0B 3CUOA 4A0YA 3HRSA 5A2QZ 1C0WA 3BJAA 3U9GA 1XDSA 2K4JA 2CG4A 2M87A 3WGGA 2L02A 2QYOA 2ESNA 4ZYHA 4CYDA 2XGXA 3V8KA 1ZRFA 2D1HA 2E7WA 4EVIA 3FM3A 3K0LA 1V3FA 4IHSA 4U0WA 1BI0A 2D1VA 3KZZA 4CICA 2RC4A 2XAFA 2J5OA 5L3GA 1ZGAA 1L3LA 4KN4X 1V4RA 1U5TA 2VT2A 3M9AA 1ZG5A 2M30A 4UXNA 4MHGA 2JT1A 1TBXA 4U0YA 1SFXA 3F21A 4EJTA 1XGNA 1REPC 5E20A 2QZ8A 3J81Z 4IXAA 4RB2C 1J9IA 5F1RA 5HOOA 3K1MA 4FHTA 1OYIA 5E17F 1P4XA 3I64A 1DPUA 2P7CB 5CVVA 1WKMA 1PUEE 1YYVA 3IRQA 3I53A 3WODF 1WWXA 5LGUA 1I5ZA 3F8MA 2WTEA 5D5UB 2GA2A 5JR3A 1ZYRF 2MBFA 2Y48A 3W6JB 3JSOA 1JHHA 1U3EM 1MD0A 5LRSA 4UNOA 2FMLA 1VTNC 2FBIA 4LLLA 2PQ8A 4BHPA 1MGTA 3GFLA 5BQTA 3IHUA 2LF7A 2BGCA 2DQRA 5DCMA 3PFIA 2VE9A 2K4BA 1XCVA 3HYIA 3I59B 2OQGA 4CXFA 3OOPA 2P4WA 1IXCA 5IT3A 1IN5A 3ZMDA 4LJZF 3CO7C 1FNNA 1Z91A 3QRFF 4HLXA 2F2EA 2KIFA 2RKHA 4NQWA 3HTUA 1YS6A 1GHCA 3GVAA 5CVUA 2A61A 2OZUA 1BIBA 4MEYF 2L54A 2R7DA 3O6BB 1IAWA 1B9NA 3GW2A 1ZH5A 2XUBA 1KU9A 5AIQA 5CLSA 1Z1DA 3MAJA 4KICA 2BV6A 3I54A 5FB2A 1ULYA 5EEHA 3FF5A 3RJPA 4HX4A 5D6FA 1K78B 2EV0A 1S8NA 2FNAA 2HEOA 4O5VA 3DFGA 3WG9A 4OIQF 1TTYA 2HWVA 2HFHA 4OIRF 4HQEA 2HYGD 2QQAA 1CF7B 5E1WA 2FXAA 4U88A 2XROA 1IN4A 1E2XA 1USTA 1XMKA 5HLGA 2ZNZA 3CJNA 4GYIA 2HGCA 2FA5A 1FYMA 1J5YA 4KA4A 5FGMA 3DKWA 2DFIA 2YX4A 2RNJA 1W7PD 3R6SA 4KMUX 4LB5A 4EQQA 3NEUA 3WE2A 4QLCU 2VT3A 3QPTA 1XD7A 1SD6A 1H9TA 5DD4A 3RIRA 4HA8A 1QQIA 1BI1A 4L5JA 2BE5F 2QWWA 1SFEA 5HLIA 2V1UA 4L0ZB 3J7AO 3RI4A 1P2FA 1ONVA 1FY7A 4Y17A 3RKXA 3TDUC 1IN7A 1QBJA 3WTXC 4ENMA 4ZYGA 1W5TA 2GA1A 2IJLA 3LFKA 3BROA 3DP7A 4BXUA 3CDHA 2P5LC 3GFJA 3K9TA 4ESFA 1FYLA 1GVJA 3MQ0A 4KIGA 1FBQA 4P9UA 3RPUA 4I98B 3HOSA 2BEOA 3F8NA 2NNYA 3FXUA 3H3ZA 2V79A 2PBIA 5TRDA 3ISPA 2QUFA 2Q2EA 3J80K 4WK8F 2H27A 3R61A 4LK1F 1TQIA 1PDNC 3H3UA 1OYWA 1H0MA 4HZFA 1QNTA 1G3TA 4OMZA 5HVQC 3SHFA 1U5TC 4HX8A 4GGGA 1FP2A 2KIUA 2L4AA 1U5TB 4A2UA 2K02A 1O3SA 1LJ9A 2ISYA 5BPDA 1OPCA 2XAJA 1IUYA 1O7FA 1KU3A 1TW3A 1P92A 2HXRA 3EETA 3KLOA 1KGSA 5LHGA 4RB1A 4P5OA 2PI0A 2EV6A 4GYGA 2NS0A 1Y0UA 4WCGA 4HAMA 4QBAA 5K1YA 3HRMA 1ZG3A 3ERED 2G7HA 2P8TA 2GQQA 1XN7A 2E1CA 1FZPB 4KUMA 1B9MA 1TLHB 4R8HA 4AWXB 3DV8A 3R4KA 3LA3A 4YIFA 2Y0MA 1XGSA 1CF7A 3WTZA 4IRHA 2PMUA 2MLKA 2DPDA 2UZKA 4OINF 1W7PA 3V7SA 4JBAA 2MLGA 2OA4A 1XGOA 1K78A 2Q8KA 4L0YB 4IVNA 3CUQA 2RQPA 2A6EF 2CW0F 1KA8A 2AXLA 2V9VA 4MEXF 4BQAA 1R23A 2RDPA 4HF2A 4I02A 1JE8A 3JAMZ 5CJ9A 2M1BA 2V6CA 3FWEA 4FX0A 2PLYA 1WI9A 1ON2A 4RGXA 4Q47A 2OQRA 3F23A 1U2WA 1ZLJA 1HKTA 3M7GA 2FSWA 1FP1D 1UB9A 5L3DA 4EJVA 5CVIA 3GZ5A 5HDKA 3HFUA 3V4GA 2EV5A 3LSTA 2M5WA 4HBLA 3KE2A 4EM1A 2P6TA 2PJPA 2NRAC 1FWZA 1G3SA 1MDMB 3ML6A 1GXPA 5LGNA 3F72A 1KQ9A 1O57A 1B59A 1T98A 3GUDA 3GF2A 3VFZA 4KYWA 5HS7A 2KKOA 3L00A 2EFWA 1XMAA 1Z05A 1TNSA 4MNUA 2PN6A 3P9IA 3H92A 2HZTA 2W85A 1QZYA 5D5VB 3TO6A 3RKWA 4YFXF 2JSCA 2DTRA 4LMYA 1IF1A 4QWQA 4L9NA 4IRIA 2DLLA 5CVJA 2LKPA 1FBUA 1RUOA 2RGVA 2LDUA 4RS8A 5L3CA 2FOKA 1BOAA 3E3VA 4O3MA 2XKOA 3QU6A 3LAJA 1J2XA 3ECHA 3QP6A 2MC3A 2H94A 4EM0B 4EMSA 4JVIA 1SD7A 3IWFA 3MFKA 2PG4A 3SZPA 1KQ0A 2ZKZA 1K7AA 3JW4A 4N9IA 2FE3A 2E1NA 3TOBA 2IA0A 4JVDA 3E6MA 2FBHA 3GFMA 2IW5A 2VODA 2MH2A 3HIFA 3VODA 3KP6A 2PEXA 3HSFA 2Z3YA 3BJ6A 4HDUA 1FOKA 4K2EA 2XHKA 1LVAA 3ABUA 2FNPA 2XVCA 3RTRA 4UV8A 1R7JA 1ZHFA 5ILSA 2M8EA 4PGGA 2ZCWA 3ZN1A 4I2OA 4G9YA 1T38A 5ICCA 1KU7A 4ZYDA 3Q9VA 3MZHA 2P5KA 4HV6A 2VC0A 4M72A 3ABTA 3WU1B 5K5OA 2ZMEB 3BY6A 5TJJA 4BHBA 2H09A 4Q4ZF 4O6JA 3HUGA 1R5HA 5LHHA 2ZJ2A 4KIBA 4CHUA 1FBSA 1W4MA 1W7PB 1FYKA 4PDKA 3L7WA 4RGRA 2ISZA 1NHAA 4L9TA 3V8LA 1UHMA 3GZ6A 3AAFA 5DV5A 5E1XA 1QGPA 4BHCA 4AIHA 3FMQA 5A2QK 1RZ4A 1HKSA 2GWRA 3DF8A 3C3WA 4UVAA 4XLPF 1QZZA 2G7UA 2CGPA 2VN2A 5FD6A 2EWNA 2XAHA 2JPBA 2K27A 3KP3A 1T39A 2HTJA 2STWA 5H6RA 2Z9OA 1SD5A 1P4AA 2NNNA 4OMYA 4IHTA 1EH8A 5ILVA 3GFIA 5BMZA 1HKQA 3BP8A 4KT5C 2ELHA 2RN7A 4IRGA 1YW7A 3U1DA 3E5UA 1YW9A 1BIAA 4G7ZF 3KP2A 2MA3A 1J0RA 4Z2YA 3S2WA 1I6XA 4EJOA 1IXSB 1YLFA 4RB3C 1ZN2A 2WC2A 1MJ9A 3SZTA 4G7HF 1TW2A 1KQ8A 3I5UA 3NRVA 3ZPLA 1IZ1A 3PQKA 2K86A 5HS9A 3KP5A 5HDNA 5D6EA 2HR3A 2VE8A 4NB5A 3COAC 4RAZA 3HTSB 2VBXA 1FSEA 3T8TA 1IN6A 3B73A 3RPQA 2GXBA 3CUQB 2YSRA 2F5EA 3FMRA 4AIJA 3CO6C 3ZMUA 5DD8A 4WXHA 4I7HA 4G6QA 2OU2A 5L3FA 4LFUA 4WWCA 2Z99A 5LEKA 2FRHA 4EJUA 3IKVA 3JTHA 3TDZC 2UXNA 3JAMK 3Q9SA 1F5TA 3EUHA 3IC7A 4GCVA 5E18F 1R5GA 3IL2A 2HYFA 1GXQA 2IA1A 1SFUA 3MEXA 2DU9A 3F6OA 4MQ9F 1Z7UA 1XSXA 4HF0A 4HLYA 3HRUA 5DEQA 2IA2A 2EFOA 5KVRA 1WQ2A 4UUVA 1EH7A 3CTAA 5LLQA 4YG2F 3F3XA 4M6YA 2BBYA 4GXOA 2UXXA 1P4WA 4LD5A 4P55A 4ZH4F 3EYYA 3GWZA 4A0XA 2GZWA 5LBQA 4BAYA 1YG2A 1G3YA 3VB2A 4DNCA 4ETSA 3RYPA 1S3JA 4A12A 5IT9K 3EYIA 1YQAA 3LA2A 1R1UA 4FT8A 5BPIA 2XAQA 5D4RA 1R1VA 2O61A 4Q48A 4WF2A 1LEAA 5DCMB 4F7ZA 5J8CA 5LEJA 3BOQA 3ZMSA 2VBZA 1UHWA 4JQFA 1OMIA 2FQ3A 5FD5A 4YIIA 5D5XB 3HSEA 4UVBA 4L5IA 5FFZA 1LNWA 3T5XA 1ZARA 2QQ9A 4KN7X 1HSTA 2ZFWA 2VBWA 4ASNA 1U6GA 4BH9A 1TQMA 4WXCA 3REOA 1ZRDA 2P5VA 4S04A 3ZMTA 1BM9A 5DUKA 1KU2A 2H6BA 1FLIA 4BYYA 2ZO4A 2CYYA 1I27A 1A04A 1ZGJA 2QBYA 4U7DA 1YFHA 3DXJF 3KFWX 1CGPA 3D5LA 1FX7A 2RVCA 3R60A 2DT5A 1SAXA 6PAXA 2J5PA 3IRRA 3TO7A 1MZBA 1TQPA 2VOOA 5D5WB 2KJCA 2Z5UA 5CVRA 5D8LB 3D0SA 2A3SA 2FMYA 4M9SA 3DPTA 1SMYF 2WV0A 4LLNA 4XRFA 1YIOA 2PFBA 2OZ6A 4HQMA 1RUNA 2XASA 1IRFA 1D5VA 2GAUA 4L9VA 1HW5A 5IT9Z 3QAHA 1R1TA 4OU0A 1I1SA 3WTWC 2Z33A 1ON1A 1HBXG 2XKPA 3FXRA 3ULQB 3FX3A 1KYWA 1YS7A 1P6RA 2X0LA 4UV9A 4ESJA 5BS6A 1LB2A 2L01A 1BC7C 2FU4A 3U2RA 2EK5A 5BOXA 2VBYA 2A6HF 3F22A 2ACJA 5F6FA 5ED4A 2DBBA 4KDPA 1FT9A 2IRFG 3R0AA 5HS8A 3CLOA 4EM2A 1B4AA 4CDGA 3Q5FA 4WX9A 3P7NA 4ENJA 2CSOA 2KIMA 3JTGA 4AVPA 2EFPA 4RGSA 2X4HA 2RV8A 2EB7A 5EEGA 2D2WA 3ZMVA 1RNLA 3NQOA 4OOIA 3LQQA 5J6XA 2ZBKA 2JZYA 5D4SA 1Q1HA 5E1ZB 3E97A 4LB6B 1J59A 2O6GE 4EJWA 4EGYA 3RKYA 2EFQA 1LQ1A 1BJAA 3V7CA 1F9NA 2DK5A 1USSA 4A6DA 2ETHA 4OIPF 1LDJA 3C7JA 4TV7A 2W25A 1T2KA 1UCRA 4EV0A 1AWCA 3OV8A 1HSJA 4E70A 4U7BA 2HDCA 3BWGA 1IRGA 3I71A 4KIFA 3LWFA 3HOTA 3O3KA 2HKXA 2VOPA 3ZMZA 2G9WA 2NAZA 4HX7A 1ZG1A 2FEZA 5ICEA 3P9CA 3TKYA 5CYVA 2L4MA 3E5QA 1BC8C 2QENA 1G3WA 2QQBA 3T8RA 2JRTA 2FBKA 1O3TA 4YFNF 2YX7A 4ENNA 4M9XA 2JPCA 1IN8A 3PQJA 2OBPA 4XSZF 3DEUA 1R22A 1RI7A 4CO8A 2Q0OA 4HDVA 1ZRCA 2IP2A 1S29A 4MQVA 1MDMA 3VOEA 2EA4A 1ZAOA 4I0AA 1B6AA 4P9FA 3R0JA 1EV7A 2M45A 4LGWA 4G8XA 2LNBA 3C18A 3I0TA 3TQNA 2JTVA 4UHTA 3WGIA 3TGNA 1TNTA 1QO0D 2OD5A 1R36A 1IW7F 2CFXA 2F5CA 2GXGA 3KCCA 2EJRA 4PZJA 3ELKA 5FFXA 5JHUA 4HYEA 3BJOA 2V1XA 1BBYA 1DUXC 3E6BA 3KP4A 4LG0A 3LQRA 4JK1X 2W57A 2IT0A 3IKTA 3TOAA 4AD9A 2DI3A 2F5DA 2XIGA 2HQNA 2ZNYA 1UFMA 3KEQA 3MZYA 2ADUA 4MTEA 4AIKA 1DP7P 1Z6RA 5ICFA 1OYYA 2P7VB 1STZA 2QLZA 3VEPA 4EGZA 2IPQX 2YPRA 2O8XA 2STTA 4WXDA 2ZXJA 4HW0A 1O3QA 4MTDA 4L9JA 4RGUA 1XCBA 2ESHA 1LDKB 3BZ6A 1K79A 1S7OA 5FO5A 1X3UA 3N4MA 3I58A 3G3ZA 4ON0A 3GO5A 4Y15A 5H20A 2QVOA 3QP5A 3SQNA 3T0YA 2E7XA 3MWMA 2TDXA 2ZMEA 3GEZA 3QOPA 2CWEA 5JFRA 3C1DA 1R00A 3SFZA 3GX4X 2YR2A 5L3BA 4RB0A 1QPMA 4IJAA 4ZZLA 1U8RA 4M9ZA 5DYMA 1G6NA 3WTUC 4I09A 3M1EA 2QM3A 5K5RA 1DPRA 1R58A 3FM5A 2DW4A 2R7FA 2COMA 4I0BA 4DQ2A 4LLGF 1S6LA 2DK8A 4ZZDA 3FMSA 1XSVA 4B8XA 5J8FA 3IWZA 4YFKF 5E8GA 3WTSC 2R3SA 2L3DA 3P9KA 3E5XA 2O03A 1H9GA 4CZZA 3FHZA 3K69A 3E6DA 3RYRA 2HS5A 3SXYA 5E8IA 3M8EA 1OKRA 3L9FA 2MH9A 3J81K 1O3RA 3DQVC 2NYXA 1HQCA 4PGHA 3F8CA 2C6YA 3WGHA 3WTYC 3F8FA 2BYVE 1ZREA 3F8BA 3KZYA 4PCQA 4ESBA 4KFCA 4ZYEA 3BPXA 4JVCA 2B0LA 3N97A 3EQLF 1WSUA 3K1NA 2A07F 1F1ZA 1I1GA 1JHFA 4R1HA 3L2CA 5ILUA 2KRFA 3L09A 1T6SA 2VC1A 4KMFA 3RDIA 1BN5A 4Y13A 1MKMA 4GO1A 1FPQA 4G7OF 5FLXZ 2MD5A 4N0BA 1D8KA 3HHHA 4R79A 1YO5C 4HOBA 2LF8A 3E6CC 1YW8A 1YTYA 3JSPA 3LAPA 4A6EA 3GYHX 4MGRA 3K1PA 2DPUA 2F5FA 3V7RA 2FF4A 2PMHA 2QBYB 1Z9CA 4OIOF 3ZP5A 4XBFA 2V1DA 3ECOA 5JI6A 1SD4A 2KJBA 3KETA 3B02A 1F4KA 3KEOA 1FSHA 2YU3A 3KP7A 4U0VA 3W6KB 4BNCA 3V8JA 2O0YA 1BI2A 2EFNA 4P96A 4HV5A 4IPAA 3FXQA 3BPVA 5K5QA 5KK1A 2HTSA 4G94A 1HW1A 1RIOH 5ICGA 1HXDA 3O2PE 1KYZA 1B1BA 1S7AA 2H6CA 1AOYA 1XB4A 3M8FA 4M73A 4D0PA 2VONA 2EA2A 3TO9A 4B09A 2O3FA 2XAGA 5AIPA 4KNYA 3I59A 5DCFA 3WE3A 2DO7A 2W24A 1MJAA 5D8KB 1E17A 1XGMA 3LA7A 1U78A 3HSRA 2DAOA 4I01A 5JVTA 4LK0F 2OAZA 3FZVA 2VXZA 2A5YB 3HRTA 2UWMA 2K7LA 1L0OC 1Z6TA 4NHJA 3QPHA 5AONA 1G4DA 4UVCA 5F64A 2HQRA 5LRRA 4A0ZA 1J75A 1J7KA 3MCZA 2XV4S 2D45A 3GLXA 1JXSA 2IVMA 1ZLKA 2Y75A 3T1BA 3I4PA 5HDGA 4L18B 1LDDA 3QU3A 1D8JA
chains in the Genus database with same CATH superfamily
3GXOA 4ENKA 5FLXK 4A3FJ 1AKHA 4GL0A 1JT6A 2ZJQF 1SMTA 2O69A 4F55A 1MPBA 2V3TA 4N9HA 3CFZA 1JGSA 4N8GA 5HNFA 4A5MA 1JKRC 1DDNA 1PP7U 4XLNF 3GBGA 1PB7A 5B7DA 1K6OA 1LEBA 1Q9DA 1Z7ME 1JQFA 3K2ZA 2XDVA 1TWYA 3DBRB 3ODBA 2DVZA 3G1OA 4KQPA 3K4JA 3DPLC 3KYCB 1B46A 5LTCA 4M6XA 1XC5A 3JRFA 2E2JJ 2AS5F 2R7SA 2NXOA 4IO3A 3RGYA 1UELB 2UVJA 3A29A 4HE1A 3B6CA 4FX4A 4A3CJ 1IDYA 3OS2A 2WWYA 4OXVA 5DUIA 3U65A 5KDTA 3Q3SA 5HLHA 3EHSA 4OWRB 1FC3A 3ROUA 3DLAA 1GR2A 3WTVC 1QUIA 3PPQA 4BQNA 2KQZA 4Q5SF 4GLIA 2LSOA 1FQEA 4KYSA 4N81A 2RCBA 1HW2A 3BG9A 2W84A 3PUZE 4ZEIA 3HOUJ 4GFBA 3BZCA 4H5GA 4ESXA 2E0SA 1MJBA 4C9YA 1FQBA 3V5AA 3RQIA 4RAYA 3ZS6A 3T66A 4FORA 1M5BA 4CGZA 1A40A 2AYSA 1ETKA 3ABLH 2DQLA 1B1XA 5AA4B 2XSJC 1UHSA 1O7LA 3WU0A 2UXAA 1PVEA 4FE7A 1OR7A 1WRJA 3W9VA 1BI3A 2L5VA 4S05A 1TWGJ 1Q1KA 3EDPA 1HSEA 1DCUA 1T0FA 3ZN0A 2FOWA 5ISUA 4XQFA 5ERIA 4P56A 2XRNA 3HN0A 4R75A 3KYDB 3ABMH 4D7NA 3G73A 1E3HA 2IEEA 2XWIA 4JWOA 4NF6A 1EH6A 3J80Z 1S9TA 5M3FJ 1W5SA 3HHGA 5FKOA 1GTKA 3RT6B 4BQOA 4M3DA 1Y8QB 3IFCA 2PJRA 3ZQ7A 2R7ZJ 1SW2A 3BDDA 3BG3A 2VXDA 5L3EA 1VQ4I 4M74A 2CQKA 2K3FA 4A3GJ 2V3QA 3CUQC 2Z8EA 3ESWB 4X8RA 2CO5A 3UK4A 1POTA 2EILH 1W36C 4JX4A 1VQLI 4HF1A 1SQYA 1OLCA 2Y9ZA 4P1EA 1SI1A 1MBKA 1H88C 5H6QA 1I6BA 4H0EA 3CF2A 5FTHA 3S3MA 4M71A 2HKOA 4XOTA 3IFAA 4HTGA 4NQWB 5K7ZA 2P6SA 1Y8RB 4PSXA 3KSXA 1B0LA 4WXJA 4IF4A 2PCRA 1PDAA 2HOEA 2A5TA 1WVRA 2LVSA 3WTTC 5IOYA 4A5NA 4BXFA 1IXRC 2GIVA 5LHIA 2DP8A 2A69F 2A68F 2K3PA 2OX3A 1XDUA 5DDGA 2JA5J 1XSDA 4DGWB 5ITOA 1MQGA 3ILUB 4GDFA 3F6VA 5LGTA 2VPOA 4WEDA 3OYNA 1D3YA 2IAIA 1PP8F 2CRGA 3KLNA 1FIPA 4XSXF 3A4CA 1SC7A 3KJTA 4G6DA 1ATGA 2F48A 1D1BA 2AL5A 1ODDA 2XGCA 2QMWA 4LZ8A 5C4XJ 4BY7J 4LG0B 3CUOA 5HPQA 4XRMA 1WH5A 3DKYA 4DYCA 2PMSA 4A0YA 2K9NA 4IO2A 1LPQA 3HRSA 4M6VA 5A2QZ 3K00A 2DFHA 5F0FA 1X1DA 2V1NA 3BJAA 3K4CA 2AXTC 1C0WA 1Y4CA 2ONKE 1ENHA 4OEUA 2W1OA 3U9GA 4PF6A 1VQMI 1OCOH 1XDSA 3MVWA 2K4JA 2CG4A 3D5SC 2M87A 3FVNA 1A6QA 4GX4A 2NOOA 3WGGA 2L02A 4F31B 2QYOA 2ESNA 4ZYHA 1UTBB 4CYDA 3OYIA 5F7VA 2XGXA 3V8KA 1ZRFA 2D1HA 1A55A 2E7WA 4EVIA 3DP6A 4N91A 3IL1B 2P1SA 5HLTA 3G2BA 2YLNA 5H8NA 4J01A 3BR3A 4BDQA 1FOWA 4XKWA 2Y5LA 5BUUA 3FM3A 3K0LA 3OMYA 2BY1A 1V3FA 2XB5A 2OTLI 4IHSA 1Z3XA 2JUGA 1MQHA 3CFLA 2ZZWA 3MQ9A 3FXMA 1BI0A 4U0WA 2D1VA 3KZZA 4D1QA 2E1MC 4CICA 2XAFA 2RC4A 2J5OA 5L3GA 2DDAA 1ZGAA 4XLCA 3MN2A 2DA1A 1JTXA 3C2HA 3FVGA 3IJXB 4R74A 2H9BA 1L3LA 4KN4X 3A01A 1V4RA 4CCLA 1U5TA 2VT2A 4I9DA 4XTCQ 3M9AA 3L2WA 2XWOA 4CZCA 1ZG5A 3MC2A 2M30A 4UXNA 4MHGA 2JT1A 1TBXA 4U0YA 1SFXA 3C2GA 3F21A 4EJTA 3ONMA 3VLVA 5IYCJ 1FBCA 2PFZA 4MMPA 4O7MA 4XEQA 4YKJA 5KDTB 1XGNA 2XF6A 3LSPA 1REPC 2B9SA 3HJEA 5E20A 1SANA 2OCEA 2QZ8A 3B6TA 4NF8B 1D0XA 4UUSA 1US5A 3K4MA 3J81Z 4IXAA 4H65A 2XXWA 5CI5A 1ORKA 2DOAA 4XKCA 4RB2C 3PIPF 1R71A 1J9IA 1IQ7A 4PJNA 5F1RA 1NNTA 2Y2ZA 5HOOA 3K1MA 4FHTA 2CMOA 1OYIA 1RKTA 3HOWJ 5E17F 2MFZA 1D9QA 1P4XA 2WYPA 4GWSA 1FJ9A 3I64A 4QFPA 1DPUA 2XXTA 2P7CB 5CVVA 3JRBA 1DK4A 4MHFA 2X26A 1WKMA 1PUEE 3VLUA 3OSRA 3QQAA 2THIA 4R72A 4BDNA 1YYVA 3IRQA 1VQKI 3I53A 1FTOA 2UYFA 3O2AA 5ET5A 4CH7A 5F0HA 3WODF 3C31A 1WWXA 5LGUA 1I5ZA 3F8MA 3LSLA 1ELJA 5AA2D 5DVJA 1VDWA 5FKNA 2WTEA 3ZQCA 1F9BA 1JUSA 5D5UB 4OQOA 3SDFA 1Y39A 1NG6A 2I3WA 1Y3QA 1IMFA 3D1RA 2VPNA 2GA2A 1GV5A 1R9LA 5L8DA 2DXRA 5JR3A 4M1VA 2HCAA 1ZYRF 2DXIA 1LGBC 2FUG2 2MBFA 3K7AJ 3FASA 2CZIA 2Y48A 3CI8A 2COBA 3GTKJ 3W6JB 2I4BA 3K6XA 3UIFA 4HNTA 3KZGA 3JSOA 1DOTA 4XLEA 2VOZA 2LOOA 1R1NA 5F08A 1JHHA 5CPRB 2DT7B 1YI2I 3HCQA 3PMWA 2A5WA 1U3EM 1MD0A 5LRSA 4PETA 3PUBA 2AIXA 1YZ0A 4P0GA 2IBDA 3CDLA 4BU2A 1IMAA 4UNOA 5DYHA 1FBDA 4Q5TA 2FMLA 4C0RA 5M3MJ 2VQGA 1VTNC 2FBIA 4LLLA 2OUMA 2PQ8A 2QQ8A 4BHPA 5LD2C 4PFYA 4OFLA 4RK2A 1MGTA 3CMEI 3HPGA 4JDFA 4MFDA 2DYSH 3GFLA 5BQTA 4EQ7A 3U94A 3PMVA 3KG2A 2CQNA 3IHUA 3A03A 1RKWA 2LF7A 2BGCA 3O9PA 3K4LA 2BY0A 2DQRA 4PFTA 3PSFA 5DCMA 3J7ZI 4H4KC 1Z0XA 2ONRA 4HNUA 5JTYA 3PFIA 1MM7A 3W2AA 3J7AY 2VE9A 2K4BA 4FEBA 4BE1A 4G6TB 1XCVA 3KGCA 1LFIA 3HYIA 3I59B 2L7MP 1SPIA 4FJPA 2OQGA 4CXFA 3OOPA 1IRXA 2XXVA 2EZHA 1VF9A 4JBZA 5EZHA 3MZBA 3CCRI 4YICA 2KHMA 1ETVA 2P4WA 2FHYA 2IGMA 1IXCA 5IT3A 1IN5A 3ZMDA 1MRPA 4LJZF 1VI0A 1JKPC 1FNNA 3CO7C 3FV2A 3OYDA 1Z91A 4R6HA 3N05A 2V25A 4AIDA 3QRFF 1FTLA 3H5AA 2ME6A 4HLXA 2F2EA 2HZDA 4H1XA 2KIFA 3UNGC 2RKHA 4ZYAA 4XMYA 1JW1A 2E1OA 4XLAA 3TTNA 3IAM2 2VJ4A 4NQWA 4GQOA 1ETOA 5GPCA 3HTUA 1YS6A 2OWTA 1GHCA 3GVAA 5CVUA 2A61A 3PFYA 2OZUA 1BIBA 4MEYF 2FBPA 2XX9A 2DMNA 4H8IA 2L54A 2H1LA 2R7DA 4O8MA 3MD2A 2GHBA 1TZLA 3O6BB 3CMMA 1IAWA 4ZEKA 1B9NA 3GW2A 3PSIA 3L6GA 5KCJB 4E7ZA 1ZH5A 2XUBA 5ICTA 1KU9A 4RA2A 2EQRA 2DFEA 5AIQA 5CLSA 4QIWN 1UAAA 1W1WE 3OL3A 4XRSA 2QS1A 1Z1DA 3MAJA 2QJEA 2AL4A 4WEPA 2R5ZA 4KICA 5H2FC 4BEHB 2BV6A 2Z23A 1HDPA 4EUOA 3I54A 4HNVA 5FB2A 3EUHC 3DELB 4C30A 1LBBA 1ULYA 5EEHA 1FPDA 3FXJA 1HA8A 2M4GA 1GLNA 3O28A 2HXOA 2ZJRF 2M34A 3FF5A 3RJPA 4HX4A 5D6FA 3VYTB 1K78B 4NF4A 4PE3A 2EINH 1OVTA 2HXWA 2EV0A 1S8NA 2FNAA 2HEOA 1XG1A 2DMPA 3K4KA 4I62A 4PC9A 4TLMB 2YS9A 3ZQLA 1U9OA 3H36A 3H6TA 4O5VA 1F36A 2GHAA 3DFGA 3WG9A 4OIQF 1A54A 2VL8A 4RAFA 1TTYA 2HWVA 4PAKA 1URSA 4YKIA 5DEXA 2HFHA 5H8NB 4OIRF 1NNPA 4H67A 2P81A 4F92B 4HQEA 4RPOA 2HYGD 2JJ7A 2R7QA 4PSWA 1FPBA 2V4CA 1QRYA 2HI3A 3NAUA 3GBBA 4I40A 4IGRA 4LQ2A 4F3SA 3KSJA 3MVPA 2QQAA 1B72B 1QGXA 1CF7B 1UTHA 4N4OB 3S93A 5E1WA 4G2ZA 3TELA 2FXAA 4U88A 4LZ5A 4FQGA 2XROA 3Q28A 3T9HB 1IN4A 3DM0A 1E2XA 1USTA 2GIZA 2H8WA 1T0FC 1D9VA 3FXKA 1XMKA 4G77A 2DOJA 5HLGA 2ZNZA 3CJNA 4AU7A 3DTIA 4GYIA 2HGCA 4S0HB 2I0CA 3MZ1A 2Y31A 2FA5A 2WAFA 1FYMA 3PPOA 4QFOA 4A3LJ 3LOCA 1J5YA 2NUVA 3IB0A 5CMKA 3FVOA 4KA4A 2XWVA 1FSAA 5FGMA 3DKWA 1RKMA 2A6TA 3IK6B 3RTWB 1PJRA 2DFIA 2YX4A 3VWBA 3S1QJ 3QOEA 1EYJA 2RNJA 3G3IA 4XRSG 2ZMBA 1W7PD 2CW7A 3R6SA 1LEVA 4KMUX 4LB5A 4H8JA 2JMWA 1ZR2A 3TFLA 4EQQA 3NEUA 3A09A 5AA4A 2JSPA 3WE2A 4QLCU 1B8IA 2VT3A 4F1VA 3QPTA 2PBWA 1XD7A 2DA3A 2NS7A 1SD6A 1OCPA 1LAXA 1PBQA 3J7YJ 1H9TA 5DD4A 3S1NJ 3RIRA 4HA8A 4A3DJ 1QQIA 1I6AA 4I1DA 2L9VA 2OWZA 1BA5A 1BI1A 3UN6A 5I57A 2UVIA 4X1BA 1P1UA 1GVDA 4L5JA 4XKVA 2BE5F 3N26A 4KJZA 3MKLA 4IO4A 4NX1A 3FK7A 2QWWA 1SFEA 4IOCF 2B4LA 3M8UA 4GWOA 5HLIA 1DPEA 3PNVA 2V1UA 3K70C 4L0ZB 3J7AO 4OESA 3RI4A 2K9MA 1NKXA 1P2FA 1ONVA 1FY7A 2LY2A 4B44A 2IS1A 1S9HA 4RM2A 4Y17A 3RKXA 1A31A 2XPWA 2WX9A 1MQJA 1MG1A 3EHTA 1D1CA 2F7CA 4ZEBA 2VIXA 4RA1A 3TDUC 2V6EA 2Z1DA 1IN7A 1NV4A 2HEUA 1QW0A 3ILTB 2WKYA 1QBJA 3SEXA 3IO4A 4XKRA 3WTXC 4H5FA 4ENMA 2LY9A 1UZCA 4ZYGA 3G3KA 1YJWI 1W5TA 2GA1A 2IJLA 3LFKA 2M2EA 3BROA 4BBSJ 1K9YA 1MY2A 2X1CA 2DE2A 2F35A 4FAJA 2CQ7A 3G6EI 3WHCA 3H06B 5E3LA 3N94A 2ELKA 3UR3C 4BDOA 1K4TA 2HAUA 3DP7A 1Z67A 2R5ZB 2F6PA 4FISA 3SYTA 4BXUA 3GLBA 1FPLA 2L9SA 2KDZA 3CDHA 3KPHA 2HVRA 2P5LC 5EQ7A 1OCTC 3GFJA 3CC2I 1MY1A 3K9TA 4ESFA 1FYLA 2CUEA 1GVJA 2RNGA 2JJKA 1D1AA 3MQ0A 2PT2A 4KIGA 2JN6A 3PIOF 4H45A 3BG6A 4D7MA 1NMUA 3M3FA 4DI3D 2PX9A 3CD6I 2VKEA 5KNLA 1FBQA 2QCOA 4BACA 4N13A 4P9UA 1VQ9I 3B6AA 5CC2A 2L7KA 3RPUA 4I98B 4C2MJ 1XI6A 3ZQFA 3HOSA 4XIDA 1SYIA 1Y3NA 2Y0SN 2HAVA 3G1MA 4YAHX 2BEOA 3F8NA 2IGNA 3FXUA 4MIMA 2NNYA 5KAIC 2P3VA 3H3ZA 2V79A 2PBIA 4B1RA 1P7IA 4DXCA 5TRDA 1LCTA 3ISPA 2QUFA 1B5HA 3Q29A 4QRZA 2L2OA 3O8GA 2Q2EA 3DU6A 3J80K 4WK8F 1QULA 2DVCA 5DVFA 3EUKL 2H27A 4B43A 1R49A 1B72A 3R61A 3VVFA 1MS7A 4QSDA 1OVBA 5TP9A 5E79C 4LK1F 4DXUA 3RZOJ 2LP0A 1KA1A 1UG0A 1TQIA 4DZJA 1AA7A 1PDNC 2RC7A 2E60A 2XXXA 3H3UA 3Q0WA 2XHDA 5T3JA 2NOGA 1JGGA 2ZSHB 4IO5A 1OYWA 1H0MA 3VXBA 4HZFA 5F1JA 1QNTA 3LV0A 3H35A 1G3TA 1Y3PA 2XX8A 4OMZA 4V2FA 2Z22A 3DCFA 4N6KA 5HVQC 2Q74A 3SHFA 1ZBMA 1FTZA 1TFAA 4L17A 3H3VK 2UVGA 3OEKA 3OY9A 1B5JA 1U5TC 4HX8A 1SVMA 4GGGA 4MCOA 3H9JA 1FP2A 4POXA 4E4HA 5L9SA 4NAPA 2KIUA 2RAEA 2L4AA 1U5TB 2X85A 4A2UA 2K02A 1O3SA 3ZSFA 1LJ9A 4BDRA 2ISYA 3V83A 5BPDA 3E0JB 1LFHA 1OPCA 3MW0A 4DCYA 5HODA 2XAJA 4UUTA 4DBQA 4E6KG 1FBFA 2VPRA 1LBCA 4PDDA 3TEPA 1IUYA 3MVYA 2LBFB 1ZR4A 1O7FA 2O7IA 4UACA 4AQ4A 1KU3A 1TW3A 3VDXA 4BDYA 3ZRGA 5FHMA 4FE4A 1P92A 1FCKA 2HXRA 3EETA 2PVUA 3HEFA 3KLOA 1KGSA 5LHGA 4RB1A 3OYFA 4P5OA 1YRNB 2PI0A 3KOSA 2EV6A 1LE8A 3VDFA 4HXVA 4QPQA 4GYGA 2NS0A 4XXUA 2R7VA 1ZKBA 1Y0UA 3LL7A 4WCGA 1OIBA 1K4SA 4HAMA 3CCQI 4V2GA 4QBAA 5K1YA 3R26A 1EKEA 3HRMA 1ZG3A 4GWXA 3ERED 1Y1MA 3UKGA 2G7HA 2P8TA 2GQQA 1XN7A 2K40A 3GTOJ 3FUZA 3QWLA 2E1CA 1ITYA 5I57B 3PV0E 1Y4TA 2JA7J 3HOYJ 1FZPB 4KUMA 3OIPA 1B9MA 2OF7A 1TLHB 3FJGA 2VASA 4IB2A 3SESA 3KEIA 2IS6A 3IV5A 4R8HA 1VQ7I 2F78A 3SEQA 4AWXB 3BFUA 1V5GA 2LRDA 3DV8A 5J4VA 2UVHA 5EHMA 3R4KA 5ET7A 2RKMA 1IUFA 4EXKA 3LA3A 1DGRM 2KFDA 2KT0A 2E1MB 4YIFA 2Y0MA 1XGSA 3JV9A 4XLHA 2QL3A 3HC7A 3HG9A 3BR0A 1CF7A 4LN5A 1WODA 3WTZA 1T0KA 2XF7A 1GV2A 5L9OA 2IS4A 2JVGA 4RPNA 5IYDJ 4IRHA 2CU7A 2PMUA 1IXIA 3TP3A 1S5LC 2HDDA 2MLKA 1JVYA 2AQEA 1Y0NA 4QSEA 4EF1A 3S9NC 4PDHA 2DPDA 2UZKA 5FROA 4OINF 1W7PA 4X04A 1IJWC 3MKZA 3V7SA 3ONQA 2KDOA 4G4PA 5K2XA 1BP5A 4JBAA 2MLGA 3PL8A 1SBPA 1R5ID 2OA4A 1XGOA 1MNMC 1K78A 2Q8KA 2VJJA 3JRDA 4L0YB 1K6YA 4IVNA 2EIMH 2VKVA 3CUQA 1ZLQA 2RQPA 1W5CC 2A6EF 3B8BA 3B6QA 3QIMA 4YZZA 2GOMA 2CW0F 2EH3A 1KA8A 3BIGA 4GL8A 3USDA 3VYRB 5LFAA 2AXLA 2V9VA 4MEXF 2TCTA 4LOCA 2O6AA 1B8IB 3DKXA 3TMOA 3O6IA 4BQAA 4U87A 1R23A 2RDPA 3FIRA 4HF2A 1TL8A 2BW3B 4I02A 4U1OA 1JE8A 3JAMZ 3UP9A 1G2HA 1NFTA 3BLYA 1ZMGA 3G3HA 3S9EA 5CJ9A 3ZQQA 1MXUA 3CZ6A 2M1BA 2W48A 2BVMA 4NC8A 3JRCA 3Q27A 5IYBJ 2XXHA 2V6CA 3FWEA 1USYH 2OJTA 4FX0A 1A99A 2PLYA 3KFMA 3OMBA 2R71A 1WI9A 1B4ZA 1ZK8A 1VQOI 3G3FA 3KOTA 1ON2A 2PYYA 4ABZA 2DA6A 4RGXA 5FRMA 4Q47A 3C9HA 2OQRA 3FJ7A 3CP8A 3RPUD 3OSFA 3F23A 3H7MA 4NN3A 1U2WA 1NI9A 4ZEDA 5B3SH 1JNFA 3C32A 1ZLJA 1HKTA 1N3XA 5CM6A 1JEVA 3MVZA 3M7GA 2FSWA 5ICQA 1GUUA 1FP1D 3CCUI 3QUFA 1UB9A 5L3DA 1DSNA 5F24A 1X3WB 4EJVA 3VLWA 3OL4A 3TUSA 4X1EA 5CVIA 4DE8A 3GZ5A 5HDKA 1WI3A 2CV2A 3HFUA 4F2QA 3V4GA 3E9XA 2EV5A 4A3BJ 1VQPI 1FW0A 3LSTA 1DP3A 4Z0IA 2LD5A 2I58A 5KHDA 2M5WA 4DZ1A 4E0XA 4HBLA 1H44A 3KE2A 4GF8A 3TTKA 3AG1H 4EM1A 1BK4A 3LSKA 2P6TA 3K6VA 2M3AA 4LQ5A 2PJPA 4Z7EA 4AYBA 3PD9A 1A7LA 2NRAC 2CFOA 1TT5B 1FWZA 1G3SA 1N84A 1UTBA 1TT0A 3V89B 1MDMB 3ML6A 1GXPA 3KJ7A 5GADJ 5LGNA 5GPAA 3F72A 2JA6J 1KQ9A 2Y84A 3TAJA 3O6HA 1O57A 5H8FB 3CP2A 1B59A 3JRHA 3C35A 1T98A 3GUDA 5IZ1A 3GF2A 3VFZA 4KYWA 2VPLA 2R6GE 4F3GA 5HS7A 2K9QA 4THIA 2KKOA 2ANJA 3L00A 4BXXJ 4YB7A 1MQDA 2AO9A 4XN0A 1XMAA 2EFWA 1DTZA 1Z05A 4YB6A 1RDXA 1JUMA 1TNSA 2QMXA 4OA4A 2Q2EB 1W0TA 2R9JA 4R9FA 4NF4B 4NHBA 3R7XA 4CCNA 1YTVA 3LSRA 2NOJB 1MY4A 4DIQA 2REGA 3K02A 1OISA 4MNUA 3RPWA 3OOUA 4PFWA 2PN6A 3P9IA 2F7AA 3KN7A 1YRNA 3H92A 4U4XA 2HZTA 2W85A 3S1RJ 1QZYA 5D5VB 1B9JA 2Q9TA 2QVUA 2OV7A 1KZHA 2Y9YA 5DEXB 3A0BC 4D5CA 2E36A 2ZNUA 3QK6A 2IXSA 1F43A 3S8PA 3TO6A 3RKWA 4YFXF 4LZ7A 2JSCA 3LSHA 2DTRA 4ANJA 1R6ZA 1H43A 4LMYA 1G8XA 1AMFA 3LSIA 2R7RA 4QWQA 4L9NA 1IF1A 1YE9A 1X3ZB 1X4PA 4IRIA 3OSQA 2DLLA 3OWTA 3RYDA 1MH4A 5CVJA 1EZOA 4N4NB 3D4CA 3BR6A 4G68B 4NBQA 2LKPA 3LNQA 1FBUA 1RUOA 2HZKA 4FEDA 2DDBA 3KEYA 4J19A 2RGVA 2MABA 4ZDLA 3Q26A 1H45A 5H8QB 1B3GA 2I10A 1B3LA 2LDUA 4RLQA 1FTMA 2O1LA 4RS8A 5J16A 1B4HA 5L3CA 2ECCA 1Y20A 2FOKA 3IJOB 1BOAA 3E3VA 4O3MA 2XKOA 5JLWA 3PUVE 4DI4B 1MIJA 3QU6A 3LAJA 4PFPA 2FIEA 1J2XA 3ECHA 1LUJB 2REJA 3N6UA 3QP6A 2DSFA 3MUQA 2MC3A 1FBEA 2H94A 2DJNA 4EM0B 4EMSA 3IH2A 1BL0A 3U21A 4JVIA 2GH9A 3SEWA 1SD7A 3IWFA 3PGFA 3I3LA 2E19A 1I6HJ 4MNIA 2Y0SA 3ABKH 3FDYA 4IQ4A 4F91B 3MFKA 1ZGWA 5FRNA 4O3CA 4PQJA 2PG4A 3SZPA 3ZQHA 4I8CA 1KQ0A 2ZKZA 2IS2A 2GFEA 1E3PA 2O9LA 1K7AA 3JW4A 4ESWA 2MG4A 4F1YA 5A5LA 2OPTA 1WJCA 4N9IA 4TOZA 2FE3A 2E1NA 3TOBA 2IA0A 2R92J 4M4GA 2BXZA 4KFQA 4JYKA 1L5TA 3TMGA 4JVDA 3E6MA 2KP6A 4W97A 4XFEA 2FBHA 3QODA 4I6ZA 1R4MB 3GFMA 3S3NA 2IW5A 3OYKA 2VLAA 3CJQB 2VODA 3AXFA 2MH2A 3HIFA 2LG4A 3VODA 2BJJX 2X6XA 2A05A 3DTKA 4YB5A 3KP6A 3IO6A 2PEXA 3HSFA 4CCMA 2Z3YA 4IOAF 4P47A 1IGNA 3OO7A 3TTMA 3BJ6A 5IAIA 2DA5A 2CQQA 4HDUA 1NH3A 1FOKA 4U4SA 2KIQA 4K2EA 3MPLA 2XHKA 3CJRB 4NF5A 1LVAA 1P1WA 5ESYA 1MXWA 2Z2SB 2FNPA 3ABUA 1NH7A 5TU0A 2XVCA 4G8HA 1LBWA 2JK3A 3RTRA 4UV8A 1R7JA 1ZHFA 2ZYKA 4QXDA 5ILSA 2M8EA 4PGGA 2ZCWA 3ZN1A 4I2OA 3O6GA 4G9YA 3OYMA 2ZYOA 3PNYA 1SVOA 1T38A 5ICCA 1KU7A 2IA4A 4ZYDA 2VP1A 4D9JA 4TLLB 4ZE9A 3F0CA 2HPMA 3Q9VA 3KZIC 2WADA 3MZHA 2P5KA 4QSHA 4HV6A 2VC0A 4M72A 1JJ8C 1NV7A 2Q89A 4OANA 5FKMA 4AUXA 3ABTA 2F34A 3WU1B 5K5OA 4E7HA 3HGGA 2ZMEB 3BY6A 3FBPA 4KYDA 5TJJA 3IR1A 4BHBA 2H09A 5J1YA 1ZQ3P 4Q4ZF 4O6JA 3W15C 3HUGA 1MSEC 1IC8A 3M3YJ 4GOTA 1R5HA 4MFEA 3C4MA 4BGDA 5LHHA 2ZJ2A 4KIBA 4MLOA 1ZJLA 1USYE 4IY5A 3FIWA 1NG7A 4CHUA 3H6UA 1FBSA 3BT9A 1WJEA 4GX6A 1W4MA 4KYEA 1H76A 2O51A 2P0SA 3CIJA 1W7PB 1D9YA 3EKIA 3LSWA 3DBLB 4IO7A 1FYKA 4PDKA 2ECBA 2WB1A 1N25A 2DS9A 1A5JA 3CCYA 3FV1A 1RC9A 3L7WA 4RGRA 2ISZA 1NHAA 5IKBA 3TEDA 3BQYA 1EYIA 4L9TA 1M5DA 3V8LA 3LSXA 1UHMA 3GZ6A 1IV8A 1ZTRA 1ZELA 1A36A 3AAFA 1EJ9A 3GTJJ 1X2NA 5DV5A 4BDZA 1RYXA 5EYFA 5E1XA 4KXPA 2NWJA 1QGPA 1EZ9A 2ZNTA 4KHZE 4BHCA 2H4IA 2CH0A 4AIHA 3FMQA 2HDWA 1BW5A 1LB9A 5A2QK 1RZ4A 1HKSA 2GWRA 5I5PA 3DF8A 3C3WA 4UVAA 4XLPF 1QZZA 1Y6IA 1H3DA 2G7UA 2CGPA 5EDNA 3SEVA 2CUZA 1SVXB 2VN2A 2EWNA 5FD6A 5H8HB 2XAHA 3G71I 3NWSA 1VNDA 2JPBA 2W4SA 5IP7J 5JVGF 1OQGA 3SDGA 5DW8A 2FA7A 2A5SA 2K27A 2H98A 2MSYA 3ZKLA 3KP3A 4BE2A 1QVSA 4P0IA 1WFXA 1UMQA 1T39A 1M5FA 2NXNB 2HTJA 1NL5A 1QKAA 2STWA 2OJED 5H6RA 2Z9OA 5ELVA 4F29A 3GTPJ 1SD5A 4GXAA 2D5VA 1P4AA 2VQHA 2NNNA 1BW6A 1Q35A 4OMYA 1WZ2A 5M5YJ 4IHTA 1RPWA 3TTLA 2KZGA 5IZZA 1JKQC 1EH8A 2R7UA 1SW4A 4AS5A 3S9LC 1HKQA 5ILVA 5DM7F 3GFIA 3BP8A 5BMZA 1FQCA 4RY1A 4KT5C 2WB1N 3TZAA 1O63A 2ELHA 2XGDA 4UB6C 2RN7A 4IRGA 1YW7A 3U1DA 2L9NA 3FGSA 3E5UA 1UTHB 5L9MA 3BBRA 1YW9A 1BIAA 4G7ZF 3KP2A 1UIVA 1IMBA 2CEXA 1S7EA 2ZZXA 2MA3A 1XS5A 1J0RA 5LDZA 1ETXA 4Z2YA 4XF5A 3FKIJ 3S2WA 2CV0A 1I6XA 4Y3OA 1FPIA 4LONB 4OVQA 4EJOA 1IXSB 4A93J 1AH5A 1YLFA 4RB3C 3SEUA 1ZN2A 1MXVA 2YPNA 2WC2A 1XVXA 1MJ9A 2XXYA 4X9TA 3SZTA 4G7HF 1TW2A 4XNFA 3GTQJ 1KQ8A 4JOMA 4X0GA 2AHQA 1B40A 3MP6A 3BTIA 3I5UA 3NRVA 1V54H 3LSJA 2G0EA 5B1AH 2XXPA 3QYBA 5EGOB 1SFOJ 5DS9A 1WJFA 3ZPLA 3OS0A 1IZ1A 4X6AJ 3PQKA 2K86A 5HS9A 5GTHC 3OO8A 3CMYA 1HLVA 3BIHA 2LH9A 4U22A 2ZJPF 3KP5A 4BS9A 5HDNA 3N5LA 2MYSA 5D6EA 3OXNA 2HR3A 1IRZA 2VE8A 4NB5A 3COAC 4LITA 4YKPA 1A8FA 4RAZA 3HTSB 3A2KA 2VBXA 1FSEA 4NC6A 2DODA 2QA4I 5TISC 3T8TA 5E3NA 1IN6A 4P3LA 3AL0B 3B73A 2HQAA 1XOCA 3DP8A 1XMXA 4U2RA 4H0WA 4AYBN 3KC1A 1MMGA 2FQ4A 3S4UA 2HOTA 2ZXTA 2ID3A 2R4GA 4G12A 3RPQA 2XXIA 4QHQA 2ID6A 3K4NA 4Y33A 3S3OA 3FXBA 3I56I 2GXBA 3CUQB 2WEFA 3G7WA 3HB9A 4NWDA 3D1NI 2YSRA 2HFBA 3GTGJ 3MMYB 2F5EA 3FMRA 5GAGJ 4AIJA 3CO6C 2OCCH 3E3KA 3ZMUA 2VQLA 1IDZA 5DD8A 3EPEA 3SERA 2HHMA 4ELPA 4DW6A 4I3EA 4EXLA 2LAOA 5DTDA 4MNCA 3EUAA 4WXHA 4I7HA 4G6QA 1HCRA 2KISA 3QYEA 4ITVA 2OU2A 5L3FA 3A1YA 2ZC2A 1TC3C 1G0IA 5M2VA 4LFUA 4WWCA 1SVLA 2Z99A 5LEKA 2VJ5A 2LFBA 3MWBA 2FRHA 5EQAA 3OYCA 4EJUA 3U1OA 3T93B 5DM6F 4FBPA 2OZZA 3IKVA 3WU2C 3JTHA 3IAZA 4R73A 3NARA 1HOMA 3TDZC 1PEBA 4RNSA 5JTYB 3A01B 4XONA 1IIWA 1NUXA 4HSRA 4ZDOA 2UXNA 1LE8B 3TCFA 4KCDA 4PGNA 3E78A 1MNEA 3IUOA 5HBCA 4YMAA 3JAMK 3MZ8A 1RYOA 2Y5KA 3Q9SA 1D4NA 1F5TA 3EUHA 5IGAA 3RUMA 3DEEA 2GLOA 3PPRA 2P3NA 3IC7A 4GCVA 4B48A 5E18F 1R5GA 1QVTA 3IL2A 3TODA 3BTJA 1GT0C 2JA2A 2HYFA 2BJIA 5I2NA 1OFCX 1Z21A 3MZ9A 3RPLB 2X51A 1BIYA 2HNHA 4DYQA 1GXQA 2IA1A 1SFUA 2XC7A 4JSDA 3MEXA 1SAUA 4XKBA 2DU9A 3F6OA 4MQ9F 4CYCB 2HQ0A 1D0ZA 2BXYA 1O7TA 1Z7UA 1XSXA 2V84A 4H46A 1WJ5A 2VJIA 3CCSI 4HF0A 4XIGQ 1K61A 5H8HA 4IHVA 3CESA 1V5FA 4MF3A 2V93A 2X48A 5B1BH 3W2WA 4HLYA 3HRUA 4NGUA 5DEQA 5FHNA 2IA2A 2EFOA 5IY5H 1NK3P 2QFLA 1I3AA 3KYLA 2CUJA 4UY8I 1S7YA 2ZNSA 2B7EA 2H1KA 5KVRA 1MPDA 4PGPA 1WQ2A 3H1CA 3OD7A 3BZKA 2CZKA 2RREA 1CNQA 1ZKGA 4UUVA 1EH7A 3CTAA 1H89C 4JB7A 2DA2A 1X1BA 1BR2A 5LLQA 1P7JA 4YG2F 1EU8A 3F3XA 4M6YA 2VGQA 4DCXA 4FATA 2BBYA 4GXOA 2UXXA 4BY1J 2Z8FA 1NNKA 1P4WA 3K70D 4DXBA 3X2QH 4LD5A 5A5XB 4P55A 1XHYA 4PF8A 1FPJA 4ZH4F 3EYYA 2CMPA 3GWZA 4A0XA 2NVQJ 3PTYA 1DU6A 4O3BA 2GZWA 4PFIA 5KAFC 4C1UA 5LBQA 4BAYA 1R4NB 1YG2A 1N75A 1G3YA 3VB2A 3ZGKA 5J47A 2X7PA 3BR2A 3K6GA 4II2A 1XTAA 2XWKA 3MBPA 1V5EA 4DNCA 3RYPA 4ETSA 3H03A 4ONYA 3AG2H 2CZHA 3M1CA 1S3JA 1RR7A 4A12A 5IT9K 5C4JJ 5DVIA 2AQFA 3L1PA 3EYIA 1YXIA 1QHGA 1YQAA 1VQ8I 1MW7A 3CCEI 3LA2A 3JRAA 1R1UA 4FT8A 1IMCA 3BG5A 5BPIA 1D3KA 1MXXA 2XAQA 5D4RA 5J1DA 3CF5F 3TP0A 4PAIA 2I49A 1R1VA 2O61A 4Q48A 4WF2A 1LEAA 5DCMB 3TQWA 4F22A 3PU5A 3BTCA 4F7ZA 5J8CA 5LEJA 2O84X 3BOQA 4QTRA 3ZMSA 2CJJA 5HNHA 3PUYE 1B7HA 3D5RC 5CMCA 3UORA 3O29A 4HRIA 2QSHX 2RC8A 2VBZA 3DPUA 5CKTA 4IO6A 2R0QC 1UHWA 5J1RA 3KBZA 3V8XB 1GV8A 2JWTA 4JQFA 4E0WA 4QFNA 5AA3A 3O8HA 2XX7A 1OMIA 3QYFA 4NMYA 2FQ3A 2ZMEC 5FD5A 3VPRA 4YIIA 3O66A 5D5XB 1IITA 1FQAA 3HSEA 4UVBA 3IORA 1MBHA 1WPKA 4L5IA 1X58A 4CCKA 2OBGA 5FFZA 1LNWA 1KA0A 3T5XA 1OMPA 1APLC 3OYBA 3WHBA 1QKBA 1KZ8A 1ZARA 4CUGA 2QQ9A 4OVTA 4KN7X 1HSTA 4QF9A 2ZFWA 3OR2C 1FOYA 2VD2A 2VBWA 4ASNA 4R6YA 4CCJA 1G0HA 4DIGA 1O64A 1U6GA 3W2VA 1VZ0A 3OYEA 3KC0A 4NTLA 4BH9A 1FPKA 1JKOC 2PFYA 4ZS9A 3BR5A 1WJAA 2KRHA 2PMZA 2MKZA 4PAFA 5KCJA 2VKDA 1TQMA 2ONSA 3GZNB 4EQBA 3HPHA 2Y7RA 4WXCA 1JW5A 1AKHB 1LVKA 1O4XA 3REOA 1OLAA 1ZRDA 2P5VA 1LKXA 9ANTA 5EG0B 1JW4A 3HL2A 2E2IJ 3OYJA 4S04A 1LAGE 3OYGA 4C3HJ 2B4MA 2XB0X 3ZMTA 3CHGA 1BM9A 1B3FA 5J40A 1I39A 5DUKA 1MY3A 2FYIA 3BQZA 4N6DA 2OLBA 2G29A 4IL6C 2GRVA 1KU2A 4DYRA 4LIVA 2V26A 1ERDA 4E7JA 4NQ8A 2X1EA 3DU5A 4HE2A 3H9QA 2H6BA 2DJIA 2DA7A 3RN8A 1FLIA 4A3MJ 3PM1A 5J4YA 3S2DJ 2LYCA 4BYYA 1ZTYA 2ZO4A 3Q0VA 2XPUA 3RZDJ 4CYCA 2CYYA 3GMEA 4U1ZA 4YKKA 2V9KA 2KRCA 1I27A 1A04A 1ZGJA 3TL4X 1GGGA 2LC2A 1LBXA 3I9V2 4DDDA 2XSDC 2QBYA 1Y56A 2R7TA 5TGTA 4U7DA 2ZXWH 3BKIB 1YFHA 3DXJF 4YU0A 1FPFA 1DMBA 2FIXA 3KFWX 2ME0A 5IOZA 5I84A 1CGPA 2Q88A 2RC9A 3GLLA 3D5LA 4OETA 1OQYA 4MBPA 4AM3A 2B3FA 4B3XA 1RETA 3IH4A 1FX7A 3WG7H 2RVCA 1VFCA 3R60A 3C33A 2DT5A 4F19A 1FTKA 3PMXA 1X4OA 3HZJA 1QZEA 1SAXA 2ZZVA 1N77A 2ZYNA 1Y1ZA 1TWHJ 6PAXA 2J5PA 3NWTA 1PBPA 3IRRA 4MEVA 3IOVA 4TQUQ 3TO7A 5CQEA 2V9PA 2KR0A 1MZBA 1N76A 1TQPA 3DP4A 3MKYB 1RDZA 1MY0A 2VOOA 1PB9A 4M3EA 4ZTJA 1LBVA 3IOWA 5D5WB 5KZTA 2KJCA 1PUFB 2QEXI 1QJMA 2G93A 1G59A 4BUPA 2Z5UA 5CVRA 5D8LB 4F2OA 3CVGA 3D0SA 2A3SA 1J1NA 2FMYA 3H6WA 4Y52J 1ANFA 4M9SA 2FD5A 3DPTA 4BQQA 3DLLF 1WCMJ 2RF1A 4EEFG 1SMYF 1WJBA 2WV0A 4LLNA 3Q25A 2DTZA 4EQ9A 4XRFA 1YIOA 4V19K 2NVXJ 4NDLA 2GM4A 2QS4A 2PFBA 2OZ6A 4HQMA 2HZLA 2KLFA 3RQTA 2R8TA 2L7ZA 4LP2B 4RXLA 3U8QA 1RUNA 5I56A 2FX0A 1QA6A 4XKQA 2XASA 1A8EA 4PFBA 1IRFA 3RKQA 2MW8A 1D5VA 1AOVA 2GAUA 4L9VA 1BTJA 3K4UA 1HW5A 4IY6A 5IT9Z 4OMBA 3QAHA 1R1TA 5EYRA 3IAS2 3NOHA 5EJCA 4OU0A 1X1CA 1Z77A 3DBHB 2JRMA 1I1SA 1U8BA 3WTWC 1QUJA 1TXFA 4LUBA 4LVQA 2Y30A 2Z33A 4MNPA 2P2AA 1ON1A 1HBXG 4P8BA 3TKDA 2O68A 2XKPA 1U0JA 5I2NB 3FXRA 3ULQB 4N15A 1RESA 5F1QA 4HE0A 2Q8MA 1X1AA 3FX3A 3S16J 1KYWA 1YS7A 1P6RA 2GQ1A 1B51A 3OIQA 2NVYJ 3G4SI 3PO2J 1XT8A 2L7FP 4OENA 1URDA 2LTPA 2X0LA 4UV9A 2CUFA 2WY7Q 1DTGA 1LCFA 3QYTA 4PJ0C 2BZTA 3P7IA 1DBZA 4ESJA 4HG2A 2VD3A 4I76A 5BS6A 5EGOA 2HVSA 4EATA 3TPAA 1JJ6C 1LB2A 5AA1A 4ZDPA 3L2RA 4MLQA 3PUWE 1JI8A 1N7WA 3HHFA 2M8CA 4DJAA 2L01A 1VSOA 3MYUA 4KCCA 2CV1A 1ETYA 1BC7C 2E71A 4G61A 2FU4A 2QSGX 5FHOA 2LMDA 3DWLE 3U2RA 1W0UA 2EK5A 3RLFE 2O1MA 5BOXA 2VBYA 2F5VA 4FECA 4MIJA 1PYVA 2A6HF 3S14J 2PT1A 1OJLA 1VQNI 1DQUA 4OVRA 4JX5A 2H99A 3S1MJ 3CLQA 2QVVA 4RJZA 5TPAA 3OR1C 3F22A 5TP9B 5H8FA 4FETA 1MMSA 3A02A 2ACJA 5F6FA 1NUYA 1SI0A 5ED4A 3AL0C 5F04A 4ZEFA 2DBBA 2CW8A 4A3KJ 5EEAA 4OFOA 4KDPA 1FT9A 2F5XA 2JUCA 2IRFG 1QUKA 2DWJA 3R0AA 4XR6A 5HS8A 3CLOA 1YIJI 1YAEA 2OK2A 4P1WA 3KN3A 4EM2A 4NEDA 1B4AA 2NVTJ 4HS7A 4CDGA 4MAGA 2I8DA 2ZSIB 2QRYA 3C2BA 2WYKA 5EYGA 2LY1A 3FVKA 3ZKKA 1PB8A 1OCCH 3Q5FA 1MMDA 3BCBA 2E5ZA 2F7BA 2BY2A 3LSMA 4WX9A 2TRTA 3P7NA 4X48A 1MSFC 4I99C 3I55I 1SEUA 3H5NA 4ENJA 5ITPA 2CSOA 2WAEA 2KIMA 4IGTA 4AVZA 3O97A 3CFXA 3JTGA 2K9LA 3ZCOA 4AVPA 2EPFA 1IMDA 1FJLA 1IMEA 4ELOA 4ZC3A 4GRIA 1CB6A 3JRGA 1WH7A 2EFPA 4RGSA 4RK9A 4ZTFA 2E34A 2X4HA 2Q2AA 1U9NA 5IP6A 4GWUA 2F8DA 3G3GA 4BE0A 4X1DA 5CBRA 1EZPA 2RV8A 2R93J 2EB7A 4PFOA 3PUXE 4G68A 5EEGA 2D2WA 4XOPA 5IP9J 3ZXSA 3ZMVA 1RNLA 4OFJA 3LFUA 4ELQA 3NQOA 1B1HA 4BLAA 2EZLA 4OOIA 3LQQA 4HSTA 4EDPA 3S17J 3SETA 3K2AA 2ZBKA 3ZR8X 5J6XA 4NG7A 3TBIA 1J09A 4MFIA 4NC7A 1FBPA 2H25A 1OCZH 2JZYA 5D4SA 3C34A 3H3GA 3W3CA 3I4MJ 4C2UA 4MJOA 1Q1HA 1OLTA 3CJTB 3CSGA 3T9XB 4NUBA 2M7AA 3FXLA 5E1ZB 3E97A 4LB6B 1J59A 1Y9UA 2O6GE 4EJWA 2R7WA 1FPGA 1HC8A 3LUYA 2ZFUA 4EGYA 4HCYA 5JHFA 3K10A 3DLNA 3RKYA 5IM2A 2EFQA 1FBHA 4E7LA 5I2KA 1FPEA 1LQ1A 3H5RA 1FMVA 1BJAA 3V7CA 3H0GJ 1F9NA 2DK5A 1YX3A 1USSA 3CCLI 4A6DA 3OENA 2DT6A 1Z7LA 3M8JA 3U1KA 3LSGA 2ETHA 2F6GA 4KR5A 4OIPF 4GXSB 1P9QC 1LDJA 4OVPA 3C7JA 2K85A 2W25A 4TV7A 4XN3A 1T2KA 4F3PA 3H9GA 1UCRA 3QPLA 4C3JJ 4EV0A 1NTCA 3OIOA 4PJJA 4ND9A 4F39A 1AWCA 3OV8A 1NV1A 2DWAA 1HSJA 2QKMB 4E70A 2XRLA 4U7BA 3A0HC 2HDCA 3BWGA 1FOXA 3UGWA 1FEXA 4IHYA 1IRGA 3I71A 4KIFA 1AHDP 2B3BA 2DQVA 3IX1A 3K6UA 3LWFA 3HOTA 4O94A 3O3KA 4XL9A 2LREA 5H8SA 3OSGA 2DN0A 2HKXA 3CCJI 3JZJA 3S2VA 4CCOA 2VOPA 2VI6A 3VVEA 3ZMZA 2G9WA 2MGQA 2NAZA 4HX7A 1ZG1A 2NS8A 4BKXA 2FEZA 5IZ3B 5ICEA 3KIOA 5EQ9A 1SW5A 3G3JA 5CBSA 3P9CA 5BWJA 3TKYA 4DLDA 5I59A 3CG1A 5CYVA 4U21A 5CMBA 5EYHA 5EQ8A 3OO6A 2L4MA 1JETA 4QPOA 1YCJA 2HOSA 3FKJA 3MPKA 3MVXA 3E5QA 3M4OJ 1JP4A 1BC8C 2QENA 2WAQN 3RSNA 1IXGA 1N04A 1LAFE 1G3WA 2QQBA 2XD3A 3VVDA 3T8RA 5C44J 3VYUB 1AWBA 2JRTA 3OYLA 1JTYA 2FBKA 5EF6A 1O3TA 4ZZAA 4IEJA 4YFNF 3MSTA 4AB5A 5DTBA 2YX7A 4ENNA 2FNCA 4M9XA 2QSFX 4NE4A 4N4UA 3KX2A 2IGOA 2JPCA 5H8QA 2B63J 4R9GA 1IN8A 1MBFA 2OBPA 3PQJA 1K83J 1GDTA 4XSZF 4KISA 1SW1A 3DEUA 4POWA 1YX5A 2QS3A 3H6VA 1QPIA 4PBQA 2HQ5A 1JUPA 3HDDA 4PE5B 3SZGA 1B05A 5K2YA 4F52A 1II5A 4CA0A 1R22A 1RI7A 2GBYA 1JVXA 1M5CA 3S2HJ 2XXRA 1TWFJ 3B7DA 2DOFA 1FQDA 3TDJA 1NNFA 3E1SA 4CO8A 4LIUA 1FRPA 4LA9A 4FE8A 4P9KA 2Q0OA 4F3BA 4HDVA 2ELJA 4ZE8A 1ZRCA 2IP2A 4AB6A 1S29A 3LMMA 4MQVA 2KZVA 1MDMA 3VOEA 1MBEA 2EA4A 2M9HA 3H4ZA 1ZAOA 4XLFA 1INPA 3LUZA 4IO9F 4I0AA 3RT8A 1B6AA 2X6YA 4P9FA 3T0JA 3R0JA 1MXZA 3HPIA 3CCMI 1EV7A 2M45A 1K9ZA 1UG2A 4LGWA 1IG7A 2X7QA 3BFTA 2WBBA 4G8XA 2LNBA 3EN3A 2WAQA 3ASOH 3C18A 2I0BA 1POGA 3I0TA 3TQNA 2JTVA 1M1EB 4OZ9A 4F3QA 2E35A 4UHTA 4P1LA 3WGIA 3TGNA 3RY3A 4B4CA 4C3IJ 3T9UA 3PUFA 2BVLA 2O7UA 1TNTA 1FTTA 2O7OA 4II3A 1YYZA 3EHUA 3CSBA 1QO0D 2X1DA 2OD5A 2DE4A 4G68C 3B6WA 4PTKA 1R36A 5J3LA 1IW7F 1MBGA 2CFXA 5KCMA 4OYVA 4UUSB 2F5CA 2DA4A 5FKLA 3FISA 4FASD 3TQLA 2GXGA 2ZYMA 4BL0B 2VKHA 1ACIA 3MJNA 3KCCA 5I58A 2V3UA 3K6WA 2DWHA 4PP0A 3VXCA 2Q1ZB 4HPQA 1LAHE 2D21A 2EJRA 3SEYA 4N8YA 1T33A 4PZJA 3ELKA 2QF7A 5FFXA 1XC1A 1VR5A 4IKFA 3ECRA 4BBRJ 5JHUA 1CQTA 4HYEA 3HM5A 3BJOA 1I3QJ 2V1XA 5FLVA 1BBYA 1DUXC 1P1NA 3A3UA 2O8KA 4F93B 2KLOA 1FTAA 1Q1VA 3E6BA 3KP4A 4GWWA 3WAEA 4LG0A 4O7IA 2HPIA 2F4MB 3LQRA 1NV3A 3DEWA 4JK1X 2W57A 2IT0A 1P1QA 4IHXA 3IKTA 3TOAA 3KBRA 4PFRA 1QHHD 3TYHA 2XGEA 5GP9A 3L6HA 3QPSA 2DI3A 4AD9A 5I3SA 2F5DA 3CQZJ 2EIKH 2XIGA 4LG3A 3OYAA 3PPNA 2CQXA 2L9RA 3PO3J 2HQNA 2X6WA 1UFMA 2ZNYA 3KEQA 5E3OA 2DCEA 1E3OC 1N0TA 3HO7A 1LFUP 3I3VA 4GX3A 3MZYA 2DYXA 4XK4A 3N6TA 1UQWA 2ADUA 4MTEA 3JYRA 4KI0E 3OEMA 2WY8Q 4AIKA 1DP7P 2I48A 1Z6RA 1HSLA 4JXIA 5ICFA 1OYYA 2P7VB 1STZA 1AIVA 2QLZA 3VEPA 4EGZA 3TW6A 4FCYA 3F11A 4WKMA 2LR8A 4PJMA 2IPQX 2YPRA 2Y7KA 2O8XA 2STTA 2XPVA 4N07A 1Y1WJ 4PFUA 4WXDA 1P99A 2ZXJA 1MH3A 4GD5A 3RTFB 1N3WA 5AA2A 4E7SA 4YELA 2DFFA 4HW0A 1O3QA 2YUSA 5GTIC 4MTDA 4L9JA 2OC6A 2BOLA 2QSXA 3FXOA 4RGUA 1XCBA 3ERMA 1X2MA 3FJMA 3QXMA 4K3FA 4KPTA 5I2KB 4BJ5C 1D0YA 4BJ6C 4DOZA 2B65A 3I4NJ 3OO9A 4RLFA 3LC8A 3CC4I 4PUSA 1QU3A 2YU9J 2MC4A 4L5EA 2DMQA 2ESHA 2RCAA 1MMAA 3GBAA 3I5OA 3W6VA 1B7ZA 3GZGA 2VHAA 1Z3YA 3IH3A 2CEYA 3GYYA 1LDKB 2FJ1A 2R7XA 1VQ6I 5CMMA 1Z7NE 1LFPA 3JCUC 4NNJA 2BHZA 3L2VA 1D5YA 4GRKA 3BZ6A 1K79A 3RQ4A 1S7OA 3D4GA 4YIRX 1UIUA 5FO5A 3FK6A 1X3UA 2L5QA 3IB1A 3G1LA 4XM3A 3N4MA 4Q30B 2F97A 4ZDMA 3S9MC 1B6HA 2DOEA 3I58A 3JREA 1VFEA 3G3ZA 4ON0A 3M07A 3GO5A 3PPPA 3OELA 4Y15A 1NV0A 1NUWA 2DWIA 1QVUA 4UABA 2DMUA 5H20A 3KN8A 2QVOA 1W36D 3BG7A 2GOXB 4RMNA 2P0WA 3QP5A 1YITI 2Y7IA 3EF7A 4OTEA 3SQNA 3T0YA 4FIMA 2M8GX 1N78A 4KITB 3VSKA 2E7XA 2LBFA 3MWMA 2TDXA 1PC3A 4OERA 4JX6A 4R2FA 1LLSA 4RDUA 2ZMEA 2Y69H 3K01A 1TWCJ 3GEZA 3E7LA 3LBSA 3QOPA 4NF0A 5GAEJ 3FBIB 2JQ7A 1BKAA 3MP8A 3HUGB 2D5WA 4JWXA 2CWEA 2XA5A 3PNTA 3TW7A 1OCRH 4G8NA 1CE2A 1WGXA 3AFHA 5JFRA 3C1DA 5B5EC 1R00A 1VFDA 4QFLA 3SFZA 2BY3A 3GX4X 5EHSA 2HVQA 4OWDA 2YR2A 5L3BA 4RB0A 2X9DA 1QPMA 5FTIA 4IJAA 4XKNA 4ZZLA 3CG3A 1YJNI 1AU7A 1U8RA 4NF5B 2W82A 2ALUA 4BDMA 4M9ZA 4UA8A 2F36A 4ZECA 2EZIA 3MP1A 5HM4B 2XXUA 5DYMA 1G6NA 2IGKA 3WTUC 5K7FA 4P11A 4I09A 4RYAA 2ICWG 3M1EA 5ET6A 2QM3A 1TP4A 1V55H 1DPRA 5K5RA 1A35A 4RBOA 1MDP1 1R58A 1E0EA 3I6VA 3FM5A 2DW4A 4QSCA 1EYKA 1BLFA 2R7FA 4EF2A 3AG3H 1MM6A 5I58B 1SFKA 1T56A 1Y1VJ 3EPZA 4BDLA 2COMA 3IP4B 4I0BA 4DQ2A 4YRVA 4OEVA 4LLGF 5GAHJ 3HXLA 3CCVI 1R9TJ 3FD3A 1S6LA 2DK8A 1B7UA 3TCHA 4ZZDA 1T08B 5FJ8J 3FMSA 5IZ3A 5AE4A 1XSVA 3HBLA 4B8XA 5F27A 5J8FA 3IWZA 4YFKF 1MPCA 5E8GA 3LSFB 3WTSC 2CS3A 2XXQA 2R3SA 2JA8J 2I3VA 5I59B 3L2UA 2L3DA 2QKLB 3HKZN 1X19A 3FHNA 2KMUA 3P9KA 3E5XA 1I6QA 2O03A 1LBYA 1H9GA 1P1OA 4C2TA 4GFRA 2V4JC 4CZZA 3FHZA 4M3BA 3QMFA 1TFDA 3VE1B 1BJZA 2M0CA 5AA2B 3K69A 4R6KA 4HEA2 1B58A 4A3JJ 2X6OA 3CC7I 3E6DA 3JRIA 1X1PA 4C1TA 3RYRA 2HS5A 3SXYA 5E8IA 3HV1A 3M8EA 1OKRA 3L9FA 3QAXA 4XICA 2JVHA 2MH9A 4U23A 3GTMJ 1UJ8A 3J81K 1O3RA 3DQVC 2NYXA 4OAZA 3GXAA 2DDKA 3OOAA 1HQCA 2K5CA 4PGHA 3CMAI 4MLVA 3F8CA 1VQ5I 2OTJI 2C6YA 1KWHA 4XORA 3WGHA 1RRJA 3WTYC 3F8FA 1YJ9I 2BYVE 2QGUA 1ZREA 3F8BA 3KZYA 4PCQA 3SFIA 1XPXA 4MX6A 3THIA 1FIAA 2HYJA 4A3IJ 4D5FA 4ESBA 2F3DA 1A6IA 2H8RA 4ZYEA 2L0KA 4Y7NJ 2MD0A 4KFCA 4ZZEA 1EH3A 3BPXA 4JVCA 2B0LA 3N97A 2VQCA 2N8GA 1NV6A 1EA3A 3EQLF 3IOUA 2IEKA 1IEJA 1WSUA 3ROJA 5I7IA 4IX7A 1XS9A 5ET8A 3K1NA 5BNGA 2M4KA 3BTLA 1T8IA 2A07F 1F1ZA 1I1GA 2LK2A 1JHFA 4E7IA 2WV1A 2HPGA 3A3CA 3TCGA 2UV1A 4R1HA 1S50A 3L2CA 5ILUA 3EQ1A 3VV5A 2KRFA 2EBIA 3L09A 2WA0A 4HW8A 1T6SA 3HGYA 2VC1A 4KMFA 3RDIA 1BN5A 2DXYA 4Y13A 1MKMA 3GTLJ 4PK4A 4OAYA 2PX1A 4G8MA 4GO1A 2E2HJ 2R5YA 1YOVB 2OCUA 3OYHA 2F6CA 2O5RA 3V42A 3CR9A 3K2DA 1FPQA 4G7OF 2XAUA 4UB8C 4MH5A 1IXHA 4Q8RA 4PJLA 4QFKA 2FVZA 5FLXZ 2MD5A 3GCMA 1LFBA 4YEJA 1IO2A 3HOZJ 1AL3A 4PCDA 1WHUA 3SEZA 3RNNA 3VFJA 2VB6A 1KONA 5I56B 5FLMJ 1B2HA 2ZXIA 3CRBA 3FBNB 2W7YA 4N0BA 1SYHA 1D8KA 3HHHA 4R79A 1YO5C 2KQRA 1T95A 1OR7C 3ZQGA 1OQHA 4HOBA 4M3GA 4Q0CA 4Z6YA 4JP0A 2LF8A 2E1SA 2ZB9A 3BCAA 1NV2A 4F1UA 3MKWB 1WDNA 2EZKA 2W00A 2H5YA 3E6CC 2ZXHA 2VUMJ 1GVCA 1POY1 5FBPA 1YW8A 1B0HA 3TTRA 4ISUA 3ASNH 4A3EJ 1YTYA 1FQFA 1VE4A 4JSOA 2DMTA 3BC8A 2LKXA 4I3YA 4PBHA 3JSPA 3LAPA 1MDQA 2WBDA 4GVOA 3WAFA 1JEUA 1LSTA 4A6EA 1DGWY 5E3MA 3L2QA 3GYHX 4MGRA 1LFGA 4ECFA 3K1PA 2DPUA 2F5FA 2OWSA 3V7RA 2FF4A 2PMHA 4R2BA 4ZJZA 1US4A 3P5JA 1I50J 3JR9A 4FTHA 1Z9CA 2QBYB 2DYRH 3ZP5A 4OIOF 1NV5A 2EIJH 2I5UA 4XBFA 1MBJA 3R6UA 2NVUB 3VYSB 4OVJA 2V1DA 2GXAA 3ECOA 3SJMA 3ZOBA 5JI6A 1SD4A 4IHWA 2Q2CA 2VT5A 4NWCA 1XX5A 1S72I 2KJBA 2PMZN 3VSLA 5LOMA 3KETA 2W7NA 1YHQI 3T96B 3UA8A 3B02A 1F4KA 1B52A 5EZGA 3KEOA 1NUZA 4IQJA 1FSHA 5F0CA 2LLKA 2HU9A 5B66C 3QSLA 2QS2A 2YU3A 3KP7A 3H0DA 4U0VA 1WVJA 3RPLA 2K9SA 3W6KB 2A5TB 4KT6A 4BNCA 2ABHA 3E79A 2BW3A 4OVSA 3V8JA 2O0YA 1BI2A 2EFNA 4E7KA 1JT0A 4GIZA 4P96A 2Z8DA 3PD8A 4HV5A 2Z16A 4IPAA 1EF4A 2UYEA 3FXQA 1ETQA 4GBWA 3BPVA 4KD5A 5M5WJ 5K5QA 1RR8C 5KK1A 3U72A 5JK4A 4NF6B 2HTSA 3LR1A 2I4CA 3T22A 3FATA 4G94A 2LKSA 1HW1A 2UUZA 4AC0A 1RIOH 3E13X 2Q8JA 4Y4RA 3DTEA 3RCOA 4H6DA 1TWAJ 2KPMA 4O3AA 4DBRA 2CZLA 5ICGA 1IUDA 1HXDA 3OS1A 3SKPA 1B3EA 4GWYA 5C3EJ 3O2PE 5J1UA 4CSWA 3S15J 5A5XA 1KYZA 1SD3A 1IV6A 1B5IA 1B1BA 1S7AA 3AKZA 2PJRB 1I69A 2H6CA 3BR1A 4OHNA 1AOYA 2XF5A 1XB4A 3M8FA 4M73A 4D0PA 1DU0A 2VONA 2I6EA 2Y7WA 1N7XA 2EA2A 3TO9A 3B50A 2BHYA 3K0VA 4B09A 2DE3A 3U92A 4W1UA 1LB8A 4F18A 2O3FA 3SDBA 2XAGA 5AIPA 3M3KA 4YMBA 4KNYA 3HKZA 2R5YB 2F4OB 3I59A 5EG0A 3IOTA 5DCFA 2HOAA 2F4IA 3WE3A 1XVYA 1M5EA 2DO7A 1R6RA 1ZIUA 2W24A 1MJAA 5D8KB 4A69C 1E17A 1SDXA 4RM3A 2YJPA 1XGMA 2E5NA 1MXYA 2RINA 3HOVJ 1B32A 3LA7A 4ELRA 1U78A 3HSRA 2DAOA 4I01A 2XD2A 5JVTA 4LK0F 2XXKA 2OAZA 4NF8A 1TT1A 3FZVA 1NH8A 2VXZA 4N17A 2A5YB 3HRTA 2WBMA 1HDDC 2UWMA 2M7BA 3MAMA 2K7LA 1L0OC 2R7OA 1Z6TA 3HOXJ 4NHJA 1RDYA 3QPHA 2F3BA 4GBVA 4AS4A 3PJRA 4M3FA 5AONA 4B3AA 5CQGA 1FBGA 1H8AC 1YPNA 5CRYA 1G4DA 5JEIA 4RAGA 4UVCA 5F64A 2QVRA 4MO7A 1R9QA 3IB2A 4IR8A 4XKPA 1LBZA 2HQRA 5LRRA 5FKKA 4LATA 5K7HA 3C36A 1MMNA 1ZU0A 5IPAA 4A0ZA 4DZPA 3AG4H 4N6PA 1J75A 5M5XJ 4J00A 1FTJA 1J7KA 3F9KA 2V7FA 2HXIA 1FJ6A 2RQQA 2XV4S 3MCZA 2D3IA 4HCWA 1ETWA 5JLXA 1MNDA 5TPAB 2D45A 1MQIA 3W9WA 3GLXA 1NK2P 2KL4A 1URGA 5DT6A 1JXSA 4BEHA 2IVMA 3S32A 3HSTA 3QUJA 4B47A 1ZLKA 3E4RA 2M0MA 2Y75A 1FMWA 1HF0A 1WJDA 1PUFA 3T1BA 3T9VA 3Q0UA 3I4PA 3K4BA 5HDGA 4L18B 4GWZA 4IZZA 3CDIA 1BOBA 1LDDA 3M3LA 4BJTA 4JWYA 2Y7PA 3QU3A 1B3HA 3ZQIA 2QPQA 1BR1A 1DPPA 3U93A 5B70A 1BR4A 1D8JA
chains in the Genus database with same CATH topology
3GXOA 4ENKA 5FLXK 1SMTA 4N9HA 1JGSA 4N8GA 1DDNA 4A5MA 1PP7U 4XLNF 1K6OA 1LEBA 1Q9DA 3K2ZA 2DVZA 3DPLC 5LTCA 4M6XA 2AS5F 3A29A 4HE1A 4FX4A 2WWYA 5DUIA 3U65A 5HLHA 1FC3A 3ROUA 3WTVC 4N81A 2KQZA 4Q5SF 2LSOA 1HW2A 2W84A 1MJBA 4RAYA 4CGZA 2DQLA 1O7LA 3WU0A 1OR7A 1WRJA 3W9VA 1BI3A 2L5VA 4S05A 3EDPA 1DCUA 1T0FA 3ZN0A 5ERIA 4P56A 2XRNA 3G73A 2XWIA 1EH6A 3J80Z 1W5SA 3HHGA 3IFCA 3ZQ7A 3BDDA 5L3EA 4M74A 2CQKA 2V3QA 3CUQC 4X8RA 2CO5A 4HF1A 4P1EA 5H6QA 4H0EA 4M71A 2HKOA 3IFAA 2P6SA 4IF4A 2PCRA 2HOEA 3WTTC 4A5NA 5LHIA 1IXRC 2GIVA 2A69F 2A68F 2OX3A 1XDUA 5DDGA 1XSDA 3F6VA 5LGTA 2VPOA 1D3YA 1PP8F 3KLNA 4XSXF 4G6DA 1ODDA 4LG0B 3CUOA 4A0YA 3HRSA 5A2QZ 1C0WA 3BJAA 3U9GA 4PF6A 1XDSA 2K4JA 2CG4A 2M87A 4GX4A 3WGGA 2L02A 2QYOA 2ESNA 4ZYHA 4CYDA 2XGXA 3V8KA 1ZRFA 2D1HA 2E7WA 4EVIA 4N91A 2Y5LA 3FM3A 3K0LA 1V3FA 4IHSA 2ZZWA 4U0WA 1BI0A 2D1VA 3KZZA 4CICA 2RC4A 2XAFA 2J5OA 5L3GA 1ZGAA 1L3LA 4KN4X 1V4RA 1U5TA 2VT2A 3M9AA 2XWOA 1ZG5A 2M30A 4UXNA 4MHGA 2JT1A 1TBXA 4U0YA 1SFXA 3F21A 4EJTA 2PFZA 1FBCA 4MMPA 4O7MA 4XEQA 1XGNA 1REPC 5E20A 2QZ8A 3J81Z 4IXAA 4RB2C 1J9IA 5F1RA 5HOOA 3K1MA 4FHTA 1OYIA 5E17F 1D9QA 1P4XA 2WYPA 4GWSA 1FJ9A 3I64A 1DPUA 2P7CB 5CVVA 1DK4A 4MHFA 1WKMA 1PUEE 1YYVA 3IRQA 3I53A 5ET5A 3WODF 1WWXA 5LGUA 1I5ZA 3F8MA 1VDWA 2WTEA 5D5UB 1IMFA 3D1RA 2VPNA 2GA2A 5JR3A 4M1VA 1ZYRF 2MBFA 2CZIA 2Y48A 3W6JB 3JSOA 1JHHA 4PETA 1U3EM 1MD0A 5LRSA 1YZ0A 1IMAA 4UNOA 1FBDA 2FMLA 1VTNC 2FBIA 4LLLA 2PQ8A 4BHPA 1MGTA 3GFLA 5BQTA 3IHUA 2LF7A 2BGCA 2DQRA 5DCMA 3PFIA 2VE9A 2K4BA 1XCVA 3HYIA 3I59B 1SPIA 2OQGA 4CXFA 3OOPA 4YICA 2P4WA 2FHYA 1IXCA 5IT3A 1IN5A 3ZMDA 4LJZF 3CO7C 1FNNA 1Z91A 3QRFF 4HLXA 2F2EA 2KIFA 2RKHA 4NQWA 3HTUA 1YS6A 1GHCA 3GVAA 5CVUA 2A61A 2OZUA 1BIBA 4MEYF 2FBPA 2L54A 2R7DA 4O8MA 3O6BB 1IAWA 1B9NA 3GW2A 1ZH5A 2XUBA 1KU9A 5AIQA 5CLSA 1Z1DA 3MAJA 4KICA 2BV6A 3I54A 5FB2A 1ULYA 5EEHA 1FPDA 3FF5A 3RJPA 4HX4A 5D6FA 1K78B 4PE3A 4PC9A 2EV0A 1S8NA 2FNAA 2HEOA 4O5VA 3DFGA 3WG9A 4OIQF 4PAKA 1TTYA 2HWVA 2HFHA 4OIRF 4HQEA 2HYGD 1FPBA 2V4CA 4I40A 2QQAA 1QGXA 1CF7B 5E1WA 2FXAA 4U88A 2XROA 1IN4A 1E2XA 1USTA