3SZYA

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in apo form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
b'MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3szyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3szyA01
1Y7AA 3NKPA 1ELZA 2GSNA 4LRCA 5GOVA 4LQYA 3MK0A 3NKRA 2G9YA 5AJ9A 4UPLA 1ELYA 3TX0A 1ELXA 1FSUA 2VQRA 4CYRA 2QZUA 3IDDA 1EQJA 3BDHA 3KD8A 3MK1A 5EGEA 1ZEBA 3E2DA 4UOPA 4B56A 3T01A 1ZEDA 5LRNA 2GA3A 1KH9A 1AJAA 5L0KA 1EJJA 4ZG7A 2W5WA 1URBA 3OT9A 5K4PA 4CXSA 1ALKA 3NKQA 3CMRA 3NKOA 1EW2A 4ZGAA 1ZEFA 1KHJA 4MHXA 3UN5A 3T02A 2W8DA 5INHA 5IJSA 3M8YA 1KHKA 4UORA 3WAYA 1AJDA 3M8WA 4UPHA 1ED8A 2W5TA 3T00A 5LRMA 5L0EA 1KH7A 5LIAA 2IUCB 4N7TA 3IGZB 1HQAA 4LREA 4KJDA 3DPCA 2W5QA 3UNYA 1O99A 1ANJA 3NKNA 3MK2A 4KM4A 3ED4A 4LR2A 1Y6VA 2X98A 4CXUA 5LQQA 1HJKA 5HRTA 3BDGB 1AJBA 4KAYA 4LRBA 1KHNA 3TWZA 3WAXA 2IUCA 5EGHA 3B5QA 2D1GA 3TG0A 1N2KA 2GLQA 2XR9A 4NWXA 3WAWA 4ZG6A 4FDIA 2GSOA 4TN0A 1E33P 1B8JA 3DYCA 5DLWA 3WAVA 5DLTA 1ALIA 1ED9A 1KHLA 3NKMA 2W5XA 3UN2A 4LRFA 1EW9A 1E3CP 3BDGA 4MIVA 2W5SA 4GTYA 4KAVA 4GTXA 4GTZA 4CYSA 1KH5A 4CXKA 4ZG9A 2IFYA 2W5VA 1SHQA 1URAA 1AJCA 1EI6A 1ALHA 2XRGA 3WBHA 2W8SA 3Q3QA 1E1ZP 1AUKA 1EW8A 4YR1A 4LR7A 3UN3A 2RH6A 1E2SP 1KH4A 2ZKTA 1P49A 4UPIA 3A52A 3NVLA 3M7VA 4LRDA 3UO0A 3IGYB 4GTWA 3BDFA 5DLVA 4LR9A 5KXAA 1ALJA 1HDHA 4KJGA 1K7HA 3SZYA 4LR8A 3M8ZA 5GRRA 5IJQA 4LRAA 1N2LA 1ANIA 5TJ3A 4UOOA 5C66A 1SHNA 4MY4A 4FDJA 4NWJA 3LXQA 4UPKA 2W5RA 1O98A 5L0BA 2ANHA 4QAXA 2GSUA 3SZZA
chains in the Genus database with same CATH superfamily
1Y7AA 4A3JC 4BLBA 3NKPA 2GSNA 4PAAA 4LQYA 5IYCK 3NKRA 5AJ9A 4UPLA 1ELYA 5IOQA 4BY1C 3S16K 1BS2A 1ELXA 3DXJA 4A3DC 3A8IA 4OIQA 2QZUA 1EQJA 4AYBL 3BDHA 3GDZA 4BBSK 2JA7A 5EGEA 3N0CA 3E2DA 3V4GA 3AD9C 1TWCK 5FJ8K 1GE9A 2GA3A 3RZDC 4A3LK 4M1XA 4OINA 1WOSA 5C44K 4A3MC 3M3YC 4QIWL 3CMRA 3LAPA 4ZGAA 1Y1VA 4OIOA 4WJ3M 3UN5A 3T02A 2A6HA 2NVTC 3H0GC 5INHA 4KM9A 5IJSA 3GTPC 3FHZA 2JA6K 5IYDK 4MQ9A 4BBRK 3S17C 3WAYA 2CFAA 4KMAA 3BP8C 2GAHC 1PJ5A 4DDQA 2E2HK 1O24A 2R7ZC 1XXBA 2W5TA 3T00A 4G7ZA 1IL2A 1O2FB 1KH7A 2E2JK 2JA8K 2R92C 1TWCA 5CHPA 3M4OK 4A3CK 4KJDA 4GTAA 1USMA 4C3IC 1ZQ1C 2A6EA 3BP3A 5IOSA 1TWFK 1XZPB 3GTJK 4KM4A 3A8KA 3AQOA 2YU9C 1WSRA 4KC6A 5HRTA 2V6SA 1TWGK 4BKWA 4KN7A 4XLNA 1KHNA 3TWZA 3WAXA 4C3HC 1J6WA 4A3KK 5EGHA 3HOXC 2JA6A 2D1GA 4LK1A 4NWXA 3RZOK 4FDIA 4KATA 2R92K 4G0UA 2CW0A 1DCHA 3CQZK 3UN2A 1WCMC 2E2HA 1O26A 1E3CP 3GTGK 3BDGA 1I50K 4C3JC 4MIVA 1F9NA 4KAVA 1B4BA 3FOEA 4Y52K 2PMZL 3I4NK 1EI6A 3GTQK 3Q3QA 1VH2A 1E1ZP 1TWFA 3GTJA 4LR7A 3QX3A 2RH6A 1IS1A 1TWGA 4LJZA 3FKIK 4UPIA 2JA5A 4X6AK 2R93K 5JFEA 4GTWA 5DLVA 3LAJA 1HDHA 3I4MK 4LRAA 3S14C 4XCHA 1SFOK 3TTGA 4UOOA 5HL8A 3L4JA 3TFHA 3CQZA 3CAGA 3HOZC 3H3VD 1WQGA 3GTGA 4Q5SA 1I50A 4XLPA 2B63C 2O5IA 3ADAC 3SZZA 5C3EC 3S1RK 2NVYC 4G7HA 1I6HK 1ELZA 4LRCA 3K7AK 5FLMK 3GTQA 3GTMC 2ZUEA 3TX0A 5C4JK 2VQRA 3GTLC 4CYRA 2NVXC 2ZUFA 3S14K 3FKIA 1INNA 1R9TK 1ZEBA 2R93A 1TWAK 4B56A 1K83K 2JH3A 2ZFZA 3HOZK 2FQOA 3JSTA 2W5WA 2KWAA 3HKZL 1SFOA 2D6FC 4BXXC 1URBA 1IQ0A 1J98A 4BY7K 3NKQA 5C3EK 1Y1VC 1VGXA 3GEHA 3S1MC 1EW2A 1ZEFA 1JVIA 4GTEA 1B4AA 4A3GK 1Y1WK 2NVXK 1KHKA 2PHCB 1TWHK 1BJTA 4Y7NC 4UPHA 1O28A 2XCOA 2Y0SD 5TMCA 1ED8A 5M5YK 4A93C 3ERED 1R9TA 3OPFA 5LRMA 1WQFA 4FZBA 1TWAA 4N7TA 3IGZB 1K83A 3GTKA 3G4CA 3PO2C 4LREA 2WAQL 4MEXA 3S2DC 5IP7C 5IYBC 3S1QC 3UNYA 4A3BC 3HOWC 4XSZA 4A3JK 4WILA 1YX2A 1IW7A 3NUHA 3S0XA 3ED4A 5TMFA 4CXUA 1HJKA 4BY1K 3BDGB 3MMLB 4ZH4A 3S2HC 4KAYA 4A3DK 2IUCA 1Y1WA 1BDFA 4GFQA 3B5QA 3TG0A 1XXCA 1IBAA 1TWHA 1WIHA 4P5AA 3WODA 1USOA 2WB1L 2GSOA 4A3IC 1E33P 2NVQC 2PA8D 3DYCA 5DLTA 1ALIA 1KHLA 4GTDA 3RZDK 2W5XA 3S1QK 4GTFA 4A3MK 3M3YK 4KMUA 4YFKA 4GTYA 3N3YA 5M3MK 2NVTK 3H0GK 1X31C 4A3EC 4ZG9A 1AJCA 1F93A 3N0BA 1SHQA 1O2BA 3GTPK 4G7OA 2PPBA 2W8SA 4KAWX 4OIRA 1AUKA 4YR1A 3UN3A 3S17K 2ZKTA 1KH4A 1P49A 5IOTA 2JA5C 5C4XC 3A52A 3NVLA 1JQWA 4LRDA 2R7ZK 3BDFA 1XZQA 4LR8A 1K7HA 1KQ4A 3M8ZA 1N2LA 3GTOC 5C66A 3HOVC 4MY4A 4NWJA 3S1NC 5IP9C 3LXQA 3TFJA 4C3IK 5E68A 1O98A 4QAXA 2YU9K 2VUMC 1I3QC 1I6VA 5LIAA 3IPJA 3H0GA 4C3HK 3MK0A 3LPXA 3HOXK 3GTPA 1XPPA 4NOIA 1FSUA 2XCRB 3KD8A 3MK1A 1WCMK 3HOYC 2R7ZA 3HOUC 1PJ7A 1ZEDA 5IP9K 2E2IC 5LRNA 4C3JK 1KH9A 1AJAA 5L0KA 2R92A 3TFIA 4G0VA 5K4PA 4P9SA 4P5BA 2O5JA 4KM8A 2EBBA 4C2MC 1J6XA 4BLAA 4PABA 1KHJA 4MHXA 2YU9A 1YNNA 4YFXA 4KMDA 4G0WA 3HOUK 1HQMA 4AYBD 3PO3C 1ZXOA 2JA7C 4LLGA 3OEPA 1WCMA 2IUCB 5L46A 1HQAA 4ILDA 4KB4A 2B63K 2W5QA 3FOFA 1O99A 4QIWD 1ANJA 1VLOA 3NKNA 2NVYK 2RGRA 1ZVUA 3GTMK 1G51A 4JK1A 1EH1A 1AB4A 3GSIA 3GTLK 4WJ4A 5IYCC 3HXAA 4RMFA 3S16C 3AQPA 1F7UA 3WAWA 3VA7A 4TN0A 3WAVA 4BBSC 4KDDA 4BXXK 4O2DA 4LRFA 1TWCC 1DCOA 1F7VA 1O29A 2W5SA 1Y1VK 3H3VL 2FQTA 4GTXA 3S1MK 5C44C 2V6TA 1XZQB 2B63A 1EFWA 2XRGA 1ALHA 3WBHA 4MEYA 2NVYA 1EW8A 2GAGC 4Y7NK 3GTMA 2JA6C 1HI9A 5IYDC 3GTLA 2NVXA 3M7VA 3UO0A 4A93K 1WSVA 5CJ9A 4Q4ZA 3G4AA 4BBRC 1ALJA 5GRRA 1XXAA 4KJGA 3SZYA 3PO2K 2E2HC 3S2DK 5IP7K 5IYBK 4FDJA 4A3BK 2E2JC 1VRQC 2JA8C 3HOWK 4UPKA 3M4OC 4C45A 4A3CC 4A3FC 2ANHA 4YFNA 3AH5A 1V5VA 2PMZD 3S15C 1C0AA 3S2HK 2V6UA 5GOVA 1TWFC 3GTJC 2G9YA 1EQRA 3AD7C 1TWGC 5M3FK 4A3IK 2NVQK 3IDDA 4A3KC 2Y0SL 4GTCA 4QJVA 4UOPA 3T01A 3RZOC 1IE0A 1EJJA 4ZG7A 4A3FK 3CQZC 1RU0A 3A8JA 3EQLA 3OT9A 4CXSA 3GTGC 3S15K 1I50C 1ALKA 4A3EK 4GT9A 4OIPA 4AH6A 3NKOA 1L0WA 1VJEA 3BUEA 2W8DA 4LK0A 4Y52C 3I4NC 5C4XK 3OREA 2JA5K 3GTQC 3M8YA 4UORA 2P8TA 1AJDA 3FKIC 1J6VA 2PA8L 4X6AC 4J3NA 3GTOK 2R93C 3HOVK 5L0EA 3S1NK 3I4MC 2W7VA 1ZBSA 1ISEA 3HKZD 1SFOC 4XSXA 1WQHA 5JVOA 2VUMK 3DPCA 1I3QK 4KASA 4GZYA 3MK2A 4LR2A 1Y6VA 2X98A 5LQQA 1AJBA 4LRBA 3S1RC 3GIRA 1I6HC 2A69A 3K7AC 5FLMC 1ZYRA 3HOYK 1N2KA 2GLQA 2XR9A 5C4JC 4ZG6A 4GTBA 4FM9A 5DLWA 2E2IK 1B8JA 1O2AA 1DD5A 1ED9A 3NKMA 1R9TC 5M5WK 1XZPA 1EW9A 1TWAC 4KN4A 3GTOA 1K83C 3GTKC 4KARA 2WAQD 1EK8A 2Y3PA 4KMHA 4LOWA 4C2MK 3L4KA 1KH5A 4GTZA 4CYSA 4CXKA 3GEIA 4YG2A 2VUMA 1DCPA 4BY7C 1I3QA 3AD8C 2IFYA 1URAA 2W5VA 3GEEA 4KB2A 5D4DA 1YNJA 1WORA 1UV7A 1E2SP 4A3GC 1Y1WC 3PO3K 2JA7K 2A68A 1TWHC 3IGYB 1PJ6A 2WB1D 1O27A 1O25A 4LR9A 5KXAA 1WOPA 3GTKK 1ANIA 1YCLA 1SMYA 5IJQA 2E2IA 5TJ3A 4GTLA 1WOOA 1SHNA 2CFAB 2BE5A 1BGWA 2XCQA 2W5RA 4A3LC 5L0BA 1JOEA 5IORA 5M5XK 4QJVB 2GSUA 3M8WA 2P5MA
chains in the Genus database with same CATH topology
1Y7AA 3NKPA 1ELZA 2GSNA 4LRCA 5GOVA 4LQYA 3MK0A 3NKRA 2G9YA 5AJ9A 4UPLA 1ELYA 3TX0A 1ELXA 1FSUA 2VQRA 4CYRA 2QZUA 3IDDA 1EQJA 3BDHA 3KD8A 3MK1A 5EGEA 1ZEBA 3E2DA 4UOPA 4B56A 3T01A 1ZEDA 5LRNA 2GA3A 1KH9A 1AJAA 5L0KA 1EJJA 4ZG7A 2W5WA 1URBA 3OT9A 5K4PA 4CXSA 1ALKA 3NKQA 3CMRA 3NKOA 1EW2A 4ZGAA 1ZEFA 1KHJA 4MHXA 3UN5A 3T02A 2W8DA 5INHA 5IJSA 3M8YA 1KHKA 4UORA 3WAYA 1AJDA 3M8WA 4UPHA 1ED8A 2W5TA 3T00A 5LRMA 5L0EA 1KH7A 5LIAA 2IUCB 4N7TA 3IGZB 1HQAA 4LREA 4KJDA 3DPCA 2W5QA 3UNYA 1O99A 1ANJA 3NKNA 3MK2A 4KM4A 3ED4A 4LR2A 1Y6VA 2X98A 4CXUA 5LQQA 1HJKA 5HRTA 3BDGB 1AJBA 4KAYA 4LRBA 1KHNA 3TWZA 3WAXA 2IUCA 5EGHA 3B5QA 2D1GA 3TG0A 1N2KA 2GLQA 2XR9A 4NWXA 3WAWA 4ZG6A 4FDIA 2GSOA 4TN0A 1E33P 1B8JA 3DYCA 5DLWA 3WAVA 5DLTA 1ALIA 1ED9A 1KHLA 3NKMA 2W5XA 3UN2A 4LRFA 1EW9A 1E3CP 3BDGA 4MIVA 2W5SA 4GTYA 4KAVA 4GTXA 4GTZA 4CYSA 1KH5A 4CXKA 4ZG9A 2IFYA 2W5VA 1SHQA 1URAA 1AJCA 1EI6A 1ALHA 2XRGA 3WBHA 2W8SA 3Q3QA 1E1ZP 1AUKA 1EW8A 4YR1A 4LR7A 3UN3A 2RH6A 1E2SP 1KH4A 2ZKTA 1P49A 4UPIA 3A52A 3NVLA 3M7VA 4LRDA 3UO0A 3IGYB 4GTWA 3BDFA 5DLVA 4LR9A 5KXAA 1ALJA 1HDHA 4KJGA 1K7HA 3SZYA 4LR8A 3M8ZA 5GRRA 5IJQA 4LRAA 1N2LA 1ANIA 5TJ3A 4UOOA 5C66A 1SHNA 4MY4A 4FDJA 4NWJA 3LXQA 4UPKA 2W5RA 1O98A 5L0BA 2ANHA 4QAXA 2GSUA 3SZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y7A A;  3NKP A;  1ELZ A;  2GSN A;  4LRC A;  5GOV A;  4LQY A;  3MK0 A;  3NKR A;  2G9Y A;  5AJ9 A;  4UPL A;  1ELY A;  3TX0 A;  1ELX A;  1FSU A;  2VQR A;  4CYR A;  2QZU A;  3IDD A;  1EQJ A;  3BDH A;  3KD8 A;  3MK1 A;  5EGE A;  1ZEB A;  3E2D A;  4UOP A;  4B56 A;  3T01 A;  1ZED A;  5LRN A;  2GA3 A;  1KH9 A;  1AJA A;  5L0K A;  1EJJ A;  4ZG7 A;  2W5W A;  1URB A;  3OT9 A;  5K4P A;  4CXS A;  1ALK A;  3NKQ A;  3CMR A;  3NKO A;  1EW2 A;  4ZGA A;  1ZEF A;  1KHJ A;  4MHX A;  3UN5 A;  3T02 A;  2W8D A;  5INH A;  5IJS A;  3M8Y A;  1KHK A;  4UOR A;  3WAY A;  1AJD A;  3M8W A;  4UPH A;  1ED8 A;  2W5T A;  3T00 A;  5LRM A;  5L0E A;  1KH7 A;  5LIA A;  2IUC B;  4N7T A;  3IGZ B;  1HQA A;  4LRE A;  4KJD A;  3DPC A;  2W5Q A;  3UNY A;  1O99 A;  1ANJ A;  3NKN A;  3MK2 A;  4KM4 A;  3ED4 A;  4LR2 A;  1Y6V A;  2X98 A;  4CXU A;  5LQQ A;  1HJK A;  5HRT A;  3BDG B;  1AJB A;  4KAY A;  4LRB A;  1KHN A;  3TWZ A;  3WAX A;  2IUC A;  5EGH A;  3B5Q A;  2D1G A;  3TG0 A;  1N2K A;  2GLQ A;  2XR9 A;  4NWX A;  3WAW A;  4ZG6 A;  4FDI A;  2GSO A;  4TN0 A;  1E33 P;  1B8J A;  3DYC A;  5DLW A;  3WAV A;  5DLT A;  1ALI A;  1ED9 A;  1KHL A;  3NKM A;  2W5X A;  3UN2 A;  4LRF A;  1EW9 A;  1E3C P;  3BDG A;  4MIV A;  2W5S A;  4GTY A;  4KAV A;  4GTX A;  4GTZ A;  4CYS A;  1KH5 A;  4CXK A;  4ZG9 A;  2IFY A;  2W5V A;  1SHQ A;  1URA A;  1AJC A;  1EI6 A;  1ALH A;  2XRG A;  3WBH A;  2W8S A;  3Q3Q A;  1E1Z P;  1AUK A;  1EW8 A;  4YR1 A;  4LR7 A;  3UN3 A;  2RH6 A;  1E2S P;  1KH4 A;  2ZKT A;  1P49 A;  4UPI A;  3A52 A;  3NVL A;  3M7V A;  4LRD A;  3UO0 A;  3IGY B;  4GTW A;  3BDF A;  5DLV A;  4LR9 A;  5KXA A;  1ALJ A;  1HDH A;  4KJG A;  1K7H A;  3SZY A;  4LR8 A;  3M8Z A;  5GRR A;  5IJQ A;  4LRA A;  1N2L A;  1ANI A;  5TJ3 A;  4UOO A;  5C66 A;  1SHN A;  4MY4 A;  4FDJ A;  4NWJ A;  3LXQ A;  4UPK A;  2W5R A;  1O98 A;  5L0B A;  2ANH A;  4QAX A;  2GSU A;  3SZZ A; 
#chains in the Genus database with same CATH topology
 1Y7A A;  4A3J C;  4BLB A;  3NKP A;  2GSN A;  4PAA A;  4LQY A;  5IYC K;  3NKR A;  5AJ9 A;  4UPL A;  1ELY A;  5IOQ A;  4BY1 C;  3S16 K;  1BS2 A;  1ELX A;  3DXJ A;  4A3D C;  3A8I A;  4OIQ A;  2QZU A;  1EQJ A;  4AYB L;  3BDH A;  3GDZ A;  4BBS K;  2JA7 A;  5EGE A;  3N0C A;  3E2D A;  3V4G A;  3AD9 C;  1TWC K;  5FJ8 K;  1GE9 A;  2GA3 A;  3RZD C;  4A3L K;  4M1X A;  4OIN A;  1WOS A;  5C44 K;  4A3M C;  3M3Y C;  4QIW L;  3CMR A;  3LAP A;  4ZGA A;  1Y1V A;  4OIO A;  4WJ3 M;  3UN5 A;  3T02 A;  2A6H A;  2NVT C;  3H0G C;  5INH A;  4KM9 A;  5IJS A;  3GTP C;  3FHZ A;  2JA6 K;  5IYD K;  4MQ9 A;  4BBR K;  3S17 C;  3WAY A;  2CFA A;  4KMA A;  3BP8 C;  2GAH C;  1PJ5 A;  4DDQ A;  2E2H K;  1O24 A;  2R7Z C;  1XXB A;  2W5T A;  3T00 A;  4G7Z A;  1IL2 A;  1O2F B;  1KH7 A;  2E2J K;  2JA8 K;  2R92 C;  1TWC A;  5CHP A;  3M4O K;  4A3C K;  4KJD A;  4GTA A;  1USM A;  4C3I C;  1ZQ1 C;  2A6E A;  3BP3 A;  5IOS A;  1TWF K;  1XZP B;  3GTJ K;  4KM4 A;  3A8K A;  3AQO A;  2YU9 C;  1WSR A;  4KC6 A;  5HRT A;  2V6S A;  1TWG K;  4BKW A;  4KN7 A;  4XLN A;  1KHN A;  3TWZ A;  3WAX A;  4C3H C;  1J6W A;  4A3K K;  5EGH A;  3HOX C;  2JA6 A;  2D1G A;  4LK1 A;  4NWX A;  3RZO K;  4FDI A;  4KAT A;  2R92 K;  4G0U A;  2CW0 A;  1DCH A;  3CQZ K;  3UN2 A;  1WCM C;  2E2H A;  1O26 A;  1E3C P;  3GTG K;  3BDG A;  1I50 K;  4C3J C;  4MIV A;  1F9N A;  4KAV A;  1B4B A;  3FOE A;  4Y52 K;  2PMZ L;  3I4N K;  1EI6 A;  3GTQ K;  3Q3Q A;  1VH2 A;  1E1Z P;  1TWF A;  3GTJ A;  4LR7 A;  3QX3 A;  2RH6 A;  1IS1 A;  1TWG A;  4LJZ A;  3FKI K;  4UPI A;  2JA5 A;  4X6A K;  2R93 K;  5JFE A;  4GTW A;  5DLV A;  3LAJ A;  1HDH A;  3I4M K;  4LRA A;  3S14 C;  4XCH A;  1SFO K;  3TTG A;  4UOO A;  5HL8 A;  3L4J A;  3TFH A;  3CQZ A;  3CAG A;  3HOZ C;  3H3V D;  1WQG A;  3GTG A;  4Q5S A;  1I50 A;  4XLP A;  2B63 C;  2O5I A;  3ADA C;  3SZZ A;  5C3E C;  3S1R K;  2NVY C;  4G7H A;  1I6H K;  1ELZ A;  4LRC A;  3K7A K;  5FLM K;  3GTQ A;  3GTM C;  2ZUE A;  3TX0 A;  5C4J K;  2VQR A;  3GTL C;  4CYR A;  2NVX C;  2ZUF A;  3S14 K;  3FKI A;  1INN A;  1R9T K;  1ZEB A;  2R93 A;  1TWA K;  4B56 A;  1K83 K;  2JH3 A;  2ZFZ A;  3HOZ K;  2FQO A;  3JST A;  2W5W A;  2KWA A;  3HKZ L;  1SFO A;  2D6F C;  4BXX C;  1URB A;  1IQ0 A;  1J98 A;  4BY7 K;  3NKQ A;  5C3E K;  1Y1V C;  1VGX A;  3GEH A;  3S1M C;  1EW2 A;  1ZEF A;  1JVI A;  4GTE A;  1B4A A;  4A3G K;  1Y1W K;  2NVX K;  1KHK A;  2PHC B;  1TWH K;  1BJT A;  4Y7N C;  4UPH A;  1O28 A;  2XCO A;  2Y0S D;  5TMC A;  1ED8 A;  5M5Y K;  4A93 C;  3ERE D;  1R9T A;  3OPF A;  5LRM A;  1WQF A;  4FZB A;  1TWA A;  4N7T A;  3IGZ B;  1K83 A;  3GTK A;  3G4C A;  3PO2 C;  4LRE A;  2WAQ L;  4MEX A;  3S2D C;  5IP7 C;  5IYB C;  3S1Q C;  3UNY A;  4A3B C;  3HOW C;  4XSZ A;  4A3J K;  4WIL A;  1YX2 A;  1IW7 A;  3NUH A;  3S0X A;  3ED4 A;  5TMF A;  4CXU A;  1HJK A;  4BY1 K;  3BDG B;  3MML B;  4ZH4 A;  3S2H C;  4KAY A;  4A3D K;  2IUC A;  1Y1W A;  1BDF A;  4GFQ A;  3B5Q A;  3TG0 A;  1XXC A;  1IBA A;  1TWH A;  1WIH A;  4P5A A;  3WOD A;  1USO A;  2WB1 L;  2GSO A;  4A3I C;  1E33 P;  2NVQ C;  2PA8 D;  3DYC A;  5DLT A;  1ALI A;  1KHL A;  4GTD A;  3RZD K;  2W5X A;  3S1Q K;  4GTF A;  4A3M K;  3M3Y K;  4KMU A;  4YFK A;  4GTY A;  3N3Y A;  5M3M K;  2NVT K;  3H0G K;  1X31 C;  4A3E C;  4ZG9 A;  1AJC A;  1F93 A;  3N0B A;  1SHQ A;  1O2B A;  3GTP K;  4G7O A;  2PPB A;  2W8S A;  4KAW X;  4OIR A;  1AUK A;  4YR1 A;  3UN3 A;  3S17 K;  2ZKT A;  1KH4 A;  1P49 A;  5IOT A;  2JA5 C;  5C4X C;  3A52 A;  3NVL A;  1JQW A;  4LRD A;  2R7Z K;  3BDF A;  1XZQ A;  4LR8 A;  1K7H A;  1KQ4 A;  3M8Z A;  1N2L A;  3GTO C;  5C66 A;  3HOV C;  4MY4 A;  4NWJ A;  3S1N C;  5IP9 C;  3LXQ A;  3TFJ A;  4C3I K;  5E68 A;  1O98 A;  4QAX A;  2YU9 K;  2VUM C;  1I3Q C;  1I6V A;  5LIA A;  3IPJ A;  3H0G A;  4C3H K;  3MK0 A;  3LPX A;  3HOX K;  3GTP A;  1XPP A;  4NOI A;  1FSU A;  2XCR B;  3KD8 A;  3MK1 A;  1WCM K;  3HOY C;  2R7Z A;  3HOU C;  1PJ7 A;  1ZED A;  5IP9 K;  2E2I C;  5LRN A;  4C3J K;  1KH9 A;  1AJA A;  5L0K A;  2R92 A;  3TFI A;  4G0V A;  5K4P A;  4P9S A;  4P5B A;  2O5J A;  4KM8 A;  2EBB A;  4C2M C;  1J6X A;  4BLA A;  4PAB A;  1KHJ A;  4MHX A;  2YU9 A;  1YNN A;  4YFX A;  4KMD A;  4G0W A;  3HOU K;  1HQM A;  4AYB D;  3PO3 C;  1ZXO A;  2JA7 C;  4LLG A;  3OEP A;  1WCM A;  2IUC B;  5L46 A;  1HQA A;  4ILD A;  4KB4 A;  2B63 K;  2W5Q A;  3FOF A;  1O99 A;  4QIW D;  1ANJ A;  1VLO A;  3NKN A;  2NVY K;  2RGR A;  1ZVU A;  3GTM K;  1G51 A;  4JK1 A;  1EH1 A;  1AB4 A;  3GSI A;  3GTL K;  4WJ4 A;  5IYC C;  3HXA A;  4RMF A;  3S16 C;  3AQP A;  1F7U A;  3WAW A;  3VA7 A;  4TN0 A;  3WAV A;  4BBS C;  4KDD A;  4BXX K;  4O2D A;  4LRF A;  1TWC C;  1DCO A;  1F7V A;  1O29 A;  2W5S A;  1Y1V K;  3H3V L;  2FQT A;  4GTX A;  3S1M K;  5C44 C;  2V6T A;  1XZQ B;  2B63 A;  1EFW A;  2XRG A;  1ALH A;  3WBH A;  4MEY A;  2NVY A;  1EW8 A;  2GAG C;  4Y7N K;  3GTM A;  2JA6 C;  1HI9 A;  5IYD C;  3GTL A;  2NVX A;  3M7V A;  3UO0 A;  4A93 K;  1WSV A;  5CJ9 A;  4Q4Z A;  3G4A A;  4BBR C;  1ALJ A;  5GRR A;  1XXA A;  4KJG A;  3SZY A;  3PO2 K;  2E2H C;  3S2D K;  5IP7 K;  5IYB K;  4FDJ A;  4A3B K;  2E2J C;  1VRQ C;  2JA8 C;  3HOW K;  4UPK A;  3M4O C;  4C45 A;  4A3C C;  4A3F C;  2ANH A;  4YFN A;  3AH5 A;  1V5V A;  2PMZ D;  3S15 C;  1C0A A;  3S2H K;  2V6U A;  5GOV A;  1TWF C;  3GTJ C;  2G9Y A;  1EQR A;  3AD7 C;  1TWG C;  5M3F K;  4A3I K;  2NVQ K;  3IDD A;  4A3K C;  2Y0S L;  4GTC A;  4QJV A;  4UOP A;  3T01 A;  3RZO C;  1IE0 A;  1EJJ A;  4ZG7 A;  4A3F K;  3CQZ C;  1RU0 A;  3A8J A;  3EQL A;  3OT9 A;  4CXS A;  3GTG C;  3S15 K;  1I50 C;  1ALK A;  4A3E K;  4GT9 A;  4OIP A;  4AH6 A;  3NKO A;  1L0W A;  1VJE A;  3BUE A;  2W8D A;  4LK0 A;  4Y52 C;  3I4N C;  5C4X K;  3ORE A;  2JA5 K;  3GTQ C;  3M8Y A;  4UOR A;  2P8T A;  1AJD A;  3FKI C;  1J6V A;  2PA8 L;  4X6A C;  4J3N A;  3GTO K;  2R93 C;  3HOV K;  5L0E A;  3S1N K;  3I4M C;  2W7V A;  1ZBS A;  1ISE A;  3HKZ D;  1SFO C;  4XSX A;  1WQH A;  5JVO A;  2VUM K;  3DPC A;  1I3Q K;  4KAS A;  4GZY A;  3MK2 A;  4LR2 A;  1Y6V A;  2X98 A;  5LQQ A;  1AJB A;  4LRB A;  3S1R C;  3GIR A;  1I6H C;  2A69 A;  3K7A C;  5FLM C;  1ZYR A;  3HOY K;  1N2K A;  2GLQ A;  2XR9 A;  5C4J C;  4ZG6 A;  4GTB A;  4FM9 A;  5DLW A;  2E2I K;  1B8J A;  1O2A A;  1DD5 A;  1ED9 A;  3NKM A;  1R9T C;  5M5W K;  1XZP A;  1EW9 A;  1TWA C;  4KN4 A;  3GTO A;  1K83 C;  3GTK C;  4KAR A;  2WAQ D;  1EK8 A;  2Y3P A;  4KMH A;  4LOW A;  4C2M K;  3L4K A;  1KH5 A;  4GTZ A;  4CYS A;  4CXK A;  3GEI A;  4YG2 A;  2VUM A;  1DCP A;  4BY7 C;  1I3Q A;  3AD8 C;  2IFY A;  1URA A;  2W5V A;  3GEE A;  4KB2 A;  5D4D A;  1YNJ A;  1WOR A;  1UV7 A;  1E2S P;  4A3G C;  1Y1W C;  3PO3 K;  2JA7 K;  2A68 A;  1TWH C;  3IGY B;  1PJ6 A;  2WB1 D;  1O27 A;  1O25 A;  4LR9 A;  5KXA A;  1WOP A;  3GTK K;  1ANI A;  1YCL A;  1SMY A;  5IJQ A;  2E2I A;  5TJ3 A;  4GTL A;  1WOO A;  1SHN A;  2CFA B;  2BE5 A;  1BGW A;  2XCQ A;  2W5R A;  4A3L C;  5L0B A;  1JOE A;  5IOR A;  5M5X K;  4QJV B;  2GSU A;  3M8W A;  2P5M A; 
#chains in the Genus database with same CATH homology
 1Y7A A;  3NKP A;  1ELZ A;  2GSN A;  4LRC A;  5GOV A;  4LQY A;  3MK0 A;  3NKR A;  2G9Y A;  5AJ9 A;  4UPL A;  1ELY A;  3TX0 A;  1ELX A;  1FSU A;  2VQR A;  4CYR A;  2QZU A;  3IDD A;  1EQJ A;  3BDH A;  3KD8 A;  3MK1 A;  5EGE A;  1ZEB A;  3E2D A;  4UOP A;  4B56 A;  3T01 A;  1ZED A;  5LRN A;  2GA3 A;  1KH9 A;  1AJA A;  5L0K A;  1EJJ A;  4ZG7 A;  2W5W A;  1URB A;  3OT9 A;  5K4P A;  4CXS A;  1ALK A;  3NKQ A;  3CMR A;  3NKO A;  1EW2 A;  4ZGA A;  1ZEF A;  1KHJ A;  4MHX A;  3UN5 A;  3T02 A;  2W8D A;  5INH A;  5IJS A;  3M8Y A;  1KHK A;  4UOR A;  3WAY A;  1AJD A;  3M8W A;  4UPH A;  1ED8 A;  2W5T A;  3T00 A;  5LRM A;  5L0E A;  1KH7 A;  5LIA A;  2IUC B;  4N7T A;  3IGZ B;  1HQA A;  4LRE A;  4KJD A;  3DPC A;  2W5Q A;  3UNY A;  1O99 A;  1ANJ A;  3NKN A;  3MK2 A;  4KM4 A;  3ED4 A;  4LR2 A;  1Y6V A;  2X98 A;  4CXU A;  5LQQ A;  1HJK A;  5HRT A;  3BDG B;  1AJB A;  4KAY A;  4LRB A;  1KHN A;  3TWZ A;  3WAX A;  2IUC A;  5EGH A;  3B5Q A;  2D1G A;  3TG0 A;  1N2K A;  2GLQ A;  2XR9 A;  4NWX A;  3WAW A;  4ZG6 A;  4FDI A;  2GSO A;  4TN0 A;  1E33 P;  1B8J A;  3DYC A;  5DLW A;  3WAV A;  5DLT A;  1ALI A;  1ED9 A;  1KHL A;  3NKM A;  2W5X A;  3UN2 A;  4LRF A;  1EW9 A;  1E3C P;  3BDG A;  4MIV A;  2W5S A;  4GTY A;  4KAV A;  4GTX A;  4GTZ A;  4CYS A;  1KH5 A;  4CXK A;  4ZG9 A;  2IFY A;  2W5V A;  1SHQ A;  1URA A;  1AJC A;  1EI6 A;  1ALH A;  2XRG A;  3WBH A;  2W8S A;  3Q3Q A;  1E1Z P;  1AUK A;  1EW8 A;  4YR1 A;  4LR7 A;  3UN3 A;  2RH6 A;  1E2S P;  1KH4 A;  2ZKT A;  1P49 A;  4UPI A;  3A52 A;  3NVL A;  3M7V A;  4LRD A;  3UO0 A;  3IGY B;  4GTW A;  3BDF A;  5DLV A;  4LR9 A;  5KXA A;  1ALJ A;  1HDH A;  4KJG A;  1K7H A;  3SZY A;  4LR8 A;  3M8Z A;  5GRR A;  5IJQ A;  4LRA A;  1N2L A;  1ANI A;  5TJ3 A;  4UOO A;  5C66 A;  1SHN A;  4MY4 A;  4FDJ A;  4NWJ A;  3LXQ A;  4UPK A;  2W5R A;  1O98 A;  5L0B A;  2ANH A;  4QAX A;  2GSU A;  3SZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...