3SZYA

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in apo form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
b'MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords phosphonoacetate hydrolase
molecule tags Hydrolase
source organism Sinorhizobium meliloti
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3szyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3szyA01
2ANHA 4TN0A 5DLWA 5IJSA 5DLVA 3UNYA 4LRBA 2QZUA 5DLTA 4CXUA 4FDJA 1EI6A 4UORA 1URAA 4ZG7A 2ZKTA 5IJQA 4GTZA 3E2DA 1ZEBA 3SZZA 1KH7A 4ZG6A 4CXSA 1EW2A 5KXAA 1KHLA 4KJGA 3M8WA 3BDGB 1HQAA 3NKRA 2RH6A 3TX0A 3MK0A 2W5QA 3MK2A 4KM4A 3UO0A 1ZEDA 2GLQA 1E2SP 1ED8A 1AJBA 3BDHA 3WAXA 4CYRA 4UPHA 1N2KA 4KAYA 1Y7AA 3DYCA 4LQYA 3TWZA 2XR9A 4B56A 1ZEFA 3MK1A 4LR7A 1EW8A 1HJKA 3T01A 1EQJA 4LR2A 1K7HA 3B5QA 1E33P 4CXKA 1O99A 5EGHA 4LREA 5L0BA 1AJCA 3CMRA 3SZYA 4MY4A 1KH4A 4LRAA 2IUCA 3M7VA 4FDIA 1ED9A 3ED4A 3NKPA 2XRGA 1KHKA 1ANIA 1EJJA 5GOVA 4LR9A 3T02A 2IFYA 4LRCA 1P49A 2W5VA 1SHNA 1Y6VA 5C66A 3NVLA 4ZGAA 4N7TA 4UPLA 1ALIA 4GTYA 1AJAA 4MIVA 5LRNA 1ALHA 5L0KA 3NKMA 3WBHA 1SHQA 1ALKA 4QAXA 5AJ9A 1EW9A 5TJ3A 4KAVA 4LRDA 3DPCA 5INHA 4UPIA 2W5XA 3UN3A 1E1ZP 1KH9A 3BDGA 3NKOA 1KH5A 2D1GA 4UOPA 3WAYA 5LQQA 2W8DA 3LXQA 4UOOA 1O98A 4KJDA 1E3CP 4MHXA 4ZG9A 5LIAA 2GSUA 2G9YA 3T00A 3IDDA 4NWJA 4LRFA 4CYSA 5HRTA 3BDFA 1KHJA 1ELYA 1URBA 4YR1A 5GRRA 5L0EA 2GSNA 1HDHA 2W5WA 3NKQA 4NWXA 3IGZB 2W5SA 3UN5A 2W8SA 3A52A 3Q3QA 1KHNA 1N2LA 4GTXA 3TG0A 1AUKA 1B8JA 2IUCB 2VQRA 1ANJA 1ALJA 2W5RA 5K4PA 4GTWA 1FSUA 3M8YA 4UPKA 3OT9A 3WAWA 2W5TA 5LRMA 2X98A 5EGEA 2GA3A 3IGYB 1ELXA 3M8ZA 3KD8A 4LR8A 3UN2A 1ELZA 2GSOA 3WAVA 3NKNA 1AJDA
chains in the Genus database with same CATH superfamily
3L4JA 3H3VL 4TN0A 3M4OK 4FZBA 2E2IK 2JA8C 1DCHA 2JH3A 4KMHA 1TWHK 1EI6A 1GE9A 2PA8D 1ZYRA 1Y1VK 3LAJA 3AQOA 3GEEA 3LAPA 4KN4A 2PMZD 1I50A 3S0XA 1EW2A 2VUMK 2JA5C 1XZPB 2NVXK 4LJZA 2NVQK 3M8WA 4PAAA 2E2JK 2GAGC 4A3FC 2W5QA 3MK2A 3HOZK 3WAXA 3GTGA 1Y7AA 2V6SA 3TWZA 4B56A 1O28A 3MK1A 1EW8A 2YU9A 3T01A 1YNJA 1WQGA 1SFOK 2NVYK 2ZFZA 4LR2A 5D4DA 3GTPK 5FJ8K 1O99A 3H0GA 1I6HK 4LLGA 4GTAA 4MEXA 1VRQC 1JOEA 5C4XC 4LRAA 2R7ZK 4A3LC 1ED9A 3H3VD 2CFAA 1KHKA 4KM8A 1EJJA 3GTQA 1RU0A 4GTDA 3M3YK 3T02A 2IFYA 4LRCA 4GTLA 3EQLA 4BY7C 5C66A 1YCLA 4KB2A 4C3JK 3GTGC 4Y7NC 4KASA 4BY1C 4QJVA 1K83K 1TWHA 5LRNA 5L0KA 4C3IC 4KARA 1IL2A 1ALKA 3GTOA 4QAXA 5AJ9A 1F93A 1EW9A 2R92C 3S1QK 3DPCA 4KAVA 1I50K 2E2HA 4UPIA 1WOPA 2E2JC 1E1ZP 4BBSK 1KH5A 5JVOA 3FHZA 1Y1WC 1XXAA 1O98A 1F9NA 3IDDA 5LIAA 3S14K 2WAQD 4NWJA 1BS2A 5IP7K 4BBSC 1ISEA 3N0BA 4M1XA 3V4GA 3S17K 1EH1A 2WB1L 4A93C 1TWHC 3MMLB 1I50C 1DCOA 4YFNA 5C44C 5IP9C 1X31C 4NWXA 4GFQA 2B63C 3RZDC 2R93C 3FOEA 2JA6A 2FQTA 3HOVK 4Y52K 3GTLK 3LPXA 3Q3QA 3HOXC 1O24A 1KHNA 3GTLC 4KATA 4J3NA 4BY1K 4GTXA 1O29A 3L4KA 4C3JC 1O2AA 5IP9K 5LRMA 1YX2A 4GTWA 3HKZD 4UPKA 3HOWC 1I3QC 4GT9A 3S1RK 3M8ZA 1ELXA 3FKIA 3UN2A 3HOUC 5FLMK 4KB4A 4XLPA 2GSOA 1ELZA 3A8JA 5DLWA 4Q5SA 2ANHA 5C4JC 1HQMA 5IJSA 3UNYA 1O27A 5C4XK 5DLTA 1K83A 2Y3PA 3GTOC 4UORA 4AYBD 2JA5A 3E2DA 3GTLA 1PJ6A 3SZZA 3CQZC 2A6HA 4BLAA 4YFXA 5KXAA 1TWAK 3N3YA 1C0AA 4KJGA 4C3IK 3NKRA 2RH6A 2XCQA 3GIRA 4Q4ZA 2JA7C 1ED8A 4DDQA 2GAHC 4UPHA 1N2KA 2JA7A 1XXBA 3GTMA 1AB4A 2VUMC 1HI9A 1K7HA 4XCHA 2ZUEA 4NOIA 3I4NK 5L0BA 4C2MK 5JFEA 3TFHA 1AJCA 4C2MC 3CMRA 1I6HC 3SZYA 4MY4A 2E2IC 2JA8K 1L0WA 3FOFA 3M7VA 1TWFC 2P8TA 1TWGK 1ANIA 3GTPC 3HOYC 5GOVA 4LR9A 1ZXOA 4WJ4A 3AD9C 3GTKA 1SMYA 4OIRA 1USMA 2JA7K 2NVTK 4UPLA 1UV7A 1ALIA 1XXCA 4A3FK 2PMZL 4MIVA 3NKMA 1EFWA 2YU9K 3WBHA 3CQZK 5IYDC 1SFOA 2JA5K 3GTMC 2JA6C 4LRDA 1BGWA 2CFAB 1KH9A 3TFIA 3BDGA 3NKOA 1XZPA 1WOSA 2D1GA 3S16K 4A3IK 5LQQA 3S1RC 2W8DA 4UOOA 1V5VA 4KDDA 4GTFA 1IW7A 3PO3K 3I4MC 4G7HA 4WILA 4AH6A 1DCPA 1JQWA 2WB1D 1J98A 3RZDK 3S1NC 3NKQA 3TTGA 5C44K 4QIWD 1IE0A 4A93K 1JVIA 2FQOA 1VJEA 3AH5A 4A3GC 3QX3A 3ADAC 4KAWX 4OIPA 3HXAA 1B8JA 4P5BA 4C3HK 1EK8A 1FSUA 3WAWA 2E2HK 2P5MA 2W5TA 1TWFA 5EGEA 4A3JK 2GA3A 3KD8A 4LR8A 4JK1A 2Y0SD 3WAVA 2O5IA 3GTQC 4A3BC 4A3CC 4LRBA 4P9SA 4A3EK 4A3GK 2QZUA 4CXUA 5TMCA 4FDJA 2ZUFA 4A3KK 5IJQA 2R92K 4GTZA 3N0CA 1WORA 2NVTC 1KH7A 1TWCK 4CXSA 4BXXC 1EQRA 1KHLA 4BY7K 1Y1VA 3S2HK 3HOYK 1HQAA 3K7AK 2BE5A 4Y7NK 3TX0A 1TWGC 1XZQB 1TWFK 4C45A 4XLNA 4KM4A 2A6EA 4X6AC 2GLQA 3BDHA 4CYRA 4KMUA 1VGXA 5M5WK 1KQ4A 4MQ9A 4LQYA 3DYCA 2R7ZC 4A3LK 2XR9A 1USOA 1ZEFA 1WIHA 4G7OA 1EQJA 1WOOA 4X6AK 3B5QA 1E33P 4WJ3M 5EGHA 4LREA 1B4BA 2NVYA 1TWCA 3PO2C 3HKZL 3ERED 1WCMK 2Y0SL 4FDIA 4YFKA 1XPPA 3ED4A 2XRGA 3NKPA 1WCMC 2D6FC 1TWAA 3OPFA 1BJTA 4XSXA 3CAGA 3A8IA 4A3MC 1PJ7A 1SHNA 1Y6VA 4A3CK 4A3BK 2NVXC 3NVLA 4ZGAA 4OINA 3GTQK 5IORA 1PJ5A 5IOSA 1Y1WA 4GTYA 3GTOK 1B4AA 2NVQC 1AJAA 1ALHA 1SHQA 5IYBK 1R9TA 3GEHA 5C4JK 3I4NC 3S1MC 3S2DC 1XZQA 5FLMC 1R9TC 3GTKC 3K7AC 3HOWK 4KMAA 3IPJA 3M4OC 3S2HC 1WSRA 3G4CA 4BBRK 3LXQA 4A3DK 3GEIA 1E3CP 4BXXK 4A3DC 3T00A 2G9YA 1TWGA 2E2IA 4KM9A 4LRFA 5C3EK 4BLBA 3BDFA 5TMFA 4Y52C 3S15K 1ELYA 2WAQL 4KN7A 4QJVB 2XCRB 3GTKK 1TWAC 3GDZA 3WODA 2GSNA 5L0EA 3VA7A 4A3EC 4G0VA 2W7VA 3S1MK 3S2DK 2KWAA 5IYBC 4A3IC 2NVXA 5IP7C 2W5SA 3IGZB 3OEPA 3GTJK 4LK1A 4RMFA 2CW0A 3CQZA 2JA6K 4C3HC 1J6WA 1ANJA 5K4PA 1O2FB 2YU9C 3OT9A 5IOQA 1INNA 4A3MK 2X98A 3HOUK 2O5JA 3AQPA 1I3QK 3NKNA 5C3EC 3BP8C 5DLVA 3FKIK 3H0GK 2EBBA 4PABA 2PA8L 3AD8C 4G0UA 3HOVC 1URAA 1ZVUA 4BKWA 1DD5A 2ZKTA 2R7ZA 4ZG7A 1ZEBA 1R9TK 4ZG6A 4AYBL 1F7UA 2V6UA 3BDGB 3S16C 1I6VA 3S17C 2PHCB 3GSIA 2R93A 4YG2A 2B63A 3MK0A 3UO0A 3S14C 1ZEDA 4G7ZA 3RZOK 1E2SP 3GTMK 3BUEA 1AJBA 4KAYA 1J6VA 5M5XK 4LR7A 1HJKA 5IYCC 1WQHA 2NVYC 1SFOC 3JSTA 4CXKA 1YNNA 5CHPA 1WQFA 5CJ9A 3NUHA 3GTJA 4OIOA 4GTEA 3HOZC 3PO2K 1K83C 1KH4A 2R92A 2IUCA 4G0WA 4GTCA 3AD7C 4KMDA 5IYCK 4P5AA 2A69A 3RZOC 2RGRA 3M3YC 4A3JC 1I3QA 1P49A 3BP3A 4GTBA 1ZQ1C 1IQ0A 4LK0A 2W5VA 1Y1VC 3G4AA 4N7TA 4GZYA 4OIQA 1VH2A 1J6XA 1VLOA 4MEYA 1BDFA 1IBAA 5HL8A 3OREA 1O25A 5TJ3A 1G51A 5INHA 2VUMA 3FKIC 1TWCC 4XSZA 3HOXK 2W5XA 3UN3A 4ILDA 3I4MK 3PO3C 5L46A 3H0GC 4A3KC 4UOPA 2R93K 3WAYA 2B63K 4LOWA 5M3FK 4KJDA 1WCMA 4MHXA 4ZG9A 2GSUA 4CYSA 1O2BA 5HRTA 1KHJA 1URBA 5E68A 4YR1A 1O26A 5IOTA 5GRRA 3GTPA 2E2HC 1HDHA 2V6TA 2W5WA 4QIWL 5IYDK 1F7VA 2PPBA 4KC6A 3GTJC 1Y1WK 3DXJA 4FM9A 3UN5A 2W8SA 5M3MK 5M5YK 3A52A 1N2LA 3S15C 3S1QC 3TG0A 1AUKA 2IUCB 2VQRA 4O2DA 3S1NK 2A68A 3A8KA 2W5RA 1IS1A 1ALJA 3M8YA 2XCOA 4ZH4A 1ZBSA 3IGYB 4BBRC 1WSVA 3TFJA 1AJDA 3GTGK
chains in the Genus database with same CATH topology
2ANHA 4TN0A 5DLWA 5IJSA 5DLVA 3UNYA 4LRBA 2QZUA 5DLTA 4CXUA 4FDJA 1EI6A 4UORA 1URAA 4ZG7A 2ZKTA 5IJQA 4GTZA 3E2DA 1ZEBA 3SZZA 1KH7A 4ZG6A 4CXSA 1EW2A 5KXAA 1KHLA 4KJGA 3M8WA 3BDGB 1HQAA 3NKRA 2RH6A 3TX0A 3MK0A 2W5QA 3MK2A 4KM4A 3UO0A 1ZEDA 2GLQA 1E2SP 1ED8A 1AJBA 3BDHA 3WAXA 4CYRA 4UPHA 1N2KA 4KAYA 1Y7AA 3DYCA 4LQYA 3TWZA 2XR9A 4B56A 1ZEFA 3MK1A 4LR7A 1EW8A 1HJKA 3T01A 1EQJA 4LR2A 1K7HA 3B5QA 1E33P 4CXKA 1O99A 5EGHA 4LREA 5L0BA 1AJCA 3CMRA 3SZYA 4MY4A 1KH4A 4LRAA 2IUCA 3M7VA 4FDIA 1ED9A 3ED4A 3NKPA 2XRGA 1KHKA 1ANIA 1EJJA 5GOVA 4LR9A 3T02A 2IFYA 4LRCA 1P49A 2W5VA 1SHNA 1Y6VA 5C66A 3NVLA 4ZGAA 4N7TA 4UPLA 1ALIA 4GTYA 1AJAA 4MIVA 5LRNA 1ALHA 5L0KA 3NKMA 3WBHA 1SHQA 1ALKA 4QAXA 5AJ9A 1EW9A 5TJ3A 4KAVA 4LRDA 3DPCA 5INHA 4UPIA 2W5XA 3UN3A 1E1ZP 1KH9A 3BDGA 3NKOA 1KH5A 2D1GA 4UOPA 3WAYA 5LQQA 2W8DA 3LXQA 4UOOA 1O98A 4KJDA 1E3CP 4MHXA 4ZG9A 5LIAA 2GSUA 2G9YA 3T00A 3IDDA 4NWJA 4LRFA 4CYSA 5HRTA 3BDFA 1KHJA 1ELYA 1URBA 4YR1A 5GRRA 5L0EA 2GSNA 1HDHA 2W5WA 3NKQA 4NWXA 3IGZB 2W5SA 3UN5A 2W8SA 3A52A 3Q3QA 1KHNA 1N2LA 4GTXA 3TG0A 1AUKA 1B8JA 2IUCB 2VQRA 1ANJA 1ALJA 2W5RA 5K4PA 4GTWA 1FSUA 3M8YA 4UPKA 3OT9A 3WAWA 2W5TA 5LRMA 2X98A 5EGEA 2GA3A 3IGYB 1ELXA 3M8ZA 3KD8A 4LR8A 3UN2A 1ELZA 2GSOA 3WAVA 3NKNA 1AJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ANH A;  4TN0 A;  5DLW A;  5IJS A;  5DLV A;  3UNY A;  4LRB A;  2QZU A;  5DLT A;  4CXU A;  4FDJ A;  1EI6 A;  4UOR A;  1URA A;  4ZG7 A;  2ZKT A;  5IJQ A;  4GTZ A;  3E2D A;  1ZEB A;  3SZZ A;  1KH7 A;  4ZG6 A;  4CXS A;  1EW2 A;  5KXA A;  1KHL A;  4KJG A;  3M8W A;  3BDG B;  1HQA A;  3NKR A;  2RH6 A;  3TX0 A;  3MK0 A;  2W5Q A;  3MK2 A;  4KM4 A;  3UO0 A;  1ZED A;  2GLQ A;  1E2S P;  1ED8 A;  1AJB A;  3BDH A;  3WAX A;  4CYR A;  4UPH A;  1N2K A;  4KAY A;  1Y7A A;  3DYC A;  4LQY A;  3TWZ A;  2XR9 A;  4B56 A;  1ZEF A;  3MK1 A;  4LR7 A;  1EW8 A;  1HJK A;  3T01 A;  1EQJ A;  4LR2 A;  1K7H A;  3B5Q A;  1E33 P;  4CXK A;  1O99 A;  5EGH A;  4LRE A;  5L0B A;  1AJC A;  3CMR A;  3SZY A;  4MY4 A;  1KH4 A;  4LRA A;  2IUC A;  3M7V A;  4FDI A;  1ED9 A;  3ED4 A;  3NKP A;  2XRG A;  1KHK A;  1ANI A;  1EJJ A;  5GOV A;  4LR9 A;  3T02 A;  2IFY A;  4LRC A;  1P49 A;  2W5V A;  1SHN A;  1Y6V A;  5C66 A;  3NVL A;  4ZGA A;  4N7T A;  4UPL A;  1ALI A;  4GTY A;  1AJA A;  4MIV A;  5LRN A;  1ALH A;  5L0K A;  3NKM A;  3WBH A;  1SHQ A;  1ALK A;  4QAX A;  5AJ9 A;  1EW9 A;  5TJ3 A;  4KAV A;  4LRD A;  3DPC A;  5INH A;  4UPI A;  2W5X A;  3UN3 A;  1E1Z P;  1KH9 A;  3BDG A;  3NKO A;  1KH5 A;  2D1G A;  4UOP A;  3WAY A;  5LQQ A;  2W8D A;  3LXQ A;  4UOO A;  1O98 A;  4KJD A;  1E3C P;  4MHX A;  4ZG9 A;  5LIA A;  2GSU A;  2G9Y A;  3T00 A;  3IDD A;  4NWJ A;  4LRF A;  4CYS A;  5HRT A;  3BDF A;  1KHJ A;  1ELY A;  1URB A;  4YR1 A;  5GRR A;  5L0E A;  2GSN A;  1HDH A;  2W5W A;  3NKQ A;  4NWX A;  3IGZ B;  2W5S A;  3UN5 A;  2W8S A;  3A52 A;  3Q3Q A;  1KHN A;  1N2L A;  4GTX A;  3TG0 A;  1AUK A;  1B8J A;  2IUC B;  2VQR A;  1ANJ A;  1ALJ A;  2W5R A;  5K4P A;  4GTW A;  1FSU A;  3M8Y A;  4UPK A;  3OT9 A;  3WAW A;  2W5T A;  5LRM A;  2X98 A;  5EGE A;  2GA3 A;  3IGY B;  1ELX A;  3M8Z A;  3KD8 A;  4LR8 A;  3UN2 A;  1ELZ A;  2GSO A;  3WAV A;  3NKN A;  1AJD A; 
#chains in the Genus database with same CATH topology
 3L4J A;  3H3V L;  4TN0 A;  3M4O K;  4FZB A;  2E2I K;  2JA8 C;  1DCH A;  2JH3 A;  4KMH A;  1TWH K;  1EI6 A;  1GE9 A;  2PA8 D;  1ZYR A;  1Y1V K;  3LAJ A;  3AQO A;  3GEE A;  3LAP A;  4KN4 A;  2PMZ D;  1I50 A;  3S0X A;  1EW2 A;  2VUM K;  2JA5 C;  1XZP B;  2NVX K;  4LJZ A;  2NVQ K;  3M8W A;  4PAA A;  2E2J K;  2GAG C;  4A3F C;  2W5Q A;  3MK2 A;  3HOZ K;  3WAX A;  3GTG A;  1Y7A A;  2V6S A;  3TWZ A;  4B56 A;  1O28 A;  3MK1 A;  1EW8 A;  2YU9 A;  3T01 A;  1YNJ A;  1WQG A;  1SFO K;  2NVY K;  2ZFZ A;  4LR2 A;  5D4D A;  3GTP K;  5FJ8 K;  1O99 A;  3H0G A;  1I6H K;  4LLG A;  4GTA A;  4MEX A;  1VRQ C;  1JOE A;  5C4X C;  4LRA A;  2R7Z K;  4A3L C;  1ED9 A;  3H3V D;  2CFA A;  1KHK A;  4KM8 A;  1EJJ A;  3GTQ A;  1RU0 A;  4GTD A;  3M3Y K;  3T02 A;  2IFY A;  4LRC A;  4GTL A;  3EQL A;  4BY7 C;  5C66 A;  1YCL A;  4KB2 A;  4C3J K;  3GTG C;  4Y7N C;  4KAS A;  4BY1 C;  4QJV A;  1K83 K;  1TWH A;  5LRN A;  5L0K A;  4C3I C;  4KAR A;  1IL2 A;  1ALK A;  3GTO A;  4QAX A;  5AJ9 A;  1F93 A;  1EW9 A;  2R92 C;  3S1Q K;  3DPC A;  4KAV A;  1I50 K;  2E2H A;  4UPI A;  1WOP A;  2E2J C;  1E1Z P;  4BBS K;  1KH5 A;  5JVO A;  3FHZ A;  1Y1W C;  1XXA A;  1O98 A;  1F9N A;  3IDD A;  5LIA A;  3S14 K;  2WAQ D;  4NWJ A;  1BS2 A;  5IP7 K;  4BBS C;  1ISE A;  3N0B A;  4M1X A;  3V4G A;  3S17 K;  1EH1 A;  2WB1 L;  4A93 C;  1TWH C;  3MML B;  1I50 C;  1DCO A;  4YFN A;  5C44 C;  5IP9 C;  1X31 C;  4NWX A;  4GFQ A;  2B63 C;  3RZD C;  2R93 C;  3FOE A;  2JA6 A;  2FQT A;  3HOV K;  4Y52 K;  3GTL K;  3LPX A;  3Q3Q A;  3HOX C;  1O24 A;  1KHN A;  3GTL C;  4KAT A;  4J3N A;  4BY1 K;  4GTX A;  1O29 A;  3L4K A;  4C3J C;  1O2A A;  5IP9 K;  5LRM A;  1YX2 A;  4GTW A;  3HKZ D;  4UPK A;  3HOW C;  1I3Q C;  4GT9 A;  3S1R K;  3M8Z A;  1ELX A;  3FKI A;  3UN2 A;  3HOU C;  5FLM K;  4KB4 A;  4XLP A;  2GSO A;  1ELZ A;  3A8J A;  5DLW A;  4Q5S A;  2ANH A;  5C4J C;  1HQM A;  5IJS A;  3UNY A;  1O27 A;  5C4X K;  5DLT A;  1K83 A;  2Y3P A;  3GTO C;  4UOR A;  4AYB D;  2JA5 A;  3E2D A;  3GTL A;  1PJ6 A;  3SZZ A;  3CQZ C;  2A6H A;  4BLA A;  4YFX A;  5KXA A;  1TWA K;  3N3Y A;  1C0A A;  4KJG A;  4C3I K;  3NKR A;  2RH6 A;  2XCQ A;  3GIR A;  4Q4Z A;  2JA7 C;  1ED8 A;  4DDQ A;  2GAH C;  4UPH A;  1N2K A;  2JA7 A;  1XXB A;  3GTM A;  1AB4 A;  2VUM C;  1HI9 A;  1K7H A;  4XCH A;  2ZUE A;  4NOI A;  3I4N K;  5L0B A;  4C2M K;  5JFE A;  3TFH A;  1AJC A;  4C2M C;  3CMR A;  1I6H C;  3SZY A;  4MY4 A;  2E2I C;  2JA8 K;  1L0W A;  3FOF A;  3M7V A;  1TWF C;  2P8T A;  1TWG K;  1ANI A;  3GTP C;  3HOY C;  5GOV A;  4LR9 A;  1ZXO A;  4WJ4 A;  3AD9 C;  3GTK A;  1SMY A;  4OIR A;  1USM A;  2JA7 K;  2NVT K;  4UPL A;  1UV7 A;  1ALI A;  1XXC A;  4A3F K;  2PMZ L;  4MIV A;  3NKM A;  1EFW A;  2YU9 K;  3WBH A;  3CQZ K;  5IYD C;  1SFO A;  2JA5 K;  3GTM C;  2JA6 C;  4LRD A;  1BGW A;  2CFA B;  1KH9 A;  3TFI A;  3BDG A;  3NKO A;  1XZP A;  1WOS A;  2D1G A;  3S16 K;  4A3I K;  5LQQ A;  3S1R C;  2W8D A;  4UOO A;  1V5V A;  4KDD A;  4GTF A;  1IW7 A;  3PO3 K;  3I4M C;  4G7H A;  4WIL A;  4AH6 A;  1DCP A;  1JQW A;  2WB1 D;  1J98 A;  3RZD K;  3S1N C;  3NKQ A;  3TTG A;  5C44 K;  4QIW D;  1IE0 A;  4A93 K;  1JVI A;  2FQO A;  1VJE A;  3AH5 A;  4A3G C;  3QX3 A;  3ADA C;  4KAW X;  4OIP A;  3HXA A;  1B8J A;  4P5B A;  4C3H K;  1EK8 A;  1FSU A;  3WAW A;  2E2H K;  2P5M A;  2W5T A;  1TWF A;  5EGE A;  4A3J K;  2GA3 A;  3KD8 A;  4LR8 A;  4JK1 A;  2Y0S D;  3WAV A;  2O5I A;  3GTQ C;  4A3B C;  4A3C C;  4LRB A;  4P9S A;  4A3E K;  4A3G K;  2QZU A;  4CXU A;  5TMC A;  4FDJ A;  2ZUF A;  4A3K K;  5IJQ A;  2R92 K;  4GTZ A;  3N0C A;  1WOR A;  2NVT C;  1KH7 A;  1TWC K;  4CXS A;  4BXX C;  1EQR A;  1KHL A;  4BY7 K;  1Y1V A;  3S2H K;  3HOY K;  1HQA A;  3K7A K;  2BE5 A;  4Y7N K;  3TX0 A;  1TWG C;  1XZQ B;  1TWF K;  4C45 A;  4XLN A;  4KM4 A;  2A6E A;  4X6A C;  2GLQ A;  3BDH A;  4CYR A;  4KMU A;  1VGX A;  5M5W K;  1KQ4 A;  4MQ9 A;  4LQY A;  3DYC A;  2R7Z C;  4A3L K;  2XR9 A;  1USO A;  1ZEF A;  1WIH A;  4G7O A;  1EQJ A;  1WOO A;  4X6A K;  3B5Q A;  1E33 P;  4WJ3 M;  5EGH A;  4LRE A;  1B4B A;  2NVY A;  1TWC A;  3PO2 C;  3HKZ L;  3ERE D;  1WCM K;  2Y0S L;  4FDI A;  4YFK A;  1XPP A;  3ED4 A;  2XRG A;  3NKP A;  1WCM C;  2D6F C;  1TWA A;  3OPF A;  1BJT A;  4XSX A;  3CAG A;  3A8I A;  4A3M C;  1PJ7 A;  1SHN A;  1Y6V A;  4A3C K;  4A3B K;  2NVX C;  3NVL A;  4ZGA A;  4OIN A;  3GTQ K;  5IOR A;  1PJ5 A;  5IOS A;  1Y1W A;  4GTY A;  3GTO K;  1B4A A;  2NVQ C;  1AJA A;  1ALH A;  1SHQ A;  5IYB K;  1R9T A;  3GEH A;  5C4J K;  3I4N C;  3S1M C;  3S2D C;  1XZQ A;  5FLM C;  1R9T C;  3GTK C;  3K7A C;  3HOW K;  4KMA A;  3IPJ A;  3M4O C;  3S2H C;  1WSR A;  3G4C A;  4BBR K;  3LXQ A;  4A3D K;  3GEI A;  1E3C P;  4BXX K;  4A3D C;  3T00 A;  2G9Y A;  1TWG A;  2E2I A;  4KM9 A;  4LRF A;  5C3E K;  4BLB A;  3BDF A;  5TMF A;  4Y52 C;  3S15 K;  1ELY A;  2WAQ L;  4KN7 A;  4QJV B;  2XCR B;  3GTK K;  1TWA C;  3GDZ A;  3WOD A;  2GSN A;  5L0E A;  3VA7 A;  4A3E C;  4G0V A;  2W7V A;  3S1M K;  3S2D K;  2KWA A;  5IYB C;  4A3I C;  2NVX A;  5IP7 C;  2W5S A;  3IGZ B;  3OEP A;  3GTJ K;  4LK1 A;  4RMF A;  2CW0 A;  3CQZ A;  2JA6 K;  4C3H C;  1J6W A;  1ANJ A;  5K4P A;  1O2F B;  2YU9 C;  3OT9 A;  5IOQ A;  1INN A;  4A3M K;  2X98 A;  3HOU K;  2O5J A;  3AQP A;  1I3Q K;  3NKN A;  5C3E C;  3BP8 C;  5DLV A;  3FKI K;  3H0G K;  2EBB A;  4PAB A;  2PA8 L;  3AD8 C;  4G0U A;  3HOV C;  1URA A;  1ZVU A;  4BKW A;  1DD5 A;  2ZKT A;  2R7Z A;  4ZG7 A;  1ZEB A;  1R9T K;  4ZG6 A;  4AYB L;  1F7U A;  2V6U A;  3BDG B;  3S16 C;  1I6V A;  3S17 C;  2PHC B;  3GSI A;  2R93 A;  4YG2 A;  2B63 A;  3MK0 A;  3UO0 A;  3S14 C;  1ZED A;  4G7Z A;  3RZO K;  1E2S P;  3GTM K;  3BUE A;  1AJB A;  4KAY A;  1J6V A;  5M5X K;  4LR7 A;  1HJK A;  5IYC C;  1WQH A;  2NVY C;  1SFO C;  3JST A;  4CXK A;  1YNN A;  5CHP A;  1WQF A;  5CJ9 A;  3NUH A;  3GTJ A;  4OIO A;  4GTE A;  3HOZ C;  3PO2 K;  1K83 C;  1KH4 A;  2R92 A;  2IUC A;  4G0W A;  4GTC A;  3AD7 C;  4KMD A;  5IYC K;  4P5A A;  2A69 A;  3RZO C;  2RGR A;  3M3Y C;  4A3J C;  1I3Q A;  1P49 A;  3BP3 A;  4GTB A;  1ZQ1 C;  1IQ0 A;  4LK0 A;  2W5V A;  1Y1V C;  3G4A A;  4N7T A;  4GZY A;  4OIQ A;  1VH2 A;  1J6X A;  1VLO A;  4MEY A;  1BDF A;  1IBA A;  5HL8 A;  3ORE A;  1O25 A;  5TJ3 A;  1G51 A;  5INH A;  2VUM A;  3FKI C;  1TWC C;  4XSZ A;  3HOX K;  2W5X A;  3UN3 A;  4ILD A;  3I4M K;  3PO3 C;  5L46 A;  3H0G C;  4A3K C;  4UOP A;  2R93 K;  3WAY A;  2B63 K;  4LOW A;  5M3F K;  4KJD A;  1WCM A;  4MHX A;  4ZG9 A;  2GSU A;  4CYS A;  1O2B A;  5HRT A;  1KHJ A;  1URB A;  5E68 A;  4YR1 A;  1O26 A;  5IOT A;  5GRR A;  3GTP A;  2E2H C;  1HDH A;  2V6T A;  2W5W A;  4QIW L;  5IYD K;  1F7V A;  2PPB A;  4KC6 A;  3GTJ C;  1Y1W K;  3DXJ A;  4FM9 A;  3UN5 A;  2W8S A;  5M3M K;  5M5Y K;  3A52 A;  1N2L A;  3S15 C;  3S1Q C;  3TG0 A;  1AUK A;  2IUC B;  2VQR A;  4O2D A;  3S1N K;  2A68 A;  3A8K A;  2W5R A;  1IS1 A;  1ALJ A;  3M8Y A;  2XCO A;  4ZH4 A;  1ZBS A;  3IGY B;  4BBR C;  1WSV A;  3TFJ A;  1AJD A;  3GTG K; 
#chains in the Genus database with same CATH homology
 2ANH A;  4TN0 A;  5DLW A;  5IJS A;  5DLV A;  3UNY A;  4LRB A;  2QZU A;  5DLT A;  4CXU A;  4FDJ A;  1EI6 A;  4UOR A;  1URA A;  4ZG7 A;  2ZKT A;  5IJQ A;  4GTZ A;  3E2D A;  1ZEB A;  3SZZ A;  1KH7 A;  4ZG6 A;  4CXS A;  1EW2 A;  5KXA A;  1KHL A;  4KJG A;  3M8W A;  3BDG B;  1HQA A;  3NKR A;  2RH6 A;  3TX0 A;  3MK0 A;  2W5Q A;  3MK2 A;  4KM4 A;  3UO0 A;  1ZED A;  2GLQ A;  1E2S P;  1ED8 A;  1AJB A;  3BDH A;  3WAX A;  4CYR A;  4UPH A;  1N2K A;  4KAY A;  1Y7A A;  3DYC A;  4LQY A;  3TWZ A;  2XR9 A;  4B56 A;  1ZEF A;  3MK1 A;  4LR7 A;  1EW8 A;  1HJK A;  3T01 A;  1EQJ A;  4LR2 A;  1K7H A;  3B5Q A;  1E33 P;  4CXK A;  1O99 A;  5EGH A;  4LRE A;  5L0B A;  1AJC A;  3CMR A;  3SZY A;  4MY4 A;  1KH4 A;  4LRA A;  2IUC A;  3M7V A;  4FDI A;  1ED9 A;  3ED4 A;  3NKP A;  2XRG A;  1KHK A;  1ANI A;  1EJJ A;  5GOV A;  4LR9 A;  3T02 A;  2IFY A;  4LRC A;  1P49 A;  2W5V A;  1SHN A;  1Y6V A;  5C66 A;  3NVL A;  4ZGA A;  4N7T A;  4UPL A;  1ALI A;  4GTY A;  1AJA A;  4MIV A;  5LRN A;  1ALH A;  5L0K A;  3NKM A;  3WBH A;  1SHQ A;  1ALK A;  4QAX A;  5AJ9 A;  1EW9 A;  5TJ3 A;  4KAV A;  4LRD A;  3DPC A;  5INH A;  4UPI A;  2W5X A;  3UN3 A;  1E1Z P;  1KH9 A;  3BDG A;  3NKO A;  1KH5 A;  2D1G A;  4UOP A;  3WAY A;  5LQQ A;  2W8D A;  3LXQ A;  4UOO A;  1O98 A;  4KJD A;  1E3C P;  4MHX A;  4ZG9 A;  5LIA A;  2GSU A;  2G9Y A;  3T00 A;  3IDD A;  4NWJ A;  4LRF A;  4CYS A;  5HRT A;  3BDF A;  1KHJ A;  1ELY A;  1URB A;  4YR1 A;  5GRR A;  5L0E A;  2GSN A;  1HDH A;  2W5W A;  3NKQ A;  4NWX A;  3IGZ B;  2W5S A;  3UN5 A;  2W8S A;  3A52 A;  3Q3Q A;  1KHN A;  1N2L A;  4GTX A;  3TG0 A;  1AUK A;  1B8J A;  2IUC B;  2VQR A;  1ANJ A;  1ALJ A;  2W5R A;  5K4P A;  4GTW A;  1FSU A;  3M8Y A;  4UPK A;  3OT9 A;  3WAW A;  2W5T A;  5LRM A;  2X98 A;  5EGE A;  2GA3 A;  3IGY B;  1ELX A;  3M8Z A;  3KD8 A;  4LR8 A;  3UN2 A;  1ELZ A;  2GSO A;  3WAV A;  3NKN A;  1AJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...