3SZYA

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in apo form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
molecule keywords phosphonoacetate hydrolase
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3szyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3szyA01
2XR9A 5DLTA 3SZZA 4KJDA 2GSNA 2W5XA 4TN0A 1E2SP 1ALIA 2VQRA 3WBHA 4NWJA 4UPKA 3A52A 1SHQA 1ZEDA 4CXKA 4LRFA 5LRMA 3MK1A 4LREA 3UNYA 4YR1A 1EW8A 2GSOA 4QAXA 3DYCA 4LRAA 3UN5A 2XRGA 5K4PA 2W8SA 3TX0A 5KXAA 4UPLA 1KH4A 3WAYA 3BDFA 2W5TA 3KD8A 5DLVA 1ELXA 1EI6A 1O99A 1P49A 3ED4A 3Q3QA 4LQYA 4UORA 5LRNA 1HJKA 2W8DA 5LQQA 4CXUA 3TWZA 1ANIA 3WAWA 4UOOA 1EQJA 3MK0A 1HQAA 5HRTA 1AJDA 1ED8A 4GTZA 5INHA 4FDIA 3NKRA 4UPHA 5GOVA 1KH7A 3B5QA 3MK2A 3IGYB 3NKMA 4GTWA 4N7TA 3UN2A 2D1GA 5EGHA 3M8ZA 4ZGAA 4LRDA 3E2DA 4LRCA 1KHLA 4KJGA 4ZG9A 1E33P 4UPIA 4ZG7A 1ZEBA 2G9YA 1HDHA 4LR7A 4LR9A 1URBA 4MHXA 5IJQA 1Y7AA 5TJ3A 4MY4A 1AJBA 5IJSA 2GA3A 1N2LA 1ED9A 1AJCA 3M7VA 3NKPA 1AJAA 3IDDA 4B56A 1E1ZP 1ALHA 4CYRA 1B8JA 1ANJA 3TG0A 3BDGB 3IGZB 1URAA 5C66A 1KH5A 1K7HA 3LXQA 4LR2A 1ALJA 2W5WA 4ZG6A 2W5SA 2GLQA 1N2KA 4LRBA 4CXSA 1ELYA 1SHNA 2QZUA 5L0EA 3OT9A 2RH6A 1KHNA 3BDHA 1FSUA 4KAYA 4NWXA 3T02A 1KHKA 4KAVA 3UO0A 1KHJA 1O98A 4LR8A 2IUCA 2IUCB 3NVLA 1EJJA 3NKNA 5DLWA 1EW9A 1AUKA 4FDJA 2W5VA 1ZEFA 3NKQA 5L0BA 2IFYA 4GTXA 4GTYA 1ALKA 5LIAA 1E3CP 3T00A 4CYSA 2W5QA 3CMRA 4UOPA 4KM4A 3WAXA 3SZYA 3UN3A 3BDGA 1Y6VA 3M8YA 3WAVA 5GRRA 1EW2A 5L0KA 2X98A 5AJ9A 2GSUA 2ZKTA 2W5RA 3NKOA 3M8WA 2ANHA 5EGEA 1KH9A 3T01A 4MIVA 1ELZA 3DPCA
chains in the Genus database with same CATH superfamily
1O28A 4LK0A 3A8KA 5DLTA 3I4MK 1O25A 4BLAA 1JQWA 3N0CA 4C2MC 4MEXA 2GSNA 3HOZC 4KJDA 4TN0A 4BY7C 1YNJA 1ZEDA 1IL2A 3LPXA 3FOEA 1WOSA 2E2JK 1J6XA 2O5IA 1EW8A 3GTLK 5IOTA 3GTGA 1C0AA 4YFNA 4AYBL 2Y0SL 5KXAA 2W8SA 1KH4A 4A3CK 3H3VD 1P49A 3PO3K 5LRNA 4LQYA 4C3IK 1XXBA 1I3QA 3HOXC 5LQQA 4C3HK 1HQMA 1ANIA 2YU9K 1R9TA 1WQHA 4J3NA 4C3IC 3S15K 3WAWA 3HOWK 1EQJA 3MK0A 5HRTA 4GTZA 2WAQD 5IP7K 3M4OK 1I6HK 4FDIA 1PJ5A 2R93K 2FQTA 1KQ4A 3B5QA 1I3QK 3GTOA 3NKMA 3H0GK 4OIPA 3M8ZA 3E2DA 4LOWA 1I3QC 4UPIA 1HDHA 4JK1A 4MHXA 5IJQA 1BGWA 3S1MC 2V6SA 3S2HC 3TFIA 1ZBSA 4ZH4A 3NKPA 4FZBA 3HOVK 1B4BA 3N0BA 3NUHA 3HOUC 2BE5A 1I50A 1ALHA 3GTQA 1B8JA 1BDFA 3TG0A 1TWGC 3BDGB 3IGZB 4C2MK 1Y1VA 2EBBA 4BY7K 2YU9A 3DXJA 4A3KC 4KMUA 4A3LC 1SFOK 4KAYA 2RGRA 4NWXA 4P5BA 1KHKA 3UO0A 4GTAA 4G7ZA 1KHJA 4LR8A 1BJTA 4A3GK 3GIRA 3NKNA 1Y1WK 5M5WK 3G4CA 2E2JC 5IYCK 2XCQA 1AUKA 1EW9A 2NVYK 1WOPA 3GTLC 2W5VA 3NKQA 4KB2A 1EK8A 3GTQK 2IFYA 1O27A 4BXXC 3HOYK 1PJ7A 5FLMK 4KM4A 1TWAA 4WILA 4Y7NC 5TMCA 3WAVA 2D6FC 2W5RA 2PA8D 1XXCA 3HOXK 4Y7NK 4A3EK 5IOQA 3GTJC 1WSVA 1VRQC 4QJVA 1Y1VC 2NVXA 4NOIA 1XXAA 3RZDC 4A3DC 1F7VA 1AB4A 1ELZA 2E2IA 3BP3A 2WAQL 4A3EC 3SZZA 3S1MK 1Y1WA 2R93C 3S2HK 1WCMC 2W5XA 1F9NA 2VQRA 3H0GC 3WBHA 3RZDK 4UPKA 1IQ0A 3A52A 4C3JC 4LREA 4YR1A 1ZQ1C 1IW7A 2GSOA 3A8JA 4XLNA 3DYCA 3GTMA 4LRAA 4KMHA 3CAGA 2A6EA 2XRGA 3S14C 4UPLA 4A3KK 3BDFA 2W5TA 5CJ9A 3GEHA 3TFHA 1ELXA 1VGXA 3K7AC 3Q3QA 3QX3A 4OIQA 3GEIA 4GTBA 1I50K 4A3GC 1HI9A 5M3FK 3HKZL 3TWZA 3OEPA 1RU0A 3I4NK 1F93A 4BBSC 4A3LK 3HOZK 3LAPA 4KMDA 4UPHA 3I4NC 5M3MK 3UN2A 4BBRC 3S1RC 1B4AA 2D1GA 4BXXK 4BKWA 1ZYRA 1O2BA 5IOSA 1K83A 4YG2A 4BY1C 1KHLA 1SMYA 1E33P 1WOOA 1ZEBA 3G4AA 1URBA 3S0XA 5IYCC 1Y7AA 5TJ3A 1G51A 5IJSA 3GTJK 4FM9A 3M7VA 2B63A 1AJAA 3IDDA 1JOEA 4B56A 4OIOA 3HOYC 4A3DK 1E1ZP 4XSXA 4CYRA 3GTGC 4KARA 4C3HC 4QIWL 2YU9C 3A8IA 3GTKC 1KH5A 3CQZK 3HKZD 1ALJA 2W5WA 3GTJA 1J6WA 2GLQA 1TWGA 2GAHC 4LRBA 3M3YC 2QZUA 2VUMK 3OT9A 5L0EA 3H3VL 3CQZC 4P9SA 1DCOA 3V4GA 3FOFA 4GTLA 5TMFA 2PMZD 3T02A 3M3YK 3LAJA 2E2HA 2JA5A 4KM8A 1O98A 3AD8C 1WIHA 2IUCB 3K7AK 2GAGC 3GTLA 5IYBK 1ZVUA 1ZEFA 3GTPK 2JA6C 2JA7C 5LIAA 4CYSA 3T00A 3CMRA 4A3FK 3SZYA 3RZOK 2P8TA 3JSTA 3UN3A 3S1NK 3HXAA 4A3JK 2VUMA 2ZFZA 4PABA 5HL8A 3AD7C 3FHZA 1IS1A 2A6HA 1R9TK 3NKOA 1I50C 5JVOA 4ILDA 5EGEA 4BY1K 3T01A 4G0WA 3S16K 4MIVA 1DCHA 4XSZA 4G7HA 1R9TC 2XR9A 4RMFA 4A3IC 3OPFA 4X6AK 5IYDC 3GTOK 5C4JK 3FKIC 1Y1WC 1K83C 1SHQA 2NVYA 5LRMA 5IYDK 3MK1A 4LK1A 3UNYA 1EQRA 3H0GA 3GTKK 1K83K 1XZQA 5FLMC 5C44C 3WODA 2JA8K 3KD8A 2VUMC 3TTGA 1TWAC 2ZUEA 4UORA 5C44K 4A93K 1TWCC 1PJ6A 2W8DA 3GDZA 4WJ3M 3ADAC 4A3BC 4Y52C 1ISEA 2E2IK 2NVQK 1USMA 1XZQB 4MQ9A 4BLBA 4KN4A 1SFOA 4GTCA 1HQAA 4UOOA 1AJDA 1ED8A 1EFWA 2CFAA 1WCMK 4KAWX 1DD5A 3NKRA 5GOVA 1KH7A 3MK2A 2O5JA 4KN7A 3IGYB 4C3JK 1TWHA 1TWFK 2P5MA 5EGHA 1VH2A 4LRCA 1J6VA 3S1NC 1WCMA 4MEYA 2Y0SD 3S14K 3IPJA 2R92K 2PHCB 3GTPC 5IORA 1ED9A 1TWFA 1AJCA 2JA6K 2JA7K 1TWCA 2R7ZK 4A3FC 3GEEA 2R92C 3RZOC 3AQOA 2B63C 2CFAB 1URAA 5C66A 2R7ZC 3ERED 1YCLA 4AH6A 1WQFA 1K7HA 3FKIK 3S17C 4GTEA 3LXQA 4BBSK 2ZUFA 3MMLB 1F7UA 1O2FB 4CXSA 1ELYA 2NVXK 2RH6A 5FJ8K 2PPBA 3BDHA 5JFEA 3S16C 3EQLA 4Q4ZA 5C3EC 4BBRK 3S1RK 4A3IK 3N3YA 3S1QK 4KAVA 1Y1VK 2NVXC 3FKIA 1YX2A 5C4JC 2JA8C 2IUCA 3TFJA 4M1XA 5C3EK 1TWAK 2PMZL 2JA7A 2JA6A 4A93C 4KASA 1TWCK 2R7ZA 4FDJA 1X31C 5D4DA 3L4KA 5L0BA 4A3BK 5M5YK 1J98A 2R92A 1ALKA 3GTGK 3AQPA 4UOPA 2A68A 4GTDA 1Y6VA 4KB4A 1V5VA 2A69A 2WB1D 4WJ4A 5AJ9A 4DDQA 2XCOA 4G0UA 4A3MK 4YFXA 1O26A 3GTMC 1XZPA 2ANHA 4Y52K 1ZXOA 1KH9A 1TWHC 4ZG9A 3DPCA 3OREA 4LR9A 2JH3A 3L4JA 3AD9C 3GTMK 3M4OC 1I6HC 1XPPA 1L0WA 1E2SP 3AH5A 4GTFA 4KM9A 2JA5C 1ALIA 4NWJA 1TWFC 4CXKA 4LRFA 3GTPA 5IYBC 4YFKA 1VJEA 5IP9K 4QAXA 4GFQA 4LLGA 3UN5A 1BS2A 3S17K 2NVTK 5K4PA 3TX0A 1IE0A 3VA7A 3WAYA 3BUEA 4A3JC 5DLVA 1EI6A 3PO2K 1WQGA 4XCHA 1O99A 2NVTC 3ED4A 3HOVC 4KC6A 2V6UA 3S1QC 1HJKA 4CXUA 1TWGK 4GT9A 1IBAA 5C4XC 2CW0A 4X6AC 3GTOC 1VLOA 5INHA 3BP8C 4O2DA 1SFOC 4GZYA 2Y3PA 4GTWA 1WSRA 4N7TA 1YNNA 2FQOA 3GTKA 4ZGAA 4LRDA 4XLPA 2KWAA 4KJGA 5CHPA 2V6TA 4ZG7A 2G9YA 4LR7A 4QJVB 4MY4A 2PA8L 1AJBA 4A3MC 2GA3A 1N2LA 2NVYC 4OINA 3GTQC 1I6VA 3PO3C 1WORA 2XCRB 4G0VA 2W7VA 1ANJA 1EH1A 2E2IC 2NVQC 2WB1L 4LR2A 2JA5K 4ZG6A 2W5SA 1N2KA 4LJZA 3HOWC 2R93A 5E68A 1SHNA 4QIWD 5IP7C 5IP9C 4A3CC 4KDDA 1KHNA 1FSUA 1TWHK 3GSIA 4G7OA 3NVLA 4C45A 1EJJA 3S15C 5DLWA 4PAAA 5M5XK 2E2HK 4AYBD 4GTXA 4GTYA 1O2AA 1E3CP 2W5QA 2B63K 1O24A 3WAXA 5L46A 3BDGA 2E2HC 3S2DC 3M8YA 3PO2C 1GE9A 5GRRA 1EW2A 4P5AA 5L0KA 2X98A 2GSUA 4Q5SA 1UV7A 2ZKTA 1USOA 4KATA 4OIRA 3CQZA 1INNA 1XZPB 3I4MC 3M8WA 3S2DK 5C4XK 1JVIA 3HOUK 1DCPA 1O29A 4KMAA
chains in the Genus database with same CATH topology
2XR9A 5DLTA 3SZZA 4KJDA 2GSNA 2W5XA 4TN0A 1E2SP 1ALIA 2VQRA 3WBHA 4NWJA 4UPKA 3A52A 1SHQA 1ZEDA 4CXKA 4LRFA 5LRMA 3MK1A 4LREA 3UNYA 4YR1A 1EW8A 2GSOA 4QAXA 3DYCA 4LRAA 3UN5A 2XRGA 5K4PA 2W8SA 3TX0A 5KXAA 4UPLA 1KH4A 3WAYA 3BDFA 2W5TA 3KD8A 5DLVA 1ELXA 1EI6A 1O99A 1P49A 3ED4A 3Q3QA 4LQYA 4UORA 5LRNA 1HJKA 2W8DA 5LQQA 4CXUA 3TWZA 1ANIA 3WAWA 4UOOA 1EQJA 3MK0A 1HQAA 5HRTA 1AJDA 1ED8A 4GTZA 5INHA 4FDIA 3NKRA 4UPHA 5GOVA 1KH7A 3B5QA 3MK2A 3IGYB 3NKMA 4GTWA 4N7TA 3UN2A 2D1GA 5EGHA 3M8ZA 4ZGAA 4LRDA 3E2DA 4LRCA 1KHLA 4KJGA 4ZG9A 1E33P 4UPIA 4ZG7A 1ZEBA 2G9YA 1HDHA 4LR7A 4LR9A 1URBA 4MHXA 5IJQA 1Y7AA 5TJ3A 4MY4A 1AJBA 5IJSA 2GA3A 1N2LA 1ED9A 1AJCA 3M7VA 3NKPA 1AJAA 3IDDA 4B56A 1E1ZP 1ALHA 4CYRA 1B8JA 1ANJA 3TG0A 3BDGB 3IGZB 1URAA 5C66A 1KH5A 1K7HA 3LXQA 4LR2A 1ALJA 2W5WA 4ZG6A 2W5SA 2GLQA 1N2KA 4LRBA 4CXSA 1ELYA 1SHNA 2QZUA 5L0EA 3OT9A 2RH6A 1KHNA 3BDHA 1FSUA 4KAYA 4NWXA 3T02A 1KHKA 4KAVA 3UO0A 1KHJA 1O98A 4LR8A 2IUCA 2IUCB 3NVLA 1EJJA 3NKNA 5DLWA 1EW9A 1AUKA 4FDJA 2W5VA 1ZEFA 3NKQA 5L0BA 2IFYA 4GTXA 4GTYA 1ALKA 5LIAA 1E3CP 3T00A 4CYSA 2W5QA 3CMRA 4UOPA 4KM4A 3WAXA 3SZYA 3UN3A 3BDGA 1Y6VA 3M8YA 3WAVA 5GRRA 1EW2A 5L0KA 2X98A 5AJ9A 2GSUA 2ZKTA 2W5RA 3NKOA 3M8WA 2ANHA 5EGEA 1KH9A 3T01A 4MIVA 1ELZA 3DPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR9 A;  5DLT A;  3SZZ A;  4KJD A;  2GSN A;  2W5X A;  4TN0 A;  1E2S P;  1ALI A;  2VQR A;  3WBH A;  4NWJ A;  4UPK A;  3A52 A;  1SHQ A;  1ZED A;  4CXK A;  4LRF A;  5LRM A;  3MK1 A;  4LRE A;  3UNY A;  4YR1 A;  1EW8 A;  2GSO A;  4QAX A;  3DYC A;  4LRA A;  3UN5 A;  2XRG A;  5K4P A;  2W8S A;  3TX0 A;  5KXA A;  4UPL A;  1KH4 A;  3WAY A;  3BDF A;  2W5T A;  3KD8 A;  5DLV A;  1ELX A;  1EI6 A;  1O99 A;  1P49 A;  3ED4 A;  3Q3Q A;  4LQY A;  4UOR A;  5LRN A;  1HJK A;  2W8D A;  5LQQ A;  4CXU A;  3TWZ A;  1ANI A;  3WAW A;  4UOO A;  1EQJ A;  3MK0 A;  1HQA A;  5HRT A;  1AJD A;  1ED8 A;  4GTZ A;  5INH A;  4FDI A;  3NKR A;  4UPH A;  5GOV A;  1KH7 A;  3B5Q A;  3MK2 A;  3IGY B;  3NKM A;  4GTW A;  4N7T A;  3UN2 A;  2D1G A;  5EGH A;  3M8Z A;  4ZGA A;  4LRD A;  3E2D A;  4LRC A;  1KHL A;  4KJG A;  4ZG9 A;  1E33 P;  4UPI A;  4ZG7 A;  1ZEB A;  2G9Y A;  1HDH A;  4LR7 A;  4LR9 A;  1URB A;  4MHX A;  5IJQ A;  1Y7A A;  5TJ3 A;  4MY4 A;  1AJB A;  5IJS A;  2GA3 A;  1N2L A;  1ED9 A;  1AJC A;  3M7V A;  3NKP A;  1AJA A;  3IDD A;  4B56 A;  1E1Z P;  1ALH A;  4CYR A;  1B8J A;  1ANJ A;  3TG0 A;  3BDG B;  3IGZ B;  1URA A;  5C66 A;  1KH5 A;  1K7H A;  3LXQ A;  4LR2 A;  1ALJ A;  2W5W A;  4ZG6 A;  2W5S A;  2GLQ A;  1N2K A;  4LRB A;  4CXS A;  1ELY A;  1SHN A;  2QZU A;  5L0E A;  3OT9 A;  2RH6 A;  1KHN A;  3BDH A;  1FSU A;  4KAY A;  4NWX A;  3T02 A;  1KHK A;  4KAV A;  3UO0 A;  1KHJ A;  1O98 A;  4LR8 A;  2IUC A;  2IUC B;  3NVL A;  1EJJ A;  3NKN A;  5DLW A;  1EW9 A;  1AUK A;  4FDJ A;  2W5V A;  1ZEF A;  3NKQ A;  5L0B A;  2IFY A;  4GTX A;  4GTY A;  1ALK A;  5LIA A;  1E3C P;  3T00 A;  4CYS A;  2W5Q A;  3CMR A;  4UOP A;  4KM4 A;  3WAX A;  3SZY A;  3UN3 A;  3BDG A;  1Y6V A;  3M8Y A;  3WAV A;  5GRR A;  1EW2 A;  5L0K A;  2X98 A;  5AJ9 A;  2GSU A;  2ZKT A;  2W5R A;  3NKO A;  3M8W A;  2ANH A;  5EGE A;  1KH9 A;  3T01 A;  4MIV A;  1ELZ A;  3DPC A; 
#chains in the Genus database with same CATH topology
 1O28 A;  4LK0 A;  3A8K A;  5DLT A;  3I4M K;  1O25 A;  4BLA A;  1JQW A;  3N0C A;  4C2M C;  4MEX A;  2GSN A;  3HOZ C;  4KJD A;  4TN0 A;  4BY7 C;  1YNJ A;  1ZED A;  1IL2 A;  3LPX A;  3FOE A;  1WOS A;  2E2J K;  1J6X A;  2O5I A;  1EW8 A;  3GTL K;  5IOT A;  3GTG A;  1C0A A;  4YFN A;  4AYB L;  2Y0S L;  5KXA A;  2W8S A;  1KH4 A;  4A3C K;  3H3V D;  1P49 A;  3PO3 K;  5LRN A;  4LQY A;  4C3I K;  1XXB A;  1I3Q A;  3HOX C;  5LQQ A;  4C3H K;  1HQM A;  1ANI A;  2YU9 K;  1R9T A;  1WQH A;  4J3N A;  4C3I C;  3S15 K;  3WAW A;  3HOW K;  1EQJ A;  3MK0 A;  5HRT A;  4GTZ A;  2WAQ D;  5IP7 K;  3M4O K;  1I6H K;  4FDI A;  1PJ5 A;  2R93 K;  2FQT A;  1KQ4 A;  3B5Q A;  1I3Q K;  3GTO A;  3NKM A;  3H0G K;  4OIP A;  3M8Z A;  3E2D A;  4LOW A;  1I3Q C;  4UPI A;  1HDH A;  4JK1 A;  4MHX A;  5IJQ A;  1BGW A;  3S1M C;  2V6S A;  3S2H C;  3TFI A;  1ZBS A;  4ZH4 A;  3NKP A;  4FZB A;  3HOV K;  1B4B A;  3N0B A;  3NUH A;  3HOU C;  2BE5 A;  1I50 A;  1ALH A;  3GTQ A;  1B8J A;  1BDF A;  3TG0 A;  1TWG C;  3BDG B;  3IGZ B;  4C2M K;  1Y1V A;  2EBB A;  4BY7 K;  2YU9 A;  3DXJ A;  4A3K C;  4KMU A;  4A3L C;  1SFO K;  4KAY A;  2RGR A;  4NWX A;  4P5B A;  1KHK A;  3UO0 A;  4GTA A;  4G7Z A;  1KHJ A;  4LR8 A;  1BJT A;  4A3G K;  3GIR A;  3NKN A;  1Y1W K;  5M5W K;  3G4C A;  2E2J C;  5IYC K;  2XCQ A;  1AUK A;  1EW9 A;  2NVY K;  1WOP A;  3GTL C;  2W5V A;  3NKQ A;  4KB2 A;  1EK8 A;  3GTQ K;  2IFY A;  1O27 A;  4BXX C;  3HOY K;  1PJ7 A;  5FLM K;  4KM4 A;  1TWA A;  4WIL A;  4Y7N C;  5TMC A;  3WAV A;  2D6F C;  2W5R A;  2PA8 D;  1XXC A;  3HOX K;  4Y7N K;  4A3E K;  5IOQ A;  3GTJ C;  1WSV A;  1VRQ C;  4QJV A;  1Y1V C;  2NVX A;  4NOI A;  1XXA A;  3RZD C;  4A3D C;  1F7V A;  1AB4 A;  1ELZ A;  2E2I A;  3BP3 A;  2WAQ L;  4A3E C;  3SZZ A;  3S1M K;  1Y1W A;  2R93 C;  3S2H K;  1WCM C;  2W5X A;  1F9N A;  2VQR A;  3H0G C;  3WBH A;  3RZD K;  4UPK A;  1IQ0 A;  3A52 A;  4C3J C;  4LRE A;  4YR1 A;  1ZQ1 C;  1IW7 A;  2GSO A;  3A8J A;  4XLN A;  3DYC A;  3GTM A;  4LRA A;  4KMH A;  3CAG A;  2A6E A;  2XRG A;  3S14 C;  4UPL A;  4A3K K;  3BDF A;  2W5T A;  5CJ9 A;  3GEH A;  3TFH A;  1ELX A;  1VGX A;  3K7A C;  3Q3Q A;  3QX3 A;  4OIQ A;  3GEI A;  4GTB A;  1I50 K;  4A3G C;  1HI9 A;  5M3F K;  3HKZ L;  3TWZ A;  3OEP A;  1RU0 A;  3I4N K;  1F93 A;  4BBS C;  4A3L K;  3HOZ K;  3LAP A;  4KMD A;  4UPH A;  3I4N C;  5M3M K;  3UN2 A;  4BBR C;  3S1R C;  1B4A A;  2D1G A;  4BXX K;  4BKW A;  1ZYR A;  1O2B A;  5IOS A;  1K83 A;  4YG2 A;  4BY1 C;  1KHL A;  1SMY A;  1E33 P;  1WOO A;  1ZEB A;  3G4A A;  1URB A;  3S0X A;  5IYC C;  1Y7A A;  5TJ3 A;  1G51 A;  5IJS A;  3GTJ K;  4FM9 A;  3M7V A;  2B63 A;  1AJA A;  3IDD A;  1JOE A;  4B56 A;  4OIO A;  3HOY C;  4A3D K;  1E1Z P;  4XSX A;  4CYR A;  3GTG C;  4KAR A;  4C3H C;  4QIW L;  2YU9 C;  3A8I A;  3GTK C;  1KH5 A;  3CQZ K;  3HKZ D;  1ALJ A;  2W5W A;  3GTJ A;  1J6W A;  2GLQ A;  1TWG A;  2GAH C;  4LRB A;  3M3Y C;  2QZU A;  2VUM K;  3OT9 A;  5L0E A;  3H3V L;  3CQZ C;  4P9S A;  1DCO A;  3V4G A;  3FOF A;  4GTL A;  5TMF A;  2PMZ D;  3T02 A;  3M3Y K;  3LAJ A;  2E2H A;  2JA5 A;  4KM8 A;  1O98 A;  3AD8 C;  1WIH A;  2IUC B;  3K7A K;  2GAG C;  3GTL A;  5IYB K;  1ZVU A;  1ZEF A;  3GTP K;  2JA6 C;  2JA7 C;  5LIA A;  4CYS A;  3T00 A;  3CMR A;  4A3F K;  3SZY A;  3RZO K;  2P8T A;  3JST A;  3UN3 A;  3S1N K;  3HXA A;  4A3J K;  2VUM A;  2ZFZ A;  4PAB A;  5HL8 A;  3AD7 C;  3FHZ A;  1IS1 A;  2A6H A;  1R9T K;  3NKO A;  1I50 C;  5JVO A;  4ILD A;  5EGE A;  4BY1 K;  3T01 A;  4G0W A;  3S16 K;  4MIV A;  1DCH A;  4XSZ A;  4G7H A;  1R9T C;  2XR9 A;  4RMF A;  4A3I C;  3OPF A;  4X6A K;  5IYD C;  3GTO K;  5C4J K;  3FKI C;  1Y1W C;  1K83 C;  1SHQ A;  2NVY A;  5LRM A;  5IYD K;  3MK1 A;  4LK1 A;  3UNY A;  1EQR A;  3H0G A;  3GTK K;  1K83 K;  1XZQ A;  5FLM C;  5C44 C;  3WOD A;  2JA8 K;  3KD8 A;  2VUM C;  3TTG A;  1TWA C;  2ZUE A;  4UOR A;  5C44 K;  4A93 K;  1TWC C;  1PJ6 A;  2W8D A;  3GDZ A;  4WJ3 M;  3ADA C;  4A3B C;  4Y52 C;  1ISE A;  2E2I K;  2NVQ K;  1USM A;  1XZQ B;  4MQ9 A;  4BLB A;  4KN4 A;  1SFO A;  4GTC A;  1HQA A;  4UOO A;  1AJD A;  1ED8 A;  1EFW A;  2CFA A;  1WCM K;  4KAW X;  1DD5 A;  3NKR A;  5GOV A;  1KH7 A;  3MK2 A;  2O5J A;  4KN7 A;  3IGY B;  4C3J K;  1TWH A;  1TWF K;  2P5M A;  5EGH A;  1VH2 A;  4LRC A;  1J6V A;  3S1N C;  1WCM A;  4MEY A;  2Y0S D;  3S14 K;  3IPJ A;  2R92 K;  2PHC B;  3GTP C;  5IOR A;  1ED9 A;  1TWF A;  1AJC A;  2JA6 K;  2JA7 K;  1TWC A;  2R7Z K;  4A3F C;  3GEE A;  2R92 C;  3RZO C;  3AQO A;  2B63 C;  2CFA B;  1URA A;  5C66 A;  2R7Z C;  3ERE D;  1YCL A;  4AH6 A;  1WQF A;  1K7H A;  3FKI K;  3S17 C;  4GTE A;  3LXQ A;  4BBS K;  2ZUF A;  3MML B;  1F7U A;  1O2F B;  4CXS A;  1ELY A;  2NVX K;  2RH6 A;  5FJ8 K;  2PPB A;  3BDH A;  5JFE A;  3S16 C;  3EQL A;  4Q4Z A;  5C3E C;  4BBR K;  3S1R K;  4A3I K;  3N3Y A;  3S1Q K;  4KAV A;  1Y1V K;  2NVX C;  3FKI A;  1YX2 A;  5C4J C;  2JA8 C;  2IUC A;  3TFJ A;  4M1X A;  5C3E K;  1TWA K;  2PMZ L;  2JA7 A;  2JA6 A;  4A93 C;  4KAS A;  1TWC K;  2R7Z A;  4FDJ A;  1X31 C;  5D4D A;  3L4K A;  5L0B A;  4A3B K;  5M5Y K;  1J98 A;  2R92 A;  1ALK A;  3GTG K;  3AQP A;  4UOP A;  2A68 A;  4GTD A;  1Y6V A;  4KB4 A;  1V5V A;  2A69 A;  2WB1 D;  4WJ4 A;  5AJ9 A;  4DDQ A;  2XCO A;  4G0U A;  4A3M K;  4YFX A;  1O26 A;  3GTM C;  1XZP A;  2ANH A;  4Y52 K;  1ZXO A;  1KH9 A;  1TWH C;  4ZG9 A;  3DPC A;  3ORE A;  4LR9 A;  2JH3 A;  3L4J A;  3AD9 C;  3GTM K;  3M4O C;  1I6H C;  1XPP A;  1L0W A;  1E2S P;  3AH5 A;  4GTF A;  4KM9 A;  2JA5 C;  1ALI A;  4NWJ A;  1TWF C;  4CXK A;  4LRF A;  3GTP A;  5IYB C;  4YFK A;  1VJE A;  5IP9 K;  4QAX A;  4GFQ A;  4LLG A;  3UN5 A;  1BS2 A;  3S17 K;  2NVT K;  5K4P A;  3TX0 A;  1IE0 A;  3VA7 A;  3WAY A;  3BUE A;  4A3J C;  5DLV A;  1EI6 A;  3PO2 K;  1WQG A;  4XCH A;  1O99 A;  2NVT C;  3ED4 A;  3HOV C;  4KC6 A;  2V6U A;  3S1Q C;  1HJK A;  4CXU A;  1TWG K;  4GT9 A;  1IBA A;  5C4X C;  2CW0 A;  4X6A C;  3GTO C;  1VLO A;  5INH A;  3BP8 C;  4O2D A;  1SFO C;  4GZY A;  2Y3P A;  4GTW A;  1WSR A;  4N7T A;  1YNN A;  2FQO A;  3GTK A;  4ZGA A;  4LRD A;  4XLP A;  2KWA A;  4KJG A;  5CHP A;  2V6T A;  4ZG7 A;  2G9Y A;  4LR7 A;  4QJV B;  4MY4 A;  2PA8 L;  1AJB A;  4A3M C;  2GA3 A;  1N2L A;  2NVY C;  4OIN A;  3GTQ C;  1I6V A;  3PO3 C;  1WOR A;  2XCR B;  4G0V A;  2W7V A;  1ANJ A;  1EH1 A;  2E2I C;  2NVQ C;  2WB1 L;  4LR2 A;  2JA5 K;  4ZG6 A;  2W5S A;  1N2K A;  4LJZ A;  3HOW C;  2R93 A;  5E68 A;  1SHN A;  4QIW D;  5IP7 C;  5IP9 C;  4A3C C;  4KDD A;  1KHN A;  1FSU A;  1TWH K;  3GSI A;  4G7O A;  3NVL A;  4C45 A;  1EJJ A;  3S15 C;  5DLW A;  4PAA A;  5M5X K;  2E2H K;  4AYB D;  4GTX A;  4GTY A;  1O2A A;  1E3C P;  2W5Q A;  2B63 K;  1O24 A;  3WAX A;  5L46 A;  3BDG A;  2E2H C;  3S2D C;  3M8Y A;  3PO2 C;  1GE9 A;  5GRR A;  1EW2 A;  4P5A A;  5L0K A;  2X98 A;  2GSU A;  4Q5S A;  1UV7 A;  2ZKT A;  1USO A;  4KAT A;  4OIR A;  3CQZ A;  1INN A;  1XZP B;  3I4M C;  3M8W A;  3S2D K;  5C4X K;  1JVI A;  3HOU K;  1DCP A;  1O29 A;  4KMA A; 
#chains in the Genus database with same CATH homology
 2XR9 A;  5DLT A;  3SZZ A;  4KJD A;  2GSN A;  2W5X A;  4TN0 A;  1E2S P;  1ALI A;  2VQR A;  3WBH A;  4NWJ A;  4UPK A;  3A52 A;  1SHQ A;  1ZED A;  4CXK A;  4LRF A;  5LRM A;  3MK1 A;  4LRE A;  3UNY A;  4YR1 A;  1EW8 A;  2GSO A;  4QAX A;  3DYC A;  4LRA A;  3UN5 A;  2XRG A;  5K4P A;  2W8S A;  3TX0 A;  5KXA A;  4UPL A;  1KH4 A;  3WAY A;  3BDF A;  2W5T A;  3KD8 A;  5DLV A;  1ELX A;  1EI6 A;  1O99 A;  1P49 A;  3ED4 A;  3Q3Q A;  4LQY A;  4UOR A;  5LRN A;  1HJK A;  2W8D A;  5LQQ A;  4CXU A;  3TWZ A;  1ANI A;  3WAW A;  4UOO A;  1EQJ A;  3MK0 A;  1HQA A;  5HRT A;  1AJD A;  1ED8 A;  4GTZ A;  5INH A;  4FDI A;  3NKR A;  4UPH A;  5GOV A;  1KH7 A;  3B5Q A;  3MK2 A;  3IGY B;  3NKM A;  4GTW A;  4N7T A;  3UN2 A;  2D1G A;  5EGH A;  3M8Z A;  4ZGA A;  4LRD A;  3E2D A;  4LRC A;  1KHL A;  4KJG A;  4ZG9 A;  1E33 P;  4UPI A;  4ZG7 A;  1ZEB A;  2G9Y A;  1HDH A;  4LR7 A;  4LR9 A;  1URB A;  4MHX A;  5IJQ A;  1Y7A A;  5TJ3 A;  4MY4 A;  1AJB A;  5IJS A;  2GA3 A;  1N2L A;  1ED9 A;  1AJC A;  3M7V A;  3NKP A;  1AJA A;  3IDD A;  4B56 A;  1E1Z P;  1ALH A;  4CYR A;  1B8J A;  1ANJ A;  3TG0 A;  3BDG B;  3IGZ B;  1URA A;  5C66 A;  1KH5 A;  1K7H A;  3LXQ A;  4LR2 A;  1ALJ A;  2W5W A;  4ZG6 A;  2W5S A;  2GLQ A;  1N2K A;  4LRB A;  4CXS A;  1ELY A;  1SHN A;  2QZU A;  5L0E A;  3OT9 A;  2RH6 A;  1KHN A;  3BDH A;  1FSU A;  4KAY A;  4NWX A;  3T02 A;  1KHK A;  4KAV A;  3UO0 A;  1KHJ A;  1O98 A;  4LR8 A;  2IUC A;  2IUC B;  3NVL A;  1EJJ A;  3NKN A;  5DLW A;  1EW9 A;  1AUK A;  4FDJ A;  2W5V A;  1ZEF A;  3NKQ A;  5L0B A;  2IFY A;  4GTX A;  4GTY A;  1ALK A;  5LIA A;  1E3C P;  3T00 A;  4CYS A;  2W5Q A;  3CMR A;  4UOP A;  4KM4 A;  3WAX A;  3SZY A;  3UN3 A;  3BDG A;  1Y6V A;  3M8Y A;  3WAV A;  5GRR A;  1EW2 A;  5L0K A;  2X98 A;  5AJ9 A;  2GSU A;  2ZKT A;  2W5R A;  3NKO A;  3M8W A;  2ANH A;  5EGE A;  1KH9 A;  3T01 A;  4MIV A;  1ELZ A;  3DPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...