3SZYA

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in apo form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
molecule keywords phosphonoacetate hydrolase
molecule tags Hydrolase
source organism Sinorhizobium meliloti
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3szyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3szyA01
5INHA 2W5VA 1ANIA 1B8JA 4KM4A 1ED9A 3T02A 1ZEDA 2W5RA 4GTZA 5EGEA 4LRAA 3DYCA 3BDFA 1AJDA 4UORA 5EGHA 4LRBA 1EJJA 3NKNA 1SHNA 4QAXA 5LIAA 2IUCB 4LR9A 3TX0A 4LR8A 1AJCA 3NVLA 1ZEFA 3NKQA 1O98A 1EW8A 4TN0A 5DLWA 3KD8A 4LREA 1KH7A 3DPCA 2GSOA 3IGZB 1E2SP 1AJAA 2W5XA 5KXAA 2ANHA 2G9YA 4UPKA 1AJBA 1ALKA 4NWJA 2GA3A 5C66A 4FDJA 1ZEBA 1ALHA 4YR1A 1K7HA 4FDIA 1N2KA 4CXSA 4KJGA 3MK2A 1KH4A 2GSNA 1KHNA 4LR7A 5DLTA 2GSUA 2VQRA 2W8SA 4GTWA 1ALIA 4CYRA 3SZZA 1HJKA 4N7TA 3NKRA 4B56A 4UOOA 3UN2A 1EI6A 3A52A 5TJ3A 3UN3A 3IGYB 3WAXA 2IUCA 5LRMA 3UNYA 3NKOA 3BDGB 3CMRA 2QZUA 5L0KA 3Q3QA 3MK1A 3UN5A 4KAVA 4GTXA 4UPHA 5HRTA 3T00A 4ZG9A 1ELYA 1KH5A 2RH6A 3WAWA 4ZG7A 5IJSA 1ELXA 2IFYA 1FSUA 5L0EA 3BDHA 3WAVA 3M8YA 1ELZA 1ALJA 2GLQA 1ANJA 3LXQA 4MIVA 5DLVA 3ED4A 5GOVA 3E2DA 5LRNA 4GTYA 2W8DA 2W5SA 1Y7AA 4KAYA 5K4PA 3UO0A 4ZG6A 1URBA 3B5QA 3M8WA 4LR2A 4LRCA 4MY4A 1EW2A 3NKPA 1KHKA 3IDDA 1N2LA 4MHXA 5L0BA 3SZYA 1AUKA 1KH9A 2W5TA 1E3CP 1ED8A 5GRRA 4LRDA 3TG0A 4KJDA 1Y6VA 4LRFA 1EQJA 4UPIA 3M7VA 2XRGA 4CXUA 2XR9A 1HDHA 1KHJA 4CYSA 5AJ9A 5IJQA 4LQYA 1E33P 3OT9A 1SHQA 1URAA 3MK0A 3NKMA 1HQAA 1KHLA 4UOPA 4ZGAA 3BDGA 2D1GA 4CXKA 5LQQA 3M8ZA 1O99A 3WAYA 2ZKTA 4NWXA 2X98A 1P49A 3T01A 3TWZA 4UPLA 3WBHA 1E1ZP 2W5QA 1EW9A 2W5WA
chains in the Genus database with same CATH superfamily
5INHA 2W5VA 5C4XK 1IW7A 5E68A 4BXXC 1ZEDA 4G7HA 3I4NK 2YU9C 4C3HK 1ZBSA 2B63A 5EGEA 3FKIA 3A8KA 2VUMA 2NVXA 3DYCA 4KAWX 1EJJA 4KASA 3MMLB 3FOEA 3GTGK 3TX0A 4LR8A 1WSRA 3NKQA 1EW8A 5IORA 1VLOA 3KD8A 3ADAC 4LOWA 3IGZB 4XLPA 3S14C 3HOVK 2R93C 1IE0A 4OINA 4UPKA 4PAAA 4MEXA 3S17C 1TWHK 5IP9C 3AQPA 3HOXK 2BE5A 1KQ4A 4A3DK 4CXSA 3S15C 3IPJA 4BY7C 3MK2A 1KHNA 2E2IK 2VQRA 3M3YC 4LJZA 5TMFA 4CYRA 1ZYRA 3GEHA 1TWGA 1VJEA 3CQZK 5CJ9A 4UOOA 1XZQA 4A3FC 2JA6K 3OPFA 4FM9A 2NVYK 4KB2A 3A52A 3IGYB 3WAXA 2IUCA 3GTGC 5L46A 4Y7NC 2R7ZK 3UNYA 4PABA 3CMRA 5IP7C 3MK1A 5M5XK 1VRQC 4KAVA 1DCOA 5TMCA 3T00A 4AH6A 4FZBA 1ELYA 1EFWA 3GTPK 1ELXA 4GFQA 4Y52K 2IFYA 1FSUA 1PJ5A 5IYBK 4AYBL 5C44C 3HOVC 4ILDA 4A3IC 4C3JK 5GOVA 5LRNA 1EH1A 1TWAA 4A3EK 3RZDK 4ZG6A 1YNJA 3M8WA 2O5JA 1EW2A 1Y1VK 2EBBA 1KHKA 5L0BA 3FKIK 2VUMK 2NVXK 1AUKA 1ED8A 1WOSA 5IYDC 3GEIA 1L0WA 3BP8C 4UPIA 4X6AK 4A93C 3GTLC 3PO2K 3LAPA 4KMAA 4A3MK 3S2DK 4KARA 1XZPA 3S2HK 3M4OC 1HQAA 3GTJC 2R92K 1WCMA 1TWHA 5D4DA 1I3QC 2NVTK 3H0GC 4O2DA 1O99A 3OREA 5IYBC 4GTAA 4OIQA 4KM9A 2WAQL 4UPLA 4P5AA 4BY1K 1IL2A 1E1ZP 2W5QA 1EW9A 4CYSA 1TWCA 4BLAA 2RGRA 3CQZA 2W5RA 3VA7A 4KM8A 2B63C 2JA6A 1XZQB 2PHCB 2NVXC 2VUMC 4UORA 1O25A 5EGHA 4QAXA 3NKNA 1SHNA 3GTMK 2JA7C 2R7ZA 2IUCB 1F7UA 1ZEFA 1O98A 4A3MC 4TN0A 5DLWA 3GTPA 3S2HC 4LREA 5C4JK 2GSOA 1J6VA 2WB1L 1O2AA 3TTGA 1E2SP 2W5XA 1R9TC 3GEEA 4KN7A 1JQWA 2Y0SL 3HOUK 1EQRA 1TWAK 4NWJA 3I4MC 5C66A 1Y1WC 4A3JK 3S1QC 1I6HK 4FDJA 2NVQC 1ALHA 3GTQA 1Y1VA 1SFOK 3S1RK 3DXJA 3LPXA 2CW0A 2WB1D 3HOYK 4A3BK 1IBAA 4BY1C 4KJGA 5DLTA 1K83A 2W8SA 3QX3A 1IS1A 4C2MC 2Y0SD 3SZZA 4N7TA 3NKRA 4BBRK 1TWGC 2A69A 2GAHC 5IOSA 3HKZL 4BBSK 3GIRA 1XZPB 3K7AC 3S16C 1VGXA 5LRMA 1UV7A 3NKOA 2R92A 4G7ZA 2QZUA 1O2FB 1ZXOA 3Q3QA 4C3IC 1WCMK 4GTXA 1B4AA 5C4JC 4KMUA 2RH6A 3HKZD 5C3EK 3WAVA 1ALJA 3FHZA 4MIVA 3LXQA 3S1NC 5C4XC 1B4BA 2PMZL 2W8DA 4A3JC 1TWCK 3GTKA 1YCLA 3I4NC 2JH3A 4LR2A 4C3HC 3HXAA 3AD7C 4YFXA 3HOYC 2D6FC 3NKPA 4DDQA 1N2LA 1KH9A 3GTMA 4MQ9A 5GRRA 3TG0A 4A3GK 4GTDA 3S1MK 3L4JA 2A6HA 1EQJA 4GTEA 3M7VA 4ZH4A 2PMZD 4BBRC 1KHJA 1USOA 4KATA 4BBSC 1X31C 5IJQA 4LQYA 3OT9A 1ISEA 1HI9A 3NUHA 4MEYA 4UOPA 3GSIA 1I6VA 1F7VA 5IYCK 2D1GA 1WCMC 3GTOK 1TWHC 5JFEA 5LQQA 4A3KK 3HOXC 1WIHA 5C3EC 1SFOA 4A3DC 1DD5A 3GTQK 1PJ7A 1USMA 2X98A 1WOOA 1BGWA 3T01A 2E2IC 3TWZA 4G7OA 1WORA 1K83K 1YNNA 4WILA 1ANIA 1ED9A 1SMYA 5FLMK 3CQZC 4OIRA 4GTZA 2JA6C 2FQTA 1INNA 2NVYC 3LAJA 5LIAA 2R7ZC 2Y3PA 1WSVA 3FOFA 3PO3K 4J3NA 3GTPC 3CAGA 3N3YA 4Y52C 2ZUEA 3DPCA 1WOPA 1AB4A 1AJAA 4RMFA 4XSXA 3AQOA 4C3JC 4A3LK 5KXAA 4A3EC 2V6TA 3RZDC 1AJBA 3BP3A 2GA3A 4QJVA 1F9NA 4GTBA 3GTKK 2E2JK 1F93A 2CFAA 1JOEA 2P8TA 1Y1VC 2O5IA 3RZOK 3A8JA 2E2HA 4FDIA 4YR1A 3FKIC 5CHPA 1KH4A 4WJ3M 2GSUA 1K83C 2XCRB 1O2BA 4P5BA 4XSZA 4A3CK 4X6AC 4BXXK 3G4CA 3PO2C 1HJKA 4M1XA 3EQLA 2YU9K 3S2DC 4B56A 2XCOA 1EI6A 2A68A 3UN3A 2JA8K 2R92C 1BDFA 1PJ6A 2GAGC 3GTOA 2NVTC 2JA5A 5HRTA 4ZG9A 3WAWA 5L0EA 4YFNA 4QIWD 1ELZA 4JK1A 3S14K 5DLVA 3ED4A 2R93K 1VH2A 1O24A 4G0WA 2W7VA 1EK8A 4KAYA 3S17K 3H0GA 4YG2A 3GTKC 3HOWK 5K4PA 3B5QA 4LRCA 3BUEA 4MY4A 1TWFA 4LK0A 3IDDA 3SZYA 3S15K 2W5TA 2V6UA 2XCQA 3GTMC 4LRDA 3M3YK 2V6SA 2XRGA 4CXUA 2XR9A 5AJ9A 4XCHA 2FQOA 4BKWA 4A3FK 1IQ0A 5FJ8K 2JA8C 1URAA 4GTCA 3L4KA 2JA7A 4G0UA 1KHLA 3NKMA 3N0CA 4ZGAA 3A8IA 4Y7NK 3BDGA 1XXBA 4C45A 1ZVUA 5IP7K 3HOUC 4CXKA 1TWAC 1GE9A 3TFJA 1I6HC 4QJVB 4KN4A 3WAYA 4XLNA 1C0AA 1SFOC 2CFAB 4KB4A 3S1RC 3HOZK 2ZKTA 3WODA 1O29A 3TFIA 2E2HK 4A3BC 5C44K 1I50A 3N0BA 1R9TA 3GDZA 4A3IK 4KMDA 2W5WA 4LRBA 4GTLA 3HOWC 1B8JA 4KM4A 1Y1WA 3T02A 1JVIA 2YU9A 4LRAA 3BDFA 4KDDA 1AJDA 1WQHA 4LR9A 5IYDK 4LK1A 1AJCA 3NVLA 1J6XA 4A93K 3GTLK 1HQMA 2JA5K 1G51A 3G4AA 1KH7A 1J6WA 1WQGA 3M4OK 5IOTA 3GTJK 2R93A 2ANHA 2G9YA 1ALKA 1TWCC 3AD9C 1I3QK 2KWAA 1ZEBA 3H0GK 3HOZC 3JSTA 4WJ4A 2E2HC 1K7HA 3OEPA 1YX2A 4NOIA 4GZYA 1N2KA 1XXAA 1TWFK 1XPPA 2GSNA 4A3GC 2ZFZA 4LR7A 4KC6A 3S1MC 4GTWA 5M3FK 1ALIA 2P5MA 4GTFA 4GT9A 1RU0A 2PA8L 2B63K 5M5YK 4AYBD 4P9SA 3UN2A 5M3MK 1J98A 5TJ3A 1DCPA 4KMHA 4YFKA 3GTGA 2JA7K 5IYCC 3BDGB 3GTOC 1BJTA 3AH5A 1DCHA 3UN5A 4A3KC 2JA5C 4UPHA 1KH5A 4ZG7A 1O28A 5IJSA 2PA8D 3GTQC 3BDHA 3M8YA 2GLQA 1ANJA 1ZQ1C 1I50K 3E2DA 1R9TK 4GTYA 3H3VL 2W5SA 1Y7AA 3S0XA 3UO0A 1WQFA 5FLMC 3I4MK 1URBA 1Y1WK 3S1QK 2NVQK 1XXCA 2PPBA 5HL8A 1O26A 1TWFC 1V5VA 4MHXA 1BS2A 4QIWL 2E2IA 1E3CP 4KJDA 5M5WK 1Y6VA 4Q4ZA 4LRFA 4BLBA 5IOQA 3H3VD 1HDHA 4C2MK 4G0VA 3PO3C 3GTLA 5JVOA 1TWGK 1E33P 2NVYA 1SHQA 3MK0A 3K7AK 3S16K 2WAQD 3GTJA 4A3LC 3TFHA 4C3IK 1O27A 2ZUFA 4LLGA 3AD8C 4OIOA 1I3QA 3V4GA 3M8ZA 5IP9K 4OIPA 3ERED 2E2JC 3RZOC 4Q5SA 2A6EA 4NWXA 1P49A 1I50C 3WBHA 4BY7K 4A3CC 3S1NK 5L0KA
chains in the Genus database with same CATH topology
5INHA 2W5VA 1ANIA 1B8JA 4KM4A 1ED9A 3T02A 1ZEDA 2W5RA 4GTZA 5EGEA 4LRAA 3DYCA 3BDFA 1AJDA 4UORA 5EGHA 4LRBA 1EJJA 3NKNA 1SHNA 4QAXA 5LIAA 2IUCB 4LR9A 3TX0A 4LR8A 1AJCA 3NVLA 1ZEFA 3NKQA 1O98A 1EW8A 4TN0A 5DLWA 3KD8A 4LREA 1KH7A 3DPCA 2GSOA 3IGZB 1E2SP 1AJAA 2W5XA 5KXAA 2ANHA 2G9YA 4UPKA 1AJBA 1ALKA 4NWJA 2GA3A 5C66A 4FDJA 1ZEBA 1ALHA 4YR1A 1K7HA 4FDIA 1N2KA 4CXSA 4KJGA 3MK2A 1KH4A 2GSNA 1KHNA 4LR7A 5DLTA 2GSUA 2VQRA 2W8SA 4GTWA 1ALIA 4CYRA 3SZZA 1HJKA 4N7TA 3NKRA 4B56A 4UOOA 3UN2A 1EI6A 3A52A 5TJ3A 3UN3A 3IGYB 3WAXA 2IUCA 5LRMA 3UNYA 3NKOA 3BDGB 3CMRA 2QZUA 5L0KA 3Q3QA 3MK1A 3UN5A 4KAVA 4GTXA 4UPHA 5HRTA 3T00A 4ZG9A 1ELYA 1KH5A 2RH6A 3WAWA 4ZG7A 5IJSA 1ELXA 2IFYA 1FSUA 5L0EA 3BDHA 3WAVA 3M8YA 1ELZA 1ALJA 2GLQA 1ANJA 3LXQA 4MIVA 5DLVA 3ED4A 5GOVA 3E2DA 5LRNA 4GTYA 2W8DA 2W5SA 1Y7AA 4KAYA 5K4PA 3UO0A 4ZG6A 1URBA 3B5QA 3M8WA 4LR2A 4LRCA 4MY4A 1EW2A 3NKPA 1KHKA 3IDDA 1N2LA 4MHXA 5L0BA 3SZYA 1AUKA 1KH9A 2W5TA 1E3CP 1ED8A 5GRRA 4LRDA 3TG0A 4KJDA 1Y6VA 4LRFA 1EQJA 4UPIA 3M7VA 2XRGA 4CXUA 2XR9A 1HDHA 1KHJA 4CYSA 5AJ9A 5IJQA 4LQYA 1E33P 3OT9A 1SHQA 1URAA 3MK0A 3NKMA 1HQAA 1KHLA 4UOPA 4ZGAA 3BDGA 2D1GA 4CXKA 5LQQA 3M8ZA 1O99A 3WAYA 2ZKTA 4NWXA 2X98A 1P49A 3T01A 3TWZA 4UPLA 3WBHA 1E1ZP 2W5QA 1EW9A 2W5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5INH A;  2W5V A;  1ANI A;  1B8J A;  4KM4 A;  1ED9 A;  3T02 A;  1ZED A;  2W5R A;  4GTZ A;  5EGE A;  4LRA A;  3DYC A;  3BDF A;  1AJD A;  4UOR A;  5EGH A;  4LRB A;  1EJJ A;  3NKN A;  1SHN A;  4QAX A;  5LIA A;  2IUC B;  4LR9 A;  3TX0 A;  4LR8 A;  1AJC A;  3NVL A;  1ZEF A;  3NKQ A;  1O98 A;  1EW8 A;  4TN0 A;  5DLW A;  3KD8 A;  4LRE A;  1KH7 A;  3DPC A;  2GSO A;  3IGZ B;  1E2S P;  1AJA A;  2W5X A;  5KXA A;  2ANH A;  2G9Y A;  4UPK A;  1AJB A;  1ALK A;  4NWJ A;  2GA3 A;  5C66 A;  4FDJ A;  1ZEB A;  1ALH A;  4YR1 A;  1K7H A;  4FDI A;  1N2K A;  4CXS A;  4KJG A;  3MK2 A;  1KH4 A;  2GSN A;  1KHN A;  4LR7 A;  5DLT A;  2GSU A;  2VQR A;  2W8S A;  4GTW A;  1ALI A;  4CYR A;  3SZZ A;  1HJK A;  4N7T A;  3NKR A;  4B56 A;  4UOO A;  3UN2 A;  1EI6 A;  3A52 A;  5TJ3 A;  3UN3 A;  3IGY B;  3WAX A;  2IUC A;  5LRM A;  3UNY A;  3NKO A;  3BDG B;  3CMR A;  2QZU A;  5L0K A;  3Q3Q A;  3MK1 A;  3UN5 A;  4KAV A;  4GTX A;  4UPH A;  5HRT A;  3T00 A;  4ZG9 A;  1ELY A;  1KH5 A;  2RH6 A;  3WAW A;  4ZG7 A;  5IJS A;  1ELX A;  2IFY A;  1FSU A;  5L0E A;  3BDH A;  3WAV A;  3M8Y A;  1ELZ A;  1ALJ A;  2GLQ A;  1ANJ A;  3LXQ A;  4MIV A;  5DLV A;  3ED4 A;  5GOV A;  3E2D A;  5LRN A;  4GTY A;  2W8D A;  2W5S A;  1Y7A A;  4KAY A;  5K4P A;  3UO0 A;  4ZG6 A;  1URB A;  3B5Q A;  3M8W A;  4LR2 A;  4LRC A;  4MY4 A;  1EW2 A;  3NKP A;  1KHK A;  3IDD A;  1N2L A;  4MHX A;  5L0B A;  3SZY A;  1AUK A;  1KH9 A;  2W5T A;  1E3C P;  1ED8 A;  5GRR A;  4LRD A;  3TG0 A;  4KJD A;  1Y6V A;  4LRF A;  1EQJ A;  4UPI A;  3M7V A;  2XRG A;  4CXU A;  2XR9 A;  1HDH A;  1KHJ A;  4CYS A;  5AJ9 A;  5IJQ A;  4LQY A;  1E33 P;  3OT9 A;  1SHQ A;  1URA A;  3MK0 A;  3NKM A;  1HQA A;  1KHL A;  4UOP A;  4ZGA A;  3BDG A;  2D1G A;  4CXK A;  5LQQ A;  3M8Z A;  1O99 A;  3WAY A;  2ZKT A;  4NWX A;  2X98 A;  1P49 A;  3T01 A;  3TWZ A;  4UPL A;  3WBH A;  1E1Z P;  2W5Q A;  1EW9 A;  2W5W A; 
#chains in the Genus database with same CATH topology
 5INH A;  2W5V A;  5C4X K;  1IW7 A;  5E68 A;  4BXX C;  1ZED A;  4G7H A;  3I4N K;  2YU9 C;  4C3H K;  1ZBS A;  2B63 A;  5EGE A;  3FKI A;  3A8K A;  2VUM A;  2NVX A;  3DYC A;  4KAW X;  1EJJ A;  4KAS A;  3MML B;  3FOE A;  3GTG K;  3TX0 A;  4LR8 A;  1WSR A;  3NKQ A;  1EW8 A;  5IOR A;  1VLO A;  3KD8 A;  3ADA C;  4LOW A;  3IGZ B;  4XLP A;  3S14 C;  3HOV K;  2R93 C;  1IE0 A;  4OIN A;  4UPK A;  4PAA A;  4MEX A;  3S17 C;  1TWH K;  5IP9 C;  3AQP A;  3HOX K;  2BE5 A;  1KQ4 A;  4A3D K;  4CXS A;  3S15 C;  3IPJ A;  4BY7 C;  3MK2 A;  1KHN A;  2E2I K;  2VQR A;  3M3Y C;  4LJZ A;  5TMF A;  4CYR A;  1ZYR A;  3GEH A;  1TWG A;  1VJE A;  3CQZ K;  5CJ9 A;  4UOO A;  1XZQ A;  4A3F C;  2JA6 K;  3OPF A;  4FM9 A;  2NVY K;  4KB2 A;  3A52 A;  3IGY B;  3WAX A;  2IUC A;  3GTG C;  5L46 A;  4Y7N C;  2R7Z K;  3UNY A;  4PAB A;  3CMR A;  5IP7 C;  3MK1 A;  5M5X K;  1VRQ C;  4KAV A;  1DCO A;  5TMC A;  3T00 A;  4AH6 A;  4FZB A;  1ELY A;  1EFW A;  3GTP K;  1ELX A;  4GFQ A;  4Y52 K;  2IFY A;  1FSU A;  1PJ5 A;  5IYB K;  4AYB L;  5C44 C;  3HOV C;  4ILD A;  4A3I C;  4C3J K;  5GOV A;  5LRN A;  1EH1 A;  1TWA A;  4A3E K;  3RZD K;  4ZG6 A;  1YNJ A;  3M8W A;  2O5J A;  1EW2 A;  1Y1V K;  2EBB A;  1KHK A;  5L0B A;  3FKI K;  2VUM K;  2NVX K;  1AUK A;  1ED8 A;  1WOS A;  5IYD C;  3GEI A;  1L0W A;  3BP8 C;  4UPI A;  4X6A K;  4A93 C;  3GTL C;  3PO2 K;  3LAP A;  4KMA A;  4A3M K;  3S2D K;  4KAR A;  1XZP A;  3S2H K;  3M4O C;  1HQA A;  3GTJ C;  2R92 K;  1WCM A;  1TWH A;  5D4D A;  1I3Q C;  2NVT K;  3H0G C;  4O2D A;  1O99 A;  3ORE A;  5IYB C;  4GTA A;  4OIQ A;  4KM9 A;  2WAQ L;  4UPL A;  4P5A A;  4BY1 K;  1IL2 A;  1E1Z P;  2W5Q A;  1EW9 A;  4CYS A;  1TWC A;  4BLA A;  2RGR A;  3CQZ A;  2W5R A;  3VA7 A;  4KM8 A;  2B63 C;  2JA6 A;  1XZQ B;  2PHC B;  2NVX C;  2VUM C;  4UOR A;  1O25 A;  5EGH A;  4QAX A;  3NKN A;  1SHN A;  3GTM K;  2JA7 C;  2R7Z A;  2IUC B;  1F7U A;  1ZEF A;  1O98 A;  4A3M C;  4TN0 A;  5DLW A;  3GTP A;  3S2H C;  4LRE A;  5C4J K;  2GSO A;  1J6V A;  2WB1 L;  1O2A A;  3TTG A;  1E2S P;  2W5X A;  1R9T C;  3GEE A;  4KN7 A;  1JQW A;  2Y0S L;  3HOU K;  1EQR A;  1TWA K;  4NWJ A;  3I4M C;  5C66 A;  1Y1W C;  4A3J K;  3S1Q C;  1I6H K;  4FDJ A;  2NVQ C;  1ALH A;  3GTQ A;  1Y1V A;  1SFO K;  3S1R K;  3DXJ A;  3LPX A;  2CW0 A;  2WB1 D;  3HOY K;  4A3B K;  1IBA A;  4BY1 C;  4KJG A;  5DLT A;  1K83 A;  2W8S A;  3QX3 A;  1IS1 A;  4C2M C;  2Y0S D;  3SZZ A;  4N7T A;  3NKR A;  4BBR K;  1TWG C;  2A69 A;  2GAH C;  5IOS A;  3HKZ L;  4BBS K;  3GIR A;  1XZP B;  3K7A C;  3S16 C;  1VGX A;  5LRM A;  1UV7 A;  3NKO A;  2R92 A;  4G7Z A;  2QZU A;  1O2F B;  1ZXO A;  3Q3Q A;  4C3I C;  1WCM K;  4GTX A;  1B4A A;  5C4J C;  4KMU A;  2RH6 A;  3HKZ D;  5C3E K;  3WAV A;  1ALJ A;  3FHZ A;  4MIV A;  3LXQ A;  3S1N C;  5C4X C;  1B4B A;  2PMZ L;  2W8D A;  4A3J C;  1TWC K;  3GTK A;  1YCL A;  3I4N C;  2JH3 A;  4LR2 A;  4C3H C;  3HXA A;  3AD7 C;  4YFX A;  3HOY C;  2D6F C;  3NKP A;  4DDQ A;  1N2L A;  1KH9 A;  3GTM A;  4MQ9 A;  5GRR A;  3TG0 A;  4A3G K;  4GTD A;  3S1M K;  3L4J A;  2A6H A;  1EQJ A;  4GTE A;  3M7V A;  4ZH4 A;  2PMZ D;  4BBR C;  1KHJ A;  1USO A;  4KAT A;  4BBS C;  1X31 C;  5IJQ A;  4LQY A;  3OT9 A;  1ISE A;  1HI9 A;  3NUH A;  4MEY A;  4UOP A;  3GSI A;  1I6V A;  1F7V A;  5IYC K;  2D1G A;  1WCM C;  3GTO K;  1TWH C;  5JFE A;  5LQQ A;  4A3K K;  3HOX C;  1WIH A;  5C3E C;  1SFO A;  4A3D C;  1DD5 A;  3GTQ K;  1PJ7 A;  1USM A;  2X98 A;  1WOO A;  1BGW A;  3T01 A;  2E2I C;  3TWZ A;  4G7O A;  1WOR A;  1K83 K;  1YNN A;  4WIL A;  1ANI A;  1ED9 A;  1SMY A;  5FLM K;  3CQZ C;  4OIR A;  4GTZ A;  2JA6 C;  2FQT A;  1INN A;  2NVY C;  3LAJ A;  5LIA A;  2R7Z C;  2Y3P A;  1WSV A;  3FOF A;  3PO3 K;  4J3N A;  3GTP C;  3CAG A;  3N3Y A;  4Y52 C;  2ZUE A;  3DPC A;  1WOP A;  1AB4 A;  1AJA A;  4RMF A;  4XSX A;  3AQO A;  4C3J C;  4A3L K;  5KXA A;  4A3E C;  2V6T A;  3RZD C;  1AJB A;  3BP3 A;  2GA3 A;  4QJV A;  1F9N A;  4GTB A;  3GTK K;  2E2J K;  1F93 A;  2CFA A;  1JOE A;  2P8T A;  1Y1V C;  2O5I A;  3RZO K;  3A8J A;  2E2H A;  4FDI A;  4YR1 A;  3FKI C;  5CHP A;  1KH4 A;  4WJ3 M;  2GSU A;  1K83 C;  2XCR B;  1O2B A;  4P5B A;  4XSZ A;  4A3C K;  4X6A C;  4BXX K;  3G4C A;  3PO2 C;  1HJK A;  4M1X A;  3EQL A;  2YU9 K;  3S2D C;  4B56 A;  2XCO A;  1EI6 A;  2A68 A;  3UN3 A;  2JA8 K;  2R92 C;  1BDF A;  1PJ6 A;  2GAG C;  3GTO A;  2NVT C;  2JA5 A;  5HRT A;  4ZG9 A;  3WAW A;  5L0E A;  4YFN A;  4QIW D;  1ELZ A;  4JK1 A;  3S14 K;  5DLV A;  3ED4 A;  2R93 K;  1VH2 A;  1O24 A;  4G0W A;  2W7V A;  1EK8 A;  4KAY A;  3S17 K;  3H0G A;  4YG2 A;  3GTK C;  3HOW K;  5K4P A;  3B5Q A;  4LRC A;  3BUE A;  4MY4 A;  1TWF A;  4LK0 A;  3IDD A;  3SZY A;  3S15 K;  2W5T A;  2V6U A;  2XCQ A;  3GTM C;  4LRD A;  3M3Y K;  2V6S A;  2XRG A;  4CXU A;  2XR9 A;  5AJ9 A;  4XCH A;  2FQO A;  4BKW A;  4A3F K;  1IQ0 A;  5FJ8 K;  2JA8 C;  1URA A;  4GTC A;  3L4K A;  2JA7 A;  4G0U A;  1KHL A;  3NKM A;  3N0C A;  4ZGA A;  3A8I A;  4Y7N K;  3BDG A;  1XXB A;  4C45 A;  1ZVU A;  5IP7 K;  3HOU C;  4CXK A;  1TWA C;  1GE9 A;  3TFJ A;  1I6H C;  4QJV B;  4KN4 A;  3WAY A;  4XLN A;  1C0A A;  1SFO C;  2CFA B;  4KB4 A;  3S1R C;  3HOZ K;  2ZKT A;  3WOD A;  1O29 A;  3TFI A;  2E2H K;  4A3B C;  5C44 K;  1I50 A;  3N0B A;  1R9T A;  3GDZ A;  4A3I K;  4KMD A;  2W5W A;  4LRB A;  4GTL A;  3HOW C;  1B8J A;  4KM4 A;  1Y1W A;  3T02 A;  1JVI A;  2YU9 A;  4LRA A;  3BDF A;  4KDD A;  1AJD A;  1WQH A;  4LR9 A;  5IYD K;  4LK1 A;  1AJC A;  3NVL A;  1J6X A;  4A93 K;  3GTL K;  1HQM A;  2JA5 K;  1G51 A;  3G4A A;  1KH7 A;  1J6W A;  1WQG A;  3M4O K;  5IOT A;  3GTJ K;  2R93 A;  2ANH A;  2G9Y A;  1ALK A;  1TWC C;  3AD9 C;  1I3Q K;  2KWA A;  1ZEB A;  3H0G K;  3HOZ C;  3JST A;  4WJ4 A;  2E2H C;  1K7H A;  3OEP A;  1YX2 A;  4NOI A;  4GZY A;  1N2K A;  1XXA A;  1TWF K;  1XPP A;  2GSN A;  4A3G C;  2ZFZ A;  4LR7 A;  4KC6 A;  3S1M C;  4GTW A;  5M3F K;  1ALI A;  2P5M A;  4GTF A;  4GT9 A;  1RU0 A;  2PA8 L;  2B63 K;  5M5Y K;  4AYB D;  4P9S A;  3UN2 A;  5M3M K;  1J98 A;  5TJ3 A;  1DCP A;  4KMH A;  4YFK A;  3GTG A;  2JA7 K;  5IYC C;  3BDG B;  3GTO C;  1BJT A;  3AH5 A;  1DCH A;  3UN5 A;  4A3K C;  2JA5 C;  4UPH A;  1KH5 A;  4ZG7 A;  1O28 A;  5IJS A;  2PA8 D;  3GTQ C;  3BDH A;  3M8Y A;  2GLQ A;  1ANJ A;  1ZQ1 C;  1I50 K;  3E2D A;  1R9T K;  4GTY A;  3H3V L;  2W5S A;  1Y7A A;  3S0X A;  3UO0 A;  1WQF A;  5FLM C;  3I4M K;  1URB A;  1Y1W K;  3S1Q K;  2NVQ K;  1XXC A;  2PPB A;  5HL8 A;  1O26 A;  1TWF C;  1V5V A;  4MHX A;  1BS2 A;  4QIW L;  2E2I A;  1E3C P;  4KJD A;  5M5W K;  1Y6V A;  4Q4Z A;  4LRF A;  4BLB A;  5IOQ A;  3H3V D;  1HDH A;  4C2M K;  4G0V A;  3PO3 C;  3GTL A;  5JVO A;  1TWG K;  1E33 P;  2NVY A;  1SHQ A;  3MK0 A;  3K7A K;  3S16 K;  2WAQ D;  3GTJ A;  4A3L C;  3TFH A;  4C3I K;  1O27 A;  2ZUF A;  4LLG A;  3AD8 C;  4OIO A;  1I3Q A;  3V4G A;  3M8Z A;  5IP9 K;  4OIP A;  3ERE D;  2E2J C;  3RZO C;  4Q5S A;  2A6E A;  4NWX A;  1P49 A;  1I50 C;  3WBH A;  4BY7 K;  4A3C C;  3S1N K;  5L0K A; 
#chains in the Genus database with same CATH homology
 5INH A;  2W5V A;  1ANI A;  1B8J A;  4KM4 A;  1ED9 A;  3T02 A;  1ZED A;  2W5R A;  4GTZ A;  5EGE A;  4LRA A;  3DYC A;  3BDF A;  1AJD A;  4UOR A;  5EGH A;  4LRB A;  1EJJ A;  3NKN A;  1SHN A;  4QAX A;  5LIA A;  2IUC B;  4LR9 A;  3TX0 A;  4LR8 A;  1AJC A;  3NVL A;  1ZEF A;  3NKQ A;  1O98 A;  1EW8 A;  4TN0 A;  5DLW A;  3KD8 A;  4LRE A;  1KH7 A;  3DPC A;  2GSO A;  3IGZ B;  1E2S P;  1AJA A;  2W5X A;  5KXA A;  2ANH A;  2G9Y A;  4UPK A;  1AJB A;  1ALK A;  4NWJ A;  2GA3 A;  5C66 A;  4FDJ A;  1ZEB A;  1ALH A;  4YR1 A;  1K7H A;  4FDI A;  1N2K A;  4CXS A;  4KJG A;  3MK2 A;  1KH4 A;  2GSN A;  1KHN A;  4LR7 A;  5DLT A;  2GSU A;  2VQR A;  2W8S A;  4GTW A;  1ALI A;  4CYR A;  3SZZ A;  1HJK A;  4N7T A;  3NKR A;  4B56 A;  4UOO A;  3UN2 A;  1EI6 A;  3A52 A;  5TJ3 A;  3UN3 A;  3IGY B;  3WAX A;  2IUC A;  5LRM A;  3UNY A;  3NKO A;  3BDG B;  3CMR A;  2QZU A;  5L0K A;  3Q3Q A;  3MK1 A;  3UN5 A;  4KAV A;  4GTX A;  4UPH A;  5HRT A;  3T00 A;  4ZG9 A;  1ELY A;  1KH5 A;  2RH6 A;  3WAW A;  4ZG7 A;  5IJS A;  1ELX A;  2IFY A;  1FSU A;  5L0E A;  3BDH A;  3WAV A;  3M8Y A;  1ELZ A;  1ALJ A;  2GLQ A;  1ANJ A;  3LXQ A;  4MIV A;  5DLV A;  3ED4 A;  5GOV A;  3E2D A;  5LRN A;  4GTY A;  2W8D A;  2W5S A;  1Y7A A;  4KAY A;  5K4P A;  3UO0 A;  4ZG6 A;  1URB A;  3B5Q A;  3M8W A;  4LR2 A;  4LRC A;  4MY4 A;  1EW2 A;  3NKP A;  1KHK A;  3IDD A;  1N2L A;  4MHX A;  5L0B A;  3SZY A;  1AUK A;  1KH9 A;  2W5T A;  1E3C P;  1ED8 A;  5GRR A;  4LRD A;  3TG0 A;  4KJD A;  1Y6V A;  4LRF A;  1EQJ A;  4UPI A;  3M7V A;  2XRG A;  4CXU A;  2XR9 A;  1HDH A;  1KHJ A;  4CYS A;  5AJ9 A;  5IJQ A;  4LQY A;  1E33 P;  3OT9 A;  1SHQ A;  1URA A;  3MK0 A;  3NKM A;  1HQA A;  1KHL A;  4UOP A;  4ZGA A;  3BDG A;  2D1G A;  4CXK A;  5LQQ A;  3M8Z A;  1O99 A;  3WAY A;  2ZKT A;  4NWX A;  2X98 A;  1P49 A;  3T01 A;  3TWZ A;  4UPL A;  3WBH A;  1E1Z P;  2W5Q A;  1EW9 A;  2W5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...