3T00A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with vanadate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
molecule keywords phosphonoacetate hydrolase
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t00A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t00A01
3UN3A 2W5SA 2XRGA 3M8ZA 1AJBA 4NWJA 5DLTA 2RH6A 4KAYA 4LRAA 4QAXA 3WAXA 4LREA 3UN5A 2W5WA 1EW8A 1ALJA 4CYSA 1O98A 5IJQA 1K7HA 1EQJA 3IGYB 3WAYA 5LIAA 1O99A 3CMRA 1KHKA 5LRMA 5INHA 1EJJA 5IJSA 1ELXA 3NKQA 1ZEDA 3MK1A 1EW9A 1FSUA 2W5XA 2GSNA 3E2DA 3T00A 1URBA 1ED8A 3BDGB 1ED9A 2W5TA 3T01A 5TJ3A 5GRRA 1SHNA 5KXAA 2X98A 1ELYA 5LRNA 4KAVA 2W8SA 1N2LA 5L0EA 4GTXA 4MIVA 1HJKA 2GLQA 2GSOA 4MY4A 2D1GA 5C66A 4ZG6A 1Y7AA 1ALKA 3B5QA 1AJAA 1HDHA 2G9YA 3A52A 3KD8A 1B8JA 3WAWA 4UPLA 2W5QA 1ELZA 3Q3QA 4UORA 3TX0A 1E3CP 2W5RA 3ED4A 3M8YA 4KJGA 3NVLA 4KJDA 3DYCA 3LXQA 2IFYA 5K4PA 4UPHA 4ZG7A 5L0KA 3UO0A 1URAA 3NKRA 1ALHA 3NKMA 4GTWA 5L0BA 1AJDA 3BDHA 4FDIA 2IUCA 1AUKA 4LRCA 4ZGAA 1ANJA 2QZUA 1KH5A 1E1ZP 1Y6VA 1ZEFA 2ZKTA 2ANHA 3MK0A 4LQYA 4LR8A 4UOPA 4UPKA 4CXUA 4N7TA 4KM4A 2W5VA 5AJ9A 4B56A 5DLWA 2W8DA 1KH7A 2VQRA 3NKOA 4GTYA 4UOOA 1N2KA 4ZG9A 1HQAA 4LR7A 4LRBA 3BDGA 3M8WA 1KH4A 4CYRA 4CXKA 3TG0A 4FDJA 1ZEBA 4LR9A 3NKNA 3UNYA 4LRDA 2XR9A 3SZZA 3BDFA 4YR1A 4CXSA 1KH9A 5HRTA 4UPIA 3T02A 1SHQA 3MK2A 3TWZA 4MHXA 3M7VA 5EGHA 2GA3A 3WAVA 4LR2A 5GOVA 3SZYA 1KHNA 1EI6A 1E2SP 2IUCB 3NKPA 4LRFA 4GTZA 1ANIA 3UN2A 1KHJA 1EW2A 5EGEA 1P49A 4TN0A 3IDDA 1ALIA 3IGZB 3DPCA 1AJCA 2GSUA 1KHLA 5DLVA 3OT9A 5LQQA 1E33P 3WBHA 4NWXA
chains in the Genus database with same CATH superfamily
4OIRA 4NWJA 5DLTA 3HOZC 5CJ9A 4LRAA 4QAXA 4A3EC 1INNA 5FLMK 3OREA 3FOEA 2WAQL 2JA7A 2V6TA 4CYSA 3CAGA 4M1XA 4A3IC 3GTMK 3S16K 4BY7K 1VRQC 4WJ4A 3WAYA 3TFHA 1F7UA 1RU0A 5LRMA 2JA5K 2P5MA 3HOUC 1ELXA 4KDDA 3V4GA 1EW9A 3RZDC 1K83A 5C4JK 2NVYC 1ZYRA 2JA6C 1B4AA 4C3JC 3GTKK 4Y7NC 5L46A 5TJ3A 1WQFA 2JA5A 3GTGA 4PAAA 3HOWK 2FQOA 4A3MC 2NVTC 5L0EA 1K83K 3FKIC 1O26A 4ZG6A 2P8TA 3PO2K 1J6VA 3A52A 1Y1WA 4WILA 4G7ZA 1TWAA 2W5RA 1R9TC 3IPJA 5M3MK 5C4XK 2IFYA 5K4PA 2B63C 3S15C 5L0KA 1TWFC 3OPFA 5E68A 3PO3C 3HKZD 5D4DA 4BBSK 3NKMA 5IYCK 2E2IC 3CQZC 3BDHA 4C3HC 1ISEA 4KM8A 1AUKA 3ADAC 4BBRK 2IUCA 4LRCA 5JVOA 3GTPK 1KH5A 2E2HC 2JH3A 1ZEFA 3N0CA 3GTQA 4UPKA 1BS2A 2YU9A 1GE9A 2JA7K 4GTBA 4Q4ZA 4X6AK 2E2HA 1TWCK 2E2JK 1YX2A 4UOOA 3AQOA 4KC6A 4LRBA 3HOXC 2CFAA 4MEYA 4BKWA 3GTJC 4A93K 2NVXA 4A3GK 1TWFA 3A8JA 1XPPA 3LPXA 3NKNA 3S0XA 3UNYA 3BP3A 2VUMA 1IL2A 1TWGA 5TMCA 1WIHA 1KH9A 3CQZK 3H3VL 4LK1A 4OINA 3GTKA 5C44C 2GA3A 1AB4A 1YCLA 4LR2A 3S14C 5M5WK 2B63K 3S15K 5C4XC 1KHNA 4KB2A 3NKPA 3AH5A 4OIQA 1KHJA 1EW2A 1O29A 2V6SA 3GEEA 3S1QK 4A3DK 3GTQK 1XXBA 2WB1D 3HOYK 2JA6A 5DLVA 3BP8C 2A6EA 1K83C 3S1MK 2EBBA 2JA8K 2R92A 4GZYA 3GEHA 1AJBA 3K7AK 4KAYA 4O2DA 4AH6A 3WAXA 3UN5A 1TWHA 4C3JK 2JA6K 4GTEA 3LAJA 1O98A 1WOSA 3RZDK 4BXXK 3G4CA 5LIAA 4FZBA 2R92C 1KHKA 4JK1A 1DCPA 1IBAA 5M3FK 1ZXOA 1ZEDA 2B63A 3TFIA 5IYDC 1FSUA 3T00A 1URBA 1JQWA 3H0GC 4LK0A 3S1MC 4G7OA 4A3IK 3GTMC 3S16C 3S2HK 1WOOA 3HOYC 4YG2A 4P5AA 4J3NA 4KAVA 4KMUA 3AD8C 4GTAA 1SFOA 1VLOA 4XLNA 2GLQA 4MY4A 4RMFA 1I6HC 2D1GA 5C66A 1Y7AA 1SMYA 3GTGC 3S14K 2G9YA 3KD8A 3WAWA 3HXAA 3I4MC 4AYBL 3GTOC 1E3CP 2NVYA 1F9NA 4KJGA 5IP9C 1URAA 1J6WA 4GTWA 1AJDA 1I50K 4FDIA 3VA7A 1ANJA 4C3IK 1L0WA 4UOPA 4LR8A 4PABA 3GTLK 1TWCC 2W5VA 2PA8D 3EQLA 4BY1C 1IE0A 2JA7C 3HOVK 2W8DA 2E2HK 1PJ6A 5IP9K 1XXCA 4KMHA 4BBRC 1HQAA 4QJVB 4C3HK 4OIPA 4C2MK 3GTOK 1WCMA 4CYRA 3OEPA 1R9TA 1DD5A 1YNJA 1F93A 3PO3K 4LRDA 1I3QC 3H3VD 3GTGK 4YR1A 5JFEA 4GT9A 4UPIA 1SHQA 2BE5A 4LOWA 4MQ9A 4ZH4A 1B4BA 3BUEA 5GOVA 1E2SP 4GFQA 4GTZA 3S2HC 1XXAA 2O5IA 3I4NK 3RZOK 1J98A 4BLBA 2VUMK 5IYDK 3IDDA 1ALIA 2R93A 1ZBSA 1AJCA 1Y1VA 3OT9A 2Y3PA 1WCMC 1E33P 3WBHA 1DCHA 5LQQA 4NWXA 2NVYK 4Y52K 2A6HA 5C3EK 4Y52C 3M8ZA 2RH6A 3HOUK 1TWCA 4LREA 2W5WA 1Y1VK 2PMZL 1G51A 1K7HA 1EQJA 4BY7C 3L4JA 4GTFA 5IORA 1IS1A 4GTDA 1PJ5A 5INHA 2PPBA 3AD9C 3FOFA 1XZPB 3S1QC 4A3DC 5IP7K 3NKQA 3HOZK 3ERED 2W5XA 2GSNA 3E2DA 1BJTA 3BDGB 1ED9A 1EK8A 1XZPA 5GRRA 1SHNA 1I3QK 5LRNA 3QX3A 4KASA 3N0BA 4QIWL 2R7ZK 4C2MC 4GTXA 4MIVA 4A3KC 3WODA 2GSOA 5M5YK 1EQRA 1HI9A 1SFOK 1ALKA 1WQHA 1AJAA 1HDHA 4NOIA 5FJ8K 5HL8A 1B8JA 4KAWX 2D6FC 1I3QA 2W5QA 3Q3QA 1ELZA 3TX0A 4BY1K 1O24A 3HOVC 4A3GC 3DXJA 4A93C 3TFJA 1O27A 2NVQC 3DYCA 4UPHA 3GDZA 4QIWD 4C3IC 3S1RC 4A3CC 3H0GA 2R93K 2NVXC 4YFKA 1I50C 1DCOA 1USMA 4WJ3M 5L0BA 1PJ7A 2GAHC 4A3FC 4ZGAA 2QZUA 4LQYA 1E1ZP 1Y6VA 2ZKTA 5KXAA 1ALJA 4LLGA 4A3BK 4KM4A 2YU9C 5AJ9A 3M3YC 4AYBD 2E2IK 4B56A 1WOPA 1TWHC 4BBSC 4KMAA 3NKOA 1C0AA 2VQRA 4GTYA 1N2KA 4ZG9A 3L4KA 1XZQB 2E2IA 1I6HK 3BDGA 1JVIA 1KH4A 1R9TK 3M3YK 1X31C 2YU9K 1JOEA 2R7ZA 4A3BC 4CXKA 4FDJA 3GTOA 4LR9A 2XR9A 3PO2C 4A3JK 3MMLB 4A3FK 2RGRA 3BDFA 4CXSA 2CFAB 1USOA 3T02A 3MK2A 3TWZA 2PA8L 3H0GK 2NVTK 3HOWC 3HKZL 3S1RK 1HQMA 4YFXA 4A3CK 3SZYA 3GTKC 1KQ4A 3GEIA 2R92K 3UN2A 1WORA 3NUHA 4BXXC 5IYBC 1Y1WK 5EGEA 5C4JC 2GAGC 1TWGC 3AD7C 2CW0A 2Y0SL 1WSRA 2ZFZA 3GTJA 4KATA 3DPCA 1VH2A 4KARA 2GSUA 2O5JA 2R7ZC 1XZQA 1IQ0A 1EH1A 3K7AC 4KN4A 2XCRB 3S1NC 3UN3A 2W5SA 4QJVA 1ZVUA 2XRGA 2JA8C 4KM9A 1VGXA 4KN7A 4BLAA 4P9SA 1VJEA 5FLMC 3GTQC 4A3EK 4KB4A 1EW8A 5IJQA 2W7VA 3IGYB 4KMDA 3S17C 1O99A 3CMRA 5IP7C 1I50A 4XLPA 1BGWA 1EJJA 5IJSA 3MK1A 1ZQ1C 1I6VA 1IW7A 3S2DK 5C44K 3A8IA 4FM9A 4XSXA 3S1NK 1Y1VC 1ED8A 2W5TA 2KWAA 3T01A 2X98A 1ELYA 5C3EC 1TWGK 2W8SA 5IYBK 1Y1WC 1N2LA 1WCMK 2A69A 3GTJK 1HJKA 1O2BA 3HOXK 3B5QA 3FKIA 3GSIA 1O2FB 1YNNA 4DDQA 2VUMC 2E2JC 5IOQA 4ILDA 1TWAK 3G4AA 4UPLA 4X6AC 4UORA 4GTCA 3RZOC 3I4NC 3ED4A 1UV7A 4A3LC 4MEXA 3M8YA 2A68A 3NVLA 4KJDA 3LXQA 4ZG7A 2WB1L 4P5BA 3GTLA 3UO0A 3GTPC 4A3JC 4Q5SA 1O25A 2Y0SD 3NKRA 4YFNA 1ALHA 3M4OC 4XCHA 5CHPA 5IOSA 1O28A 2XCOA 2PHCB 5IYCC 2PMZD 3TTGA 1TWFK 3MK0A 2WAQD 2ANHA 3N3YA 4CXUA 4N7TA 3JSTA 1TWHK 2V6UA 3LAPA 5IOTA 2FQTA 2ZUFA 5DLWA 3M4OK 1EFWA 3CQZA 1KH7A 5M5XK 4XSZA 3AQPA 4LR7A 1F7VA 4G0UA 3M8WA 3A8KA 4G0WA 4A3LK 3FKIK 4G7HA 2ZUEA 4C45A 4A3MK 2NVXK 1TWAC 3GTPA 3GTLC 1ZEBA 4G0VA 2R93C 3TG0A 3SZZA 1V5VA 2NVQK 4Y7NK 5HRTA 1J6XA 2XCQA 4LJZA 5EGHA 3M7VA 4MHXA 3FHZA 3WAVA 1SFOC 1EI6A 2JA5C 4A3KK 2IUCB 4LRFA 1ANIA 4GTLA 3I4MK 5TMFA 3S2DC 1WQGA 1O2AA 1P49A 1WSVA 4TN0A 3IGZB 4OIOA 3GTMA 1KHLA 1BDFA 3GIRA 3S17K
chains in the Genus database with same CATH topology
3UN3A 2W5SA 2XRGA 3M8ZA 1AJBA 4NWJA 5DLTA 2RH6A 4KAYA 4LRAA 4QAXA 3WAXA 4LREA 3UN5A 2W5WA 1EW8A 1ALJA 4CYSA 1O98A 5IJQA 1K7HA 1EQJA 3IGYB 3WAYA 5LIAA 1O99A 3CMRA 1KHKA 5LRMA 5INHA 1EJJA 5IJSA 1ELXA 3NKQA 1ZEDA 3MK1A 1EW9A 1FSUA 2W5XA 2GSNA 3E2DA 3T00A 1URBA 1ED8A 3BDGB 1ED9A 2W5TA 3T01A 5TJ3A 5GRRA 1SHNA 5KXAA 2X98A 1ELYA 5LRNA 4KAVA 2W8SA 1N2LA 5L0EA 4GTXA 4MIVA 1HJKA 2GLQA 2GSOA 4MY4A 2D1GA 5C66A 4ZG6A 1Y7AA 1ALKA 3B5QA 1AJAA 1HDHA 2G9YA 3A52A 3KD8A 1B8JA 3WAWA 4UPLA 2W5QA 1ELZA 3Q3QA 4UORA 3TX0A 1E3CP 2W5RA 3ED4A 3M8YA 4KJGA 3NVLA 4KJDA 3DYCA 3LXQA 2IFYA 5K4PA 4UPHA 4ZG7A 5L0KA 3UO0A 1URAA 3NKRA 1ALHA 3NKMA 4GTWA 5L0BA 1AJDA 3BDHA 4FDIA 2IUCA 1AUKA 4LRCA 4ZGAA 1ANJA 2QZUA 1KH5A 1E1ZP 1Y6VA 1ZEFA 2ZKTA 2ANHA 3MK0A 4LQYA 4LR8A 4UOPA 4UPKA 4CXUA 4N7TA 4KM4A 2W5VA 5AJ9A 4B56A 5DLWA 2W8DA 1KH7A 2VQRA 3NKOA 4GTYA 4UOOA 1N2KA 4ZG9A 1HQAA 4LR7A 4LRBA 3BDGA 3M8WA 1KH4A 4CYRA 4CXKA 3TG0A 4FDJA 1ZEBA 4LR9A 3NKNA 3UNYA 4LRDA 2XR9A 3SZZA 3BDFA 4YR1A 4CXSA 1KH9A 5HRTA 4UPIA 3T02A 1SHQA 3MK2A 3TWZA 4MHXA 3M7VA 5EGHA 2GA3A 3WAVA 4LR2A 5GOVA 3SZYA 1KHNA 1EI6A 1E2SP 2IUCB 3NKPA 4LRFA 4GTZA 1ANIA 3UN2A 1KHJA 1EW2A 5EGEA 1P49A 4TN0A 3IDDA 1ALIA 3IGZB 3DPCA 1AJCA 2GSUA 1KHLA 5DLVA 3OT9A 5LQQA 1E33P 3WBHA 4NWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UN3 A;  2W5S A;  2XRG A;  3M8Z A;  1AJB A;  4NWJ A;  5DLT A;  2RH6 A;  4KAY A;  4LRA A;  4QAX A;  3WAX A;  4LRE A;  3UN5 A;  2W5W A;  1EW8 A;  1ALJ A;  4CYS A;  1O98 A;  5IJQ A;  1K7H A;  1EQJ A;  3IGY B;  3WAY A;  5LIA A;  1O99 A;  3CMR A;  1KHK A;  5LRM A;  5INH A;  1EJJ A;  5IJS A;  1ELX A;  3NKQ A;  1ZED A;  3MK1 A;  1EW9 A;  1FSU A;  2W5X A;  2GSN A;  3E2D A;  3T00 A;  1URB A;  1ED8 A;  3BDG B;  1ED9 A;  2W5T A;  3T01 A;  5TJ3 A;  5GRR A;  1SHN A;  5KXA A;  2X98 A;  1ELY A;  5LRN A;  4KAV A;  2W8S A;  1N2L A;  5L0E A;  4GTX A;  4MIV A;  1HJK A;  2GLQ A;  2GSO A;  4MY4 A;  2D1G A;  5C66 A;  4ZG6 A;  1Y7A A;  1ALK A;  3B5Q A;  1AJA A;  1HDH A;  2G9Y A;  3A52 A;  3KD8 A;  1B8J A;  3WAW A;  4UPL A;  2W5Q A;  1ELZ A;  3Q3Q A;  4UOR A;  3TX0 A;  1E3C P;  2W5R A;  3ED4 A;  3M8Y A;  4KJG A;  3NVL A;  4KJD A;  3DYC A;  3LXQ A;  2IFY A;  5K4P A;  4UPH A;  4ZG7 A;  5L0K A;  3UO0 A;  1URA A;  3NKR A;  1ALH A;  3NKM A;  4GTW A;  5L0B A;  1AJD A;  3BDH A;  4FDI A;  2IUC A;  1AUK A;  4LRC A;  4ZGA A;  1ANJ A;  2QZU A;  1KH5 A;  1E1Z P;  1Y6V A;  1ZEF A;  2ZKT A;  2ANH A;  3MK0 A;  4LQY A;  4LR8 A;  4UOP A;  4UPK A;  4CXU A;  4N7T A;  4KM4 A;  2W5V A;  5AJ9 A;  4B56 A;  5DLW A;  2W8D A;  1KH7 A;  2VQR A;  3NKO A;  4GTY A;  4UOO A;  1N2K A;  4ZG9 A;  1HQA A;  4LR7 A;  4LRB A;  3BDG A;  3M8W A;  1KH4 A;  4CYR A;  4CXK A;  3TG0 A;  4FDJ A;  1ZEB A;  4LR9 A;  3NKN A;  3UNY A;  4LRD A;  2XR9 A;  3SZZ A;  3BDF A;  4YR1 A;  4CXS A;  1KH9 A;  5HRT A;  4UPI A;  3T02 A;  1SHQ A;  3MK2 A;  3TWZ A;  4MHX A;  3M7V A;  5EGH A;  2GA3 A;  3WAV A;  4LR2 A;  5GOV A;  3SZY A;  1KHN A;  1EI6 A;  1E2S P;  2IUC B;  3NKP A;  4LRF A;  4GTZ A;  1ANI A;  3UN2 A;  1KHJ A;  1EW2 A;  5EGE A;  1P49 A;  4TN0 A;  3IDD A;  1ALI A;  3IGZ B;  3DPC A;  1AJC A;  2GSU A;  1KHL A;  5DLV A;  3OT9 A;  5LQQ A;  1E33 P;  3WBH A;  4NWX A; 
#chains in the Genus database with same CATH topology
 4OIR A;  4NWJ A;  5DLT A;  3HOZ C;  5CJ9 A;  4LRA A;  4QAX A;  4A3E C;  1INN A;  5FLM K;  3ORE A;  3FOE A;  2WAQ L;  2JA7 A;  2V6T A;  4CYS A;  3CAG A;  4M1X A;  4A3I C;  3GTM K;  3S16 K;  4BY7 K;  1VRQ C;  4WJ4 A;  3WAY A;  3TFH A;  1F7U A;  1RU0 A;  5LRM A;  2JA5 K;  2P5M A;  3HOU C;  1ELX A;  4KDD A;  3V4G A;  1EW9 A;  3RZD C;  1K83 A;  5C4J K;  2NVY C;  1ZYR A;  2JA6 C;  1B4A A;  4C3J C;  3GTK K;  4Y7N C;  5L46 A;  5TJ3 A;  1WQF A;  2JA5 A;  3GTG A;  4PAA A;  3HOW K;  2FQO A;  4A3M C;  2NVT C;  5L0E A;  1K83 K;  3FKI C;  1O26 A;  4ZG6 A;  2P8T A;  3PO2 K;  1J6V A;  3A52 A;  1Y1W A;  4WIL A;  4G7Z A;  1TWA A;  2W5R A;  1R9T C;  3IPJ A;  5M3M K;  5C4X K;  2IFY A;  5K4P A;  2B63 C;  3S15 C;  5L0K A;  1TWF C;  3OPF A;  5E68 A;  3PO3 C;  3HKZ D;  5D4D A;  4BBS K;  3NKM A;  5IYC K;  2E2I C;  3CQZ C;  3BDH A;  4C3H C;  1ISE A;  4KM8 A;  1AUK A;  3ADA C;  4BBR K;  2IUC A;  4LRC A;  5JVO A;  3GTP K;  1KH5 A;  2E2H C;  2JH3 A;  1ZEF A;  3N0C A;  3GTQ A;  4UPK A;  1BS2 A;  2YU9 A;  1GE9 A;  2JA7 K;  4GTB A;  4Q4Z A;  4X6A K;  2E2H A;  1TWC K;  2E2J K;  1YX2 A;  4UOO A;  3AQO A;  4KC6 A;  4LRB A;  3HOX C;  2CFA A;  4MEY A;  4BKW A;  3GTJ C;  4A93 K;  2NVX A;  4A3G K;  1TWF A;  3A8J A;  1XPP A;  3LPX A;  3NKN A;  3S0X A;  3UNY A;  3BP3 A;  2VUM A;  1IL2 A;  1TWG A;  5TMC A;  1WIH A;  1KH9 A;  3CQZ K;  3H3V L;  4LK1 A;  4OIN A;  3GTK A;  5C44 C;  2GA3 A;  1AB4 A;  1YCL A;  4LR2 A;  3S14 C;  5M5W K;  2B63 K;  3S15 K;  5C4X C;  1KHN A;  4KB2 A;  3NKP A;  3AH5 A;  4OIQ A;  1KHJ A;  1EW2 A;  1O29 A;  2V6S A;  3GEE A;  3S1Q K;  4A3D K;  3GTQ K;  1XXB A;  2WB1 D;  3HOY K;  2JA6 A;  5DLV A;  3BP8 C;  2A6E A;  1K83 C;  3S1M K;  2EBB A;  2JA8 K;  2R92 A;  4GZY A;  3GEH A;  1AJB A;  3K7A K;  4KAY A;  4O2D A;  4AH6 A;  3WAX A;  3UN5 A;  1TWH A;  4C3J K;  2JA6 K;  4GTE A;  3LAJ A;  1O98 A;  1WOS A;  3RZD K;  4BXX K;  3G4C A;  5LIA A;  4FZB A;  2R92 C;  1KHK A;  4JK1 A;  1DCP A;  1IBA A;  5M3F K;  1ZXO A;  1ZED A;  2B63 A;  3TFI A;  5IYD C;  1FSU A;  3T00 A;  1URB A;  1JQW A;  3H0G C;  4LK0 A;  3S1M C;  4G7O A;  4A3I K;  3GTM C;  3S16 C;  3S2H K;  1WOO A;  3HOY C;  4YG2 A;  4P5A A;  4J3N A;  4KAV A;  4KMU A;  3AD8 C;  4GTA A;  1SFO A;  1VLO A;  4XLN A;  2GLQ A;  4MY4 A;  4RMF A;  1I6H C;  2D1G A;  5C66 A;  1Y7A A;  1SMY A;  3GTG C;  3S14 K;  2G9Y A;  3KD8 A;  3WAW A;  3HXA A;  3I4M C;  4AYB L;  3GTO C;  1E3C P;  2NVY A;  1F9N A;  4KJG A;  5IP9 C;  1URA A;  1J6W A;  4GTW A;  1AJD A;  1I50 K;  4FDI A;  3VA7 A;  1ANJ A;  4C3I K;  1L0W A;  4UOP A;  4LR8 A;  4PAB A;  3GTL K;  1TWC C;  2W5V A;  2PA8 D;  3EQL A;  4BY1 C;  1IE0 A;  2JA7 C;  3HOV K;  2W8D A;  2E2H K;  1PJ6 A;  5IP9 K;  1XXC A;  4KMH A;  4BBR C;  1HQA A;  4QJV B;  4C3H K;  4OIP A;  4C2M K;  3GTO K;  1WCM A;  4CYR A;  3OEP A;  1R9T A;  1DD5 A;  1YNJ A;  1F93 A;  3PO3 K;  4LRD A;  1I3Q C;  3H3V D;  3GTG K;  4YR1 A;  5JFE A;  4GT9 A;  4UPI A;  1SHQ A;  2BE5 A;  4LOW A;  4MQ9 A;  4ZH4 A;  1B4B A;  3BUE A;  5GOV A;  1E2S P;  4GFQ A;  4GTZ A;  3S2H C;  1XXA A;  2O5I A;  3I4N K;  3RZO K;  1J98 A;  4BLB A;  2VUM K;  5IYD K;  3IDD A;  1ALI A;  2R93 A;  1ZBS A;  1AJC A;  1Y1V A;  3OT9 A;  2Y3P A;  1WCM C;  1E33 P;  3WBH A;  1DCH A;  5LQQ A;  4NWX A;  2NVY K;  4Y52 K;  2A6H A;  5C3E K;  4Y52 C;  3M8Z A;  2RH6 A;  3HOU K;  1TWC A;  4LRE A;  2W5W A;  1Y1V K;  2PMZ L;  1G51 A;  1K7H A;  1EQJ A;  4BY7 C;  3L4J A;  4GTF A;  5IOR A;  1IS1 A;  4GTD A;  1PJ5 A;  5INH A;  2PPB A;  3AD9 C;  3FOF A;  1XZP B;  3S1Q C;  4A3D C;  5IP7 K;  3NKQ A;  3HOZ K;  3ERE D;  2W5X A;  2GSN A;  3E2D A;  1BJT A;  3BDG B;  1ED9 A;  1EK8 A;  1XZP A;  5GRR A;  1SHN A;  1I3Q K;  5LRN A;  3QX3 A;  4KAS A;  3N0B A;  4QIW L;  2R7Z K;  4C2M C;  4GTX A;  4MIV A;  4A3K C;  3WOD A;  2GSO A;  5M5Y K;  1EQR A;  1HI9 A;  1SFO K;  1ALK A;  1WQH A;  1AJA A;  1HDH A;  4NOI A;  5FJ8 K;  5HL8 A;  1B8J A;  4KAW X;  2D6F C;  1I3Q A;  2W5Q A;  3Q3Q A;  1ELZ A;  3TX0 A;  4BY1 K;  1O24 A;  3HOV C;  4A3G C;  3DXJ A;  4A93 C;  3TFJ A;  1O27 A;  2NVQ C;  3DYC A;  4UPH A;  3GDZ A;  4QIW D;  4C3I C;  3S1R C;  4A3C C;  3H0G A;  2R93 K;  2NVX C;  4YFK A;  1I50 C;  1DCO A;  1USM A;  4WJ3 M;  5L0B A;  1PJ7 A;  2GAH C;  4A3F C;  4ZGA A;  2QZU A;  4LQY A;  1E1Z P;  1Y6V A;  2ZKT A;  5KXA A;  1ALJ A;  4LLG A;  4A3B K;  4KM4 A;  2YU9 C;  5AJ9 A;  3M3Y C;  4AYB D;  2E2I K;  4B56 A;  1WOP A;  1TWH C;  4BBS C;  4KMA A;  3NKO A;  1C0A A;  2VQR A;  4GTY A;  1N2K A;  4ZG9 A;  3L4K A;  1XZQ B;  2E2I A;  1I6H K;  3BDG A;  1JVI A;  1KH4 A;  1R9T K;  3M3Y K;  1X31 C;  2YU9 K;  1JOE A;  2R7Z A;  4A3B C;  4CXK A;  4FDJ A;  3GTO A;  4LR9 A;  2XR9 A;  3PO2 C;  4A3J K;  3MML B;  4A3F K;  2RGR A;  3BDF A;  4CXS A;  2CFA B;  1USO A;  3T02 A;  3MK2 A;  3TWZ A;  2PA8 L;  3H0G K;  2NVT K;  3HOW C;  3HKZ L;  3S1R K;  1HQM A;  4YFX A;  4A3C K;  3SZY A;  3GTK C;  1KQ4 A;  3GEI A;  2R92 K;  3UN2 A;  1WOR A;  3NUH A;  4BXX C;  5IYB C;  1Y1W K;  5EGE A;  5C4J C;  2GAG C;  1TWG C;  3AD7 C;  2CW0 A;  2Y0S L;  1WSR A;  2ZFZ A;  3GTJ A;  4KAT A;  3DPC A;  1VH2 A;  4KAR A;  2GSU A;  2O5J A;  2R7Z C;  1XZQ A;  1IQ0 A;  1EH1 A;  3K7A C;  4KN4 A;  2XCR B;  3S1N C;  3UN3 A;  2W5S A;  4QJV A;  1ZVU A;  2XRG A;  2JA8 C;  4KM9 A;  1VGX A;  4KN7 A;  4BLA A;  4P9S A;  1VJE A;  5FLM C;  3GTQ C;  4A3E K;  4KB4 A;  1EW8 A;  5IJQ A;  2W7V A;  3IGY B;  4KMD A;  3S17 C;  1O99 A;  3CMR A;  5IP7 C;  1I50 A;  4XLP A;  1BGW A;  1EJJ A;  5IJS A;  3MK1 A;  1ZQ1 C;  1I6V A;  1IW7 A;  3S2D K;  5C44 K;  3A8I A;  4FM9 A;  4XSX A;  3S1N K;  1Y1V C;  1ED8 A;  2W5T A;  2KWA A;  3T01 A;  2X98 A;  1ELY A;  5C3E C;  1TWG K;  2W8S A;  5IYB K;  1Y1W C;  1N2L A;  1WCM K;  2A69 A;  3GTJ K;  1HJK A;  1O2B A;  3HOX K;  3B5Q A;  3FKI A;  3GSI A;  1O2F B;  1YNN A;  4DDQ A;  2VUM C;  2E2J C;  5IOQ A;  4ILD A;  1TWA K;  3G4A A;  4UPL A;  4X6A C;  4UOR A;  4GTC A;  3RZO C;  3I4N C;  3ED4 A;  1UV7 A;  4A3L C;  4MEX A;  3M8Y A;  2A68 A;  3NVL A;  4KJD A;  3LXQ A;  4ZG7 A;  2WB1 L;  4P5B A;  3GTL A;  3UO0 A;  3GTP C;  4A3J C;  4Q5S A;  1O25 A;  2Y0S D;  3NKR A;  4YFN A;  1ALH A;  3M4O C;  4XCH A;  5CHP A;  5IOS A;  1O28 A;  2XCO A;  2PHC B;  5IYC C;  2PMZ D;  3TTG A;  1TWF K;  3MK0 A;  2WAQ D;  2ANH A;  3N3Y A;  4CXU A;  4N7T A;  3JST A;  1TWH K;  2V6U A;  3LAP A;  5IOT A;  2FQT A;  2ZUF A;  5DLW A;  3M4O K;  1EFW A;  3CQZ A;  1KH7 A;  5M5X K;  4XSZ A;  3AQP A;  4LR7 A;  1F7V A;  4G0U A;  3M8W A;  3A8K A;  4G0W A;  4A3L K;  3FKI K;  4G7H A;  2ZUE A;  4C45 A;  4A3M K;  2NVX K;  1TWA C;  3GTP A;  3GTL C;  1ZEB A;  4G0V A;  2R93 C;  3TG0 A;  3SZZ A;  1V5V A;  2NVQ K;  4Y7N K;  5HRT A;  1J6X A;  2XCQ A;  4LJZ A;  5EGH A;  3M7V A;  4MHX A;  3FHZ A;  3WAV A;  1SFO C;  1EI6 A;  2JA5 C;  4A3K K;  2IUC B;  4LRF A;  1ANI A;  4GTL A;  3I4M K;  5TMF A;  3S2D C;  1WQG A;  1O2A A;  1P49 A;  1WSV A;  4TN0 A;  3IGZ B;  4OIO A;  3GTM A;  1KHL A;  1BDF A;  3GIR A;  3S17 K; 
#chains in the Genus database with same CATH homology
 3UN3 A;  2W5S A;  2XRG A;  3M8Z A;  1AJB A;  4NWJ A;  5DLT A;  2RH6 A;  4KAY A;  4LRA A;  4QAX A;  3WAX A;  4LRE A;  3UN5 A;  2W5W A;  1EW8 A;  1ALJ A;  4CYS A;  1O98 A;  5IJQ A;  1K7H A;  1EQJ A;  3IGY B;  3WAY A;  5LIA A;  1O99 A;  3CMR A;  1KHK A;  5LRM A;  5INH A;  1EJJ A;  5IJS A;  1ELX A;  3NKQ A;  1ZED A;  3MK1 A;  1EW9 A;  1FSU A;  2W5X A;  2GSN A;  3E2D A;  3T00 A;  1URB A;  1ED8 A;  3BDG B;  1ED9 A;  2W5T A;  3T01 A;  5TJ3 A;  5GRR A;  1SHN A;  5KXA A;  2X98 A;  1ELY A;  5LRN A;  4KAV A;  2W8S A;  1N2L A;  5L0E A;  4GTX A;  4MIV A;  1HJK A;  2GLQ A;  2GSO A;  4MY4 A;  2D1G A;  5C66 A;  4ZG6 A;  1Y7A A;  1ALK A;  3B5Q A;  1AJA A;  1HDH A;  2G9Y A;  3A52 A;  3KD8 A;  1B8J A;  3WAW A;  4UPL A;  2W5Q A;  1ELZ A;  3Q3Q A;  4UOR A;  3TX0 A;  1E3C P;  2W5R A;  3ED4 A;  3M8Y A;  4KJG A;  3NVL A;  4KJD A;  3DYC A;  3LXQ A;  2IFY A;  5K4P A;  4UPH A;  4ZG7 A;  5L0K A;  3UO0 A;  1URA A;  3NKR A;  1ALH A;  3NKM A;  4GTW A;  5L0B A;  1AJD A;  3BDH A;  4FDI A;  2IUC A;  1AUK A;  4LRC A;  4ZGA A;  1ANJ A;  2QZU A;  1KH5 A;  1E1Z P;  1Y6V A;  1ZEF A;  2ZKT A;  2ANH A;  3MK0 A;  4LQY A;  4LR8 A;  4UOP A;  4UPK A;  4CXU A;  4N7T A;  4KM4 A;  2W5V A;  5AJ9 A;  4B56 A;  5DLW A;  2W8D A;  1KH7 A;  2VQR A;  3NKO A;  4GTY A;  4UOO A;  1N2K A;  4ZG9 A;  1HQA A;  4LR7 A;  4LRB A;  3BDG A;  3M8W A;  1KH4 A;  4CYR A;  4CXK A;  3TG0 A;  4FDJ A;  1ZEB A;  4LR9 A;  3NKN A;  3UNY A;  4LRD A;  2XR9 A;  3SZZ A;  3BDF A;  4YR1 A;  4CXS A;  1KH9 A;  5HRT A;  4UPI A;  3T02 A;  1SHQ A;  3MK2 A;  3TWZ A;  4MHX A;  3M7V A;  5EGH A;  2GA3 A;  3WAV A;  4LR2 A;  5GOV A;  3SZY A;  1KHN A;  1EI6 A;  1E2S P;  2IUC B;  3NKP A;  4LRF A;  4GTZ A;  1ANI A;  3UN2 A;  1KHJ A;  1EW2 A;  5EGE A;  1P49 A;  4TN0 A;  3IDD A;  1ALI A;  3IGZ B;  3DPC A;  1AJC A;  2GSU A;  1KHL A;  5DLV A;  3OT9 A;  5LQQ A;  1E33 P;  3WBH A;  4NWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...