3T00A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with vanadate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
molecule keywords phosphonoacetate hydrolase
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t00A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t00A01
2GSNA 1KH4A 1ZEFA 1AUKA 4UOPA 1KHKA 2GA3A 5EGEA 3WAVA 1ALJA 2W8SA 4UOOA 3M8YA 3WAYA 1ANJA 3T00A 2IUCA 5LQQA 4MHXA 1ED8A 4KAYA 3NVLA 4LR9A 4FDIA 4UORA 5EGHA 2W5VA 5DLWA 4LRBA 4NWJA 2W5SA 3NKQA 3A52A 4CYSA 3IDDA 4N7TA 1SHQA 1EQJA 2XRGA 3MK1A 3UN5A 1HQAA 2W5XA 5AJ9A 1KH5A 2GSUA 3IGZB 4YR1A 1ELZA 1HDHA 4KAVA 5GOVA 1URBA 2W5RA 3UO0A 4GTXA 4NWXA 1K7HA 1KH9A 1EW2A 4LR2A 1P49A 5GRRA 3M7VA 5DLTA 3BDGB 1AJDA 1EJJA 4LRAA 2IUCB 3MK2A 1EI6A 1ALIA 3WBHA 5IJSA 2D1GA 3M8ZA 4ZG7A 1E2SP 4CXSA 1KHNA 1KH7A 2GLQA 3KD8A 3UNYA 5INHA 5IJQA 1EW9A 2XR9A 1ZEDA 1FSUA 2RH6A 2X98A 3IGYB 5K4PA 4ZG9A 2W5WA 3SZZA 1HJKA 2W5QA 4MY4A 1SHNA 1ALHA 3LXQA 1Y7AA 1ALKA 1O98A 3E2DA 3OT9A 1EW8A 3BDHA 1N2LA 4LQYA 1B8JA 3DYCA 2G9YA 3MK0A 3NKOA 5LRNA 4UPKA 2VQRA 3WAXA 3NKPA 1ZEBA 4UPIA 1ELXA 4B56A 4UPHA 1AJBA 3TX0A 3NKRA 3Q3QA 1E3CP 1E1ZP 4GTWA 3NKNA 5L0EA 2IFYA 5L0BA 4KM4A 1URAA 2GSOA 4LREA 1O99A 4GTZA 4MIVA 3WAWA 4TN0A 4ZG6A 5HRTA 5LIAA 4LRFA 1ANIA 3BDFA 2ANHA 3M8WA 4CYRA 4CXKA 1E33P 1AJAA 3T02A 3ED4A 2ZKTA 4ZGAA 5C66A 4LR8A 4KJDA 3DPCA 4FDJA 4QAXA 5KXAA 5TJ3A 1Y6VA 4LR7A 3BDGA 3UN3A 1KHLA 3SZYA 3B5QA 1ELYA 5LRMA 1ED9A 1N2KA 2W8DA 3TG0A 3UN2A 4KJGA 4CXUA 2W5TA 3CMRA 1KHJA 4UPLA 1AJCA 4LRCA 5DLVA 2QZUA 4LRDA 5L0KA 4GTYA 3TWZA 3T01A 3NKMA
chains in the Genus database with same CATH superfamily
4XLNA 4UOPA 1AUKA 2E2JC 1ALJA 1O26A 1JVIA 4O2DA 2W8SA 4LJZA 3M8YA 1IBAA 4JK1A 3S2HC 5LQQA 1ED8A 4KAYA 4LR9A 3NUHA 1I6HK 4AYBD 3GTQC 2W7VA 4P9SA 3M4OK 5C3EK 1O2FB 1EQJA 3IPJA 3UN5A 5AJ9A 2W5XA 1KH5A 1R9TA 4MEXA 3IGZB 1XXBA 4YR1A 1URBA 4KASA 2O5JA 2R93K 3GEIA 1K7HA 4A3FC 4A3KK 4XSXA 4PABA 1TWAC 3GTLA 1EQRA 1J6WA 2Y0SL 2WB1L 3CQZA 4LRAA 2IUCB 1WOSA 2VUMK 1PJ6A 4BY1K 4AH6A 2RGRA 3GTGC 2FQTA 1KHNA 2EBBA 4KMUA 1XZPB 3V4GA 3HOUC 4BXXC 2Y0SD 3FKIK 3HOZK 5IJQA 2RH6A 2X98A 4KATA 4Q5SA 1WCMA 3SZZA 4GTBA 1K83A 1WCMK 3OEPA 1Y7AA 3HOXK 2JA6C 4BLBA 4Y52C 1YNJA 3BDHA 4KB2A 1I3QK 1N2LA 4BKWA 3GTKC 1F7VA 1WQFA 5TMCA 4A3LC 4KN4A 2NVQC 2VQRA 3WAXA 2YU9C 3HOYC 1I50K 1B4BA 4QJVA 1Y1VC 3NKPA 1ZEBA 1WQGA 4B56A 5IOTA 3JSTA 4KM8A 3GTMC 4BY7K 5L0BA 1IQ0A 4LREA 1TWHA 4A3IC 1VRQC 1WOOA 4XSZA 5IP9K 1DD5A 3L4JA 3GTOC 4TN0A 4ZG6A 5HRTA 1ZBSA 2ZUEA 4CYRA 4G7OA 1E33P 4C3IC 1K83K 3S16C 4OIPA 3K7AC 5C66A 1G51A 1ZXOA 3GTPK 4KJDA 3N0CA 2E2IK 1KQ4A 1HI9A 2PHCB 3M3YC 2E2HA 3UN3A 1KHLA 1XXCA 4C45A 1IE0A 5LRMA 1BS2A 1ED9A 1N2KA 1PJ5A 5IP9C 3UN2A 3HKZL 4KJGA 5IYDK 3S0XA 4A3JK 3S1QC 2W5TA 3CQZK 4UPLA 3S17K 2QZUA 4LOWA 5IYCK 4A3BK 2R92C 2R92A 1O29A 2WB1D 3NKMA 2GSNA 4KMDA 5EGEA 1ZEFA 1TWHK 1KHKA 4G0WA 5TMFA 3ADAC 2R7ZK 3GTKK 2A6HA 1J6VA 3FOEA 3DXJA 3GTPA 4DDQA 1ANJA 5CJ9A 2E2HC 3G4AA 2WAQD 5EGHA 3A8IA 3GEHA 4XLPA 5DLWA 3A52A 4C3JK 4QIWL 4GTLA 1PJ7A 2XRGA 3MK1A 2GSUA 4KM9A 1ELZA 1HDHA 2W5RA 1I50A 3UO0A 4J3NA 4GTXA 1KH9A 1VH2A 1EH1A 4RMFA 2VUMC 1P49A 5GRRA 1USOA 3M7VA 3S1RK 1EJJA 5M5XK 4MQ9A 5HL8A 1ALIA 5IYBC 3GTJK 4C2MC 4A3FK 1Y1VA 5C4XK 1E2SP 4BBRK 1KH7A 2YU9K 2P5MA 4A3LK 3QX3A 4ZG9A 5JVOA 5K4PA 5IOSA 2W5QA 5C4XC 3LXQA 4NOIA 1AB4A 5C4JK 4G7HA 2JA6K 3E2DA 4FM9A 3OT9A 4Y7NK 3RZDC 3GTOK 1WCMC 1EW8A 1XPPA 1SMYA 2JH3A 3S1RC 3HOWK 3H0GK 1WIHA 2PMZD 2D6FC 3H0GA 3GTGA 4KC6A 5M3MK 3HKZD 1WQHA 2P8TA 1UV7A 2Y3PA 2R92K 3LAJA 3HOYK 4M1XA 3PO2K 1ELXA 1AJBA 3NKRA 3Q3QA 5CHPA 4GTWA 3CQZC 3FKIA 1F9NA 2A69A 2IFYA 3NKNA 4KM4A 4A3JC 3S1QK 1Y1WK 2R7ZA 1TWAA 1O99A 3H3VD 4GTZA 4A3EC 4Y7NC 4Y52K 4YFKA 4A3KC 5C4JC 1VJEA 2R93A 4FZBA 2R93C 1DCOA 4A3EK 1I6VA 5M5YK 1O24A 3FHZA 3S16K 4CXKA 2R7ZC 5FJ8K 4C3IK 4ZGAA 3FKIC 3I4NK 3OREA 4BBRC 4LK1A 3HOUK 3I4MK 4BXXK 3DPCA 3LPXA 1F7UA 5IYCC 3H0GC 1IW7A 4LR7A 3TTGA 5IYBK 4ILDA 1VLOA 3TG0A 3N3YA 1DCPA 2ZUFA 1VGXA 4WILA 5L46A 3CMRA 1TWAK 1L0WA 1USMA 5DLVA 1JQWA 2PA8D 5L0KA 4Q4ZA 3I4MC 4GTYA 1YX2A 2O5IA 3T01A 4WJ3M 3A8KA 4P5BA 2GAHC 3I4NC 2WAQL 2NVQK 1J6XA 1Y1WA 4BLAA 3AD9C 1WOPA 1DCHA 1I6HC 4C2MK 4A3CC 2IUCA 5IP7C 2E2HK 5D4DA 3GTJC 3BP3A 4X6AK 4UORA 4G7ZA 5C44C 2A68A 2CFAB 1O27A 3NKQA 4CYSA 4GTCA 4OIQA 4A93K 1SHQA 3EQLA 2VUMA 2JA8K 1I50C 4NWXA 4GTFA 4PAAA 3S17C 3HOWC 5IOQA 4LR2A 4GTEA 1F93A 1C0AA 3BP8C 2B63A 3S2DK 3RZDK 3G4CA 4LK0A 3LAPA 1SFOC 2V6UA 1TWFA 3AD8C 3MMLB 5IJSA 4KMHA 2D1GA 3M8ZA 4ZG7A 4YG2A 1TWFK 3N0BA 2E2IC 4CXSA 3GTPC 1O2AA 5FLMK 5INHA 3HOZC 2XR9A 1O25A 3WODA 1ZEDA 3GTLK 3IGYB 4KARA 2W5WA 1HJKA 3TFHA 1SHNA 4MY4A 4XCHA 1ALHA 3TFIA 1X31C 3GTGK 4A3BC 1TWGA 3S1NK 1INNA 4OIOA 2JA5A 3GDZA 4A3IK 1B8JA 3ERED 5LRNA 1YCLA 4QJVB 3HOVK 3M3YK 2NVYC 1Y1VK 4UPIA 1RU0A 1EK8A 3K7AK 4UPHA 3S14C 1E3CP 4C3JC 3M4OC 2GSOA 1URAA 3BUEA 1I3QC 1IS1A 3S1MC 2CW0A 1YNNA 4A3GK 4C3HK 3RZOC 5LIAA 4LRFA 1WORA 1ANIA 2GAGC 3GTOA 2ANHA 1AJAA 1TWHC 2JA7C 1O28A 2JA7K 4GZYA 3GTMA 5TJ3A 1Y6VA 4ZH4A 4BBSC 3BDGA 2YU9A 1J98A 3SZYA 1ELYA 2W8DA 5IYDC 3S1MK 3GTKA 2NVXK 2KWAA 2V6TA 3VA7A 3CAGA 1KHJA 4GT9A 1R9TK 3GEEA 1AJCA 4LRCA 2JA6A 4LRDA 1BJTA 2XCQA 1EFWA 3PO3C 1JOEA 1K83C 2XCRB 3H3VL 4A3MK 3HOVC 1KH4A 3WAVA 2GA3A 1ZVUA 4UOOA 3WAYA 1HQMA 3S15K 1XXAA 3T00A 4BY1C 4MHXA 4BBSK 3AQOA 4KAWX 3NVLA 4FDIA 2W5VA 2PMZL 4LRBA 4NWJA 2W5SA 2JA7A 3IDDA 3GTLC 4N7TA 3GTMK 4BY7C 1HQAA 5FLMC 2PPBA 3PO3K 3FOFA 4KAVA 5GOVA 1ZQ1C 4QIWD 1XZPA 1EW2A 1R9TC 4KMAA 4C3HC 3A8JA 5C3EC 1I3QA 5DLTA 3BDGB 1AJDA 2V6SA 3S2DC 4WJ4A 2A6EA 4YFNA 1EI6A 4KN7A 4OIRA 3GTQA 3MK2A 3HOXC 1BGWA 3WBHA 3S2HK 1ISEA 1GE9A 2NVYA 1ZYRA 2NVTK 4OINA 3GIRA 4LLGA 2GLQA 3KD8A 3AD7C 3UNYA 3AH5A 4P5AA 1EW9A 2BE5A 1O2BA 4A3DK 4A93C 1FSUA 2JA5C 4KB4A 4GFQA 1TWGC 1IL2A 1WSVA 2NVTC 1TWCC 1ALKA 1O98A 3GSIA 1XZQB 5IP7K 3RZOK 4G0UA 4KDDA 4A3GC 2ZFZA 5JFEA 4LQYA 3DYCA 2G9YA 3MK0A 3NKOA 4UPKA 5M3FK 4A3MC 2E2IA 3L4KA 3TFJA 1TWFC 2NVYK 1SFOA 1BDFA 1SFOK 3TX0A 1E1ZP 2PA8L 5L0EA 4G0VA 2B63C 2NVXC 3GTQK 1B4AA 4AYBL 4MIVA 3WAWA 3S1NC 1V5VA 3HXAA 2XCOA 3S15C 1TWGK 3BDFA 1XZQA 2FQOA 2B63K 3M8WA 3OPFA 4A3DC 1WSRA 2NVXA 3T02A 2E2JK 3ED4A 2ZKTA 4LR8A 4FDJA 4QAXA 5KXAA 4MEYA 5C44K 3GTJA 4X6AC 3B5QA 4A3CK 2CFAA 4GTDA 5IORA 4CXUA 5M5WK 4GTAA 1Y1WC 3S14K 3AQPA 5E68A 4YFXA 1TWCK 3PO2C 2JA8C 3TWZA 1TWCA 2JA5K
chains in the Genus database with same CATH topology
2GSNA 1KH4A 1ZEFA 1AUKA 4UOPA 1KHKA 2GA3A 5EGEA 3WAVA 1ALJA 2W8SA 4UOOA 3M8YA 3WAYA 1ANJA 3T00A 2IUCA 5LQQA 4MHXA 1ED8A 4KAYA 3NVLA 4LR9A 4FDIA 4UORA 5EGHA 2W5VA 5DLWA 4LRBA 4NWJA 2W5SA 3NKQA 3A52A 4CYSA 3IDDA 4N7TA 1SHQA 1EQJA 2XRGA 3MK1A 3UN5A 1HQAA 2W5XA 5AJ9A 1KH5A 2GSUA 3IGZB 4YR1A 1ELZA 1HDHA 4KAVA 5GOVA 1URBA 2W5RA 3UO0A 4GTXA 4NWXA 1K7HA 1KH9A 1EW2A 4LR2A 1P49A 5GRRA 3M7VA 5DLTA 3BDGB 1AJDA 1EJJA 4LRAA 2IUCB 3MK2A 1EI6A 1ALIA 3WBHA 5IJSA 2D1GA 3M8ZA 4ZG7A 1E2SP 4CXSA 1KHNA 1KH7A 2GLQA 3KD8A 3UNYA 5INHA 5IJQA 1EW9A 2XR9A 1ZEDA 1FSUA 2RH6A 2X98A 3IGYB 5K4PA 4ZG9A 2W5WA 3SZZA 1HJKA 2W5QA 4MY4A 1SHNA 1ALHA 3LXQA 1Y7AA 1ALKA 1O98A 3E2DA 3OT9A 1EW8A 3BDHA 1N2LA 4LQYA 1B8JA 3DYCA 2G9YA 3MK0A 3NKOA 5LRNA 4UPKA 2VQRA 3WAXA 3NKPA 1ZEBA 4UPIA 1ELXA 4B56A 4UPHA 1AJBA 3TX0A 3NKRA 3Q3QA 1E3CP 1E1ZP 4GTWA 3NKNA 5L0EA 2IFYA 5L0BA 4KM4A 1URAA 2GSOA 4LREA 1O99A 4GTZA 4MIVA 3WAWA 4TN0A 4ZG6A 5HRTA 5LIAA 4LRFA 1ANIA 3BDFA 2ANHA 3M8WA 4CYRA 4CXKA 1E33P 1AJAA 3T02A 3ED4A 2ZKTA 4ZGAA 5C66A 4LR8A 4KJDA 3DPCA 4FDJA 4QAXA 5KXAA 5TJ3A 1Y6VA 4LR7A 3BDGA 3UN3A 1KHLA 3SZYA 3B5QA 1ELYA 5LRMA 1ED9A 1N2KA 2W8DA 3TG0A 3UN2A 4KJGA 4CXUA 2W5TA 3CMRA 1KHJA 4UPLA 1AJCA 4LRCA 5DLVA 2QZUA 4LRDA 5L0KA 4GTYA 3TWZA 3T01A 3NKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GSN A;  1KH4 A;  1ZEF A;  1AUK A;  4UOP A;  1KHK A;  2GA3 A;  5EGE A;  3WAV A;  1ALJ A;  2W8S A;  4UOO A;  3M8Y A;  3WAY A;  1ANJ A;  3T00 A;  2IUC A;  5LQQ A;  4MHX A;  1ED8 A;  4KAY A;  3NVL A;  4LR9 A;  4FDI A;  4UOR A;  5EGH A;  2W5V A;  5DLW A;  4LRB A;  4NWJ A;  2W5S A;  3NKQ A;  3A52 A;  4CYS A;  3IDD A;  4N7T A;  1SHQ A;  1EQJ A;  2XRG A;  3MK1 A;  3UN5 A;  1HQA A;  2W5X A;  5AJ9 A;  1KH5 A;  2GSU A;  3IGZ B;  4YR1 A;  1ELZ A;  1HDH A;  4KAV A;  5GOV A;  1URB A;  2W5R A;  3UO0 A;  4GTX A;  4NWX A;  1K7H A;  1KH9 A;  1EW2 A;  4LR2 A;  1P49 A;  5GRR A;  3M7V A;  5DLT A;  3BDG B;  1AJD A;  1EJJ A;  4LRA A;  2IUC B;  3MK2 A;  1EI6 A;  1ALI A;  3WBH A;  5IJS A;  2D1G A;  3M8Z A;  4ZG7 A;  1E2S P;  4CXS A;  1KHN A;  1KH7 A;  2GLQ A;  3KD8 A;  3UNY A;  5INH A;  5IJQ A;  1EW9 A;  2XR9 A;  1ZED A;  1FSU A;  2RH6 A;  2X98 A;  3IGY B;  5K4P A;  4ZG9 A;  2W5W A;  3SZZ A;  1HJK A;  2W5Q A;  4MY4 A;  1SHN A;  1ALH A;  3LXQ A;  1Y7A A;  1ALK A;  1O98 A;  3E2D A;  3OT9 A;  1EW8 A;  3BDH A;  1N2L A;  4LQY A;  1B8J A;  3DYC A;  2G9Y A;  3MK0 A;  3NKO A;  5LRN A;  4UPK A;  2VQR A;  3WAX A;  3NKP A;  1ZEB A;  4UPI A;  1ELX A;  4B56 A;  4UPH A;  1AJB A;  3TX0 A;  3NKR A;  3Q3Q A;  1E3C P;  1E1Z P;  4GTW A;  3NKN A;  5L0E A;  2IFY A;  5L0B A;  4KM4 A;  1URA A;  2GSO A;  4LRE A;  1O99 A;  4GTZ A;  4MIV A;  3WAW A;  4TN0 A;  4ZG6 A;  5HRT A;  5LIA A;  4LRF A;  1ANI A;  3BDF A;  2ANH A;  3M8W A;  4CYR A;  4CXK A;  1E33 P;  1AJA A;  3T02 A;  3ED4 A;  2ZKT A;  4ZGA A;  5C66 A;  4LR8 A;  4KJD A;  3DPC A;  4FDJ A;  4QAX A;  5KXA A;  5TJ3 A;  1Y6V A;  4LR7 A;  3BDG A;  3UN3 A;  1KHL A;  3SZY A;  3B5Q A;  1ELY A;  5LRM A;  1ED9 A;  1N2K A;  2W8D A;  3TG0 A;  3UN2 A;  4KJG A;  4CXU A;  2W5T A;  3CMR A;  1KHJ A;  4UPL A;  1AJC A;  4LRC A;  5DLV A;  2QZU A;  4LRD A;  5L0K A;  4GTY A;  3TWZ A;  3T01 A;  3NKM A; 
#chains in the Genus database with same CATH topology
 4XLN A;  4UOP A;  1AUK A;  2E2J C;  1ALJ A;  1O26 A;  1JVI A;  4O2D A;  2W8S A;  4LJZ A;  3M8Y A;  1IBA A;  4JK1 A;  3S2H C;  5LQQ A;  1ED8 A;  4KAY A;  4LR9 A;  3NUH A;  1I6H K;  4AYB D;  3GTQ C;  2W7V A;  4P9S A;  3M4O K;  5C3E K;  1O2F B;  1EQJ A;  3IPJ A;  3UN5 A;  5AJ9 A;  2W5X A;  1KH5 A;  1R9T A;  4MEX A;  3IGZ B;  1XXB A;  4YR1 A;  1URB A;  4KAS A;  2O5J A;  2R93 K;  3GEI A;  1K7H A;  4A3F C;  4A3K K;  4XSX A;  4PAB A;  1TWA C;  3GTL A;  1EQR A;  1J6W A;  2Y0S L;  2WB1 L;  3CQZ A;  4LRA A;  2IUC B;  1WOS A;  2VUM K;  1PJ6 A;  4BY1 K;  4AH6 A;  2RGR A;  3GTG C;  2FQT A;  1KHN A;  2EBB A;  4KMU A;  1XZP B;  3V4G A;  3HOU C;  4BXX C;  2Y0S D;  3FKI K;  3HOZ K;  5IJQ A;  2RH6 A;  2X98 A;  4KAT A;  4Q5S A;  1WCM A;  3SZZ A;  4GTB A;  1K83 A;  1WCM K;  3OEP A;  1Y7A A;  3HOX K;  2JA6 C;  4BLB A;  4Y52 C;  1YNJ A;  3BDH A;  4KB2 A;  1I3Q K;  1N2L A;  4BKW A;  3GTK C;  1F7V A;  1WQF A;  5TMC A;  4A3L C;  4KN4 A;  2NVQ C;  2VQR A;  3WAX A;  2YU9 C;  3HOY C;  1I50 K;  1B4B A;  4QJV A;  1Y1V C;  3NKP A;  1ZEB A;  1WQG A;  4B56 A;  5IOT A;  3JST A;  4KM8 A;  3GTM C;  4BY7 K;  5L0B A;  1IQ0 A;  4LRE A;  1TWH A;  4A3I C;  1VRQ C;  1WOO A;  4XSZ A;  5IP9 K;  1DD5 A;  3L4J A;  3GTO C;  4TN0 A;  4ZG6 A;  5HRT A;  1ZBS A;  2ZUE A;  4CYR A;  4G7O A;  1E33 P;  4C3I C;  1K83 K;  3S16 C;  4OIP A;  3K7A C;  5C66 A;  1G51 A;  1ZXO A;  3GTP K;  4KJD A;  3N0C A;  2E2I K;  1KQ4 A;  1HI9 A;  2PHC B;  3M3Y C;  2E2H A;  3UN3 A;  1KHL A;  1XXC A;  4C45 A;  1IE0 A;  5LRM A;  1BS2 A;  1ED9 A;  1N2K A;  1PJ5 A;  5IP9 C;  3UN2 A;  3HKZ L;  4KJG A;  5IYD K;  3S0X A;  4A3J K;  3S1Q C;  2W5T A;  3CQZ K;  4UPL A;  3S17 K;  2QZU A;  4LOW A;  5IYC K;  4A3B K;  2R92 C;  2R92 A;  1O29 A;  2WB1 D;  3NKM A;  2GSN A;  4KMD A;  5EGE A;  1ZEF A;  1TWH K;  1KHK A;  4G0W A;  5TMF A;  3ADA C;  2R7Z K;  3GTK K;  2A6H A;  1J6V A;  3FOE A;  3DXJ A;  3GTP A;  4DDQ A;  1ANJ A;  5CJ9 A;  2E2H C;  3G4A A;  2WAQ D;  5EGH A;  3A8I A;  3GEH A;  4XLP A;  5DLW A;  3A52 A;  4C3J K;  4QIW L;  4GTL A;  1PJ7 A;  2XRG A;  3MK1 A;  2GSU A;  4KM9 A;  1ELZ A;  1HDH A;  2W5R A;  1I50 A;  3UO0 A;  4J3N A;  4GTX A;  1KH9 A;  1VH2 A;  1EH1 A;  4RMF A;  2VUM C;  1P49 A;  5GRR A;  1USO A;  3M7V A;  3S1R K;  1EJJ A;  5M5X K;  4MQ9 A;  5HL8 A;  1ALI A;  5IYB C;  3GTJ K;  4C2M C;  4A3F K;  1Y1V A;  5C4X K;  1E2S P;  4BBR K;  1KH7 A;  2YU9 K;  2P5M A;  4A3L K;  3QX3 A;  4ZG9 A;  5JVO A;  5K4P A;  5IOS A;  2W5Q A;  5C4X C;  3LXQ A;  4NOI A;  1AB4 A;  5C4J K;  4G7H A;  2JA6 K;  3E2D A;  4FM9 A;  3OT9 A;  4Y7N K;  3RZD C;  3GTO K;  1WCM C;  1EW8 A;  1XPP A;  1SMY A;  2JH3 A;  3S1R C;  3HOW K;  3H0G K;  1WIH A;  2PMZ D;  2D6F C;  3H0G A;  3GTG A;  4KC6 A;  5M3M K;  3HKZ D;  1WQH A;  2P8T A;  1UV7 A;  2Y3P A;  2R92 K;  3LAJ A;  3HOY K;  4M1X A;  3PO2 K;  1ELX A;  1AJB A;  3NKR A;  3Q3Q A;  5CHP A;  4GTW A;  3CQZ C;  3FKI A;  1F9N A;  2A69 A;  2IFY A;  3NKN A;  4KM4 A;  4A3J C;  3S1Q K;  1Y1W K;  2R7Z A;  1TWA A;  1O99 A;  3H3V D;  4GTZ A;  4A3E C;  4Y7N C;  4Y52 K;  4YFK A;  4A3K C;  5C4J C;  1VJE A;  2R93 A;  4FZB A;  2R93 C;  1DCO A;  4A3E K;  1I6V A;  5M5Y K;  1O24 A;  3FHZ A;  3S16 K;  4CXK A;  2R7Z C;  5FJ8 K;  4C3I K;  4ZGA A;  3FKI C;  3I4N K;  3ORE A;  4BBR C;  4LK1 A;  3HOU K;  3I4M K;  4BXX K;  3DPC A;  3LPX A;  1F7U A;  5IYC C;  3H0G C;  1IW7 A;  4LR7 A;  3TTG A;  5IYB K;  4ILD A;  1VLO A;  3TG0 A;  3N3Y A;  1DCP A;  2ZUF A;  1VGX A;  4WIL A;  5L46 A;  3CMR A;  1TWA K;  1L0W A;  1USM A;  5DLV A;  1JQW A;  2PA8 D;  5L0K A;  4Q4Z A;  3I4M C;  4GTY A;  1YX2 A;  2O5I A;  3T01 A;  4WJ3 M;  3A8K A;  4P5B A;  2GAH C;  3I4N C;  2WAQ L;  2NVQ K;  1J6X A;  1Y1W A;  4BLA A;  3AD9 C;  1WOP A;  1DCH A;  1I6H C;  4C2M K;  4A3C C;  2IUC A;  5IP7 C;  2E2H K;  5D4D A;  3GTJ C;  3BP3 A;  4X6A K;  4UOR A;  4G7Z A;  5C44 C;  2A68 A;  2CFA B;  1O27 A;  3NKQ A;  4CYS A;  4GTC A;  4OIQ A;  4A93 K;  1SHQ A;  3EQL A;  2VUM A;  2JA8 K;  1I50 C;  4NWX A;  4GTF A;  4PAA A;  3S17 C;  3HOW C;  5IOQ A;  4LR2 A;  4GTE A;  1F93 A;  1C0A A;  3BP8 C;  2B63 A;  3S2D K;  3RZD K;  3G4C A;  4LK0 A;  3LAP A;  1SFO C;  2V6U A;  1TWF A;  3AD8 C;  3MML B;  5IJS A;  4KMH A;  2D1G A;  3M8Z A;  4ZG7 A;  4YG2 A;  1TWF K;  3N0B A;  2E2I C;  4CXS A;  3GTP C;  1O2A A;  5FLM K;  5INH A;  3HOZ C;  2XR9 A;  1O25 A;  3WOD A;  1ZED A;  3GTL K;  3IGY B;  4KAR A;  2W5W A;  1HJK A;  3TFH A;  1SHN A;  4MY4 A;  4XCH A;  1ALH A;  3TFI A;  1X31 C;  3GTG K;  4A3B C;  1TWG A;  3S1N K;  1INN A;  4OIO A;  2JA5 A;  3GDZ A;  4A3I K;  1B8J A;  3ERE D;  5LRN A;  1YCL A;  4QJV B;  3HOV K;  3M3Y K;  2NVY C;  1Y1V K;  4UPI A;  1RU0 A;  1EK8 A;  3K7A K;  4UPH A;  3S14 C;  1E3C P;  4C3J C;  3M4O C;  2GSO A;  1URA A;  3BUE A;  1I3Q C;  1IS1 A;  3S1M C;  2CW0 A;  1YNN A;  4A3G K;  4C3H K;  3RZO C;  5LIA A;  4LRF A;  1WOR A;  1ANI A;  2GAG C;  3GTO A;  2ANH A;  1AJA A;  1TWH C;  2JA7 C;  1O28 A;  2JA7 K;  4GZY A;  3GTM A;  5TJ3 A;  1Y6V A;  4ZH4 A;  4BBS C;  3BDG A;  2YU9 A;  1J98 A;  3SZY A;  1ELY A;  2W8D A;  5IYD C;  3S1M K;  3GTK A;  2NVX K;  2KWA A;  2V6T A;  3VA7 A;  3CAG A;  1KHJ A;  4GT9 A;  1R9T K;  3GEE A;  1AJC A;  4LRC A;  2JA6 A;  4LRD A;  1BJT A;  2XCQ A;  1EFW A;  3PO3 C;  1JOE A;  1K83 C;  2XCR B;  3H3V L;  4A3M K;  3HOV C;  1KH4 A;  3WAV A;  2GA3 A;  1ZVU A;  4UOO A;  3WAY A;  1HQM A;  3S15 K;  1XXA A;  3T00 A;  4BY1 C;  4MHX A;  4BBS K;  3AQO A;  4KAW X;  3NVL A;  4FDI A;  2W5V A;  2PMZ L;  4LRB A;  4NWJ A;  2W5S A;  2JA7 A;  3IDD A;  3GTL C;  4N7T A;  3GTM K;  4BY7 C;  1HQA A;  5FLM C;  2PPB A;  3PO3 K;  3FOF A;  4KAV A;  5GOV A;  1ZQ1 C;  4QIW D;  1XZP A;  1EW2 A;  1R9T C;  4KMA A;  4C3H C;  3A8J A;  5C3E C;  1I3Q A;  5DLT A;  3BDG B;  1AJD A;  2V6S A;  3S2D C;  4WJ4 A;  2A6E A;  4YFN A;  1EI6 A;  4KN7 A;  4OIR A;  3GTQ A;  3MK2 A;  3HOX C;  1BGW A;  3WBH A;  3S2H K;  1ISE A;  1GE9 A;  2NVY A;  1ZYR A;  2NVT K;  4OIN A;  3GIR A;  4LLG A;  2GLQ A;  3KD8 A;  3AD7 C;  3UNY A;  3AH5 A;  4P5A A;  1EW9 A;  2BE5 A;  1O2B A;  4A3D K;  4A93 C;  1FSU A;  2JA5 C;  4KB4 A;  4GFQ A;  1TWG C;  1IL2 A;  1WSV A;  2NVT C;  1TWC C;  1ALK A;  1O98 A;  3GSI A;  1XZQ B;  5IP7 K;  3RZO K;  4G0U A;  4KDD A;  4A3G C;  2ZFZ A;  5JFE A;  4LQY A;  3DYC A;  2G9Y A;  3MK0 A;  3NKO A;  4UPK A;  5M3F K;  4A3M C;  2E2I A;  3L4K A;  3TFJ A;  1TWF C;  2NVY K;  1SFO A;  1BDF A;  1SFO K;  3TX0 A;  1E1Z P;  2PA8 L;  5L0E A;  4G0V A;  2B63 C;  2NVX C;  3GTQ K;  1B4A A;  4AYB L;  4MIV A;  3WAW A;  3S1N C;  1V5V A;  3HXA A;  2XCO A;  3S15 C;  1TWG K;  3BDF A;  1XZQ A;  2FQO A;  2B63 K;  3M8W A;  3OPF A;  4A3D C;  1WSR A;  2NVX A;  3T02 A;  2E2J K;  3ED4 A;  2ZKT A;  4LR8 A;  4FDJ A;  4QAX A;  5KXA A;  4MEY A;  5C44 K;  3GTJ A;  4X6A C;  3B5Q A;  4A3C K;  2CFA A;  4GTD A;  5IOR A;  4CXU A;  5M5W K;  4GTA A;  1Y1W C;  3S14 K;  3AQP A;  5E68 A;  4YFX A;  1TWC K;  3PO2 C;  2JA8 C;  3TWZ A;  1TWC A;  2JA5 K; 
#chains in the Genus database with same CATH homology
 2GSN A;  1KH4 A;  1ZEF A;  1AUK A;  4UOP A;  1KHK A;  2GA3 A;  5EGE A;  3WAV A;  1ALJ A;  2W8S A;  4UOO A;  3M8Y A;  3WAY A;  1ANJ A;  3T00 A;  2IUC A;  5LQQ A;  4MHX A;  1ED8 A;  4KAY A;  3NVL A;  4LR9 A;  4FDI A;  4UOR A;  5EGH A;  2W5V A;  5DLW A;  4LRB A;  4NWJ A;  2W5S A;  3NKQ A;  3A52 A;  4CYS A;  3IDD A;  4N7T A;  1SHQ A;  1EQJ A;  2XRG A;  3MK1 A;  3UN5 A;  1HQA A;  2W5X A;  5AJ9 A;  1KH5 A;  2GSU A;  3IGZ B;  4YR1 A;  1ELZ A;  1HDH A;  4KAV A;  5GOV A;  1URB A;  2W5R A;  3UO0 A;  4GTX A;  4NWX A;  1K7H A;  1KH9 A;  1EW2 A;  4LR2 A;  1P49 A;  5GRR A;  3M7V A;  5DLT A;  3BDG B;  1AJD A;  1EJJ A;  4LRA A;  2IUC B;  3MK2 A;  1EI6 A;  1ALI A;  3WBH A;  5IJS A;  2D1G A;  3M8Z A;  4ZG7 A;  1E2S P;  4CXS A;  1KHN A;  1KH7 A;  2GLQ A;  3KD8 A;  3UNY A;  5INH A;  5IJQ A;  1EW9 A;  2XR9 A;  1ZED A;  1FSU A;  2RH6 A;  2X98 A;  3IGY B;  5K4P A;  4ZG9 A;  2W5W A;  3SZZ A;  1HJK A;  2W5Q A;  4MY4 A;  1SHN A;  1ALH A;  3LXQ A;  1Y7A A;  1ALK A;  1O98 A;  3E2D A;  3OT9 A;  1EW8 A;  3BDH A;  1N2L A;  4LQY A;  1B8J A;  3DYC A;  2G9Y A;  3MK0 A;  3NKO A;  5LRN A;  4UPK A;  2VQR A;  3WAX A;  3NKP A;  1ZEB A;  4UPI A;  1ELX A;  4B56 A;  4UPH A;  1AJB A;  3TX0 A;  3NKR A;  3Q3Q A;  1E3C P;  1E1Z P;  4GTW A;  3NKN A;  5L0E A;  2IFY A;  5L0B A;  4KM4 A;  1URA A;  2GSO A;  4LRE A;  1O99 A;  4GTZ A;  4MIV A;  3WAW A;  4TN0 A;  4ZG6 A;  5HRT A;  5LIA A;  4LRF A;  1ANI A;  3BDF A;  2ANH A;  3M8W A;  4CYR A;  4CXK A;  1E33 P;  1AJA A;  3T02 A;  3ED4 A;  2ZKT A;  4ZGA A;  5C66 A;  4LR8 A;  4KJD A;  3DPC A;  4FDJ A;  4QAX A;  5KXA A;  5TJ3 A;  1Y6V A;  4LR7 A;  3BDG A;  3UN3 A;  1KHL A;  3SZY A;  3B5Q A;  1ELY A;  5LRM A;  1ED9 A;  1N2K A;  2W8D A;  3TG0 A;  3UN2 A;  4KJG A;  4CXU A;  2W5T A;  3CMR A;  1KHJ A;  4UPL A;  1AJC A;  4LRC A;  5DLV A;  2QZU A;  4LRD A;  5L0K A;  4GTY A;  3TWZ A;  3T01 A;  3NKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...