3T00A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with vanadate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t00A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t00A01
4GTYA 5DLVA 3IGYB 1N2KA 1EI6A 4ZG7A 2ZKTA 2W5XA 4GTZA 5GOVA 3M7VA 1KHJA 2G9YA 4QAXA 3B5QA 4LR7A 1ALJA 4CXSA 3OT9A 3SZZA 3NKPA 1SHNA 4LRFA 1EJJA 2RH6A 4TN0A 4CYSA 2W5TA 2W8SA 1EW9A 1FSUA 4UPKA 3TWZA 1Y6VA 1AJDA 1E3CP 1O99A 1ED8A 1ELXA 3NKMA 3BDHA 3UO0A 5KXAA 5L0BA 5IJQA 1ELZA 1E33P 4LR8A 4ZG9A 5LRNA 1ALHA 4UPIA 3UNYA 5IJSA 1ZEDA 4LRDA 4KAYA 3WAWA 3UN3A 4MY4A 4FDIA 1KH9A 3CMRA 1URBA 2IUCA 1EW2A 1KHKA 3BDGB 3E2DA 4FDJA 3M8ZA 5L0EA 3LXQA 2GSOA 3KD8A 2GSUA 1ELYA 2GLQA 4KM4A 4MIVA 4UOPA 4ZG6A 5LQQA 5C66A 3BDFA 3A52A 4GTXA 1ANIA 1E1ZP 3UN2A 4CYRA 4LRCA 2X98A 2W5WA 5K4PA 1KHLA 3MK2A 3NKNA 3M8WA 3NVLA 1P49A 4MHXA 2W5QA 3WAYA 3NKQA 4KJDA 2W5RA 5EGEA 4LRBA 3MK1A 3M8YA 3T01A 1ED9A 3WAVA 3WAXA 5AJ9A 3SZYA 4NWJA 5HRTA 4LQYA 2W8DA 1B8JA 3DPCA 2ANHA 4YR1A 4UPLA 2QZUA 2IFYA 3DYCA 3IDDA 1ALIA 1SHQA 4ZGAA 5EGHA 1Y7AA 1AJCA 4B56A 1K7HA 1ZEBA 5INHA 4CXUA 1AJAA 1EW8A 1KH4A 4UPHA 3Q3QA 4LREA 4NWXA 5DLTA 3MK0A 2IUCB 1HJKA 3UN5A 3TX0A 3T00A 4LR9A 4UORA 2GSNA 5LRMA 2VQRA 2D1GA 1KHNA 5L0KA 3TG0A 1ALKA 5TJ3A 1ANJA 5LIAA 1AJBA 5DLWA 1N2LA 3BDGA 2GA3A 5GRRA 1URAA 3ED4A 1AUKA 4GTWA 3IGZB 4CXKA 1EQJA 1KH5A 2XRGA 3NKRA 4KJGA 4UOOA 3T02A 1E2SP 2W5VA 1KH7A 1HQAA 2XR9A 3WBHA 1ZEFA 4KAVA 4LR2A 4LRAA 4N7TA 2W5SA 3NKOA 1HDHA 1O98A
chains in the Genus database with same CATH superfamily
4C2MC 3S14K 5FJ8K 4OIQA 5DLVA 1JQWA 2WB1L 1R9TC 3GTOK 1J6WA 4XLPA 1O2AA 3B5QA 3MMLB 3GDZA 2NVYK 3GTOA 1XZQB 5C4XC 1SHNA 3GTPC 4TN0A 1X31C 1O27A 1FSUA 2NVYA 1Y6VA 1WIHA 1AJDA 4WJ3M 4KMDA 3PO3C 4GT9A 1E3CP 1ELXA 4C3JK 1O99A 1WSVA 2ZUEA 1VRQC 4PABA 1R9TA 4AYBL 5IP7C 1TWCC 1WORA 1IW7A 1ELZA 1E33P 1VLOA 5IOSA 4GTBA 1Y1VC 4KB4A 1VH2A 1XZPA 3GTPA 4X6AC 1KH9A 4BKWA 3TTGA 4BXXC 1URBA 1B4BA 1WQFA 3S1RK 4FDJA 1WQHA 1KHKA 4KB2A 1J6VA 1Y1VK 1L0WA 2XCOA 3HOWK 4Y7NK 1TWCA 5C66A 4GTXA 1Y1VA 2YU9C 4A3BK 2W5WA 3HOVK 3NKNA 5K4PA 3GTJC 4BY7K 4A3LK 2NVTK 4A93C 1USOA 1I6HK 4GZYA 2PA8D 4KASA 3HKZL 2E2HC 2W5RA 1I50K 2Y3PA 5IORA 3S15K 1ZXOA 4GTCA 1ED9A 3WAVA 4A3MC 2NVQK 2YU9A 3S17K 3A8KA 4YR1A 3HOZC 3DPCA 3CAGA 4A3CC 3H3VL 4KAWX 2JA6C 3S0XA 2IFYA 5IOTA 3FHZA 2JA5C 2GAGC 3S1QC 3IDDA 2GAHC 5TMFA 3HOZK 4ZGAA 1V5VA 1IQ0A 3H0GK 4XSXA 1AJCA 1Y7AA 4G7HA 1ZEBA 4B56A 4CXUA 4XCHA 1EW8A 1KH4A 3Q3QA 4NWXA 3S1QK 1BS2A 3I4NK 3UN5A 2JA6A 3T00A 1TWAC 3M4OC 1HI9A 1EQRA 2JA5A 4LLGA 4YFKA 3CQZK 2O5IA 1ALKA 1O25A 5IYDK 4MQ9A 4A3DK 1TWAK 3TFHA 1EH1A 3CQZA 4BBSK 4DDQA 4KC6A 4NOIA 4A3GC 5GRRA 3GTGK 4QJVB 1EQJA 2NVXC 3HOYC 1TWHK 1TWAA 4KJGA 4ZH4A 2RGRA 4O2DA 1G51A 4KAVA 4LRAA 4N7TA 2W5SA 2FQTA 3NKOA 1HDHA 3OREA 3EQLA 4KMHA 5IYCC 4GTYA 2R92C 2NVXK 3HOXK 1N2KA 1EI6A 2JA8C 5D4DA 3S2HC 1PJ7A 3L4KA 4C3IK 5GOVA 1XPPA 1GE9A 1AB4A 4P5BA 2NVXA 3OT9A 3S1NK 2R7ZC 1EJJA 2E2JK 4CYSA 4OIOA 2W5TA 1SFOC 4LK1A 1F7UA 5IYBK 3GTLC 1EW9A 4J3NA 4UPKA 3TWZA 2R92A 5E68A 2BE5A 5M5YK 5L0BA 3GSIA 1F93A 1O2BA 2V6TA 5KXAA 5IJQA 4LR8A 5LRNA 4UPIA 3UNYA 5IJSA 1F9NA 3M3YC 3QX3A 3UN3A 2R7ZA 4MY4A 1WCMC 4P9SA 3LAJA 1SFOA 4FDIA 2KWAA 4YG2A 3HKZD 3E2DA 4A3EK 2O5JA 3M8ZA 1WOOA 1IBAA 3LAPA 3LPXA 4MIVA 1DCPA 2W7VA 5IP7K 1JOEA 4C2MK 3BDFA 3A52A 2CW0A 1Y1WC 1R9TK 2X98A 3MK2A 4PAAA 4JK1A 3NVLA 4LK0A 3BP3A 5M3FK 1WCMA 4FM9A 4MHXA 3H3VD 4GTFA 3WAYA 5IP9C 5C4XK 4KJDA 3GTPK 4LRBA 3MK1A 3M8YA 3AH5A 3PO3K 3FOEA 3WAXA 5AJ9A 1Y1WA 4GTLA 3L4JA 1TWCK 2Y0SL 4FZBA 4UPLA 3VA7A 4KATA 3DYCA 4KDDA 2ZUFA 1WQGA 1YNNA 1WSRA 3IPJA 4X6AK 1EFWA 4BXXK 1B4AA 5CJ9A 1ALIA 2A6EA 1J6XA 5M3MK 3A8JA 1K7HA 4Y52C 2B63C 1TWGC 2A68A 3GTKC 4LREA 4KN4A 1INNA 2D6FC 3N0CA 1YX2A 2YU9K 3GTMC 3TX0A 3GTJK 3GTQC 4A93K 4UORA 2B63K 5LRMA 1TWFC 2D1GA 1KHNA 5M5XK 3OPFA 2E2HK 3GTJA 5L0KA 4WJ4A 3OEPA 5C4JC 1ANJA 2B63A 5DLWA 3WODA 1N2LA 1TWGA 2PMZD 3GTKA 5M5WK 4ILDA 2E2HA 1ZVUA 2R93C 1URAA 4GTWA 4A3MK 3GTMA 3IGZB 1TWFK 1KQ4A 3S1MC 3GTQA 3T02A 1YCLA 4A3CK 2W5VA 2JA7C 4A3FC 2JA6K 1XZPB 1TWFA 4LR2A 5FLMC 1K83C 1ZEFA 4QAXA 2JA5K 3S2DC 4C3HC 4ZG7A 2FQOA 3GEIA 4KMUA 4BBRC 4BLBA 2R93A 3G4AA 1ALJA 4CXSA 3GIRA 3SZZA 3NKPA 2VUMC 3I4MC 1I3QC 2JA7A 4LRFA 2RH6A 3FKIC 3AD7C 5C44C 1K83A 2WB1D 3M4OK 3A8IA 4KMAA 1ED8A 3NKMA 4A3KC 1ALHA 3RZOC 2VUMA 4BY1C 4A3GK 1I3QA 4LRDA 4KAYA 3RZDC 4G0VA 1O29A 4P5AA 3HOYK 3CMRA 4G7OA 4AYBD 2IUCA 4A3KK 1HQMA 3AD9C 3LXQA 4KM4A 4ZG6A 2GSUA 2PA8L 2GLQA 5LQQA 1ANIA 5IYCK 2R92K 1E1ZP 4A3IC 4CYRA 2JA8K 4LRCA 1YNJA 1XZQA 3S2HK 2CFAA 2Y0SD 1RU0A 1P49A 1ZYRA 5C3EK 3AQOA 3TFJA 3NKQA 3K7AC 4GFQA 5EGEA 5JVOA 1BDFA 2R7ZK 1O2FB 2PHCB 1SFOK 3GTLK 4AH6A 3PO2C 3S16C 1BGWA 1VJEA 4GTEA 4NWJA 3GTLA 4OINA 1BJTA 5HL8A 4M1XA 4OIPA 1JVIA 1XXBA 2E2IC 3M3YK 1DCHA 3HOUC 5C3EC 1WCMK 3S14C 2WAQL 5EGHA 3BUEA 2NVYC 5DLTA 4MEYA 1O28A 1Y1WK 1HJKA 1J98A 2IUCB 2E2IA 3TFIA 3AD8C 2GSNA 1ZQ1C 4C3JC 2ZFZA 5IP9K 3TG0A 4C45A 4XSZA 5TJ3A 2CFAB 5LIAA 3BDGA 3ED4A 1AUKA 2XRGA 3NUHA 3S1RC 1E2SP 1KH7A 3AQPA 2XR9A 3DXJA 3HOWC 4Y7NC 2P8TA 4G0WA 3IGYB 4Q4ZA 2ZKTA 4A3BC 4QIWL 4YFNA 3HOVC 2W5XA 3M7VA 4GTZA 1KHJA 2G9YA 1EK8A 2P5MA 1IL2A 4BY7C 4A3LC 2NVTC 4Y52K 4LR7A 1TWGK 4G7ZA 3GTKK 1I6HC 4KARA 4GTAA 3GTMK 4LJZA 1I50C 2W8SA 3GTQK 3S15C 2XCQA 2NVQC 3S17C 3BDHA 3UO0A 4QJVA 1F7VA 5C4JK 4ZG9A 1O24A 2JH3A 1XXAA 1ZEDA 2R93K 1IS1A 3WAWA 3V4GA 4G0UA 1I50A 3S1MK 3N0BA 4OIRA 2XCRB 1ZBSA 5TMCA 3ERED 2JA7K 4KM9A 1EW2A 3BDGB 4A3FK 3H0GC 5L0EA 5FLMK 1K83K 2GSOA 3JSTA 1ELYA 3KD8A 1C0AA 4UOPA 3S2DK 4XLNA 3UN2A 4C3HK 3I4NC 4KM8A 1KHLA 4BBRK 3M8WA 1I6VA 3G4CA 2W5QA 2VUMK 3I4MK 3CQZC 1I3QK 3HXAA 4LOWA 3FKIK 3H0GA 5IYDC 4BLAA 5C44K 4A3DC 2WAQD 4BBSC 3T01A 3FOFA 3FKIA 3SZYA 3GTGC 1DCOA 5HRTA 4LQYA 1TWHC 2W8DA 2V6UA 1B8JA 2ANHA 1WOSA 2QZUA 5JFEA 3RZOK 4BY1K 3GEEA 3RZDK 3ADAC 1USMA 4A3JC 3HOXC 4WILA 1SHQA 1PJ5A 1UV7A 4C3IC 2EBBA 3GEHA 3GTGA 5INHA 1IE0A 1AJAA 4GTDA 4UPHA 1TWHA 3S1NC 3BP8C 3MK0A 4A3IK 4A3JK 2PMZL 2E2JC 5IYBC 4LR9A 1WOPA 4KN7A 1SMYA 4MEXA 2PPBA 2VQRA 2A6HA 1ISEA 2V6SA 3K7AK 1VGXA 3N3YA 1AJBA 1O26A 1PJ6A 2A69A 5IOQA 3PO2K 3S16K 4QIWD 5CHPA 2GA3A 4YFXA 4CXKA 4UOOA 1KH5A 3NKRA 3GTOC 1XXCA 4RMFA 4A3EC 2E2IK 4Q5SA 1HQAA 3WBHA 5L46A 3HOUK 1DD5A 1O98A
chains in the Genus database with same CATH topology
4GTYA 5DLVA 3IGYB 1N2KA 1EI6A 4ZG7A 2ZKTA 2W5XA 4GTZA 5GOVA 3M7VA 1KHJA 2G9YA 4QAXA 3B5QA 4LR7A 1ALJA 4CXSA 3OT9A 3SZZA 3NKPA 1SHNA 4LRFA 1EJJA 2RH6A 4TN0A 4CYSA 2W5TA 2W8SA 1EW9A 1FSUA 4UPKA 3TWZA 1Y6VA 1AJDA 1E3CP 1O99A 1ED8A 1ELXA 3NKMA 3BDHA 3UO0A 5KXAA 5L0BA 5IJQA 1ELZA 1E33P 4LR8A 4ZG9A 5LRNA 1ALHA 4UPIA 3UNYA 5IJSA 1ZEDA 4LRDA 4KAYA 3WAWA 3UN3A 4MY4A 4FDIA 1KH9A 3CMRA 1URBA 2IUCA 1EW2A 1KHKA 3BDGB 3E2DA 4FDJA 3M8ZA 5L0EA 3LXQA 2GSOA 3KD8A 2GSUA 1ELYA 2GLQA 4KM4A 4MIVA 4UOPA 4ZG6A 5LQQA 5C66A 3BDFA 3A52A 4GTXA 1ANIA 1E1ZP 3UN2A 4CYRA 4LRCA 2X98A 2W5WA 5K4PA 1KHLA 3MK2A 3NKNA 3M8WA 3NVLA 1P49A 4MHXA 2W5QA 3WAYA 3NKQA 4KJDA 2W5RA 5EGEA 4LRBA 3MK1A 3M8YA 3T01A 1ED9A 3WAVA 3WAXA 5AJ9A 3SZYA 4NWJA 5HRTA 4LQYA 2W8DA 1B8JA 3DPCA 2ANHA 4YR1A 4UPLA 2QZUA 2IFYA 3DYCA 3IDDA 1ALIA 1SHQA 4ZGAA 5EGHA 1Y7AA 1AJCA 4B56A 1K7HA 1ZEBA 5INHA 4CXUA 1AJAA 1EW8A 1KH4A 4UPHA 3Q3QA 4LREA 4NWXA 5DLTA 3MK0A 2IUCB 1HJKA 3UN5A 3TX0A 3T00A 4LR9A 4UORA 2GSNA 5LRMA 2VQRA 2D1GA 1KHNA 5L0KA 3TG0A 1ALKA 5TJ3A 1ANJA 5LIAA 1AJBA 5DLWA 1N2LA 3BDGA 2GA3A 5GRRA 1URAA 3ED4A 1AUKA 4GTWA 3IGZB 4CXKA 1EQJA 1KH5A 2XRGA 3NKRA 4KJGA 4UOOA 3T02A 1E2SP 2W5VA 1KH7A 1HQAA 2XR9A 3WBHA 1ZEFA 4KAVA 4LR2A 4LRAA 4N7TA 2W5SA 3NKOA 1HDHA 1O98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTY A;  5DLV A;  3IGY B;  1N2K A;  1EI6 A;  4ZG7 A;  2ZKT A;  2W5X A;  4GTZ A;  5GOV A;  3M7V A;  1KHJ A;  2G9Y A;  4QAX A;  3B5Q A;  4LR7 A;  1ALJ A;  4CXS A;  3OT9 A;  3SZZ A;  3NKP A;  1SHN A;  4LRF A;  1EJJ A;  2RH6 A;  4TN0 A;  4CYS A;  2W5T A;  2W8S A;  1EW9 A;  1FSU A;  4UPK A;  3TWZ A;  1Y6V A;  1AJD A;  1E3C P;  1O99 A;  1ED8 A;  1ELX A;  3NKM A;  3BDH A;  3UO0 A;  5KXA A;  5L0B A;  5IJQ A;  1ELZ A;  1E33 P;  4LR8 A;  4ZG9 A;  5LRN A;  1ALH A;  4UPI A;  3UNY A;  5IJS A;  1ZED A;  4LRD A;  4KAY A;  3WAW A;  3UN3 A;  4MY4 A;  4FDI A;  1KH9 A;  3CMR A;  1URB A;  2IUC A;  1EW2 A;  1KHK A;  3BDG B;  3E2D A;  4FDJ A;  3M8Z A;  5L0E A;  3LXQ A;  2GSO A;  3KD8 A;  2GSU A;  1ELY A;  2GLQ A;  4KM4 A;  4MIV A;  4UOP A;  4ZG6 A;  5LQQ A;  5C66 A;  3BDF A;  3A52 A;  4GTX A;  1ANI A;  1E1Z P;  3UN2 A;  4CYR A;  4LRC A;  2X98 A;  2W5W A;  5K4P A;  1KHL A;  3MK2 A;  3NKN A;  3M8W A;  3NVL A;  1P49 A;  4MHX A;  2W5Q A;  3WAY A;  3NKQ A;  4KJD A;  2W5R A;  5EGE A;  4LRB A;  3MK1 A;  3M8Y A;  3T01 A;  1ED9 A;  3WAV A;  3WAX A;  5AJ9 A;  3SZY A;  4NWJ A;  5HRT A;  4LQY A;  2W8D A;  1B8J A;  3DPC A;  2ANH A;  4YR1 A;  4UPL A;  2QZU A;  2IFY A;  3DYC A;  3IDD A;  1ALI A;  1SHQ A;  4ZGA A;  5EGH A;  1Y7A A;  1AJC A;  4B56 A;  1K7H A;  1ZEB A;  5INH A;  4CXU A;  1AJA A;  1EW8 A;  1KH4 A;  4UPH A;  3Q3Q A;  4LRE A;  4NWX A;  5DLT A;  3MK0 A;  2IUC B;  1HJK A;  3UN5 A;  3TX0 A;  3T00 A;  4LR9 A;  4UOR A;  2GSN A;  5LRM A;  2VQR A;  2D1G A;  1KHN A;  5L0K A;  3TG0 A;  1ALK A;  5TJ3 A;  1ANJ A;  5LIA A;  1AJB A;  5DLW A;  1N2L A;  3BDG A;  2GA3 A;  5GRR A;  1URA A;  3ED4 A;  1AUK A;  4GTW A;  3IGZ B;  4CXK A;  1EQJ A;  1KH5 A;  2XRG A;  3NKR A;  4KJG A;  4UOO A;  3T02 A;  1E2S P;  2W5V A;  1KH7 A;  1HQA A;  2XR9 A;  3WBH A;  1ZEF A;  4KAV A;  4LR2 A;  4LRA A;  4N7T A;  2W5S A;  3NKO A;  1HDH A;  1O98 A; 
#chains in the Genus database with same CATH topology
 4C2M C;  3S14 K;  5FJ8 K;  4OIQ A;  5DLV A;  1JQW A;  2WB1 L;  1R9T C;  3GTO K;  1J6W A;  4XLP A;  1O2A A;  3B5Q A;  3MML B;  3GDZ A;  2NVY K;  3GTO A;  1XZQ B;  5C4X C;  1SHN A;  3GTP C;  4TN0 A;  1X31 C;  1O27 A;  1FSU A;  2NVY A;  1Y6V A;  1WIH A;  1AJD A;  4WJ3 M;  4KMD A;  3PO3 C;  4GT9 A;  1E3C P;  1ELX A;  4C3J K;  1O99 A;  1WSV A;  2ZUE A;  1VRQ C;  4PAB A;  1R9T A;  4AYB L;  5IP7 C;  1TWC C;  1WOR A;  1IW7 A;  1ELZ A;  1E33 P;  1VLO A;  5IOS A;  4GTB A;  1Y1V C;  4KB4 A;  1VH2 A;  1XZP A;  3GTP A;  4X6A C;  1KH9 A;  4BKW A;  3TTG A;  4BXX C;  1URB A;  1B4B A;  1WQF A;  3S1R K;  4FDJ A;  1WQH A;  1KHK A;  4KB2 A;  1J6V A;  1Y1V K;  1L0W A;  2XCO A;  3HOW K;  4Y7N K;  1TWC A;  5C66 A;  4GTX A;  1Y1V A;  2YU9 C;  4A3B K;  2W5W A;  3HOV K;  3NKN A;  5K4P A;  3GTJ C;  4BY7 K;  4A3L K;  2NVT K;  4A93 C;  1USO A;  1I6H K;  4GZY A;  2PA8 D;  4KAS A;  3HKZ L;  2E2H C;  2W5R A;  1I50 K;  2Y3P A;  5IOR A;  3S15 K;  1ZXO A;  4GTC A;  1ED9 A;  3WAV A;  4A3M C;  2NVQ K;  2YU9 A;  3S17 K;  3A8K A;  4YR1 A;  3HOZ C;  3DPC A;  3CAG A;  4A3C C;  3H3V L;  4KAW X;  2JA6 C;  3S0X A;  2IFY A;  5IOT A;  3FHZ A;  2JA5 C;  2GAG C;  3S1Q C;  3IDD A;  2GAH C;  5TMF A;  3HOZ K;  4ZGA A;  1V5V A;  1IQ0 A;  3H0G K;  4XSX A;  1AJC A;  1Y7A A;  4G7H A;  1ZEB A;  4B56 A;  4CXU A;  4XCH A;  1EW8 A;  1KH4 A;  3Q3Q A;  4NWX A;  3S1Q K;  1BS2 A;  3I4N K;  3UN5 A;  2JA6 A;  3T00 A;  1TWA C;  3M4O C;  1HI9 A;  1EQR A;  2JA5 A;  4LLG A;  4YFK A;  3CQZ K;  2O5I A;  1ALK A;  1O25 A;  5IYD K;  4MQ9 A;  4A3D K;  1TWA K;  3TFH A;  1EH1 A;  3CQZ A;  4BBS K;  4DDQ A;  4KC6 A;  4NOI A;  4A3G C;  5GRR A;  3GTG K;  4QJV B;  1EQJ A;  2NVX C;  3HOY C;  1TWH K;  1TWA A;  4KJG A;  4ZH4 A;  2RGR A;  4O2D A;  1G51 A;  4KAV A;  4LRA A;  4N7T A;  2W5S A;  2FQT A;  3NKO A;  1HDH A;  3ORE A;  3EQL A;  4KMH A;  5IYC C;  4GTY A;  2R92 C;  2NVX K;  3HOX K;  1N2K A;  1EI6 A;  2JA8 C;  5D4D A;  3S2H C;  1PJ7 A;  3L4K A;  4C3I K;  5GOV A;  1XPP A;  1GE9 A;  1AB4 A;  4P5B A;  2NVX A;  3OT9 A;  3S1N K;  2R7Z C;  1EJJ A;  2E2J K;  4CYS A;  4OIO A;  2W5T A;  1SFO C;  4LK1 A;  1F7U A;  5IYB K;  3GTL C;  1EW9 A;  4J3N A;  4UPK A;  3TWZ A;  2R92 A;  5E68 A;  2BE5 A;  5M5Y K;  5L0B A;  3GSI A;  1F93 A;  1O2B A;  2V6T A;  5KXA A;  5IJQ A;  4LR8 A;  5LRN A;  4UPI A;  3UNY A;  5IJS A;  1F9N A;  3M3Y C;  3QX3 A;  3UN3 A;  2R7Z A;  4MY4 A;  1WCM C;  4P9S A;  3LAJ A;  1SFO A;  4FDI A;  2KWA A;  4YG2 A;  3HKZ D;  3E2D A;  4A3E K;  2O5J A;  3M8Z A;  1WOO A;  1IBA A;  3LAP A;  3LPX A;  4MIV A;  1DCP A;  2W7V A;  5IP7 K;  1JOE A;  4C2M K;  3BDF A;  3A52 A;  2CW0 A;  1Y1W C;  1R9T K;  2X98 A;  3MK2 A;  4PAA A;  4JK1 A;  3NVL A;  4LK0 A;  3BP3 A;  5M3F K;  1WCM A;  4FM9 A;  4MHX A;  3H3V D;  4GTF A;  3WAY A;  5IP9 C;  5C4X K;  4KJD A;  3GTP K;  4LRB A;  3MK1 A;  3M8Y A;  3AH5 A;  3PO3 K;  3FOE A;  3WAX A;  5AJ9 A;  1Y1W A;  4GTL A;  3L4J A;  1TWC K;  2Y0S L;  4FZB A;  4UPL A;  3VA7 A;  4KAT A;  3DYC A;  4KDD A;  2ZUF A;  1WQG A;  1YNN A;  1WSR A;  3IPJ A;  4X6A K;  1EFW A;  4BXX K;  1B4A A;  5CJ9 A;  1ALI A;  2A6E A;  1J6X A;  5M3M K;  3A8J A;  1K7H A;  4Y52 C;  2B63 C;  1TWG C;  2A68 A;  3GTK C;  4LRE A;  4KN4 A;  1INN A;  2D6F C;  3N0C A;  1YX2 A;  2YU9 K;  3GTM C;  3TX0 A;  3GTJ K;  3GTQ C;  4A93 K;  4UOR A;  2B63 K;  5LRM A;  1TWF C;  2D1G A;  1KHN A;  5M5X K;  3OPF A;  2E2H K;  3GTJ A;  5L0K A;  4WJ4 A;  3OEP A;  5C4J C;  1ANJ A;  2B63 A;  5DLW A;  3WOD A;  1N2L A;  1TWG A;  2PMZ D;  3GTK A;  5M5W K;  4ILD A;  2E2H A;  1ZVU A;  2R93 C;  1URA A;  4GTW A;  4A3M K;  3GTM A;  3IGZ B;  1TWF K;  1KQ4 A;  3S1M C;  3GTQ A;  3T02 A;  1YCL A;  4A3C K;  2W5V A;  2JA7 C;  4A3F C;  2JA6 K;  1XZP B;  1TWF A;  4LR2 A;  5FLM C;  1K83 C;  1ZEF A;  4QAX A;  2JA5 K;  3S2D C;  4C3H C;  4ZG7 A;  2FQO A;  3GEI A;  4KMU A;  4BBR C;  4BLB A;  2R93 A;  3G4A A;  1ALJ A;  4CXS A;  3GIR A;  3SZZ A;  3NKP A;  2VUM C;  3I4M C;  1I3Q C;  2JA7 A;  4LRF A;  2RH6 A;  3FKI C;  3AD7 C;  5C44 C;  1K83 A;  2WB1 D;  3M4O K;  3A8I A;  4KMA A;  1ED8 A;  3NKM A;  4A3K C;  1ALH A;  3RZO C;  2VUM A;  4BY1 C;  4A3G K;  1I3Q A;  4LRD A;  4KAY A;  3RZD C;  4G0V A;  1O29 A;  4P5A A;  3HOY K;  3CMR A;  4G7O A;  4AYB D;  2IUC A;  4A3K K;  1HQM A;  3AD9 C;  3LXQ A;  4KM4 A;  4ZG6 A;  2GSU A;  2PA8 L;  2GLQ A;  5LQQ A;  1ANI A;  5IYC K;  2R92 K;  1E1Z P;  4A3I C;  4CYR A;  2JA8 K;  4LRC A;  1YNJ A;  1XZQ A;  3S2H K;  2CFA A;  2Y0S D;  1RU0 A;  1P49 A;  1ZYR A;  5C3E K;  3AQO A;  3TFJ A;  3NKQ A;  3K7A C;  4GFQ A;  5EGE A;  5JVO A;  1BDF A;  2R7Z K;  1O2F B;  2PHC B;  1SFO K;  3GTL K;  4AH6 A;  3PO2 C;  3S16 C;  1BGW A;  1VJE A;  4GTE A;  4NWJ A;  3GTL A;  4OIN A;  1BJT A;  5HL8 A;  4M1X A;  4OIP A;  1JVI A;  1XXB A;  2E2I C;  3M3Y K;  1DCH A;  3HOU C;  5C3E C;  1WCM K;  3S14 C;  2WAQ L;  5EGH A;  3BUE A;  2NVY C;  5DLT A;  4MEY A;  1O28 A;  1Y1W K;  1HJK A;  1J98 A;  2IUC B;  2E2I A;  3TFI A;  3AD8 C;  2GSN A;  1ZQ1 C;  4C3J C;  2ZFZ A;  5IP9 K;  3TG0 A;  4C45 A;  4XSZ A;  5TJ3 A;  2CFA B;  5LIA A;  3BDG A;  3ED4 A;  1AUK A;  2XRG A;  3NUH A;  3S1R C;  1E2S P;  1KH7 A;  3AQP A;  2XR9 A;  3DXJ A;  3HOW C;  4Y7N C;  2P8T A;  4G0W A;  3IGY B;  4Q4Z A;  2ZKT A;  4A3B C;  4QIW L;  4YFN A;  3HOV C;  2W5X A;  3M7V A;  4GTZ A;  1KHJ A;  2G9Y A;  1EK8 A;  2P5M A;  1IL2 A;  4BY7 C;  4A3L C;  2NVT C;  4Y52 K;  4LR7 A;  1TWG K;  4G7Z A;  3GTK K;  1I6H C;  4KAR A;  4GTA A;  3GTM K;  4LJZ A;  1I50 C;  2W8S A;  3GTQ K;  3S15 C;  2XCQ A;  2NVQ C;  3S17 C;  3BDH A;  3UO0 A;  4QJV A;  1F7V A;  5C4J K;  4ZG9 A;  1O24 A;  2JH3 A;  1XXA A;  1ZED A;  2R93 K;  1IS1 A;  3WAW A;  3V4G A;  4G0U A;  1I50 A;  3S1M K;  3N0B A;  4OIR A;  2XCR B;  1ZBS A;  5TMC A;  3ERE D;  2JA7 K;  4KM9 A;  1EW2 A;  3BDG B;  4A3F K;  3H0G C;  5L0E A;  5FLM K;  1K83 K;  2GSO A;  3JST A;  1ELY A;  3KD8 A;  1C0A A;  4UOP A;  3S2D K;  4XLN A;  3UN2 A;  4C3H K;  3I4N C;  4KM8 A;  1KHL A;  4BBR K;  3M8W A;  1I6V A;  3G4C A;  2W5Q A;  2VUM K;  3I4M K;  3CQZ C;  1I3Q K;  3HXA A;  4LOW A;  3FKI K;  3H0G A;  5IYD C;  4BLA A;  5C44 K;  4A3D C;  2WAQ D;  4BBS C;  3T01 A;  3FOF A;  3FKI A;  3SZY A;  3GTG C;  1DCO A;  5HRT A;  4LQY A;  1TWH C;  2W8D A;  2V6U A;  1B8J A;  2ANH A;  1WOS A;  2QZU A;  5JFE A;  3RZO K;  4BY1 K;  3GEE A;  3RZD K;  3ADA C;  1USM A;  4A3J C;  3HOX C;  4WIL A;  1SHQ A;  1PJ5 A;  1UV7 A;  4C3I C;  2EBB A;  3GEH A;  3GTG A;  5INH A;  1IE0 A;  1AJA A;  4GTD A;  4UPH A;  1TWH A;  3S1N C;  3BP8 C;  3MK0 A;  4A3I K;  4A3J K;  2PMZ L;  2E2J C;  5IYB C;  4LR9 A;  1WOP A;  4KN7 A;  1SMY A;  4MEX A;  2PPB A;  2VQR A;  2A6H A;  1ISE A;  2V6S A;  3K7A K;  1VGX A;  3N3Y A;  1AJB A;  1O26 A;  1PJ6 A;  2A69 A;  5IOQ A;  3PO2 K;  3S16 K;  4QIW D;  5CHP A;  2GA3 A;  4YFX A;  4CXK A;  4UOO A;  1KH5 A;  3NKR A;  3GTO C;  1XXC A;  4RMF A;  4A3E C;  2E2I K;  4Q5S A;  1HQA A;  3WBH A;  5L46 A;  3HOU K;  1DD5 A;  1O98 A; 
#chains in the Genus database with same CATH homology
 4GTY A;  5DLV A;  3IGY B;  1N2K A;  1EI6 A;  4ZG7 A;  2ZKT A;  2W5X A;  4GTZ A;  5GOV A;  3M7V A;  1KHJ A;  2G9Y A;  4QAX A;  3B5Q A;  4LR7 A;  1ALJ A;  4CXS A;  3OT9 A;  3SZZ A;  3NKP A;  1SHN A;  4LRF A;  1EJJ A;  2RH6 A;  4TN0 A;  4CYS A;  2W5T A;  2W8S A;  1EW9 A;  1FSU A;  4UPK A;  3TWZ A;  1Y6V A;  1AJD A;  1E3C P;  1O99 A;  1ED8 A;  1ELX A;  3NKM A;  3BDH A;  3UO0 A;  5KXA A;  5L0B A;  5IJQ A;  1ELZ A;  1E33 P;  4LR8 A;  4ZG9 A;  5LRN A;  1ALH A;  4UPI A;  3UNY A;  5IJS A;  1ZED A;  4LRD A;  4KAY A;  3WAW A;  3UN3 A;  4MY4 A;  4FDI A;  1KH9 A;  3CMR A;  1URB A;  2IUC A;  1EW2 A;  1KHK A;  3BDG B;  3E2D A;  4FDJ A;  3M8Z A;  5L0E A;  3LXQ A;  2GSO A;  3KD8 A;  2GSU A;  1ELY A;  2GLQ A;  4KM4 A;  4MIV A;  4UOP A;  4ZG6 A;  5LQQ A;  5C66 A;  3BDF A;  3A52 A;  4GTX A;  1ANI A;  1E1Z P;  3UN2 A;  4CYR A;  4LRC A;  2X98 A;  2W5W A;  5K4P A;  1KHL A;  3MK2 A;  3NKN A;  3M8W A;  3NVL A;  1P49 A;  4MHX A;  2W5Q A;  3WAY A;  3NKQ A;  4KJD A;  2W5R A;  5EGE A;  4LRB A;  3MK1 A;  3M8Y A;  3T01 A;  1ED9 A;  3WAV A;  3WAX A;  5AJ9 A;  3SZY A;  4NWJ A;  5HRT A;  4LQY A;  2W8D A;  1B8J A;  3DPC A;  2ANH A;  4YR1 A;  4UPL A;  2QZU A;  2IFY A;  3DYC A;  3IDD A;  1ALI A;  1SHQ A;  4ZGA A;  5EGH A;  1Y7A A;  1AJC A;  4B56 A;  1K7H A;  1ZEB A;  5INH A;  4CXU A;  1AJA A;  1EW8 A;  1KH4 A;  4UPH A;  3Q3Q A;  4LRE A;  4NWX A;  5DLT A;  3MK0 A;  2IUC B;  1HJK A;  3UN5 A;  3TX0 A;  3T00 A;  4LR9 A;  4UOR A;  2GSN A;  5LRM A;  2VQR A;  2D1G A;  1KHN A;  5L0K A;  3TG0 A;  1ALK A;  5TJ3 A;  1ANJ A;  5LIA A;  1AJB A;  5DLW A;  1N2L A;  3BDG A;  2GA3 A;  5GRR A;  1URA A;  3ED4 A;  1AUK A;  4GTW A;  3IGZ B;  4CXK A;  1EQJ A;  1KH5 A;  2XRG A;  3NKR A;  4KJG A;  4UOO A;  3T02 A;  1E2S P;  2W5V A;  1KH7 A;  1HQA A;  2XR9 A;  3WBH A;  1ZEF A;  4KAV A;  4LR2 A;  4LRA A;  4N7T A;  2W5S A;  3NKO A;  1HDH A;  1O98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...