3T00A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with vanadate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t00A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t00A01
1AUKA 3TG0A 1EI6A 2IUCA 3NKQA 2QZUA 4CYRA 2D1GA 4LREA 5KXAA 5DLWA 4CXSA 5INHA 3M8WA 4ZG9A 3MK0A 1KHKA 1AJBA 1AJDA 2GLQA 3UNYA 1B8JA 2IFYA 3UN5A 3KD8A 1ZEFA 1KHJA 4TN0A 1KH5A 2W5SA 1ZEBA 2IUCB 2X98A 3DYCA 3M8ZA 1KH4A 2GSUA 1SHQA 4UPLA 3SZZA 3MK2A 1ALHA 4MY4A 3ED4A 4LR8A 4ZGAA 1EW9A 3UO0A 4LRAA 1ANIA 2W8SA 1ED8A 5C66A 3WAXA 1HJKA 4NWJA 2G9YA 4YR1A 5AJ9A 4KM4A 1EJJA 2W5VA 1Y7AA 4N7TA 5IJSA 1ELYA 4LRDA 3M7VA 3IDDA 4QAXA 4GTZA 3NKNA 1EQJA 4LR2A 5GRRA 5EGEA 3WAWA 3A52A 1N2KA 3TWZA 4CYSA 5L0KA 1HDHA 2ANHA 4LRCA 5EGHA 5DLVA 1E2SP 4B56A 3BDGA 3CMRA 4ZG6A 3T00A 3B5QA 4GTXA 2W5WA 1URAA 1SHNA 2RH6A 4KJDA 2W8DA 3T01A 3SZYA 4UOOA 4CXUA 3NVLA 1KH7A 5TJ3A 1P49A 2GSOA 4LR7A 3TX0A 4MIVA 1N2LA 4UPHA 4UPKA 4GTWA 1KHNA 1Y6VA 4FDJA 5L0EA 1URBA 3MK1A 3Q3QA 1ANJA 3E2DA 3BDFA 5LRNA 1ELZA 1AJAA 3BDHA 3UN2A 2W5RA 1E33P 4KAVA 3WBHA 3IGYB 5DLTA 1E3CP 1ALKA 1E1ZP 4FDIA 4KAYA 1EW8A 5LQQA 5L0BA 4ZG7A 5GOVA 4GTYA 3NKMA 1ALIA 3M8YA 3DPCA 3OT9A 3WAVA 4KJGA 5LIAA 3NKPA 2ZKTA 2VQRA 4CXKA 3NKRA 1ED9A 2W5XA 1AJCA 5LRMA 5HRTA 3BDGB 3IGZB 4MHXA 4UORA 3T02A 1FSUA 1EW2A 3WAYA 2XRGA 4LRFA 1ALJA 1HQAA 4UOPA 1ELXA 2W5QA 4UPIA 3LXQA 5K4PA 5IJQA 4LQYA 2XR9A 1K7HA 1O98A 1O99A 2GA3A 1KHLA 2GSNA 2W5TA 1KH9A 3NKOA 3UN3A 1ZEDA 4NWXA 4LR9A 4LRBA
chains in the Genus database with same CATH superfamily
1AUKA 1IBAA 4G0WA 2IUCA 1YCLA 1Y1WC 2QZUA 1I6VA 2R93A 3FOEA 2D1GA 5KXAA 4LOWA 5INHA 1DCOA 1ZXOA 1BGWA 1ZEFA 2JA8C 1KH5A 2ZUFA 2IUCB 2X98A 3DYCA 5IYDC 3M8ZA 1KH4A 4A93K 2E2IA 4BY7K 3N3YA 2EBBA 1WQFA 4C3HC 1F9NA 2P5MA 1I50A 3PO3C 2V6SA 2G9YA 4C2MC 4XSXA 1I3QA 1TWHK 2W5VA 4XSZA 1J6VA 1V5VA 1WOSA 4N7TA 2FQTA 5IJSA 4KN7A 1ELYA 1ZYRA 2NVQK 2B63C 5GRRA 1O2BA 1N2KA 3AD9C 3ADAC 1EK8A 5IOTA 3ERED 3S1QK 3TWZA 4CYSA 1TWGC 5EGHA 5DLVA 1J98A 1WOPA 4KM8A 4JK1A 1SMYA 5FLMK 4A3JC 1SFOA 2YU9A 3H3VD 4BXXC 3B5QA 3S0XA 3GTOC 1DCPA 4KJDA 1SHNA 1ZQ1C 2NVYA 3S14C 3FKIK 1O29A 1ZVUA 4X6AK 4CXUA 3S1RK 4FM9A 4UPHA 1TWAA 2D6FC 3PO2K 1TWFA 1I6HK 1URBA 1YX2A 2R92A 3GTLA 1ELZA 1WCMC 4LK1A 3UN2A 2CW0A 4XCHA 3GTKK 1O28A 2W5RA 1E33P 4NOIA 3IGYB 4FZBA 3RZDK 3NUHA 2W7VA 1E1ZP 5E68A 4PABA 4BKWA 4LLGA 2R93K 3NKMA 1IW7A 2A68A 3GTGA 3AQOA 4A93C 3DPCA 3OT9A 4BY7C 5LIAA 5IORA 1ED9A 1B4AA 1AJCA 3BDGB 3RZOK 3T02A 4OIQA 1JOEA 1DD5A 1ZBSA 3CQZA 3FHZA 3S16K 4KN4A 2E2IK 5C3EK 1TWHC 4UOPA 1XZQB 2WB1L 4UPIA 1R9TA 2NVQC 1K7HA 2XR9A 2GA3A 4A3KK 1I50K 4A3DC 1F7VA 1BDFA 2V6TA 1PJ5A 1KH9A 3K7AK 1I3QK 2E2JK 3TG0A 3GTJA 2B63K 3S1QC 3N0CA 4NWXA 3TFIA 5JFEA 4CYRA 4KDDA 4LREA 3GTPA 4C3IK 3MMLB 5FLMC 5DLWA 1KHKA 1AJBA 4KMUA 1B8JA 2IFYA 3TTGA 1O27A 4PAAA 4TN0A 4X6AC 1ZEBA 3S1MK 1SFOK 2YU9K 3MK2A 2JH3A 3PO2C 1HQMA 1VRQC 4BBSK 4LR8A 3S15C 5D4DA 4ZGAA 2NVYK 4KMHA 1I6HC 3JSTA 1O2FB 4A3IK 4LRAA 1ANIA 3EQLA 2NVXC 5JVOA 4OIOA 2JA5A 1USOA 5C66A 1HJKA 4NWJA 3GTKC 2P8TA 4G7OA 5AJ9A 3S17K 3GTQA 4KM4A 1TWAK 3AQPA 3RZDC 3N0BA 4Y7NK 1WCMK 1F7UA 1PJ7A 4LRDA 3TFJA 3IDDA 2GAHC 3A8JA 4O2DA 2R93C 3I4MK 4LR2A 1IQ0A 1Y1VA 4WJ3M 1YNNA 1HDHA 4LRCA 1L0WA 1EH1A 4BY1K 4G0UA 4ZG6A 5IYCC 2PA8D 3RZOC 3A8IA 3S16C 4AYBL 2E2IC 5C3EC 2R7ZA 4A3LK 1URAA 4UOOA 4A3KC 1I50C 2E2HA 3NVLA 4LK0A 3GIRA 3K7AC 1I3QC 4KARA 5C44C 3HKZL 2PHCB 1N2LA 2E2JC 1KHNA 4OIPA 4A3DK 3Q3QA 4GTBA 3V4GA 1R9TK 3MK1A 3E2DA 2JA6A 1XXAA 4WILA 4GT9A 1AJAA 1F93A 4C3IC 4KAVA 4XLPA 5DLTA 1E3CP 1ALKA 3GTJK 2PA8L 4FDIA 1EW8A 1VH2A 2Y0SL 2A69A 3S1MC 1GE9A 4GTYA 3GTPK 4KAWX 1SFOC 4KJGA 2YU9C 3H0GA 4BBSC 2NVYC 1K83A 4A3IC 5HRTA 4GFQA 4UORA 1EW2A 3GEHA 3AD8C 2O5IA 3S15K 1J6XA 4C3JK 4LRFA 1ALJA 3S17C 1ELXA 2WB1D 1TWAC 4YFKA 4A3GK 5IJQA 2XCOA 4KASA 4Y7NC 2NVXK 1TWFC 3L4KA 3GTLC 5M3MK 3VA7A 3GDZA 3I4MC 3NKOA 1XXBA 2WAQL 1WSVA 4LRBA 1YNJA 1X31C 1TWCA 1EQRA 3NKQA 4BY1C 5M5YK 3G4CA 4RMFA 3GTGC 1Y1VK 3CAGA 4C45A 4G0VA 4CXSA 4ZG9A 4A3LC 5IYCK 1AJDA 2GLQA 3UN5A 4YG2A 5FJ8K 2GSUA 3CQZC 1AB4A 4UPLA 4GTAA 4MEXA 3ED4A 4GTLA 2PPBA 3UO0A 1R9TC 2E2HK 4KB2A 4BLAA 5C44K 1EFWA 1ED8A 3A8KA 4KM9A 5C4JC 4A3BK 4YR1A 3GTMA 1O26A 1EJJA 1UV7A 3GTJC 5TMFA 5IYBK 5HL8A 3M3YK 5TMCA 2JA6K 3HOZK 4GTZA 3NKNA 4QIWD 3GTPC 2XCQA 3I4NK 3A52A 3HXAA 1USMA 1C0AA 5IOSA 4P5AA 4B56A 4Q4ZA 3CMRA 3OREA 4A3MK 1O24A 1JQWA 4KB4A 2RGRA 4AYBD 4C3JC 1G51A 2PMZL 3IPJA 3T00A 4A3GC 4GTXA 2JA7A 2W5WA 2VUMA 1K83K 4J3NA 1KH7A 2JA5C 2FQOA 3FKIA 2GSOA 1TWFK 5IP9K 3QX3A 3TX0A 4YFNA 4MIVA 3HKZD 2R92K 4GTWA 4WJ4A 3GTLK 1Y6VA 4P5BA 4QIWL 3G4AA 3BDHA 1BS2A 1Y1VC 3HOXK 3WBHA 1IL2A 3HOWK 3OEPA 3HOVC 1TWCK 1IS1A 4KAYA 2CFAA 4KATA 1INNA 3GTGK 4OIRA 1Y1WA 4ZG7A 4GTFA 2Y0SD 5GOVA 3M8YA 4DDQA 3HOYC 1WSRA 3WAVA 3LAJA 2R7ZC 1XXCA 4GTCA 3GEEA 4KMAA 3NKPA 2O5JA 4G7ZA 2VQRA 4GZYA 4CXKA 5LRMA 2ZUEA 3CQZK 3OPFA 4P9SA 2E2HC 2CFAB 3WAYA 5M3FK 2XRGA 5M5WK 4BBRK 4A3BC 2W5QA 3LXQA 3BP8C 1O2AA 4LQYA 5IYBC 3M3YC 1O98A 2JA6C 1KHLA 5CHPA 5C4JK 3HOZC 4QJVA 2GSNA 1O25A 2W5TA 4GTEA 3UN3A 1ZEDA 2WAQD 1ISEA 3GTMK 3I4NC 5C4XK 4LR9A 3AH5A 1J6WA 1EI6A 4YFXA 4M1XA 2B63A 4A3MC 3DXJA 4G7HA 4A3EK 4Y52K 1WORA 2XCRB 5M5XK 4QJVB 1WOOA 3H0GC 3M8WA 1RU0A 1DCHA 1HI9A 3MK0A 3UNYA 3S2HK 1K83C 1TWGA 3KD8A 1KHJA 2W5SA 4OINA 3HOUK 3S2DK 5IP7K 5IP9C 1SHQA 3SZZA 4A3FK 1ALHA 2R92C 4MY4A 3LPXA 2JA7K 3GTOA 1EW9A 2VUMK 2JA5K 3BUEA 3S1NC 3M4OC 4KMDA 2W8SA 3GTQK 3WAXA 2Y3PA 3HOXC 1JVIA 3HOWC 1Y7AA 1TWCC 4A3CK 4AH6A 3M7VA 4QAXA 1WCMA 1XZPA 1EQJA 1KQ4A 2NVTK 2GAGC 3HOVK 1WQHA 5EGEA 2A6EA 3WAWA 5CJ9A 1B4BA 1VLOA 5L0KA 2ANHA 1E2SP 1Y1WK 3HOYK 3BDGA 2R7ZK 1BJTA 4BBRC 2PMZD 3H3VL 1XZPB 4KC6A 1XZQA 4MQ9A 4LJZA 2RH6A 2W8DA 3T01A 3SZYA 2JA8K 5L46A 5IYDK 5TJ3A 1P49A 4LR7A 3GTMC 1TWHA 4MEYA 5C4XC 4UPKA 5L0EA 1VGXA 3LAPA 4FDJA 4C3HK 4Q5SA 3WODA 1ANJA 3GSIA 4BLBA 3BDFA 5LRNA 2V6UA 3PO3K 4A3EC 4Y52C 4C2MK 4XLNA 3S2HC 3AD7C 5LQQA 5L0BA 4ILDA 3H0GK 4GTDA 3HOUC 1ALIA 1XPPA 3BP3A 3S2DC 5IP7C 1IE0A 2KWAA 4A3FC 3L4JA 2ZKTA 1VJEA 2JA7C 2VUMC 3NKRA 1TWGK 2W5XA 1PJ6A 3IGZB 4MHXA 3GTQC 1FSUA 2A6HA 3FKIC 1HQAA 4A3JK 1WQGA 3FOFA 3S1RC 4BXXK 3S1NK 2BE5A 3M4OK 5K4PA 3GTOK 3TFHA 4A3CC 3S14K 3GEIA 1O99A 2ZFZA 1WIHA 5IOQA 2NVXA 4ZH4A 2NVTC 3GTKA
chains in the Genus database with same CATH topology
1AUKA 3TG0A 1EI6A 2IUCA 3NKQA 2QZUA 4CYRA 2D1GA 4LREA 5KXAA 5DLWA 4CXSA 5INHA 3M8WA 4ZG9A 3MK0A 1KHKA 1AJBA 1AJDA 2GLQA 3UNYA 1B8JA 2IFYA 3UN5A 3KD8A 1ZEFA 1KHJA 4TN0A 1KH5A 2W5SA 1ZEBA 2IUCB 2X98A 3DYCA 3M8ZA 1KH4A 2GSUA 1SHQA 4UPLA 3SZZA 3MK2A 1ALHA 4MY4A 3ED4A 4LR8A 4ZGAA 1EW9A 3UO0A 4LRAA 1ANIA 2W8SA 1ED8A 5C66A 3WAXA 1HJKA 4NWJA 2G9YA 4YR1A 5AJ9A 4KM4A 1EJJA 2W5VA 1Y7AA 4N7TA 5IJSA 1ELYA 4LRDA 3M7VA 3IDDA 4QAXA 4GTZA 3NKNA 1EQJA 4LR2A 5GRRA 5EGEA 3WAWA 3A52A 1N2KA 3TWZA 4CYSA 5L0KA 1HDHA 2ANHA 4LRCA 5EGHA 5DLVA 1E2SP 4B56A 3BDGA 3CMRA 4ZG6A 3T00A 3B5QA 4GTXA 2W5WA 1URAA 1SHNA 2RH6A 4KJDA 2W8DA 3T01A 3SZYA 4UOOA 4CXUA 3NVLA 1KH7A 5TJ3A 1P49A 2GSOA 4LR7A 3TX0A 4MIVA 1N2LA 4UPHA 4UPKA 4GTWA 1KHNA 1Y6VA 4FDJA 5L0EA 1URBA 3MK1A 3Q3QA 1ANJA 3E2DA 3BDFA 5LRNA 1ELZA 1AJAA 3BDHA 3UN2A 2W5RA 1E33P 4KAVA 3WBHA 3IGYB 5DLTA 1E3CP 1ALKA 1E1ZP 4FDIA 4KAYA 1EW8A 5LQQA 5L0BA 4ZG7A 5GOVA 4GTYA 3NKMA 1ALIA 3M8YA 3DPCA 3OT9A 3WAVA 4KJGA 5LIAA 3NKPA 2ZKTA 2VQRA 4CXKA 3NKRA 1ED9A 2W5XA 1AJCA 5LRMA 5HRTA 3BDGB 3IGZB 4MHXA 4UORA 3T02A 1FSUA 1EW2A 3WAYA 2XRGA 4LRFA 1ALJA 1HQAA 4UOPA 1ELXA 2W5QA 4UPIA 3LXQA 5K4PA 5IJQA 4LQYA 2XR9A 1K7HA 1O98A 1O99A 2GA3A 1KHLA 2GSNA 2W5TA 1KH9A 3NKOA 3UN3A 1ZEDA 4NWXA 4LR9A 4LRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUK A;  3TG0 A;  1EI6 A;  2IUC A;  3NKQ A;  2QZU A;  4CYR A;  2D1G A;  4LRE A;  5KXA A;  5DLW A;  4CXS A;  5INH A;  3M8W A;  4ZG9 A;  3MK0 A;  1KHK A;  1AJB A;  1AJD A;  2GLQ A;  3UNY A;  1B8J A;  2IFY A;  3UN5 A;  3KD8 A;  1ZEF A;  1KHJ A;  4TN0 A;  1KH5 A;  2W5S A;  1ZEB A;  2IUC B;  2X98 A;  3DYC A;  3M8Z A;  1KH4 A;  2GSU A;  1SHQ A;  4UPL A;  3SZZ A;  3MK2 A;  1ALH A;  4MY4 A;  3ED4 A;  4LR8 A;  4ZGA A;  1EW9 A;  3UO0 A;  4LRA A;  1ANI A;  2W8S A;  1ED8 A;  5C66 A;  3WAX A;  1HJK A;  4NWJ A;  2G9Y A;  4YR1 A;  5AJ9 A;  4KM4 A;  1EJJ A;  2W5V A;  1Y7A A;  4N7T A;  5IJS A;  1ELY A;  4LRD A;  3M7V A;  3IDD A;  4QAX A;  4GTZ A;  3NKN A;  1EQJ A;  4LR2 A;  5GRR A;  5EGE A;  3WAW A;  3A52 A;  1N2K A;  3TWZ A;  4CYS A;  5L0K A;  1HDH A;  2ANH A;  4LRC A;  5EGH A;  5DLV A;  1E2S P;  4B56 A;  3BDG A;  3CMR A;  4ZG6 A;  3T00 A;  3B5Q A;  4GTX A;  2W5W A;  1URA A;  1SHN A;  2RH6 A;  4KJD A;  2W8D A;  3T01 A;  3SZY A;  4UOO A;  4CXU A;  3NVL A;  1KH7 A;  5TJ3 A;  1P49 A;  2GSO A;  4LR7 A;  3TX0 A;  4MIV A;  1N2L A;  4UPH A;  4UPK A;  4GTW A;  1KHN A;  1Y6V A;  4FDJ A;  5L0E A;  1URB A;  3MK1 A;  3Q3Q A;  1ANJ A;  3E2D A;  3BDF A;  5LRN A;  1ELZ A;  1AJA A;  3BDH A;  3UN2 A;  2W5R A;  1E33 P;  4KAV A;  3WBH A;  3IGY B;  5DLT A;  1E3C P;  1ALK A;  1E1Z P;  4FDI A;  4KAY A;  1EW8 A;  5LQQ A;  5L0B A;  4ZG7 A;  5GOV A;  4GTY A;  3NKM A;  1ALI A;  3M8Y A;  3DPC A;  3OT9 A;  3WAV A;  4KJG A;  5LIA A;  3NKP A;  2ZKT A;  2VQR A;  4CXK A;  3NKR A;  1ED9 A;  2W5X A;  1AJC A;  5LRM A;  5HRT A;  3BDG B;  3IGZ B;  4MHX A;  4UOR A;  3T02 A;  1FSU A;  1EW2 A;  3WAY A;  2XRG A;  4LRF A;  1ALJ A;  1HQA A;  4UOP A;  1ELX A;  2W5Q A;  4UPI A;  3LXQ A;  5K4P A;  5IJQ A;  4LQY A;  2XR9 A;  1K7H A;  1O98 A;  1O99 A;  2GA3 A;  1KHL A;  2GSN A;  2W5T A;  1KH9 A;  3NKO A;  3UN3 A;  1ZED A;  4NWX A;  4LR9 A;  4LRB A; 
#chains in the Genus database with same CATH topology
 1AUK A;  1IBA A;  4G0W A;  2IUC A;  1YCL A;  1Y1W C;  2QZU A;  1I6V A;  2R93 A;  3FOE A;  2D1G A;  5KXA A;  4LOW A;  5INH A;  1DCO A;  1ZXO A;  1BGW A;  1ZEF A;  2JA8 C;  1KH5 A;  2ZUF A;  2IUC B;  2X98 A;  3DYC A;  5IYD C;  3M8Z A;  1KH4 A;  4A93 K;  2E2I A;  4BY7 K;  3N3Y A;  2EBB A;  1WQF A;  4C3H C;  1F9N A;  2P5M A;  1I50 A;  3PO3 C;  2V6S A;  2G9Y A;  4C2M C;  4XSX A;  1I3Q A;  1TWH K;  2W5V A;  4XSZ A;  1J6V A;  1V5V A;  1WOS A;  4N7T A;  2FQT A;  5IJS A;  4KN7 A;  1ELY A;  1ZYR A;  2NVQ K;  2B63 C;  5GRR A;  1O2B A;  1N2K A;  3AD9 C;  3ADA C;  1EK8 A;  5IOT A;  3ERE D;  3S1Q K;  3TWZ A;  4CYS A;  1TWG C;  5EGH A;  5DLV A;  1J98 A;  1WOP A;  4KM8 A;  4JK1 A;  1SMY A;  5FLM K;  4A3J C;  1SFO A;  2YU9 A;  3H3V D;  4BXX C;  3B5Q A;  3S0X A;  3GTO C;  1DCP A;  4KJD A;  1SHN A;  1ZQ1 C;  2NVY A;  3S14 C;  3FKI K;  1O29 A;  1ZVU A;  4X6A K;  4CXU A;  3S1R K;  4FM9 A;  4UPH A;  1TWA A;  2D6F C;  3PO2 K;  1TWF A;  1I6H K;  1URB A;  1YX2 A;  2R92 A;  3GTL A;  1ELZ A;  1WCM C;  4LK1 A;  3UN2 A;  2CW0 A;  4XCH A;  3GTK K;  1O28 A;  2W5R A;  1E33 P;  4NOI A;  3IGY B;  4FZB A;  3RZD K;  3NUH A;  2W7V A;  1E1Z P;  5E68 A;  4PAB A;  4BKW A;  4LLG A;  2R93 K;  3NKM A;  1IW7 A;  2A68 A;  3GTG A;  3AQO A;  4A93 C;  3DPC A;  3OT9 A;  4BY7 C;  5LIA A;  5IOR A;  1ED9 A;  1B4A A;  1AJC A;  3BDG B;  3RZO K;  3T02 A;  4OIQ A;  1JOE A;  1DD5 A;  1ZBS A;  3CQZ A;  3FHZ A;  3S16 K;  4KN4 A;  2E2I K;  5C3E K;  1TWH C;  4UOP A;  1XZQ B;  2WB1 L;  4UPI A;  1R9T A;  2NVQ C;  1K7H A;  2XR9 A;  2GA3 A;  4A3K K;  1I50 K;  4A3D C;  1F7V A;  1BDF A;  2V6T A;  1PJ5 A;  1KH9 A;  3K7A K;  1I3Q K;  2E2J K;  3TG0 A;  3GTJ A;  2B63 K;  3S1Q C;  3N0C A;  4NWX A;  3TFI A;  5JFE A;  4CYR A;  4KDD A;  4LRE A;  3GTP A;  4C3I K;  3MML B;  5FLM C;  5DLW A;  1KHK A;  1AJB A;  4KMU A;  1B8J A;  2IFY A;  3TTG A;  1O27 A;  4PAA A;  4TN0 A;  4X6A C;  1ZEB A;  3S1M K;  1SFO K;  2YU9 K;  3MK2 A;  2JH3 A;  3PO2 C;  1HQM A;  1VRQ C;  4BBS K;  4LR8 A;  3S15 C;  5D4D A;  4ZGA A;  2NVY K;  4KMH A;  1I6H C;  3JST A;  1O2F B;  4A3I K;  4LRA A;  1ANI A;  3EQL A;  2NVX C;  5JVO A;  4OIO A;  2JA5 A;  1USO A;  5C66 A;  1HJK A;  4NWJ A;  3GTK C;  2P8T A;  4G7O A;  5AJ9 A;  3S17 K;  3GTQ A;  4KM4 A;  1TWA K;  3AQP A;  3RZD C;  3N0B A;  4Y7N K;  1WCM K;  1F7U A;  1PJ7 A;  4LRD A;  3TFJ A;  3IDD A;  2GAH C;  3A8J A;  4O2D A;  2R93 C;  3I4M K;  4LR2 A;  1IQ0 A;  1Y1V A;  4WJ3 M;  1YNN A;  1HDH A;  4LRC A;  1L0W A;  1EH1 A;  4BY1 K;  4G0U A;  4ZG6 A;  5IYC C;  2PA8 D;  3RZO C;  3A8I A;  3S16 C;  4AYB L;  2E2I C;  5C3E C;  2R7Z A;  4A3L K;  1URA A;  4UOO A;  4A3K C;  1I50 C;  2E2H A;  3NVL A;  4LK0 A;  3GIR A;  3K7A C;  1I3Q C;  4KAR A;  5C44 C;  3HKZ L;  2PHC B;  1N2L A;  2E2J C;  1KHN A;  4OIP A;  4A3D K;  3Q3Q A;  4GTB A;  3V4G A;  1R9T K;  3MK1 A;  3E2D A;  2JA6 A;  1XXA A;  4WIL A;  4GT9 A;  1AJA A;  1F93 A;  4C3I C;  4KAV A;  4XLP A;  5DLT A;  1E3C P;  1ALK A;  3GTJ K;  2PA8 L;  4FDI A;  1EW8 A;  1VH2 A;  2Y0S L;  2A69 A;  3S1M C;  1GE9 A;  4GTY A;  3GTP K;  4KAW X;  1SFO C;  4KJG A;  2YU9 C;  3H0G A;  4BBS C;  2NVY C;  1K83 A;  4A3I C;  5HRT A;  4GFQ A;  4UOR A;  1EW2 A;  3GEH A;  3AD8 C;  2O5I A;  3S15 K;  1J6X A;  4C3J K;  4LRF A;  1ALJ A;  3S17 C;  1ELX A;  2WB1 D;  1TWA C;  4YFK A;  4A3G K;  5IJQ A;  2XCO A;  4KAS A;  4Y7N C;  2NVX K;  1TWF C;  3L4K A;  3GTL C;  5M3M K;  3VA7 A;  3GDZ A;  3I4M C;  3NKO A;  1XXB A;  2WAQ L;  1WSV A;  4LRB A;  1YNJ A;  1X31 C;  1TWC A;  1EQR A;  3NKQ A;  4BY1 C;  5M5Y K;  3G4C A;  4RMF A;  3GTG C;  1Y1V K;  3CAG A;  4C45 A;  4G0V A;  4CXS A;  4ZG9 A;  4A3L C;  5IYC K;  1AJD A;  2GLQ A;  3UN5 A;  4YG2 A;  5FJ8 K;  2GSU A;  3CQZ C;  1AB4 A;  4UPL A;  4GTA A;  4MEX A;  3ED4 A;  4GTL A;  2PPB A;  3UO0 A;  1R9T C;  2E2H K;  4KB2 A;  4BLA A;  5C44 K;  1EFW A;  1ED8 A;  3A8K A;  4KM9 A;  5C4J C;  4A3B K;  4YR1 A;  3GTM A;  1O26 A;  1EJJ A;  1UV7 A;  3GTJ C;  5TMF A;  5IYB K;  5HL8 A;  3M3Y K;  5TMC A;  2JA6 K;  3HOZ K;  4GTZ A;  3NKN A;  4QIW D;  3GTP C;  2XCQ A;  3I4N K;  3A52 A;  3HXA A;  1USM A;  1C0A A;  5IOS A;  4P5A A;  4B56 A;  4Q4Z A;  3CMR A;  3ORE A;  4A3M K;  1O24 A;  1JQW A;  4KB4 A;  2RGR A;  4AYB D;  4C3J C;  1G51 A;  2PMZ L;  3IPJ A;  3T00 A;  4A3G C;  4GTX A;  2JA7 A;  2W5W A;  2VUM A;  1K83 K;  4J3N A;  1KH7 A;  2JA5 C;  2FQO A;  3FKI A;  2GSO A;  1TWF K;  5IP9 K;  3QX3 A;  3TX0 A;  4YFN A;  4MIV A;  3HKZ D;  2R92 K;  4GTW A;  4WJ4 A;  3GTL K;  1Y6V A;  4P5B A;  4QIW L;  3G4A A;  3BDH A;  1BS2 A;  1Y1V C;  3HOX K;  3WBH A;  1IL2 A;  3HOW K;  3OEP A;  3HOV C;  1TWC K;  1IS1 A;  4KAY A;  2CFA A;  4KAT A;  1INN A;  3GTG K;  4OIR A;  1Y1W A;  4ZG7 A;  4GTF A;  2Y0S D;  5GOV A;  3M8Y A;  4DDQ A;  3HOY C;  1WSR A;  3WAV A;  3LAJ A;  2R7Z C;  1XXC A;  4GTC A;  3GEE A;  4KMA A;  3NKP A;  2O5J A;  4G7Z A;  2VQR A;  4GZY A;  4CXK A;  5LRM A;  2ZUE A;  3CQZ K;  3OPF A;  4P9S A;  2E2H C;  2CFA B;  3WAY A;  5M3F K;  2XRG A;  5M5W K;  4BBR K;  4A3B C;  2W5Q A;  3LXQ A;  3BP8 C;  1O2A A;  4LQY A;  5IYB C;  3M3Y C;  1O98 A;  2JA6 C;  1KHL A;  5CHP A;  5C4J K;  3HOZ C;  4QJV A;  2GSN A;  1O25 A;  2W5T A;  4GTE A;  3UN3 A;  1ZED A;  2WAQ D;  1ISE A;  3GTM K;  3I4N C;  5C4X K;  4LR9 A;  3AH5 A;  1J6W A;  1EI6 A;  4YFX A;  4M1X A;  2B63 A;  4A3M C;  3DXJ A;  4G7H A;  4A3E K;  4Y52 K;  1WOR A;  2XCR B;  5M5X K;  4QJV B;  1WOO A;  3H0G C;  3M8W A;  1RU0 A;  1DCH A;  1HI9 A;  3MK0 A;  3UNY A;  3S2H K;  1K83 C;  1TWG A;  3KD8 A;  1KHJ A;  2W5S A;  4OIN A;  3HOU K;  3S2D K;  5IP7 K;  5IP9 C;  1SHQ A;  3SZZ A;  4A3F K;  1ALH A;  2R92 C;  4MY4 A;  3LPX A;  2JA7 K;  3GTO A;  1EW9 A;  2VUM K;  2JA5 K;  3BUE A;  3S1N C;  3M4O C;  4KMD A;  2W8S A;  3GTQ K;  3WAX A;  2Y3P A;  3HOX C;  1JVI A;  3HOW C;  1Y7A A;  1TWC C;  4A3C K;  4AH6 A;  3M7V A;  4QAX A;  1WCM A;  1XZP A;  1EQJ A;  1KQ4 A;  2NVT K;  2GAG C;  3HOV K;  1WQH A;  5EGE A;  2A6E A;  3WAW A;  5CJ9 A;  1B4B A;  1VLO A;  5L0K A;  2ANH A;  1E2S P;  1Y1W K;  3HOY K;  3BDG A;  2R7Z K;  1BJT A;  4BBR C;  2PMZ D;  3H3V L;  1XZP B;  4KC6 A;  1XZQ A;  4MQ9 A;  4LJZ A;  2RH6 A;  2W8D A;  3T01 A;  3SZY A;  2JA8 K;  5L46 A;  5IYD K;  5TJ3 A;  1P49 A;  4LR7 A;  3GTM C;  1TWH A;  4MEY A;  5C4X C;  4UPK A;  5L0E A;  1VGX A;  3LAP A;  4FDJ A;  4C3H K;  4Q5S A;  3WOD A;  1ANJ A;  3GSI A;  4BLB A;  3BDF A;  5LRN A;  2V6U A;  3PO3 K;  4A3E C;  4Y52 C;  4C2M K;  4XLN A;  3S2H C;  3AD7 C;  5LQQ A;  5L0B A;  4ILD A;  3H0G K;  4GTD A;  3HOU C;  1ALI A;  1XPP A;  3BP3 A;  3S2D C;  5IP7 C;  1IE0 A;  2KWA A;  4A3F C;  3L4J A;  2ZKT A;  1VJE A;  2JA7 C;  2VUM C;  3NKR A;  1TWG K;  2W5X A;  1PJ6 A;  3IGZ B;  4MHX A;  3GTQ C;  1FSU A;  2A6H A;  3FKI C;  1HQA A;  4A3J K;  1WQG A;  3FOF A;  3S1R C;  4BXX K;  3S1N K;  2BE5 A;  3M4O K;  5K4P A;  3GTO K;  3TFH A;  4A3C C;  3S14 K;  3GEI A;  1O99 A;  2ZFZ A;  1WIH A;  5IOQ A;  2NVX A;  4ZH4 A;  2NVT C;  3GTK A; 
#chains in the Genus database with same CATH homology
 1AUK A;  3TG0 A;  1EI6 A;  2IUC A;  3NKQ A;  2QZU A;  4CYR A;  2D1G A;  4LRE A;  5KXA A;  5DLW A;  4CXS A;  5INH A;  3M8W A;  4ZG9 A;  3MK0 A;  1KHK A;  1AJB A;  1AJD A;  2GLQ A;  3UNY A;  1B8J A;  2IFY A;  3UN5 A;  3KD8 A;  1ZEF A;  1KHJ A;  4TN0 A;  1KH5 A;  2W5S A;  1ZEB A;  2IUC B;  2X98 A;  3DYC A;  3M8Z A;  1KH4 A;  2GSU A;  1SHQ A;  4UPL A;  3SZZ A;  3MK2 A;  1ALH A;  4MY4 A;  3ED4 A;  4LR8 A;  4ZGA A;  1EW9 A;  3UO0 A;  4LRA A;  1ANI A;  2W8S A;  1ED8 A;  5C66 A;  3WAX A;  1HJK A;  4NWJ A;  2G9Y A;  4YR1 A;  5AJ9 A;  4KM4 A;  1EJJ A;  2W5V A;  1Y7A A;  4N7T A;  5IJS A;  1ELY A;  4LRD A;  3M7V A;  3IDD A;  4QAX A;  4GTZ A;  3NKN A;  1EQJ A;  4LR2 A;  5GRR A;  5EGE A;  3WAW A;  3A52 A;  1N2K A;  3TWZ A;  4CYS A;  5L0K A;  1HDH A;  2ANH A;  4LRC A;  5EGH A;  5DLV A;  1E2S P;  4B56 A;  3BDG A;  3CMR A;  4ZG6 A;  3T00 A;  3B5Q A;  4GTX A;  2W5W A;  1URA A;  1SHN A;  2RH6 A;  4KJD A;  2W8D A;  3T01 A;  3SZY A;  4UOO A;  4CXU A;  3NVL A;  1KH7 A;  5TJ3 A;  1P49 A;  2GSO A;  4LR7 A;  3TX0 A;  4MIV A;  1N2L A;  4UPH A;  4UPK A;  4GTW A;  1KHN A;  1Y6V A;  4FDJ A;  5L0E A;  1URB A;  3MK1 A;  3Q3Q A;  1ANJ A;  3E2D A;  3BDF A;  5LRN A;  1ELZ A;  1AJA A;  3BDH A;  3UN2 A;  2W5R A;  1E33 P;  4KAV A;  3WBH A;  3IGY B;  5DLT A;  1E3C P;  1ALK A;  1E1Z P;  4FDI A;  4KAY A;  1EW8 A;  5LQQ A;  5L0B A;  4ZG7 A;  5GOV A;  4GTY A;  3NKM A;  1ALI A;  3M8Y A;  3DPC A;  3OT9 A;  3WAV A;  4KJG A;  5LIA A;  3NKP A;  2ZKT A;  2VQR A;  4CXK A;  3NKR A;  1ED9 A;  2W5X A;  1AJC A;  5LRM A;  5HRT A;  3BDG B;  3IGZ B;  4MHX A;  4UOR A;  3T02 A;  1FSU A;  1EW2 A;  3WAY A;  2XRG A;  4LRF A;  1ALJ A;  1HQA A;  4UOP A;  1ELX A;  2W5Q A;  4UPI A;  3LXQ A;  5K4P A;  5IJQ A;  4LQY A;  2XR9 A;  1K7H A;  1O98 A;  1O99 A;  2GA3 A;  1KHL A;  2GSN A;  2W5T A;  1KH9 A;  3NKO A;  3UN3 A;  1ZED A;  4NWX A;  4LR9 A;  4LRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...