3T00A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with vanadate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
molecule keywords phosphonoacetate hydrolase
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t00A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t00A01
2QZUA 4UOPA 4LRFA 2GSUA 4CYSA 4ZG6A 3KD8A 3WAWA 3M8WA 5IJSA 4ZG7A 3DYCA 4MY4A 2IUCA 4LR8A 1KH4A 5DLWA 4KM4A 1AJAA 4LR7A 1URBA 3UN5A 2W5SA 1EW8A 2IFYA 3OT9A 4LRAA 5IJQA 1KHLA 4ZGAA 4ZG9A 3MK2A 2G9YA 5GRRA 5KXAA 4LRCA 4GTYA 1N2KA 3CMRA 3IDDA 1ALHA 1ALKA 3WAVA 3SZYA 4NWJA 4CXUA 1K7HA 1ALJA 5K4PA 1KH9A 4MIVA 1HQAA 3Q3QA 4FDIA 3WAXA 5EGHA 3ED4A 5L0KA 5L0EA 4KJDA 2W5TA 3NKPA 5LIAA 2W5RA 1E2SP 1ZEDA 4NWXA 4CXKA 1KHJA 1EJJA 1O99A 1URAA 3LXQA 4UPHA 1ED8A 1O98A 1KH7A 1EQJA 1HDHA 2GLQA 3IGYB 2XRGA 3BDGB 3T02A 3SZZA 3NKOA 3M8YA 3BDGA 5AJ9A 1EW9A 3MK1A 3NVLA 4UOOA 3NKNA 3UN3A 1SHQA 4UPLA 1EW2A 5C66A 3WBHA 4CXSA 5DLTA 1AJCA 1FSUA 3WAYA 1N2LA 3NKRA 2W5WA 5GOVA 4YR1A 1KHNA 4B56A 3NKMA 4KAVA 4LR2A 3UN2A 2XR9A 1AJDA 2GSNA 2X98A 4LRDA 3MK0A 1KH5A 5L0BA 4GTZA 4CYRA 4UORA 3DPCA 3TWZA 1AJBA 4TN0A 2W8SA 1ELYA 3BDHA 4GTXA 4LR9A 3T00A 1ELZA 1P49A 5HRTA 1ZEBA 3NKQA 4GTWA 1ELXA 4LQYA 1SHNA 2VQRA 3BDFA 1KHKA 3E2DA 5EGEA 5DLVA 4N7TA 1ZEFA 2W5VA 1E1ZP 3M7VA 4KJGA 3M8ZA 1HJKA 4KAYA 1E3CP 1EI6A 3B5QA 2W8DA 4LRBA 2W5XA 5INHA 2IUCB 3A52A 5LRMA 1E33P 2GA3A 4LREA 2W5QA 1AUKA 1ANIA 2ANHA 3IGZB 1B8JA 1ED9A 1Y6VA 4QAXA 5LQQA 1ALIA 2RH6A 4UPKA 2GSOA 3T01A 4UPIA 1ANJA 4FDJA 3UO0A 3UNYA 5LRNA 5TJ3A 3TG0A 2ZKTA 2D1GA 4MHXA 1Y7AA 3TX0A
chains in the Genus database with same CATH superfamily
4LRFA 4BY7C 4CYSA 4ZG6A 3KD8A 3WAWA 4ZG7A 3HOYK 4MY4A 2A69A 4LR8A 5DLWA 3UN5A 1TWCK 1XXBA 1EW8A 2NVQK 3S1NK 4LRAA 4LK0A 1I3QK 4GZYA 2YU9C 3LPXA 1TWFK 2CFAB 2JA6C 5KXAA 2D6FC 4GTYA 4A3FC 3GTGA 2NVTK 4NWJA 1TWGK 1K83C 3FKIK 4KAWX 4KMDA 1WIHA 4BY1C 3HOWK 3Q3QA 2JA5K 3AQPA 1SFOK 4Q5SA 1IQ0A 3GTMC 1K83K 3HOWC 4OINA 4CXKA 1TWGC 1EJJA 2E2HK 2O5JA 4UPHA 1ED8A 1EQJA 4A3JK 2E2IK 2PMZL 2JA8C 2GLQA 3IGYB 1XZPA 3BDGB 3M3YC 5AJ9A 3GTKC 3MK1A 2WAQL 1HI9A 3A8IA 3NKNA 3UN3A 4UPLA 1EW2A 1TWAC 3S14K 1N2LA 3OPFA 1Y1WA 5L46A 2ZUEA 1JOEA 2XCQA 4B56A 2B63C 2Y0SL 1BS2A 1O28A 3UN2A 3GEIA 2XR9A 4C3JC 2E2JK 1PJ6A 2X98A 1O2BA 3PO3K 4LRDA 4GTZA 4C2MC 1I6VA 1WQFA 1YX2A 1ZBSA 4UORA 1ZXOA 1XPPA 4TN0A 5C3EK 1ELYA 4P5AA 4A3FK 1VGXA 4A3KK 1ELXA 3A8JA 2W5VA 3S14C 4LJZA 2NVQC 3S1NC 4A93K 1ZQ1C 1Y1WC 1I6HC 4BBRK 1WOOA 2W8DA 3HKZD 1VRQC 3HOZC 3H0GK 4PAAA 4AYBL 2GA3A 4C45A 1O24A 2R7ZC 2E2IC 2JA8K 1ANIA 4BY1K 1B8JA 1ED9A 3S0XA 1ALIA 3GEHA 2NVXC 1JQWA 5JFEA 4LOWA 3GTPC 1ANJA 4GTBA 3I4MK 2R93K 5M3MK 3UO0A 5FJ8K 1IW7A 1ISEA 3UNYA 4A3GC 3FKIC 5LRNA 4X6AK 3GTMA 1TWCC 2ZKTA 4MHXA 1IL2A 1Y7AA 4KMUA 2QZUA 4UOPA 5IORA 5IJSA 2V6UA 2NVYC 3H3VD 3DYCA 4A3CK 3MMLB 5C4JC 1BDFA 1DCHA 3GTLC 1KHLA 1WCMA 4KATA 1B4BA 4BY7K 3FKIA 3K7AC 1YCLA 3GTQC 5IYBC 2V6TA 1ALKA 3I4MC 1DD5A 4CXUA 1TWFA 4A3MK 3S2DC 1I50K 1KH9A 4GTEA 2Y3PA 4C3IK 3GTLK 4A3EK 1J98A 1EQRA 4MEXA 1TWHA 4KB4A 5LIAA 2PPBA 3AD7C 3GIRA 4NWXA 3HOZK 1KHJA 3VA7A 1BJTA 5IYDC 3LAPA 1TWAK 3GTJA 4G0UA 4A3EC 3T02A 1R9TA 3PO2C 5IYCK 1XZPB 3BDGA 3FOEA 3GTOK 1JVIA 1R9TK 1EW9A 4QIWL 5IYBK 4Y7NK 1Y1VK 2PA8L 2RGRA 1USMA 3WAYA 2WAQD 5E68A 2EBBA 4OIPA 3HOXK 2JA5C 4A3DC 1DCOA 5GOVA 3S2HK 3S1QC 1KHNA 4A3LK 3HOVC 2JA7A 3NKMA 4P5BA 4C3HK 4LR2A 2JH3A 3TFHA 3GTLA 4KARA 2NVYK 1Y1VC 1AJDA 4Y7NC 3CQZC 1GE9A 1EK8A 3I4NC 3MK0A 1KH5A 1SFOC 4MQ9A 4CYRA 3TWZA 1I3QC 2R7ZA 5FLMK 3GTGK 2NVTC 3HOUC 1C0AA 5HRTA 5CJ9A 4DDQA 4GTWA 2W7VA 4X6AC 4LQYA 5TMFA 3E2DA 5EGEA 1DCPA 3GTQA 5IOTA 3BP8C 1TWCA 1E1ZP 1BGWA 4KJGA 3M8ZA 1HJKA 1E3CP 2NVXK 4G0WA 1WCMC 4FM9A 3S15K 1PJ7A 3OREA 2IUCB 3A52A 2GAGC 5IOQA 1VJEA 1AUKA 1F93A 3IGZB 3G4CA 2R93A 3JSTA 4PABA 1IBAA 5LQQA 2RH6A 1R9TC 2GSOA 4G7OA 2Y0SD 1EFWA 3HOUK 2WB1L 5TJ3A 3TG0A 1VLOA 3S1MK 3TX0A 3HOVK 1WOPA 4KB2A 2GSUA 3BP3A 4KASA 4RMFA 3M8WA 3S17C 3EQLA 4A3GK 3I4NK 1AJAA 4G7ZA 1URBA 4KM4A 3GDZA 2R92K 4C3JK 4Y52C 1WOSA 2IFYA 4ZGAA 4YFKA 4BLBA 4KN4A 5M5XK 4OIRA 1L0WA 2G9YA 1USOA 4KM9A 1O2AA 4WJ4A 4LRCA 3AQOA 1XXAA 4GTFA 3CMRA 3WAVA 4QJVA 4XLPA 1TWAA 4Y52K 1HQAA 2R92C 5JVOA 1WQGA 1O26A 3WAXA 4A3BK 3ED4A 2CFAA 3OEPA 5L0KA 1K83A 5L0EA 5IYCC 4KJDA 2W5TA 4LK1A 3NKPA 2W5RA 2O5IA 1E2SP 4LLGA 3TFJA 4A3MC 3S2DK 2JA6A 1O99A 2KWAA 1O98A 1KH7A 4GTCA 1G51A 4XCHA 1TWGA 3SZZA 3NKOA 3M8YA 4ILDA 2R93C 1WCMK 3S15C 3M4OC 4GTLA 2E2IA 4UOOA 2P8TA 1EH1A 5C66A 4CXSA 5C44C 5M3FK 4BXXC 1FSUA 5C4XC 3NKRA 4YR1A 3K7AK 4BBRC 1J6WA 4AYBD 3RZOK 3AD8C 1RU0A 5CHPA 2BE5A 4KN7A 3S16K 1O27A 5D4DA 4AH6A 2GSNA 4A3CC 5C44K 1WSRA 4YG2A 3DPCA 3TTGA 2ZUFA 3N0BA 1AJBA 3RZOC 1XZQB 2W8SA 2PMZD 1I3QA 3BDHA 3NUHA 4GTXA 4Q4ZA 4LR9A 2P5MA 3A8KA 3GTKA 1IE0A 3ADAC 2E2JC 2R92A 1YNJA 1ELZA 1ZEBA 4KDDA 3HOYC 4KMAA 4OIQA 1SHNA 2VQRA 5DLVA 1KHKA 5HL8A 5IOSA 1TWHK 1ZEFA 4C2MK 3M7VA 2CW0A 2FQOA 3GTOC 4KAYA 4A3IC 3B5QA 5INHA 3FHZA 1F9NA 4KMHA 4QIWD 5LRMA 1INNA 1XXCA 4XSXA 1F7UA 1HQMA 1PJ5A 4BKWA 3AD9C 3PO2K 2YU9K 4QAXA 1B4AA 3BUEA 2GAHC 3CQZA 4FZBA 3N3YA 1WORA 3T01A 3L4JA 3GTGC 5M5WK 4P9SA 4MEYA 1X31C 5IP9K 3CQZK 1O2FB 2YU9A 3GSIA 2E2HC 4O2DA 2D1GA 3WODA 4A3LC 3GTQK 3AH5A 2NVYA 3GTMK 2IUCA 1KH4A 4LR7A 2W5SA 3OT9A 3G4AA 5IJQA 4ZG9A 3MK2A 2A6HA 3N0CA 1Y1VA 4WILA 5GRRA 3GTKK 1N2KA 2PA8D 1F7VA 4GT9A 3IDDA 1ALHA 1SMYA 4ZH4A 3SZYA 2JA7C 4BBSK 5IYDK 1K7HA 1ALJA 5K4PA 4MIVA 3FOFA 3H0GA 4XSZA 5C4JK 4KM8A 4FDIA 1J6VA 5EGHA 4JK1A 2PHCB 3GTJK 4BLAA 4C3HC 2VUMK 4A3IK 1ZVUA 3GEEA 4NOIA 1SFOA 1ZEDA 5IP7C 1I50C 2VUMA 3QX3A 1URAA 3LXQA 4C3IC 3HOXC 3GTJC 4A3DK 5C4XK 1HDHA 2XRGA 3GTPA 1VH2A 1I50A 2VUMC 4A93C 3GTPK 3NVLA 1I6HK 3CAGA 1SHQA 4GTDA 3H0GC 3S16C 3WBHA 5DLTA 1AJCA 2A6EA 2V6SA 2W5WA 1IS1A 4A3BC 1TWFC 2JA6K 3IPJA 5FLMC 1Y1WK 4KAVA 4J3NA 1AB4A 3LAJA 4KC6A 1YNNA 4A3KC 2A68A 4QJVB 2NVXA 1O25A 2ZFZA 4BXXK 1V5VA 3S1RC 5L0BA 3S2HC 3S1QK 1TWHC 4OIOA 3RZDK 2WB1D 3DXJA 3H3VL 4YFXA 3T00A 1P49A 3M4OK 2E2HA 3NKQA 3S1RK 3PO3C 3BDFA 1UV7A 2R7ZK 3HKZL 4N7TA 1KQ4A 4G0VA 1WSVA 2B63A 1XZQA 4YFNA 2XCRB 1EI6A 2B63K 4LRBA 2FQTA 4M1XA 3S17K 2JA5A 2W5XA 5TMCA 4G7HA 3ERED 5IP9C 3L4KA 4GFQA 3V4GA 1E33P 4LREA 2JA7K 4BBSC 2W5QA 4A3JC 2ANHA 3S1MC 3M3YK 1Y6VA 5M5YK 4UPKA 2XCOA 4XLNA 4WJ3M 5C3EC 4UPIA 3RZDC 4FDJA 5IP7K 3GTOA 1J6XA 1O29A 1ZYRA 1WQHA 4GTAA 3HXAA 3TFIA
chains in the Genus database with same CATH topology
2QZUA 4UOPA 4LRFA 2GSUA 4CYSA 4ZG6A 3KD8A 3WAWA 3M8WA 5IJSA 4ZG7A 3DYCA 4MY4A 2IUCA 4LR8A 1KH4A 5DLWA 4KM4A 1AJAA 4LR7A 1URBA 3UN5A 2W5SA 1EW8A 2IFYA 3OT9A 4LRAA 5IJQA 1KHLA 4ZGAA 4ZG9A 3MK2A 2G9YA 5GRRA 5KXAA 4LRCA 4GTYA 1N2KA 3CMRA 3IDDA 1ALHA 1ALKA 3WAVA 3SZYA 4NWJA 4CXUA 1K7HA 1ALJA 5K4PA 1KH9A 4MIVA 1HQAA 3Q3QA 4FDIA 3WAXA 5EGHA 3ED4A 5L0KA 5L0EA 4KJDA 2W5TA 3NKPA 5LIAA 2W5RA 1E2SP 1ZEDA 4NWXA 4CXKA 1KHJA 1EJJA 1O99A 1URAA 3LXQA 4UPHA 1ED8A 1O98A 1KH7A 1EQJA 1HDHA 2GLQA 3IGYB 2XRGA 3BDGB 3T02A 3SZZA 3NKOA 3M8YA 3BDGA 5AJ9A 1EW9A 3MK1A 3NVLA 4UOOA 3NKNA 3UN3A 1SHQA 4UPLA 1EW2A 5C66A 3WBHA 4CXSA 5DLTA 1AJCA 1FSUA 3WAYA 1N2LA 3NKRA 2W5WA 5GOVA 4YR1A 1KHNA 4B56A 3NKMA 4KAVA 4LR2A 3UN2A 2XR9A 1AJDA 2GSNA 2X98A 4LRDA 3MK0A 1KH5A 5L0BA 4GTZA 4CYRA 4UORA 3DPCA 3TWZA 1AJBA 4TN0A 2W8SA 1ELYA 3BDHA 4GTXA 4LR9A 3T00A 1ELZA 1P49A 5HRTA 1ZEBA 3NKQA 4GTWA 1ELXA 4LQYA 1SHNA 2VQRA 3BDFA 1KHKA 3E2DA 5EGEA 5DLVA 4N7TA 1ZEFA 2W5VA 1E1ZP 3M7VA 4KJGA 3M8ZA 1HJKA 4KAYA 1E3CP 1EI6A 3B5QA 2W8DA 4LRBA 2W5XA 5INHA 2IUCB 3A52A 5LRMA 1E33P 2GA3A 4LREA 2W5QA 1AUKA 1ANIA 2ANHA 3IGZB 1B8JA 1ED9A 1Y6VA 4QAXA 5LQQA 1ALIA 2RH6A 4UPKA 2GSOA 3T01A 4UPIA 1ANJA 4FDJA 3UO0A 3UNYA 5LRNA 5TJ3A 3TG0A 2ZKTA 2D1GA 4MHXA 1Y7AA 3TX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QZU A;  4UOP A;  4LRF A;  2GSU A;  4CYS A;  4ZG6 A;  3KD8 A;  3WAW A;  3M8W A;  5IJS A;  4ZG7 A;  3DYC A;  4MY4 A;  2IUC A;  4LR8 A;  1KH4 A;  5DLW A;  4KM4 A;  1AJA A;  4LR7 A;  1URB A;  3UN5 A;  2W5S A;  1EW8 A;  2IFY A;  3OT9 A;  4LRA A;  5IJQ A;  1KHL A;  4ZGA A;  4ZG9 A;  3MK2 A;  2G9Y A;  5GRR A;  5KXA A;  4LRC A;  4GTY A;  1N2K A;  3CMR A;  3IDD A;  1ALH A;  1ALK A;  3WAV A;  3SZY A;  4NWJ A;  4CXU A;  1K7H A;  1ALJ A;  5K4P A;  1KH9 A;  4MIV A;  1HQA A;  3Q3Q A;  4FDI A;  3WAX A;  5EGH A;  3ED4 A;  5L0K A;  5L0E A;  4KJD A;  2W5T A;  3NKP A;  5LIA A;  2W5R A;  1E2S P;  1ZED A;  4NWX A;  4CXK A;  1KHJ A;  1EJJ A;  1O99 A;  1URA A;  3LXQ A;  4UPH A;  1ED8 A;  1O98 A;  1KH7 A;  1EQJ A;  1HDH A;  2GLQ A;  3IGY B;  2XRG A;  3BDG B;  3T02 A;  3SZZ A;  3NKO A;  3M8Y A;  3BDG A;  5AJ9 A;  1EW9 A;  3MK1 A;  3NVL A;  4UOO A;  3NKN A;  3UN3 A;  1SHQ A;  4UPL A;  1EW2 A;  5C66 A;  3WBH A;  4CXS A;  5DLT A;  1AJC A;  1FSU A;  3WAY A;  1N2L A;  3NKR A;  2W5W A;  5GOV A;  4YR1 A;  1KHN A;  4B56 A;  3NKM A;  4KAV A;  4LR2 A;  3UN2 A;  2XR9 A;  1AJD A;  2GSN A;  2X98 A;  4LRD A;  3MK0 A;  1KH5 A;  5L0B A;  4GTZ A;  4CYR A;  4UOR A;  3DPC A;  3TWZ A;  1AJB A;  4TN0 A;  2W8S A;  1ELY A;  3BDH A;  4GTX A;  4LR9 A;  3T00 A;  1ELZ A;  1P49 A;  5HRT A;  1ZEB A;  3NKQ A;  4GTW A;  1ELX A;  4LQY A;  1SHN A;  2VQR A;  3BDF A;  1KHK A;  3E2D A;  5EGE A;  5DLV A;  4N7T A;  1ZEF A;  2W5V A;  1E1Z P;  3M7V A;  4KJG A;  3M8Z A;  1HJK A;  4KAY A;  1E3C P;  1EI6 A;  3B5Q A;  2W8D A;  4LRB A;  2W5X A;  5INH A;  2IUC B;  3A52 A;  5LRM A;  1E33 P;  2GA3 A;  4LRE A;  2W5Q A;  1AUK A;  1ANI A;  2ANH A;  3IGZ B;  1B8J A;  1ED9 A;  1Y6V A;  4QAX A;  5LQQ A;  1ALI A;  2RH6 A;  4UPK A;  2GSO A;  3T01 A;  4UPI A;  1ANJ A;  4FDJ A;  3UO0 A;  3UNY A;  5LRN A;  5TJ3 A;  3TG0 A;  2ZKT A;  2D1G A;  4MHX A;  1Y7A A;  3TX0 A; 
#chains in the Genus database with same CATH topology
 4LRF A;  4BY7 C;  4CYS A;  4ZG6 A;  3KD8 A;  3WAW A;  4ZG7 A;  3HOY K;  4MY4 A;  2A69 A;  4LR8 A;  5DLW A;  3UN5 A;  1TWC K;  1XXB A;  1EW8 A;  2NVQ K;  3S1N K;  4LRA A;  4LK0 A;  1I3Q K;  4GZY A;  2YU9 C;  3LPX A;  1TWF K;  2CFA B;  2JA6 C;  5KXA A;  2D6F C;  4GTY A;  4A3F C;  3GTG A;  2NVT K;  4NWJ A;  1TWG K;  1K83 C;  3FKI K;  4KAW X;  4KMD A;  1WIH A;  4BY1 C;  3HOW K;  3Q3Q A;  2JA5 K;  3AQP A;  1SFO K;  4Q5S A;  1IQ0 A;  3GTM C;  1K83 K;  3HOW C;  4OIN A;  4CXK A;  1TWG C;  1EJJ A;  2E2H K;  2O5J A;  4UPH A;  1ED8 A;  1EQJ A;  4A3J K;  2E2I K;  2PMZ L;  2JA8 C;  2GLQ A;  3IGY B;  1XZP A;  3BDG B;  3M3Y C;  5AJ9 A;  3GTK C;  3MK1 A;  2WAQ L;  1HI9 A;  3A8I A;  3NKN A;  3UN3 A;  4UPL A;  1EW2 A;  1TWA C;  3S14 K;  1N2L A;  3OPF A;  1Y1W A;  5L46 A;  2ZUE A;  1JOE A;  2XCQ A;  4B56 A;  2B63 C;  2Y0S L;  1BS2 A;  1O28 A;  3UN2 A;  3GEI A;  2XR9 A;  4C3J C;  2E2J K;  1PJ6 A;  2X98 A;  1O2B A;  3PO3 K;  4LRD A;  4GTZ A;  4C2M C;  1I6V A;  1WQF A;  1YX2 A;  1ZBS A;  4UOR A;  1ZXO A;  1XPP A;  4TN0 A;  5C3E K;  1ELY A;  4P5A A;  4A3F K;  1VGX A;  4A3K K;  1ELX A;  3A8J A;  2W5V A;  3S14 C;  4LJZ A;  2NVQ C;  3S1N C;  4A93 K;  1ZQ1 C;  1Y1W C;  1I6H C;  4BBR K;  1WOO A;  2W8D A;  3HKZ D;  1VRQ C;  3HOZ C;  3H0G K;  4PAA A;  4AYB L;  2GA3 A;  4C45 A;  1O24 A;  2R7Z C;  2E2I C;  2JA8 K;  1ANI A;  4BY1 K;  1B8J A;  1ED9 A;  3S0X A;  1ALI A;  3GEH A;  2NVX C;  1JQW A;  5JFE A;  4LOW A;  3GTP C;  1ANJ A;  4GTB A;  3I4M K;  2R93 K;  5M3M K;  3UO0 A;  5FJ8 K;  1IW7 A;  1ISE A;  3UNY A;  4A3G C;  3FKI C;  5LRN A;  4X6A K;  3GTM A;  1TWC C;  2ZKT A;  4MHX A;  1IL2 A;  1Y7A A;  4KMU A;  2QZU A;  4UOP A;  5IOR A;  5IJS A;  2V6U A;  2NVY C;  3H3V D;  3DYC A;  4A3C K;  3MML B;  5C4J C;  1BDF A;  1DCH A;  3GTL C;  1KHL A;  1WCM A;  4KAT A;  1B4B A;  4BY7 K;  3FKI A;  3K7A C;  1YCL A;  3GTQ C;  5IYB C;  2V6T A;  1ALK A;  3I4M C;  1DD5 A;  4CXU A;  1TWF A;  4A3M K;  3S2D C;  1I50 K;  1KH9 A;  4GTE A;  2Y3P A;  4C3I K;  3GTL K;  4A3E K;  1J98 A;  1EQR A;  4MEX A;  1TWH A;  4KB4 A;  5LIA A;  2PPB A;  3AD7 C;  3GIR A;  4NWX A;  3HOZ K;  1KHJ A;  3VA7 A;  1BJT A;  5IYD C;  3LAP A;  1TWA K;  3GTJ A;  4G0U A;  4A3E C;  3T02 A;  1R9T A;  3PO2 C;  5IYC K;  1XZP B;  3BDG A;  3FOE A;  3GTO K;  1JVI A;  1R9T K;  1EW9 A;  4QIW L;  5IYB K;  4Y7N K;  1Y1V K;  2PA8 L;  2RGR A;  1USM A;  3WAY A;  2WAQ D;  5E68 A;  2EBB A;  4OIP A;  3HOX K;  2JA5 C;  4A3D C;  1DCO A;  5GOV A;  3S2H K;  3S1Q C;  1KHN A;  4A3L K;  3HOV C;  2JA7 A;  3NKM A;  4P5B A;  4C3H K;  4LR2 A;  2JH3 A;  3TFH A;  3GTL A;  4KAR A;  2NVY K;  1Y1V C;  1AJD A;  4Y7N C;  3CQZ C;  1GE9 A;  1EK8 A;  3I4N C;  3MK0 A;  1KH5 A;  1SFO C;  4MQ9 A;  4CYR A;  3TWZ A;  1I3Q C;  2R7Z A;  5FLM K;  3GTG K;  2NVT C;  3HOU C;  1C0A A;  5HRT A;  5CJ9 A;  4DDQ A;  4GTW A;  2W7V A;  4X6A C;  4LQY A;  5TMF A;  3E2D A;  5EGE A;  1DCP A;  3GTQ A;  5IOT A;  3BP8 C;  1TWC A;  1E1Z P;  1BGW A;  4KJG A;  3M8Z A;  1HJK A;  1E3C P;  2NVX K;  4G0W A;  1WCM C;  4FM9 A;  3S15 K;  1PJ7 A;  3ORE A;  2IUC B;  3A52 A;  2GAG C;  5IOQ A;  1VJE A;  1AUK A;  1F93 A;  3IGZ B;  3G4C A;  2R93 A;  3JST A;  4PAB A;  1IBA A;  5LQQ A;  2RH6 A;  1R9T C;  2GSO A;  4G7O A;  2Y0S D;  1EFW A;  3HOU K;  2WB1 L;  5TJ3 A;  3TG0 A;  1VLO A;  3S1M K;  3TX0 A;  3HOV K;  1WOP A;  4KB2 A;  2GSU A;  3BP3 A;  4KAS A;  4RMF A;  3M8W A;  3S17 C;  3EQL A;  4A3G K;  3I4N K;  1AJA A;  4G7Z A;  1URB A;  4KM4 A;  3GDZ A;  2R92 K;  4C3J K;  4Y52 C;  1WOS A;  2IFY A;  4ZGA A;  4YFK A;  4BLB A;  4KN4 A;  5M5X K;  4OIR A;  1L0W A;  2G9Y A;  1USO A;  4KM9 A;  1O2A A;  4WJ4 A;  4LRC A;  3AQO A;  1XXA A;  4GTF A;  3CMR A;  3WAV A;  4QJV A;  4XLP A;  1TWA A;  4Y52 K;  1HQA A;  2R92 C;  5JVO A;  1WQG A;  1O26 A;  3WAX A;  4A3B K;  3ED4 A;  2CFA A;  3OEP A;  5L0K A;  1K83 A;  5L0E A;  5IYC C;  4KJD A;  2W5T A;  4LK1 A;  3NKP A;  2W5R A;  2O5I A;  1E2S P;  4LLG A;  3TFJ A;  4A3M C;  3S2D K;  2JA6 A;  1O99 A;  2KWA A;  1O98 A;  1KH7 A;  4GTC A;  1G51 A;  4XCH A;  1TWG A;  3SZZ A;  3NKO A;  3M8Y A;  4ILD A;  2R93 C;  1WCM K;  3S15 C;  3M4O C;  4GTL A;  2E2I A;  4UOO A;  2P8T A;  1EH1 A;  5C66 A;  4CXS A;  5C44 C;  5M3F K;  4BXX C;  1FSU A;  5C4X C;  3NKR A;  4YR1 A;  3K7A K;  4BBR C;  1J6W A;  4AYB D;  3RZO K;  3AD8 C;  1RU0 A;  5CHP A;  2BE5 A;  4KN7 A;  3S16 K;  1O27 A;  5D4D A;  4AH6 A;  2GSN A;  4A3C C;  5C44 K;  1WSR A;  4YG2 A;  3DPC A;  3TTG A;  2ZUF A;  3N0B A;  1AJB A;  3RZO C;  1XZQ B;  2W8S A;  2PMZ D;  1I3Q A;  3BDH A;  3NUH A;  4GTX A;  4Q4Z A;  4LR9 A;  2P5M A;  3A8K A;  3GTK A;  1IE0 A;  3ADA C;  2E2J C;  2R92 A;  1YNJ A;  1ELZ A;  1ZEB A;  4KDD A;  3HOY C;  4KMA A;  4OIQ A;  1SHN A;  2VQR A;  5DLV A;  1KHK A;  5HL8 A;  5IOS A;  1TWH K;  1ZEF A;  4C2M K;  3M7V A;  2CW0 A;  2FQO A;  3GTO C;  4KAY A;  4A3I C;  3B5Q A;  5INH A;  3FHZ A;  1F9N A;  4KMH A;  4QIW D;  5LRM A;  1INN A;  1XXC A;  4XSX A;  1F7U A;  1HQM A;  1PJ5 A;  4BKW A;  3AD9 C;  3PO2 K;  2YU9 K;  4QAX A;  1B4A A;  3BUE A;  2GAH C;  3CQZ A;  4FZB A;  3N3Y A;  1WOR A;  3T01 A;  3L4J A;  3GTG C;  5M5W K;  4P9S A;  4MEY A;  1X31 C;  5IP9 K;  3CQZ K;  1O2F B;  2YU9 A;  3GSI A;  2E2H C;  4O2D A;  2D1G A;  3WOD A;  4A3L C;  3GTQ K;  3AH5 A;  2NVY A;  3GTM K;  2IUC A;  1KH4 A;  4LR7 A;  2W5S A;  3OT9 A;  3G4A A;  5IJQ A;  4ZG9 A;  3MK2 A;  2A6H A;  3N0C A;  1Y1V A;  4WIL A;  5GRR A;  3GTK K;  1N2K A;  2PA8 D;  1F7V A;  4GT9 A;  3IDD A;  1ALH A;  1SMY A;  4ZH4 A;  3SZY A;  2JA7 C;  4BBS K;  5IYD K;  1K7H A;  1ALJ A;  5K4P A;  4MIV A;  3FOF A;  3H0G A;  4XSZ A;  5C4J K;  4KM8 A;  4FDI A;  1J6V A;  5EGH A;  4JK1 A;  2PHC B;  3GTJ K;  4BLA A;  4C3H C;  2VUM K;  4A3I K;  1ZVU A;  3GEE A;  4NOI A;  1SFO A;  1ZED A;  5IP7 C;  1I50 C;  2VUM A;  3QX3 A;  1URA A;  3LXQ A;  4C3I C;  3HOX C;  3GTJ C;  4A3D K;  5C4X K;  1HDH A;  2XRG A;  3GTP A;  1VH2 A;  1I50 A;  2VUM C;  4A93 C;  3GTP K;  3NVL A;  1I6H K;  3CAG A;  1SHQ A;  4GTD A;  3H0G C;  3S16 C;  3WBH A;  5DLT A;  1AJC A;  2A6E A;  2V6S A;  2W5W A;  1IS1 A;  4A3B C;  1TWF C;  2JA6 K;  3IPJ A;  5FLM C;  1Y1W K;  4KAV A;  4J3N A;  1AB4 A;  3LAJ A;  4KC6 A;  1YNN A;  4A3K C;  2A68 A;  4QJV B;  2NVX A;  1O25 A;  2ZFZ A;  4BXX K;  1V5V A;  3S1R C;  5L0B A;  3S2H C;  3S1Q K;  1TWH C;  4OIO A;  3RZD K;  2WB1 D;  3DXJ A;  3H3V L;  4YFX A;  3T00 A;  1P49 A;  3M4O K;  2E2H A;  3NKQ A;  3S1R K;  3PO3 C;  3BDF A;  1UV7 A;  2R7Z K;  3HKZ L;  4N7T A;  1KQ4 A;  4G0V A;  1WSV A;  2B63 A;  1XZQ A;  4YFN A;  2XCR B;  1EI6 A;  2B63 K;  4LRB A;  2FQT A;  4M1X A;  3S17 K;  2JA5 A;  2W5X A;  5TMC A;  4G7H A;  3ERE D;  5IP9 C;  3L4K A;  4GFQ A;  3V4G A;  1E33 P;  4LRE A;  2JA7 K;  4BBS C;  2W5Q A;  4A3J C;  2ANH A;  3S1M C;  3M3Y K;  1Y6V A;  5M5Y K;  4UPK A;  2XCO A;  4XLN A;  4WJ3 M;  5C3E C;  4UPI A;  3RZD C;  4FDJ A;  5IP7 K;  3GTO A;  1J6X A;  1O29 A;  1ZYR A;  1WQH A;  4GTA A;  3HXA A;  3TFI A; 
#chains in the Genus database with same CATH homology
 2QZU A;  4UOP A;  4LRF A;  2GSU A;  4CYS A;  4ZG6 A;  3KD8 A;  3WAW A;  3M8W A;  5IJS A;  4ZG7 A;  3DYC A;  4MY4 A;  2IUC A;  4LR8 A;  1KH4 A;  5DLW A;  4KM4 A;  1AJA A;  4LR7 A;  1URB A;  3UN5 A;  2W5S A;  1EW8 A;  2IFY A;  3OT9 A;  4LRA A;  5IJQ A;  1KHL A;  4ZGA A;  4ZG9 A;  3MK2 A;  2G9Y A;  5GRR A;  5KXA A;  4LRC A;  4GTY A;  1N2K A;  3CMR A;  3IDD A;  1ALH A;  1ALK A;  3WAV A;  3SZY A;  4NWJ A;  4CXU A;  1K7H A;  1ALJ A;  5K4P A;  1KH9 A;  4MIV A;  1HQA A;  3Q3Q A;  4FDI A;  3WAX A;  5EGH A;  3ED4 A;  5L0K A;  5L0E A;  4KJD A;  2W5T A;  3NKP A;  5LIA A;  2W5R A;  1E2S P;  1ZED A;  4NWX A;  4CXK A;  1KHJ A;  1EJJ A;  1O99 A;  1URA A;  3LXQ A;  4UPH A;  1ED8 A;  1O98 A;  1KH7 A;  1EQJ A;  1HDH A;  2GLQ A;  3IGY B;  2XRG A;  3BDG B;  3T02 A;  3SZZ A;  3NKO A;  3M8Y A;  3BDG A;  5AJ9 A;  1EW9 A;  3MK1 A;  3NVL A;  4UOO A;  3NKN A;  3UN3 A;  1SHQ A;  4UPL A;  1EW2 A;  5C66 A;  3WBH A;  4CXS A;  5DLT A;  1AJC A;  1FSU A;  3WAY A;  1N2L A;  3NKR A;  2W5W A;  5GOV A;  4YR1 A;  1KHN A;  4B56 A;  3NKM A;  4KAV A;  4LR2 A;  3UN2 A;  2XR9 A;  1AJD A;  2GSN A;  2X98 A;  4LRD A;  3MK0 A;  1KH5 A;  5L0B A;  4GTZ A;  4CYR A;  4UOR A;  3DPC A;  3TWZ A;  1AJB A;  4TN0 A;  2W8S A;  1ELY A;  3BDH A;  4GTX A;  4LR9 A;  3T00 A;  1ELZ A;  1P49 A;  5HRT A;  1ZEB A;  3NKQ A;  4GTW A;  1ELX A;  4LQY A;  1SHN A;  2VQR A;  3BDF A;  1KHK A;  3E2D A;  5EGE A;  5DLV A;  4N7T A;  1ZEF A;  2W5V A;  1E1Z P;  3M7V A;  4KJG A;  3M8Z A;  1HJK A;  4KAY A;  1E3C P;  1EI6 A;  3B5Q A;  2W8D A;  4LRB A;  2W5X A;  5INH A;  2IUC B;  3A52 A;  5LRM A;  1E33 P;  2GA3 A;  4LRE A;  2W5Q A;  1AUK A;  1ANI A;  2ANH A;  3IGZ B;  1B8J A;  1ED9 A;  1Y6V A;  4QAX A;  5LQQ A;  1ALI A;  2RH6 A;  4UPK A;  2GSO A;  3T01 A;  4UPI A;  1ANJ A;  4FDJ A;  3UO0 A;  3UNY A;  5LRN A;  5TJ3 A;  3TG0 A;  2ZKT A;  2D1G A;  4MHX A;  1Y7A A;  3TX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...