3T00A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with vanadate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
b'MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t00A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t00A01
3IGYB 3WAXA 3WAWA 4LR7A 3M8ZA 4UPIA 1ALJA 4UOOA 2W5RA 4NWJA 3WAVA 3Q3QA 1AJBA 1N2KA 1E33P 1O98A 1B8JA 4CYRA 3MK1A 4LRBA 1URBA 1KH7A 3DPCA 1EQJA 2XRGA 1ALKA 2IFYA 5LIAA 2D1GA 4LRFA 4FDJA 4CXKA 1K7HA 2GA3A 1KHLA 2W5SA 3M8YA 3BDHA 3LXQA 4LREA 1EI6A 1ALHA 4GTWA 2GSUA 5AJ9A 5K4PA 5GRRA 5HRTA 1ANJA 1ZEFA 3TWZA 3M7VA 5GOVA 4B56A 1KHJA 5EGHA 3NKMA 3MK0A 4CXSA 3MK2A 3NKRA 3CMRA 4MIVA 5IJQA 3OT9A 3T00A 2W5VA 3T02A 3NVLA 4KJDA 3A52A 1ED8A 3TX0A 2W5XA 2GSNA 1KHNA 1KHKA 2ZKTA 4UPHA 4ZG7A 5IJSA 5LRMA 1O99A 4ZGAA 1N2LA 1Y7AA 2GLQA 4KAVA 1AJDA 1P49A 4KJGA 2RH6A 4N7TA 2W5WA 4KAYA 2ANHA 5L0KA 4UOPA 5C66A 4ZG6A 2XR9A 4UPKA 3NKPA 4GTXA 3DYCA 2W5QA 1ZEBA 1AUKA 5DLWA 3SZYA 3T01A 1EW2A 5DLTA 3IGZB 4ZG9A 1AJCA 2VQRA 4YR1A 5LRNA 4NWXA 3B5QA 3SZZA 1KH4A 4TN0A 3ED4A 5EGEA 4GTZA 4QAXA 3TG0A 4LR9A 1Y6VA 1FSUA 4LR8A 1EW9A 1HDHA 1SHNA 1E2SP 2GSOA 3UO0A 1URAA 3BDGB 4GTYA 4LRCA 3UN5A 2IUCB 4CYSA 3BDGA 3NKOA 4KM4A 5INHA 5DLVA 4LR2A 2IUCA 3WBHA 1ELXA 5LQQA 3NKQA 4CXUA 4LRDA 2W8DA 4LRAA 2X98A 1ANIA 1KH5A 2W8SA 1EJJA 2QZUA 3M8WA 1ZEDA 1HQAA 1ELZA 3IDDA 5L0EA 1AJAA 1ED9A 5KXAA 1KH9A 1ELYA 3UN3A 3UNYA 1E3CP 1HJKA 4MY4A 3E2DA 3NKNA 4UORA 1E1ZP 4MHXA 5TJ3A 3UN2A 3WAYA 2G9YA 5L0BA 1SHQA 3BDFA 4UPLA 1ALIA 2W5TA 4FDIA 1EW8A 3KD8A 4LQYA
chains in the Genus database with same CATH superfamily
2O5IA 3IGYB 2NVYC 3WAXA 5C4JC 2V6SA 1ALJA 4UOOA 3S0XA 3S2DC 2JA5A 1USOA 3GTKK 1E33P 4GTEA 4A3GK 4LRBA 3DPCA 1KH7A 1EQJA 1ALKA 3LPXA 4LRFA 1XXAA 2A6EA 4KC6A 4BLBA 1K83K 1KHLA 3CAGA 3H0GA 3S17K 4A3KC 1Y1WA 2W5SA 3M8YA 4LREA 3HOYK 3QX3A 4O2DA 4BKWA 1ZEFA 3TWZA 4KATA 3HOUC 3HOWK 3I4NK 2R7ZK 3M3YC 3MK0A 4CXSA 1PJ5A 3N3YA 1IW7A 3CMRA 2WAQD 5IORA 3S1QK 4MIVA 2A68A 3S1NK 5IJQA 3L4JA 3OT9A 3GTLK 3GTGC 5M5XK 2R92K 3S16K 4LJZA 4A93C 3TX0A 2JA8C 4QJVB 2W5XA 2ZKTA 4UPHA 5IJSA 4KASA 1VLOA 4GFQA 1O99A 1XZQB 2E2JK 2JA7A 3JSTA 3S1RC 5FLMK 2V6TA 1AJDA 3PO2K 4LLGA 2JA6K 1G51A 1JOEA 3FKIA 4UOPA 1R9TC 5C66A 3S14K 3ERED 3GTJA 1XPPA 1IL2A 3VA7A 3N0CA 4A3DC 3GEIA 3GDZA 1EW2A 3T01A 1X31C 3IGZB 4P5BA 2VQRA 5LRNA 4P5AA 5L46A 3GTPA 4J3NA 3SZZA 2O5JA 4TN0A 3ED4A 5TMCA 4C2MC 1HDHA 3UO0A 1URAA 2PA8D 1DD5A 3TTGA 3AD7C 5IYCK 3HKZD 4LK1A 5DLVA 2IUCA 3WBHA 4Y52C 2Y0SL 3MMLB 1L0WA 1IE0A 2D6FC 3N0BA 3OREA 2B63K 1IBAA 1Y1VC 1EJJA 4A3MK 5C44C 3RZOK 3GTKA 1HQAA 3S2HK 5L0EA 1AJAA 2PHCB 4P9SA 3AQPA 3LAPA 1K83A 2EBBA 4BY1K 2R93K 1DCOA 1E1ZP 4C3JK 2NVQC 1TWFK 3WODA 1EH1A 1TWAK 4KMUA 3ADAC 3HOVK 2YU9K 4KAWX 4UPLA 2V6UA 4C3HC 4BBSK 3LXQA 3KD8A 2E2HC 3HOZC 2R7ZA 4QIWL 4ZGAA 3S15C 2JA7K 3I4MC 3GTOA 3H0GC 3WAWA 3RZDK 1Y1WC 4A3LC 1I6VA 4UPIA 1VH2A 4GZYA 4AYBD 1I50K 2WAQL 5IYBC 2W5RA 4NWJA 3GSIA 3Q3QA 1B8JA 4XSXA 2XRGA 5LIAA 3FOEA 4A3FK 1TWGK 3CQZK 4CXKA 1K7HA 5JFEA 1AB4A 5IP7K 3G4AA 1EI6A 4BBRC 1TWHK 2GSUA 1ZBSA 1WCMC 2WB1L 5C4JK 5AJ9A 1ANJA 2JA6A 5IYDC 2CW0A 3DXJA 3M7VA 2NVXA 4ILDA 1KHJA 3NKRA 4A3IC 3V4GA 1YX2A 1SMYA 4C3IK 2W5VA 3FKIC 1XZPB 3GTJC 1HI9A 4A3EC 4GTCA 3GTMA 3HOXK 1KHKA 5LRMA 2VUMK 3GTQA 4BXXK 4QJVA 2PA8L 3AD8C 2FQOA 4KMHA 1XZQA 3HKZL 4XSZA 4MEXA 1I6HC 1Y7AA 2GLQA 2B63A 4OIRA 4KJGA 4N7TA 1KQ4A 2W5WA 4KDDA 4KB2A 4KAYA 3GTGK 5FJ8K 2W5QA 3DYCA 4NOIA 1ZEBA 5M3MK 3GTOK 1ISEA 4G0UA 3LAJA 2R93A 3B5QA 5C3EC 4KN7A 1KH4A 5EGEA 4QAXA 1TWFA 3TG0A 2GAGC 1EK8A 1VJEA 1TWAA 3EQLA 4LR9A 1TWCC 2PMZD 1SHNA 4LR8A 1DCHA 2YU9A 4G7ZA 3GTKC 1R9TK 4LRCA 4CYSA 3BP8C 1C0AA 3NKOA 5INHA 1K83C 1ELXA 4KM8A 3S17C 4LRDA 2W8DA 3HOYC 1ANIA 1WSRA 3AD9C 2W8SA 1I50A 4MQ9A 2NVXK 2FQTA 1O24A 1YNJA 1ZVUA 4DDQA 3M8WA 1J6XA 3HOWC 4GTBA 2R7ZC 3I4NC 3IDDA 2W7VA 5TMFA 5KXAA 4A3BK 1ELYA 3UN3A 1TWGA 3CQZA 4XLNA 4Q4ZA 3PO3K 1HJKA 4MY4A 3S1MK 3S1QC 3NKNA 4A3JK 1I3QC 1WQHA 1IQ0A 1TWHA 4ZH4A 1WQFA 3GTLC 5M5YK 3H3VD 3UN2A 2R92C 5CHPA 3GTMK 2NVTK 2RGRA 3BDFA 1Y1VK 4WJ3M 3GTQK 4FDIA 2W5TA 1BJTA 5C44K 1WIHA 1VRQC 4Q5SA 1HQMA 1EW8A 5C4XC 2E2JC 1SFOK 1WORA 2Y3PA 4LR7A 3BP3A 5FLMC 3M8ZA 4LK0A 4Y7NC 5HL8A 3PO2C 1JVIA 2NVQK 2E2IC 1AJBA 3K7AK 5M5WK 4WJ4A 3MK1A 2IFYA 1O2BA 1WOOA 2VUMA 2D1GA 3L4KA 2E2HK 4G0VA 3HOZK 3A8IA 3FOFA 1VGXA 1JQWA 3AH5A 3OEPA 3TFJA 3I4MK 2JA5C 2XCOA 5HRTA 2PPBA 1YNNA 4GT9A 4OIQA 5GOVA 3GTGA 5IYCC 2A6HA 5EGHA 4A3CK 2GAHC 3AQOA 4BY7K 4OIOA 3T00A 4KARA 1WOPA 4A3MC 3NVLA 4KJDA 5IP9K 1XZPA 2CFAA 1KHNA 3HXAA 2PMZL 1R9TA 5CJ9A 4X6AC 4GTFA 1ZXOA 2NVYK 3GIRA 4BY1C 3FHZA 1F7VA 4C3JC 3S2DK 5L0KA 2YU9C 3M4OC 2XR9A 4UPKA 4GTXA 1YCLA 3IPJA 4OINA 4BBSC 4GTDA 5DLWA 3SZYA 5DLTA 2JA7C 4ZG9A 1INNA 1EFWA 4C45A 4KMDA 4A3KK 1I6HK 2CFAB 1I50C 1BGWA 1FSUA 1EW9A 1E2SP 3BDGB 1Y1VA 5IOQA 3HOUK 4KM4A 4A3FC 4XLPA 3M3YK 1WSVA 4GTLA 3GTPC 3CQZC 1SFOA 1PJ6A 5IP7C 1TWHC 1J6VA 5C3EK 1KH5A 4JK1A 1TWCK 4A93K 1ZEDA 2JA8K 1O2AA 1KH9A 3BUEA 3A8JA 2E2HA 4KM9A 2P5MA 1E3CP 3E2DA 3S1RK 4C3IC 3WAYA 4A3GC 5L0BA 1SHQA 4QIWD 3HOXC 1ALIA 5IOTA 4A3DK 1ED8A 2P8TA 2VUMC 4BXXC 3A8KA 4GTAA 5E68A 3G4CA 1I3QK 1GE9A 4C2MK 4AYBL 3WAVA 1WCMA 1N2KA 1DCPA 1O98A 1EQRA 4CYRA 1URBA 3GTOC 1O29A 1ZYRA 4FDJA 2NVYA 3S1NC 4Y52K 5C4XK 1O26A 2GA3A 1J6WA 4YFNA 4AH6A 1XXCA 2WB1D 4YFXA 3BDHA 1ALHA 4GTWA 3S16C 5K4PA 5GRRA 4Y7NK 4M1XA 4KN4A 2E2IK 1F9NA 4B56A 4RMFA 3NKMA 4KB4A 3MK2A 1WQGA 2A69A 1ZQ1C 4YFKA 5JVOA 4XCHA 2ZUFA 2JA6C 1O2FB 2XCQA 1B4AA 5D4DA 5M3FK 3S14C 3T02A 2NVXC 2JA5K 3A52A 4G7OA 2KWAA 2XCRB 1V5VA 4C3HK 2GSNA 3TFHA 4ZG7A 3TFIA 1IS1A 4A3BC 3S15K 1J98A 1N2LA 3PO3C 3S1MC 3H0GK 4A3JC 1PJ7A 1Y1WK 4A3LK 1BS2A 4KAVA 1P49A 2RH6A 4KMAA 1O25A 2ANHA 5IYBK 3GTMC 4OIPA 2NVTC 4ZG6A 1B4BA 3GTQC 1TWCA 3NKPA 1F93A 1AUKA 4YG2A 4G0WA 1WOSA 1SFOC 4MEYA 4X6AK 1AJCA 4YR1A 2B63C 4NWXA 3OPFA 4GTZA 1F7UA 3NUHA 4BBRK 1XXBA 1WCMK 3RZOC 1Y6VA 4LOWA 4FM9A 5IYDK 1RU0A 2GSOA 3K7AC 3S2HC 5IOSA 4PABA 3M4OK 4GTYA 3UN5A 2IUCB 3BDGA 1UV7A 2R93C 4LR2A 2ZFZA 4A3IK 5LQQA 1TWFC 3NKQA 4CXUA 1TWAC 1USMA 2BE5A 4LRAA 2X98A 3HOVC 1I3QA 3FKIK 2QZUA 4WILA 3GTLA 3GTJK 4A3EK 2R92A 1O28A 1ELZA 4A3CC 1ED9A 1BDFA 1O27A 3RZDC 3UNYA 4FZBA 4BY7C 3GTPK 4PAAA 2ZUEA 4UORA 3GEHA 5TJ3A 4MHXA 4G7HA 2G9YA 3H3VL 2JH3A 5IP9C 3GEEA 2Y0SD 2E2IA 4BLAA 1TWGC 4LQYA
chains in the Genus database with same CATH topology
3IGYB 3WAXA 3WAWA 4LR7A 3M8ZA 4UPIA 1ALJA 4UOOA 2W5RA 4NWJA 3WAVA 3Q3QA 1AJBA 1N2KA 1E33P 1O98A 1B8JA 4CYRA 3MK1A 4LRBA 1URBA 1KH7A 3DPCA 1EQJA 2XRGA 1ALKA 2IFYA 5LIAA 2D1GA 4LRFA 4FDJA 4CXKA 1K7HA 2GA3A 1KHLA 2W5SA 3M8YA 3BDHA 3LXQA 4LREA 1EI6A 1ALHA 4GTWA 2GSUA 5AJ9A 5K4PA 5GRRA 5HRTA 1ANJA 1ZEFA 3TWZA 3M7VA 5GOVA 4B56A 1KHJA 5EGHA 3NKMA 3MK0A 4CXSA 3MK2A 3NKRA 3CMRA 4MIVA 5IJQA 3OT9A 3T00A 2W5VA 3T02A 3NVLA 4KJDA 3A52A 1ED8A 3TX0A 2W5XA 2GSNA 1KHNA 1KHKA 2ZKTA 4UPHA 4ZG7A 5IJSA 5LRMA 1O99A 4ZGAA 1N2LA 1Y7AA 2GLQA 4KAVA 1AJDA 1P49A 4KJGA 2RH6A 4N7TA 2W5WA 4KAYA 2ANHA 5L0KA 4UOPA 5C66A 4ZG6A 2XR9A 4UPKA 3NKPA 4GTXA 3DYCA 2W5QA 1ZEBA 1AUKA 5DLWA 3SZYA 3T01A 1EW2A 5DLTA 3IGZB 4ZG9A 1AJCA 2VQRA 4YR1A 5LRNA 4NWXA 3B5QA 3SZZA 1KH4A 4TN0A 3ED4A 5EGEA 4GTZA 4QAXA 3TG0A 4LR9A 1Y6VA 1FSUA 4LR8A 1EW9A 1HDHA 1SHNA 1E2SP 2GSOA 3UO0A 1URAA 3BDGB 4GTYA 4LRCA 3UN5A 2IUCB 4CYSA 3BDGA 3NKOA 4KM4A 5INHA 5DLVA 4LR2A 2IUCA 3WBHA 1ELXA 5LQQA 3NKQA 4CXUA 4LRDA 2W8DA 4LRAA 2X98A 1ANIA 1KH5A 2W8SA 1EJJA 2QZUA 3M8WA 1ZEDA 1HQAA 1ELZA 3IDDA 5L0EA 1AJAA 1ED9A 5KXAA 1KH9A 1ELYA 3UN3A 3UNYA 1E3CP 1HJKA 4MY4A 3E2DA 3NKNA 4UORA 1E1ZP 4MHXA 5TJ3A 3UN2A 3WAYA 2G9YA 5L0BA 1SHQA 3BDFA 4UPLA 1ALIA 2W5TA 4FDIA 1EW8A 3KD8A 4LQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IGY B;  3WAX A;  3WAW A;  4LR7 A;  3M8Z A;  4UPI A;  1ALJ A;  4UOO A;  2W5R A;  4NWJ A;  3WAV A;  3Q3Q A;  1AJB A;  1N2K A;  1E33 P;  1O98 A;  1B8J A;  4CYR A;  3MK1 A;  4LRB A;  1URB A;  1KH7 A;  3DPC A;  1EQJ A;  2XRG A;  1ALK A;  2IFY A;  5LIA A;  2D1G A;  4LRF A;  4FDJ A;  4CXK A;  1K7H A;  2GA3 A;  1KHL A;  2W5S A;  3M8Y A;  3BDH A;  3LXQ A;  4LRE A;  1EI6 A;  1ALH A;  4GTW A;  2GSU A;  5AJ9 A;  5K4P A;  5GRR A;  5HRT A;  1ANJ A;  1ZEF A;  3TWZ A;  3M7V A;  5GOV A;  4B56 A;  1KHJ A;  5EGH A;  3NKM A;  3MK0 A;  4CXS A;  3MK2 A;  3NKR A;  3CMR A;  4MIV A;  5IJQ A;  3OT9 A;  3T00 A;  2W5V A;  3T02 A;  3NVL A;  4KJD A;  3A52 A;  1ED8 A;  3TX0 A;  2W5X A;  2GSN A;  1KHN A;  1KHK A;  2ZKT A;  4UPH A;  4ZG7 A;  5IJS A;  5LRM A;  1O99 A;  4ZGA A;  1N2L A;  1Y7A A;  2GLQ A;  4KAV A;  1AJD A;  1P49 A;  4KJG A;  2RH6 A;  4N7T A;  2W5W A;  4KAY A;  2ANH A;  5L0K A;  4UOP A;  5C66 A;  4ZG6 A;  2XR9 A;  4UPK A;  3NKP A;  4GTX A;  3DYC A;  2W5Q A;  1ZEB A;  1AUK A;  5DLW A;  3SZY A;  3T01 A;  1EW2 A;  5DLT A;  3IGZ B;  4ZG9 A;  1AJC A;  2VQR A;  4YR1 A;  5LRN A;  4NWX A;  3B5Q A;  3SZZ A;  1KH4 A;  4TN0 A;  3ED4 A;  5EGE A;  4GTZ A;  4QAX A;  3TG0 A;  4LR9 A;  1Y6V A;  1FSU A;  4LR8 A;  1EW9 A;  1HDH A;  1SHN A;  1E2S P;  2GSO A;  3UO0 A;  1URA A;  3BDG B;  4GTY A;  4LRC A;  3UN5 A;  2IUC B;  4CYS A;  3BDG A;  3NKO A;  4KM4 A;  5INH A;  5DLV A;  4LR2 A;  2IUC A;  3WBH A;  1ELX A;  5LQQ A;  3NKQ A;  4CXU A;  4LRD A;  2W8D A;  4LRA A;  2X98 A;  1ANI A;  1KH5 A;  2W8S A;  1EJJ A;  2QZU A;  3M8W A;  1ZED A;  1HQA A;  1ELZ A;  3IDD A;  5L0E A;  1AJA A;  1ED9 A;  5KXA A;  1KH9 A;  1ELY A;  3UN3 A;  3UNY A;  1E3C P;  1HJK A;  4MY4 A;  3E2D A;  3NKN A;  4UOR A;  1E1Z P;  4MHX A;  5TJ3 A;  3UN2 A;  3WAY A;  2G9Y A;  5L0B A;  1SHQ A;  3BDF A;  4UPL A;  1ALI A;  2W5T A;  4FDI A;  1EW8 A;  3KD8 A;  4LQY A; 
#chains in the Genus database with same CATH topology
 2O5I A;  3IGY B;  2NVY C;  3WAX A;  5C4J C;  2V6S A;  1ALJ A;  4UOO A;  3S0X A;  3S2D C;  2JA5 A;  1USO A;  3GTK K;  1E33 P;  4GTE A;  4A3G K;  4LRB A;  3DPC A;  1KH7 A;  1EQJ A;  1ALK A;  3LPX A;  4LRF A;  1XXA A;  2A6E A;  4KC6 A;  4BLB A;  1K83 K;  1KHL A;  3CAG A;  3H0G A;  3S17 K;  4A3K C;  1Y1W A;  2W5S A;  3M8Y A;  4LRE A;  3HOY K;  3QX3 A;  4O2D A;  4BKW A;  1ZEF A;  3TWZ A;  4KAT A;  3HOU C;  3HOW K;  3I4N K;  2R7Z K;  3M3Y C;  3MK0 A;  4CXS A;  1PJ5 A;  3N3Y A;  1IW7 A;  3CMR A;  2WAQ D;  5IOR A;  3S1Q K;  4MIV A;  2A68 A;  3S1N K;  5IJQ A;  3L4J A;  3OT9 A;  3GTL K;  3GTG C;  5M5X K;  2R92 K;  3S16 K;  4LJZ A;  4A93 C;  3TX0 A;  2JA8 C;  4QJV B;  2W5X A;  2ZKT A;  4UPH A;  5IJS A;  4KAS A;  1VLO A;  4GFQ A;  1O99 A;  1XZQ B;  2E2J K;  2JA7 A;  3JST A;  3S1R C;  5FLM K;  2V6T A;  1AJD A;  3PO2 K;  4LLG A;  2JA6 K;  1G51 A;  1JOE A;  3FKI A;  4UOP A;  1R9T C;  5C66 A;  3S14 K;  3ERE D;  3GTJ A;  1XPP A;  1IL2 A;  3VA7 A;  3N0C A;  4A3D C;  3GEI A;  3GDZ A;  1EW2 A;  3T01 A;  1X31 C;  3IGZ B;  4P5B A;  2VQR A;  5LRN A;  4P5A A;  5L46 A;  3GTP A;  4J3N A;  3SZZ A;  2O5J A;  4TN0 A;  3ED4 A;  5TMC A;  4C2M C;  1HDH A;  3UO0 A;  1URA A;  2PA8 D;  1DD5 A;  3TTG A;  3AD7 C;  5IYC K;  3HKZ D;  4LK1 A;  5DLV A;  2IUC A;  3WBH A;  4Y52 C;  2Y0S L;  3MML B;  1L0W A;  1IE0 A;  2D6F C;  3N0B A;  3ORE A;  2B63 K;  1IBA A;  1Y1V C;  1EJJ A;  4A3M K;  5C44 C;  3RZO K;  3GTK A;  1HQA A;  3S2H K;  5L0E A;  1AJA A;  2PHC B;  4P9S A;  3AQP A;  3LAP A;  1K83 A;  2EBB A;  4BY1 K;  2R93 K;  1DCO A;  1E1Z P;  4C3J K;  2NVQ C;  1TWF K;  3WOD A;  1EH1 A;  1TWA K;  4KMU A;  3ADA C;  3HOV K;  2YU9 K;  4KAW X;  4UPL A;  2V6U A;  4C3H C;  4BBS K;  3LXQ A;  3KD8 A;  2E2H C;  3HOZ C;  2R7Z A;  4QIW L;  4ZGA A;  3S15 C;  2JA7 K;  3I4M C;  3GTO A;  3H0G C;  3WAW A;  3RZD K;  1Y1W C;  4A3L C;  1I6V A;  4UPI A;  1VH2 A;  4GZY A;  4AYB D;  1I50 K;  2WAQ L;  5IYB C;  2W5R A;  4NWJ A;  3GSI A;  3Q3Q A;  1B8J A;  4XSX A;  2XRG A;  5LIA A;  3FOE A;  4A3F K;  1TWG K;  3CQZ K;  4CXK A;  1K7H A;  5JFE A;  1AB4 A;  5IP7 K;  3G4A A;  1EI6 A;  4BBR C;  1TWH K;  2GSU A;  1ZBS A;  1WCM C;  2WB1 L;  5C4J K;  5AJ9 A;  1ANJ A;  2JA6 A;  5IYD C;  2CW0 A;  3DXJ A;  3M7V A;  2NVX A;  4ILD A;  1KHJ A;  3NKR A;  4A3I C;  3V4G A;  1YX2 A;  1SMY A;  4C3I K;  2W5V A;  3FKI C;  1XZP B;  3GTJ C;  1HI9 A;  4A3E C;  4GTC A;  3GTM A;  3HOX K;  1KHK A;  5LRM A;  2VUM K;  3GTQ A;  4BXX K;  4QJV A;  2PA8 L;  3AD8 C;  2FQO A;  4KMH A;  1XZQ A;  3HKZ L;  4XSZ A;  4MEX A;  1I6H C;  1Y7A A;  2GLQ A;  2B63 A;  4OIR A;  4KJG A;  4N7T A;  1KQ4 A;  2W5W A;  4KDD A;  4KB2 A;  4KAY A;  3GTG K;  5FJ8 K;  2W5Q A;  3DYC A;  4NOI A;  1ZEB A;  5M3M K;  3GTO K;  1ISE A;  4G0U A;  3LAJ A;  2R93 A;  3B5Q A;  5C3E C;  4KN7 A;  1KH4 A;  5EGE A;  4QAX A;  1TWF A;  3TG0 A;  2GAG C;  1EK8 A;  1VJE A;  1TWA A;  3EQL A;  4LR9 A;  1TWC C;  2PMZ D;  1SHN A;  4LR8 A;  1DCH A;  2YU9 A;  4G7Z A;  3GTK C;  1R9T K;  4LRC A;  4CYS A;  3BP8 C;  1C0A A;  3NKO A;  5INH A;  1K83 C;  1ELX A;  4KM8 A;  3S17 C;  4LRD A;  2W8D A;  3HOY C;  1ANI A;  1WSR A;  3AD9 C;  2W8S A;  1I50 A;  4MQ9 A;  2NVX K;  2FQT A;  1O24 A;  1YNJ A;  1ZVU A;  4DDQ A;  3M8W A;  1J6X A;  3HOW C;  4GTB A;  2R7Z C;  3I4N C;  3IDD A;  2W7V A;  5TMF A;  5KXA A;  4A3B K;  1ELY A;  3UN3 A;  1TWG A;  3CQZ A;  4XLN A;  4Q4Z A;  3PO3 K;  1HJK A;  4MY4 A;  3S1M K;  3S1Q C;  3NKN A;  4A3J K;  1I3Q C;  1WQH A;  1IQ0 A;  1TWH A;  4ZH4 A;  1WQF A;  3GTL C;  5M5Y K;  3H3V D;  3UN2 A;  2R92 C;  5CHP A;  3GTM K;  2NVT K;  2RGR A;  3BDF A;  1Y1V K;  4WJ3 M;  3GTQ K;  4FDI A;  2W5T A;  1BJT A;  5C44 K;  1WIH A;  1VRQ C;  4Q5S A;  1HQM A;  1EW8 A;  5C4X C;  2E2J C;  1SFO K;  1WOR A;  2Y3P A;  4LR7 A;  3BP3 A;  5FLM C;  3M8Z A;  4LK0 A;  4Y7N C;  5HL8 A;  3PO2 C;  1JVI A;  2NVQ K;  2E2I C;  1AJB A;  3K7A K;  5M5W K;  4WJ4 A;  3MK1 A;  2IFY A;  1O2B A;  1WOO A;  2VUM A;  2D1G A;  3L4K A;  2E2H K;  4G0V A;  3HOZ K;  3A8I A;  3FOF A;  1VGX A;  1JQW A;  3AH5 A;  3OEP A;  3TFJ A;  3I4M K;  2JA5 C;  2XCO A;  5HRT A;  2PPB A;  1YNN A;  4GT9 A;  4OIQ A;  5GOV A;  3GTG A;  5IYC C;  2A6H A;  5EGH A;  4A3C K;  2GAH C;  3AQO A;  4BY7 K;  4OIO A;  3T00 A;  4KAR A;  1WOP A;  4A3M C;  3NVL A;  4KJD A;  5IP9 K;  1XZP A;  2CFA A;  1KHN A;  3HXA A;  2PMZ L;  1R9T A;  5CJ9 A;  4X6A C;  4GTF A;  1ZXO A;  2NVY K;  3GIR A;  4BY1 C;  3FHZ A;  1F7V A;  4C3J C;  3S2D K;  5L0K A;  2YU9 C;  3M4O C;  2XR9 A;  4UPK A;  4GTX A;  1YCL A;  3IPJ A;  4OIN A;  4BBS C;  4GTD A;  5DLW A;  3SZY A;  5DLT A;  2JA7 C;  4ZG9 A;  1INN A;  1EFW A;  4C45 A;  4KMD A;  4A3K K;  1I6H K;  2CFA B;  1I50 C;  1BGW A;  1FSU A;  1EW9 A;  1E2S P;  3BDG B;  1Y1V A;  5IOQ A;  3HOU K;  4KM4 A;  4A3F C;  4XLP A;  3M3Y K;  1WSV A;  4GTL A;  3GTP C;  3CQZ C;  1SFO A;  1PJ6 A;  5IP7 C;  1TWH C;  1J6V A;  5C3E K;  1KH5 A;  4JK1 A;  1TWC K;  4A93 K;  1ZED A;  2JA8 K;  1O2A A;  1KH9 A;  3BUE A;  3A8J A;  2E2H A;  4KM9 A;  2P5M A;  1E3C P;  3E2D A;  3S1R K;  4C3I C;  3WAY A;  4A3G C;  5L0B A;  1SHQ A;  4QIW D;  3HOX C;  1ALI A;  5IOT A;  4A3D K;  1ED8 A;  2P8T A;  2VUM C;  4BXX C;  3A8K A;  4GTA A;  5E68 A;  3G4C A;  1I3Q K;  1GE9 A;  4C2M K;  4AYB L;  3WAV A;  1WCM A;  1N2K A;  1DCP A;  1O98 A;  1EQR A;  4CYR A;  1URB A;  3GTO C;  1O29 A;  1ZYR A;  4FDJ A;  2NVY A;  3S1N C;  4Y52 K;  5C4X K;  1O26 A;  2GA3 A;  1J6W A;  4YFN A;  4AH6 A;  1XXC A;  2WB1 D;  4YFX A;  3BDH A;  1ALH A;  4GTW A;  3S16 C;  5K4P A;  5GRR A;  4Y7N K;  4M1X A;  4KN4 A;  2E2I K;  1F9N A;  4B56 A;  4RMF A;  3NKM A;  4KB4 A;  3MK2 A;  1WQG A;  2A69 A;  1ZQ1 C;  4YFK A;  5JVO A;  4XCH A;  2ZUF A;  2JA6 C;  1O2F B;  2XCQ A;  1B4A A;  5D4D A;  5M3F K;  3S14 C;  3T02 A;  2NVX C;  2JA5 K;  3A52 A;  4G7O A;  2KWA A;  2XCR B;  1V5V A;  4C3H K;  2GSN A;  3TFH A;  4ZG7 A;  3TFI A;  1IS1 A;  4A3B C;  3S15 K;  1J98 A;  1N2L A;  3PO3 C;  3S1M C;  3H0G K;  4A3J C;  1PJ7 A;  1Y1W K;  4A3L K;  1BS2 A;  4KAV A;  1P49 A;  2RH6 A;  4KMA A;  1O25 A;  2ANH A;  5IYB K;  3GTM C;  4OIP A;  2NVT C;  4ZG6 A;  1B4B A;  3GTQ C;  1TWC A;  3NKP A;  1F93 A;  1AUK A;  4YG2 A;  4G0W A;  1WOS A;  1SFO C;  4MEY A;  4X6A K;  1AJC A;  4YR1 A;  2B63 C;  4NWX A;  3OPF A;  4GTZ A;  1F7U A;  3NUH A;  4BBR K;  1XXB A;  1WCM K;  3RZO C;  1Y6V A;  4LOW A;  4FM9 A;  5IYD K;  1RU0 A;  2GSO A;  3K7A C;  3S2H C;  5IOS A;  4PAB A;  3M4O K;  4GTY A;  3UN5 A;  2IUC B;  3BDG A;  1UV7 A;  2R93 C;  4LR2 A;  2ZFZ A;  4A3I K;  5LQQ A;  1TWF C;  3NKQ A;  4CXU A;  1TWA C;  1USM A;  2BE5 A;  4LRA A;  2X98 A;  3HOV C;  1I3Q A;  3FKI K;  2QZU A;  4WIL A;  3GTL A;  3GTJ K;  4A3E K;  2R92 A;  1O28 A;  1ELZ A;  4A3C C;  1ED9 A;  1BDF A;  1O27 A;  3RZD C;  3UNY A;  4FZB A;  4BY7 C;  3GTP K;  4PAA A;  2ZUE A;  4UOR A;  3GEH A;  5TJ3 A;  4MHX A;  4G7H A;  2G9Y A;  3H3V L;  2JH3 A;  5IP9 C;  3GEE A;  2Y0S D;  2E2I A;  4BLA A;  1TWG C;  4LQY A; 
#chains in the Genus database with same CATH homology
 3IGY B;  3WAX A;  3WAW A;  4LR7 A;  3M8Z A;  4UPI A;  1ALJ A;  4UOO A;  2W5R A;  4NWJ A;  3WAV A;  3Q3Q A;  1AJB A;  1N2K A;  1E33 P;  1O98 A;  1B8J A;  4CYR A;  3MK1 A;  4LRB A;  1URB A;  1KH7 A;  3DPC A;  1EQJ A;  2XRG A;  1ALK A;  2IFY A;  5LIA A;  2D1G A;  4LRF A;  4FDJ A;  4CXK A;  1K7H A;  2GA3 A;  1KHL A;  2W5S A;  3M8Y A;  3BDH A;  3LXQ A;  4LRE A;  1EI6 A;  1ALH A;  4GTW A;  2GSU A;  5AJ9 A;  5K4P A;  5GRR A;  5HRT A;  1ANJ A;  1ZEF A;  3TWZ A;  3M7V A;  5GOV A;  4B56 A;  1KHJ A;  5EGH A;  3NKM A;  3MK0 A;  4CXS A;  3MK2 A;  3NKR A;  3CMR A;  4MIV A;  5IJQ A;  3OT9 A;  3T00 A;  2W5V A;  3T02 A;  3NVL A;  4KJD A;  3A52 A;  1ED8 A;  3TX0 A;  2W5X A;  2GSN A;  1KHN A;  1KHK A;  2ZKT A;  4UPH A;  4ZG7 A;  5IJS A;  5LRM A;  1O99 A;  4ZGA A;  1N2L A;  1Y7A A;  2GLQ A;  4KAV A;  1AJD A;  1P49 A;  4KJG A;  2RH6 A;  4N7T A;  2W5W A;  4KAY A;  2ANH A;  5L0K A;  4UOP A;  5C66 A;  4ZG6 A;  2XR9 A;  4UPK A;  3NKP A;  4GTX A;  3DYC A;  2W5Q A;  1ZEB A;  1AUK A;  5DLW A;  3SZY A;  3T01 A;  1EW2 A;  5DLT A;  3IGZ B;  4ZG9 A;  1AJC A;  2VQR A;  4YR1 A;  5LRN A;  4NWX A;  3B5Q A;  3SZZ A;  1KH4 A;  4TN0 A;  3ED4 A;  5EGE A;  4GTZ A;  4QAX A;  3TG0 A;  4LR9 A;  1Y6V A;  1FSU A;  4LR8 A;  1EW9 A;  1HDH A;  1SHN A;  1E2S P;  2GSO A;  3UO0 A;  1URA A;  3BDG B;  4GTY A;  4LRC A;  3UN5 A;  2IUC B;  4CYS A;  3BDG A;  3NKO A;  4KM4 A;  5INH A;  5DLV A;  4LR2 A;  2IUC A;  3WBH A;  1ELX A;  5LQQ A;  3NKQ A;  4CXU A;  4LRD A;  2W8D A;  4LRA A;  2X98 A;  1ANI A;  1KH5 A;  2W8S A;  1EJJ A;  2QZU A;  3M8W A;  1ZED A;  1HQA A;  1ELZ A;  3IDD A;  5L0E A;  1AJA A;  1ED9 A;  5KXA A;  1KH9 A;  1ELY A;  3UN3 A;  3UNY A;  1E3C P;  1HJK A;  4MY4 A;  3E2D A;  3NKN A;  4UOR A;  1E1Z P;  4MHX A;  5TJ3 A;  3UN2 A;  3WAY A;  2G9Y A;  5L0B A;  1SHQ A;  3BDF A;  4UPL A;  1ALI A;  2W5T A;  4FDI A;  1EW8 A;  3KD8 A;  4LQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...