3T01A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with phosphonoformate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
b'MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase/hydrolase inhibitor
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t01A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t01A01
5KXAA 1AJDA 2W5SA 5EGHA 3BDHA 3TX0A 5LRNA 2IUCB 2QZUA 1ED8A 4KAVA 4GTXA 1EJJA 1ANIA 1URBA 3MK2A 4LRCA 1KHJA 3NVLA 4LRFA 5DLWA 1SHNA 5EGEA 3WAWA 2ANHA 4TN0A 1EW8A 1ELYA 1AJAA 1KH5A 3IGZB 2ZKTA 3TG0A 5L0BA 3WBHA 4UPIA 3BDGA 4KAYA 1P49A 5AJ9A 4B56A 1E3CP 3SZZA 4LR9A 2W5WA 4LQYA 1ELZA 4UPKA 4CXUA 1HJKA 4CXKA 5K4PA 4CXSA 1KH9A 5DLTA 5LIAA 5DLVA 3WAVA 2GSNA 3NKOA 3M8ZA 1E33P 1K7HA 4KJDA 1SHQA 4CYRA 1O99A 1EW9A 3NKQA 4UORA 1ALJA 4NWXA 4UPHA 1E1ZP 3IGYB 4UPLA 4GTYA 3T00A 4LREA 3BDFA 2GSUA 1URAA 3M8WA 4LR8A 4FDJA 4YR1A 4LR7A 2VQRA 4CYSA 5GRRA 2W5XA 3NKPA 4LRAA 5IJSA 3IDDA 3A52A 4GTWA 3OT9A 3E2DA 4NWJA 2W5VA 1EQJA 2IFYA 3MK1A 1N2KA 1E2SP 3UNYA 3WAYA 4ZGAA 2IUCA 2W5RA 1O98A 3WAXA 3Q3QA 4QAXA 3DPCA 1ANJA 4FDIA 4KJGA 4ZG7A 2GLQA 1Y6VA 2W5TA 4LRDA 1FSUA 4ZG6A 2XR9A 4KM4A 4LR2A 4LRBA 3NKMA 1Y7AA 4MHXA 5LQQA 3UO0A 2G9YA 5INHA 5L0KA 2RH6A 3M8YA 2GA3A 1KHLA 5TJ3A 2W8SA 4MIVA 3UN3A 5L0EA 1B8JA 1KH7A 1KH4A 3LXQA 1HQAA 4UOPA 5C66A 1N2LA 3M7VA 2X98A 3NKRA 1ZEFA 1EI6A 1ED9A 1ELXA 1KHNA 4MY4A 3B5QA 3NKNA 1ALIA 5IJQA 3CMRA 1KHKA 4ZG9A 1AUKA 1EW2A 4N7TA 4UOOA 3TWZA 3MK0A 2GSOA 1ALKA 1ZEDA 2W8DA 1HDHA 4GTZA 5GOVA 3KD8A 3T01A 3UN5A 3SZYA 5HRTA 1AJBA 1ZEBA 3DYCA 3ED4A 5LRMA 3BDGB 3T02A 1ALHA 3UN2A 2XRGA 2W5QA 1AJCA 2D1GA
chains in the Genus database with same CATH superfamily
5KXAA 5EGHA 2W5SA 3TX0A 2B63C 4GZYA 1XXCA 2JA5A 3S1NK 3RZDC 4KB4A 5IP9K 1JVIA 3AD7C 1URBA 2GAGC 1KHJA 5IYCK 1WQHA 3M3YC 3S14K 5EGEA 3HOXC 1EW8A 4BBRK 2RGRA 4P5AA 3IGZB 1TWHA 3MMLB 3GTJC 3WBHA 2R7ZA 1Y1VK 3HOZC 4LLGA 4Q4ZA 4GTDA 4A3BK 4KAYA 2W7VA 4B56A 5M5WK 3N0BA 1EK8A 4A3JC 3S16K 3S1RK 4CXUA 1F7UA 1HJKA 5LIAA 2NVTK 2GSNA 2NVXC 1E33P 2Y0SL 3L4KA 3GTOK 4BY7C 3PO2K 3BP8C 2KWAA 3GTQK 4UORA 1I6VA 3S15C 4UPHA 3GTLA 3M4OK 4LREA 2JA6C 1UV7A 4X6AC 1J6XA 2O5IA 4BLAA 1INNA 4KM9A 4BXXC 3GTKK 3E2DA 4NWJA 3H0GC 2IFYA 3MK1A 1N2KA 2A6HA 3HOVC 5IP9C 5M3FK 3WAYA 3K7AK 4J3NA 2IUCA 3GTGA 4FDIA 1Y6VA 3FKIK 5E68A 4MEXA 2XR9A 3GTMA 2JA7K 4BBRC 4G0VA 3GTPK 1Y7AA 2VUMC 5LQQA 5INHA 2YU9K 1Y1VC 4A3BC 1AB4A 3GSIA 5M5YK 1KHLA 2O5JA 4XSXA 1B4BA 3S16C 4XLPA 3S1RC 4UOPA 4QIWL 1J6WA 5C66A 1O29A 3A8JA 4BKWA 2NVTC 3NKRA 5IYDK 2D6FC 1TWAK 1VH2A 4MY4A 2E2IK 3NKNA 4C3IK 4LK0A 4C3HK 5IP7C 3FHZA 4KARA 1O2BA 3TWZA 1SMYA 4BLBA 5FJ8K 1HDHA 3GTKC 1Y1WA 3UN5A 1J6VA 3SZYA 1VRQC 5JVOA 5LRMA 2JA5K 1F93A 3T02A 2XRGA 4BY1K 1O24A 3VA7A 2D1GA 1IE0A 2E2HA 1B4AA 2QZUA 1ED8A 4OINA 4GTXA 1BS2A 1EJJA 4WJ3M 1TWHK 3OPFA 3NVLA 2JA7C 3GTPC 2R7ZK 3IPJA 3CQZA 2CW0A 2V6UA 4A3MK 1K83A 4A3GK 2PMZD 1ISEA 5M5XK 4G7ZA 4TN0A 2XCOA 4KC6A 3CAGA 1WCMC 1XZPA 2R93K 1O26A 3HKZD 1YX2A 5L0BA 1VJEA 1I3QA 4MQ9A 5IYDC 5C4XK 1TWAC 3TFIA 2NVYK 1ELZA 4UPKA 3FOFA 4GTFA 5K4PA 4CXSA 1I50C 1IQ0A 1USMA 4KMUA 4LOWA 4WILA 4C3HC 3GTLK 3H3VD 5DLTA 3NKOA 3M8ZA 4C3JC 1K7HA 5TMCA 1SHQA 4KN4A 2P5MA 1O99A 4KDDA 3ADAC 4UPLA 4BBSK 1PJ6A 3I4MC 2B63A 2GSUA 5HL8A 3M8WA 4GTCA 4YR1A 4A3EK 4BY1C 4Y7NK 3S17K 4LR7A 3NKPA 1WOOA 3GTGK 2A68A 3WODA 3OT9A 3JSTA 2WB1L 3V4GA 4Y52K 5C4JK 3HOUK 1E2SP 3GTMK 4ZGAA 2W5RA 1O98A 4A3CK 1F9NA 2PMZL 3GTJA 3WAXA 1L0WA 2R7ZC 4QAXA 3DPCA 4KJGA 4ZG7A 2W5TA 4A3GC 4G0WA 4LRDA 4GTBA 4PABA 4LR2A 4YG2A 1FSUA 2JA8C 1TWFK 2R93C 3TTGA 3NKMA 3RZOC 3AD9C 1HQMA 1V5VA 2E2JK 5L0KA 2NVXA 2GA3A 1WOSA 1F7VA 5C4XC 3H3VL 3EQLA 2NVYC 4C2MK 1B8JA 2A69A 1HQAA 1ZBSA 4A93K 4A3DK 1TWCA 4A3FK 3S1NC 4JK1A 1ED9A 3G4AA 1O2FB 1ZEFA 1HI9A 1O27A 3B5QA 1DCHA 3AQPA 1Y1WK 5IYCC 4BBSC 3LAPA 1AUKA 4OIOA 3S14C 1PJ5A 2R92K 3H0GA 3TFJA 2WAQD 3AQOA 5IYBK 1G51A 1O25A 4A3EC 5HRTA 2E2HK 3GTGC 4Q5SA 3DYCA 1J98A 2BE5A 4Y52C 5C4JC 1X31C 4GTZA 3GTMC 4KATA 2VUMA 1WQFA 4A3CC 5L46A 3BDHA 5LRNA 1WQGA 1K83K 3CQZK 4AYBD 1ZXOA 3TFHA 3GTOC 2EBBA 2Y3PA 1BDFA 3PO2C 1TWGA 3GTQC 3S1MK 1TWFC 3S2HK 4LRFA 1I3QK 2E2JC 3M4OC 1EFWA 5DLWA 1SHNA 1R9TK 2NVQK 2ANHA 1SFOA 4G7HA 4XCHA 4OIPA 3GIRA 2ZKTA 4C2MC 4XLNA 4YFKA 4OIRA 4A93C 4A3DC 2JH3A 4A3FC 1GE9A 1E3CP 4LR9A 4P9SA 4LQYA 2W5WA 1IL2A 3K7AC 3AD8C 1WSRA 1KH9A 3GTKA 2WAQL 1YNJA 2B63K 5IOQA 3WAVA 5DLVA 1WORA 4C45A 2R92C 3FKIC 1USOA 4MEYA 1EW9A 3NKQA 1ALJA 4NWXA 5IYBC 4KAWX 4GTYA 2GAHC 3GEIA 3QX3A 2YU9C 1URAA 1DD5A 4YFNA 4LR8A 4FDJA 5TMFA 4GTLA 2VQRA 4CYSA 5GRRA 2JA7A 2W5XA 4LRAA 4A3KK 3IDDA 4QJVB 4GTWA 4KB2A 1WSVA 1K83C 4G0UA 2E2IC 1JOEA 1XXBA 4A3JK 1WCMA 4C3IC 1YNNA 3DXJA 3S1MC 3S2HC 1EH1A 4KM8A 2P8TA 1ANJA 2GLQA 1TWAA 1R9TC 2NVQC 1IBAA 3AH5A 5CJ9A 3S0XA 4LRBA 3OEPA 2Y0SD 4O2DA 1I50A 1ZVUA 2XCRB 1TWCK 2FQOA 2RH6A 4NOIA 2JA5C 3M8YA 5TJ3A 3BP3A 4M1XA 5D4DA 2W8SA 4QJVA 3HOWK 4GFQA 1KH7A 3LXQA 1N2LA 5CHPA 3S1QK 3OREA 1O2AA 3H0GK 3HOVK 1ALIA 5IOSA 4ILDA 1TWHC 5FLMK 2ZUEA 3CMRA 4LJZA 4GT9A 3S2DK 3GEHA 4A3MC 4N7TA 3HKZL 1RU0A 3G4CA 3PO3K 2VUMK 3NUHA 3T01A 3LPXA 4A3KC 1AJBA 3BDGB 3UN2A 1ALHA 1XZQB 3BUEA 4LK1A 1O28A 1AJCA 1TWGK 2R93A 1AJDA 3GTLC 2JA6A 2IUCB 1PJ7A 4YFXA 4KAVA 5IOTA 4GTAA 4QIWD 1SFOK 4KMHA 1ANIA 3MK2A 4LRCA 2NVYA 1XPPA 2PPBA 2PHCB 1TWCC 4ZH4A 4DDQA 3WAWA 1IS1A 4A3LK 3I4NK 1AJAA 1ELYA 1KH5A 3TG0A 3HOWC 4Y7NC 3S17C 4UPIA 3BDGA 1P49A 1XZQA 3S1QC 5AJ9A 1WOPA 4FZBA 4PAAA 3SZZA 1XXAA 3HOUC 2CFAB 4CXKA 5C44K 5FLMC 1Y1VA 1WIHA 3S2DC 2PA8D 4KJDA 1ZYRA 4CYRA 1I6HK 3PO3C 1E1ZP 3IGYB 1EQRA 3T00A 3BDFA 4KMAA 3GTOA 1YCLA 3A8IA 1WCMK 3GTQA 2A6EA 3LAJA 1BGWA 1TWFA 1TWGC 3A8KA 5IJSA 3HOYK 1C0AA 5C3EK 3A52A 2V6TA 3FOEA 1EQJA 2W5VA 4WJ4A 2CFAA 2FQTA 5IP7K 1SFOC 3UNYA 4A3IK 1I50K 2XCQA 3Q3QA 3L4JA 1KQ4A 1Y1WC 4G7OA 5IORA 3RZDK 4C3JK 4KMDA 4ZG6A 4KM4A 4A3LC 4GTEA 4KN7A 3I4NC 4MHXA 3UO0A 5JFEA 3I4MK 2G9YA 1XZPB 2E2HC 3M3YK 1DCPA 3ERED 1IW7A 2R92A 3GEEA 3FKIA 3HOXK 4MIVA 3UN3A 2ZFZA 5L0EA 4AYBL 3GTJK 2PA8L 3GTPA 1BJTA 1KH4A 5C44C 3HOZK 3M7VA 2YU9A 3CQZC 2X98A 1EI6A 1VGXA 1ELXA 3HXAA 1KHNA 1VLOA 1I6HC 2WB1D 5IJQA 5M3MK 1ZQ1C 3N0CA 1KHKA 1I3QC 4ZG9A 2NVXK 1EW2A 4FM9A 4UOOA 3MK0A 2GSOA 4BY7K 2E2IA 2V6SA 1ALKA 1ZEDA 2W8DA 1DCOA 2JA8K 1JQWA 3S15K 3RZOK 2ZUFA 5GOVA 4KASA 3KD8A 3HOYC 2JA6K 3N3YA 5C3EC 1ZEBA 3ED4A 4X6AK 4OIQA 4AH6A 1R9TA 2W5QA 4BXXK 4P5BA 4RMFA 3GDZA 4XSZA 4A3IC
chains in the Genus database with same CATH topology
5KXAA 1AJDA 2W5SA 5EGHA 3BDHA 3TX0A 5LRNA 2IUCB 2QZUA 1ED8A 4KAVA 4GTXA 1EJJA 1ANIA 1URBA 3MK2A 4LRCA 1KHJA 3NVLA 4LRFA 5DLWA 1SHNA 5EGEA 3WAWA 2ANHA 4TN0A 1EW8A 1ELYA 1AJAA 1KH5A 3IGZB 2ZKTA 3TG0A 5L0BA 3WBHA 4UPIA 3BDGA 4KAYA 1P49A 5AJ9A 4B56A 1E3CP 3SZZA 4LR9A 2W5WA 4LQYA 1ELZA 4UPKA 4CXUA 1HJKA 4CXKA 5K4PA 4CXSA 1KH9A 5DLTA 5LIAA 5DLVA 3WAVA 2GSNA 3NKOA 3M8ZA 1E33P 1K7HA 4KJDA 1SHQA 4CYRA 1O99A 1EW9A 3NKQA 4UORA 1ALJA 4NWXA 4UPHA 1E1ZP 3IGYB 4UPLA 4GTYA 3T00A 4LREA 3BDFA 2GSUA 1URAA 3M8WA 4LR8A 4FDJA 4YR1A 4LR7A 2VQRA 4CYSA 5GRRA 2W5XA 3NKPA 4LRAA 5IJSA 3IDDA 3A52A 4GTWA 3OT9A 3E2DA 4NWJA 2W5VA 1EQJA 2IFYA 3MK1A 1N2KA 1E2SP 3UNYA 3WAYA 4ZGAA 2IUCA 2W5RA 1O98A 3WAXA 3Q3QA 4QAXA 3DPCA 1ANJA 4FDIA 4KJGA 4ZG7A 2GLQA 1Y6VA 2W5TA 4LRDA 1FSUA 4ZG6A 2XR9A 4KM4A 4LR2A 4LRBA 3NKMA 1Y7AA 4MHXA 5LQQA 3UO0A 2G9YA 5INHA 5L0KA 2RH6A 3M8YA 2GA3A 1KHLA 5TJ3A 2W8SA 4MIVA 3UN3A 5L0EA 1B8JA 1KH7A 1KH4A 3LXQA 1HQAA 4UOPA 5C66A 1N2LA 3M7VA 2X98A 3NKRA 1ZEFA 1EI6A 1ED9A 1ELXA 1KHNA 4MY4A 3B5QA 3NKNA 1ALIA 5IJQA 3CMRA 1KHKA 4ZG9A 1AUKA 1EW2A 4N7TA 4UOOA 3TWZA 3MK0A 2GSOA 1ALKA 1ZEDA 2W8DA 1HDHA 4GTZA 5GOVA 3KD8A 3T01A 3UN5A 3SZYA 5HRTA 1AJBA 1ZEBA 3DYCA 3ED4A 5LRMA 3BDGB 3T02A 1ALHA 3UN2A 2XRGA 2W5QA 1AJCA 2D1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KXA A;  1AJD A;  2W5S A;  5EGH A;  3BDH A;  3TX0 A;  5LRN A;  2IUC B;  2QZU A;  1ED8 A;  4KAV A;  4GTX A;  1EJJ A;  1ANI A;  1URB A;  3MK2 A;  4LRC A;  1KHJ A;  3NVL A;  4LRF A;  5DLW A;  1SHN A;  5EGE A;  3WAW A;  2ANH A;  4TN0 A;  1EW8 A;  1ELY A;  1AJA A;  1KH5 A;  3IGZ B;  2ZKT A;  3TG0 A;  5L0B A;  3WBH A;  4UPI A;  3BDG A;  4KAY A;  1P49 A;  5AJ9 A;  4B56 A;  1E3C P;  3SZZ A;  4LR9 A;  2W5W A;  4LQY A;  1ELZ A;  4UPK A;  4CXU A;  1HJK A;  4CXK A;  5K4P A;  4CXS A;  1KH9 A;  5DLT A;  5LIA A;  5DLV A;  3WAV A;  2GSN A;  3NKO A;  3M8Z A;  1E33 P;  1K7H A;  4KJD A;  1SHQ A;  4CYR A;  1O99 A;  1EW9 A;  3NKQ A;  4UOR A;  1ALJ A;  4NWX A;  4UPH A;  1E1Z P;  3IGY B;  4UPL A;  4GTY A;  3T00 A;  4LRE A;  3BDF A;  2GSU A;  1URA A;  3M8W A;  4LR8 A;  4FDJ A;  4YR1 A;  4LR7 A;  2VQR A;  4CYS A;  5GRR A;  2W5X A;  3NKP A;  4LRA A;  5IJS A;  3IDD A;  3A52 A;  4GTW A;  3OT9 A;  3E2D A;  4NWJ A;  2W5V A;  1EQJ A;  2IFY A;  3MK1 A;  1N2K A;  1E2S P;  3UNY A;  3WAY A;  4ZGA A;  2IUC A;  2W5R A;  1O98 A;  3WAX A;  3Q3Q A;  4QAX A;  3DPC A;  1ANJ A;  4FDI A;  4KJG A;  4ZG7 A;  2GLQ A;  1Y6V A;  2W5T A;  4LRD A;  1FSU A;  4ZG6 A;  2XR9 A;  4KM4 A;  4LR2 A;  4LRB A;  3NKM A;  1Y7A A;  4MHX A;  5LQQ A;  3UO0 A;  2G9Y A;  5INH A;  5L0K A;  2RH6 A;  3M8Y A;  2GA3 A;  1KHL A;  5TJ3 A;  2W8S A;  4MIV A;  3UN3 A;  5L0E A;  1B8J A;  1KH7 A;  1KH4 A;  3LXQ A;  1HQA A;  4UOP A;  5C66 A;  1N2L A;  3M7V A;  2X98 A;  3NKR A;  1ZEF A;  1EI6 A;  1ED9 A;  1ELX A;  1KHN A;  4MY4 A;  3B5Q A;  3NKN A;  1ALI A;  5IJQ A;  3CMR A;  1KHK A;  4ZG9 A;  1AUK A;  1EW2 A;  4N7T A;  4UOO A;  3TWZ A;  3MK0 A;  2GSO A;  1ALK A;  1ZED A;  2W8D A;  1HDH A;  4GTZ A;  5GOV A;  3KD8 A;  3T01 A;  3UN5 A;  3SZY A;  5HRT A;  1AJB A;  1ZEB A;  3DYC A;  3ED4 A;  5LRM A;  3BDG B;  3T02 A;  1ALH A;  3UN2 A;  2XRG A;  2W5Q A;  1AJC A;  2D1G A; 
#chains in the Genus database with same CATH topology
 5KXA A;  5EGH A;  2W5S A;  3TX0 A;  2B63 C;  4GZY A;  1XXC A;  2JA5 A;  3S1N K;  3RZD C;  4KB4 A;  5IP9 K;  1JVI A;  3AD7 C;  1URB A;  2GAG C;  1KHJ A;  5IYC K;  1WQH A;  3M3Y C;  3S14 K;  5EGE A;  3HOX C;  1EW8 A;  4BBR K;  2RGR A;  4P5A A;  3IGZ B;  1TWH A;  3MML B;  3GTJ C;  3WBH A;  2R7Z A;  1Y1V K;  3HOZ C;  4LLG A;  4Q4Z A;  4GTD A;  4A3B K;  4KAY A;  2W7V A;  4B56 A;  5M5W K;  3N0B A;  1EK8 A;  4A3J C;  3S16 K;  3S1R K;  4CXU A;  1F7U A;  1HJK A;  5LIA A;  2NVT K;  2GSN A;  2NVX C;  1E33 P;  2Y0S L;  3L4K A;  3GTO K;  4BY7 C;  3PO2 K;  3BP8 C;  2KWA A;  3GTQ K;  4UOR A;  1I6V A;  3S15 C;  4UPH A;  3GTL A;  3M4O K;  4LRE A;  2JA6 C;  1UV7 A;  4X6A C;  1J6X A;  2O5I A;  4BLA A;  1INN A;  4KM9 A;  4BXX C;  3GTK K;  3E2D A;  4NWJ A;  3H0G C;  2IFY A;  3MK1 A;  1N2K A;  2A6H A;  3HOV C;  5IP9 C;  5M3F K;  3WAY A;  3K7A K;  4J3N A;  2IUC A;  3GTG A;  4FDI A;  1Y6V A;  3FKI K;  5E68 A;  4MEX A;  2XR9 A;  3GTM A;  2JA7 K;  4BBR C;  4G0V A;  3GTP K;  1Y7A A;  2VUM C;  5LQQ A;  5INH A;  2YU9 K;  1Y1V C;  4A3B C;  1AB4 A;  3GSI A;  5M5Y K;  1KHL A;  2O5J A;  4XSX A;  1B4B A;  3S16 C;  4XLP A;  3S1R C;  4UOP A;  4QIW L;  1J6W A;  5C66 A;  1O29 A;  3A8J A;  4BKW A;  2NVT C;  3NKR A;  5IYD K;  2D6F C;  1TWA K;  1VH2 A;  4MY4 A;  2E2I K;  3NKN A;  4C3I K;  4LK0 A;  4C3H K;  5IP7 C;  3FHZ A;  4KAR A;  1O2B A;  3TWZ A;  1SMY A;  4BLB A;  5FJ8 K;  1HDH A;  3GTK C;  1Y1W A;  3UN5 A;  1J6V A;  3SZY A;  1VRQ C;  5JVO A;  5LRM A;  2JA5 K;  1F93 A;  3T02 A;  2XRG A;  4BY1 K;  1O24 A;  3VA7 A;  2D1G A;  1IE0 A;  2E2H A;  1B4A A;  2QZU A;  1ED8 A;  4OIN A;  4GTX A;  1BS2 A;  1EJJ A;  4WJ3 M;  1TWH K;  3OPF A;  3NVL A;  2JA7 C;  3GTP C;  2R7Z K;  3IPJ A;  3CQZ A;  2CW0 A;  2V6U A;  4A3M K;  1K83 A;  4A3G K;  2PMZ D;  1ISE A;  5M5X K;  4G7Z A;  4TN0 A;  2XCO A;  4KC6 A;  3CAG A;  1WCM C;  1XZP A;  2R93 K;  1O26 A;  3HKZ D;  1YX2 A;  5L0B A;  1VJE A;  1I3Q A;  4MQ9 A;  5IYD C;  5C4X K;  1TWA C;  3TFI A;  2NVY K;  1ELZ A;  4UPK A;  3FOF A;  4GTF A;  5K4P A;  4CXS A;  1I50 C;  1IQ0 A;  1USM A;  4KMU A;  4LOW A;  4WIL A;  4C3H C;  3GTL K;  3H3V D;  5DLT A;  3NKO A;  3M8Z A;  4C3J C;  1K7H A;  5TMC A;  1SHQ A;  4KN4 A;  2P5M A;  1O99 A;  4KDD A;  3ADA C;  4UPL A;  4BBS K;  1PJ6 A;  3I4M C;  2B63 A;  2GSU A;  5HL8 A;  3M8W A;  4GTC A;  4YR1 A;  4A3E K;  4BY1 C;  4Y7N K;  3S17 K;  4LR7 A;  3NKP A;  1WOO A;  3GTG K;  2A68 A;  3WOD A;  3OT9 A;  3JST A;  2WB1 L;  3V4G A;  4Y52 K;  5C4J K;  3HOU K;  1E2S P;  3GTM K;  4ZGA A;  2W5R A;  1O98 A;  4A3C K;  1F9N A;  2PMZ L;  3GTJ A;  3WAX A;  1L0W A;  2R7Z C;  4QAX A;  3DPC A;  4KJG A;  4ZG7 A;  2W5T A;  4A3G C;  4G0W A;  4LRD A;  4GTB A;  4PAB A;  4LR2 A;  4YG2 A;  1FSU A;  2JA8 C;  1TWF K;  2R93 C;  3TTG A;  3NKM A;  3RZO C;  3AD9 C;  1HQM A;  1V5V A;  2E2J K;  5L0K A;  2NVX A;  2GA3 A;  1WOS A;  1F7V A;  5C4X C;  3H3V L;  3EQL A;  2NVY C;  4C2M K;  1B8J A;  2A69 A;  1HQA A;  1ZBS A;  4A93 K;  4A3D K;  1TWC A;  4A3F K;  3S1N C;  4JK1 A;  1ED9 A;  3G4A A;  1O2F B;  1ZEF A;  1HI9 A;  1O27 A;  3B5Q A;  1DCH A;  3AQP A;  1Y1W K;  5IYC C;  4BBS C;  3LAP A;  1AUK A;  4OIO A;  3S14 C;  1PJ5 A;  2R92 K;  3H0G A;  3TFJ A;  2WAQ D;  3AQO A;  5IYB K;  1G51 A;  1O25 A;  4A3E C;  5HRT A;  2E2H K;  3GTG C;  4Q5S A;  3DYC A;  1J98 A;  2BE5 A;  4Y52 C;  5C4J C;  1X31 C;  4GTZ A;  3GTM C;  4KAT A;  2VUM A;  1WQF A;  4A3C C;  5L46 A;  3BDH A;  5LRN A;  1WQG A;  1K83 K;  3CQZ K;  4AYB D;  1ZXO A;  3TFH A;  3GTO C;  2EBB A;  2Y3P A;  1BDF A;  3PO2 C;  1TWG A;  3GTQ C;  3S1M K;  1TWF C;  3S2H K;  4LRF A;  1I3Q K;  2E2J C;  3M4O C;  1EFW A;  5DLW A;  1SHN A;  1R9T K;  2NVQ K;  2ANH A;  1SFO A;  4G7H A;  4XCH A;  4OIP A;  3GIR A;  2ZKT A;  4C2M C;  4XLN A;  4YFK A;  4OIR A;  4A93 C;  4A3D C;  2JH3 A;  4A3F C;  1GE9 A;  1E3C P;  4LR9 A;  4P9S A;  4LQY A;  2W5W A;  1IL2 A;  3K7A C;  3AD8 C;  1WSR A;  1KH9 A;  3GTK A;  2WAQ L;  1YNJ A;  2B63 K;  5IOQ A;  3WAV A;  5DLV A;  1WOR A;  4C45 A;  2R92 C;  3FKI C;  1USO A;  4MEY A;  1EW9 A;  3NKQ A;  1ALJ A;  4NWX A;  5IYB C;  4KAW X;  4GTY A;  2GAH C;  3GEI A;  3QX3 A;  2YU9 C;  1URA A;  1DD5 A;  4YFN A;  4LR8 A;  4FDJ A;  5TMF A;  4GTL A;  2VQR A;  4CYS A;  5GRR A;  2JA7 A;  2W5X A;  4LRA A;  4A3K K;  3IDD A;  4QJV B;  4GTW A;  4KB2 A;  1WSV A;  1K83 C;  4G0U A;  2E2I C;  1JOE A;  1XXB A;  4A3J K;  1WCM A;  4C3I C;  1YNN A;  3DXJ A;  3S1M C;  3S2H C;  1EH1 A;  4KM8 A;  2P8T A;  1ANJ A;  2GLQ A;  1TWA A;  1R9T C;  2NVQ C;  1IBA A;  3AH5 A;  5CJ9 A;  3S0X A;  4LRB A;  3OEP A;  2Y0S D;  4O2D A;  1I50 A;  1ZVU A;  2XCR B;  1TWC K;  2FQO A;  2RH6 A;  4NOI A;  2JA5 C;  3M8Y A;  5TJ3 A;  3BP3 A;  4M1X A;  5D4D A;  2W8S A;  4QJV A;  3HOW K;  4GFQ A;  1KH7 A;  3LXQ A;  1N2L A;  5CHP A;  3S1Q K;  3ORE A;  1O2A A;  3H0G K;  3HOV K;  1ALI A;  5IOS A;  4ILD A;  1TWH C;  5FLM K;  2ZUE A;  3CMR A;  4LJZ A;  4GT9 A;  3S2D K;  3GEH A;  4A3M C;  4N7T A;  3HKZ L;  1RU0 A;  3G4C A;  3PO3 K;  2VUM K;  3NUH A;  3T01 A;  3LPX A;  4A3K C;  1AJB A;  3BDG B;  3UN2 A;  1ALH A;  1XZQ B;  3BUE A;  4LK1 A;  1O28 A;  1AJC A;  1TWG K;  2R93 A;  1AJD A;  3GTL C;  2JA6 A;  2IUC B;  1PJ7 A;  4YFX A;  4KAV A;  5IOT A;  4GTA A;  4QIW D;  1SFO K;  4KMH A;  1ANI A;  3MK2 A;  4LRC A;  2NVY A;  1XPP A;  2PPB A;  2PHC B;  1TWC C;  4ZH4 A;  4DDQ A;  3WAW A;  1IS1 A;  4A3L K;  3I4N K;  1AJA A;  1ELY A;  1KH5 A;  3TG0 A;  3HOW C;  4Y7N C;  3S17 C;  4UPI A;  3BDG A;  1P49 A;  1XZQ A;  3S1Q C;  5AJ9 A;  1WOP A;  4FZB A;  4PAA A;  3SZZ A;  1XXA A;  3HOU C;  2CFA B;  4CXK A;  5C44 K;  5FLM C;  1Y1V A;  1WIH A;  3S2D C;  2PA8 D;  4KJD A;  1ZYR A;  4CYR A;  1I6H K;  3PO3 C;  1E1Z P;  3IGY B;  1EQR A;  3T00 A;  3BDF A;  4KMA A;  3GTO A;  1YCL A;  3A8I A;  1WCM K;  3GTQ A;  2A6E A;  3LAJ A;  1BGW A;  1TWF A;  1TWG C;  3A8K A;  5IJS A;  3HOY K;  1C0A A;  5C3E K;  3A52 A;  2V6T A;  3FOE A;  1EQJ A;  2W5V A;  4WJ4 A;  2CFA A;  2FQT A;  5IP7 K;  1SFO C;  3UNY A;  4A3I K;  1I50 K;  2XCQ A;  3Q3Q A;  3L4J A;  1KQ4 A;  1Y1W C;  4G7O A;  5IOR A;  3RZD K;  4C3J K;  4KMD A;  4ZG6 A;  4KM4 A;  4A3L C;  4GTE A;  4KN7 A;  3I4N C;  4MHX A;  3UO0 A;  5JFE A;  3I4M K;  2G9Y A;  1XZP B;  2E2H C;  3M3Y K;  1DCP A;  3ERE D;  1IW7 A;  2R92 A;  3GEE A;  3FKI A;  3HOX K;  4MIV A;  3UN3 A;  2ZFZ A;  5L0E A;  4AYB L;  3GTJ K;  2PA8 L;  3GTP A;  1BJT A;  1KH4 A;  5C44 C;  3HOZ K;  3M7V A;  2YU9 A;  3CQZ C;  2X98 A;  1EI6 A;  1VGX A;  1ELX A;  3HXA A;  1KHN A;  1VLO A;  1I6H C;  2WB1 D;  5IJQ A;  5M3M K;  1ZQ1 C;  3N0C A;  1KHK A;  1I3Q C;  4ZG9 A;  2NVX K;  1EW2 A;  4FM9 A;  4UOO A;  3MK0 A;  2GSO A;  4BY7 K;  2E2I A;  2V6S A;  1ALK A;  1ZED A;  2W8D A;  1DCO A;  2JA8 K;  1JQW A;  3S15 K;  3RZO K;  2ZUF A;  5GOV A;  4KAS A;  3KD8 A;  3HOY C;  2JA6 K;  3N3Y A;  5C3E C;  1ZEB A;  3ED4 A;  4X6A K;  4OIQ A;  4AH6 A;  1R9T A;  2W5Q A;  4BXX K;  4P5B A;  4RMF A;  3GDZ A;  4XSZ A;  4A3I C; 
#chains in the Genus database with same CATH homology
 5KXA A;  1AJD A;  2W5S A;  5EGH A;  3BDH A;  3TX0 A;  5LRN A;  2IUC B;  2QZU A;  1ED8 A;  4KAV A;  4GTX A;  1EJJ A;  1ANI A;  1URB A;  3MK2 A;  4LRC A;  1KHJ A;  3NVL A;  4LRF A;  5DLW A;  1SHN A;  5EGE A;  3WAW A;  2ANH A;  4TN0 A;  1EW8 A;  1ELY A;  1AJA A;  1KH5 A;  3IGZ B;  2ZKT A;  3TG0 A;  5L0B A;  3WBH A;  4UPI A;  3BDG A;  4KAY A;  1P49 A;  5AJ9 A;  4B56 A;  1E3C P;  3SZZ A;  4LR9 A;  2W5W A;  4LQY A;  1ELZ A;  4UPK A;  4CXU A;  1HJK A;  4CXK A;  5K4P A;  4CXS A;  1KH9 A;  5DLT A;  5LIA A;  5DLV A;  3WAV A;  2GSN A;  3NKO A;  3M8Z A;  1E33 P;  1K7H A;  4KJD A;  1SHQ A;  4CYR A;  1O99 A;  1EW9 A;  3NKQ A;  4UOR A;  1ALJ A;  4NWX A;  4UPH A;  1E1Z P;  3IGY B;  4UPL A;  4GTY A;  3T00 A;  4LRE A;  3BDF A;  2GSU A;  1URA A;  3M8W A;  4LR8 A;  4FDJ A;  4YR1 A;  4LR7 A;  2VQR A;  4CYS A;  5GRR A;  2W5X A;  3NKP A;  4LRA A;  5IJS A;  3IDD A;  3A52 A;  4GTW A;  3OT9 A;  3E2D A;  4NWJ A;  2W5V A;  1EQJ A;  2IFY A;  3MK1 A;  1N2K A;  1E2S P;  3UNY A;  3WAY A;  4ZGA A;  2IUC A;  2W5R A;  1O98 A;  3WAX A;  3Q3Q A;  4QAX A;  3DPC A;  1ANJ A;  4FDI A;  4KJG A;  4ZG7 A;  2GLQ A;  1Y6V A;  2W5T A;  4LRD A;  1FSU A;  4ZG6 A;  2XR9 A;  4KM4 A;  4LR2 A;  4LRB A;  3NKM A;  1Y7A A;  4MHX A;  5LQQ A;  3UO0 A;  2G9Y A;  5INH A;  5L0K A;  2RH6 A;  3M8Y A;  2GA3 A;  1KHL A;  5TJ3 A;  2W8S A;  4MIV A;  3UN3 A;  5L0E A;  1B8J A;  1KH7 A;  1KH4 A;  3LXQ A;  1HQA A;  4UOP A;  5C66 A;  1N2L A;  3M7V A;  2X98 A;  3NKR A;  1ZEF A;  1EI6 A;  1ED9 A;  1ELX A;  1KHN A;  4MY4 A;  3B5Q A;  3NKN A;  1ALI A;  5IJQ A;  3CMR A;  1KHK A;  4ZG9 A;  1AUK A;  1EW2 A;  4N7T A;  4UOO A;  3TWZ A;  3MK0 A;  2GSO A;  1ALK A;  1ZED A;  2W8D A;  1HDH A;  4GTZ A;  5GOV A;  3KD8 A;  3T01 A;  3UN5 A;  3SZY A;  5HRT A;  1AJB A;  1ZEB A;  3DYC A;  3ED4 A;  5LRM A;  3BDG B;  3T02 A;  1ALH A;  3UN2 A;  2XRG A;  2W5Q A;  1AJC A;  2D1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...