3T01A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with phosphonoformate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase/hydrolase inhibitor
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t01A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t01A01
3LXQA 3M8YA 3NKPA 5L0EA 1E2SP 4YR1A 3DPCA 3IGYB 1AJCA 1KHJA 1URAA 3BDGB 1ANJA 5K4PA 1EW9A 1HDHA 4KAVA 5DLTA 1AUKA 3E2DA 4UPKA 1Y7AA 4KAYA 4LQYA 1ALIA 3SZYA 3MK1A 2IUCB 3T00A 1ELYA 1URBA 3Q3QA 4LRFA 4UORA 1E33P 4ZG9A 3TX0A 1KHNA 2W5QA 4UPHA 1O99A 3OT9A 1KH5A 1ELZA 2XRGA 5AJ9A 3T02A 3M8ZA 3CMRA 3UO0A 1ALHA 1FSUA 5L0KA 2W5XA 3NKMA 1P49A 1KH4A 5IJQA 3WBHA 4CYSA 5LRMA 2G9YA 4GTWA 4B56A 5LQQA 2X98A 4NWXA 1AJDA 4MHXA 1ALKA 4LRAA 1SHQA 4ZG7A 4NWJA 3M8WA 1N2LA 1Y6VA 4UOOA 4LR7A 1B8JA 2W5WA 4KJGA 4GTXA 2XR9A 3KD8A 4LRDA 5GRRA 3B5QA 3IDDA 1HQAA 4MIVA 1E1ZP 1ZEFA 5INHA 3SZZA 2W8SA 2D1GA 4LR8A 1ED9A 1KH9A 3BDFA 5DLWA 4CYRA 4MY4A 4FDIA 1K7HA 1KHLA 3BDGA 2ANHA 3ED4A 2GA3A 1ELXA 2GSUA 3NKQA 2ZKTA 3UN2A 1EJJA 4KJDA 2IUCA 5HRTA 4LR9A 5LIAA 5KXAA 1EW8A 4QAXA 5TJ3A 1ANIA 4CXUA 3WAYA 1ED8A 1AJAA 4GTZA 1EW2A 3NKOA 4FDJA 3IGZB 4TN0A 3T01A 3UN5A 1ALJA 3NVLA 2GSOA 5DLVA 1KH7A 4ZG6A 1SHNA 4LR2A 1EQJA 3MK0A 4UPIA 2QZUA 4LRBA 4N7TA 3DYCA 4UOPA 2W5SA 4UPLA 3M7VA 1AJBA 1E3CP 4KM4A 2W5TA 1ZEBA 1EI6A 3WAXA 4CXKA 3TG0A 2W8DA 4LRCA 5EGHA 5EGEA 4LREA 3UN3A 3NKNA 1ZEDA 2W5RA 5L0BA 1O98A 3A52A 3WAWA 1KHKA 3NKRA 1HJKA 2W5VA 2VQRA 5GOVA 3TWZA 3BDHA 5IJSA 5LRNA 3MK2A 4GTYA 2RH6A 1N2KA 3UNYA 5C66A 2GLQA 3WAVA 2IFYA 2GSNA 4CXSA 4ZGAA
chains in the Genus database with same CATH superfamily
3LXQA 1TWAK 1HQMA 1SMYA 1TWHK 1TWFA 1WIHA 2JH3A 3GTLC 1AJCA 2GAGC 3ADAC 4KB2A 2JA5A 1USOA 1R9TC 3BDGB 1F7VA 5K4PA 1XXAA 1WCMC 4KAVA 2EBBA 4A3FK 1WOPA 2Y0SD 3E2DA 3HOYC 1Y7AA 4UPKA 2FQTA 2R92A 4A3BC 3T00A 1IQ0A 4KMHA 4MEXA 4A3EK 4WJ4A 4KMDA 4X6AK 3PO2K 3S16C 1O29A 3S15C 1E33P 4C2MC 4KM9A 4BBSK 4UPHA 5HL8A 2R93C 1ELZA 4A3DK 4KN4A 5M3MK 3M8ZA 2GAHC 3UO0A 1O28A 1R9TA 2VUMC 3TFHA 2W5XA 1P49A 1INNA 4CYSA 1WCMA 2NVQK 5LRMA 3GTGK 4GTDA 1WSRA 5C3EC 4BXXC 5IP7K 5JFEA 2X98A 1DCPA 4MHXA 3HKZD 4AYBD 2W7VA 4J3NA 4NWJA 2ZFZA 2JA6K 4LR7A 1VH2A 1IBAA 5IOTA 3GEEA 2YU9K 4C45A 3DXJA 2R93A 1Y1VA 3IDDA 1F9NA 3HOZK 1TWFK 2B63A 4G7OA 3GTMK 3H0GK 5M5YK 5INHA 2JA8C 2ZUFA 1J6VA 3S2HK 3GTOA 1ED9A 4GTCA 1XXBA 4MY4A 4O2DA 4ZH4A 2BE5A 4C3HK 4A3KK 3GTQK 1ELXA 4Q5SA 3QX3A 3S17C 4QIWD 1J6WA 4KJDA 1ZQ1C 1AB4A 5TJ3A 4A3GC 1ANIA 3CQZA 1DCOA 3M4OK 3WAYA 1ED8A 2V6UA 5JVOA 3NKOA 4C3IK 4FDJA 3H3VL 2E2HC 4YG2A 3MK0A 1BJTA 4LRBA 1TWAC 4GTFA 3DYCA 4KM4A 1PJ6A 2E2IA 2W5TA 1TWHC 1Y1WA 1EI6A 1B4AA 4Y7NK 3TG0A 4G7HA 5M3FK 4KARA 5EGHA 4A3MK 4GZYA 4LRCA 5FJ8K 4LREA 5C44C 1I3QC 5L0BA 2W5RA 1I50C 3A52A 3WAWA 2PHCB 2VQRA 3K7AC 1USMA 1SFOK 4A3EC 3GTJK 4C3JK 4X6AC 3PO2C 5IYDC 3AD7C 4GTYA 5C66A 2NVXK 4BBSC 4BLAA 3AD9C 3S1RK 3GTOK 5L0EA 4Q4ZA 2CFAA 3HOUK 4YR1A 1G51A 4KMUA 3GTKK 1URAA 4KB4A 3HXAA 1VJEA 3RZDK 1ANJA 4BLBA 1AUKA 2NVQC 1I3QA 1ALIA 3SZYA 1BS2A 3FKIK 1I50A 4PABA 3CQZK 4UORA 2JA6C 4ZG9A 2A6HA 4A3JK 1TWCA 3OT9A 2WB1D 2XRGA 3M3YK 3TFIA 5IYCC 3HOXC 5AJ9A 1ZYRA 3HOVK 1PJ7A 5L0KA 3WBHA 4G0WA 3I4MC 3S14K 1IL2A 3S2HC 1TWGC 4B56A 3S1MK 3RZOC 4GTEA 4A3KC 3GTQC 5D4DA 1ALKA 2JA7A 1N2LA 2R7ZK 4UOOA 3OEPA 1B8JA 4BBRK 1O2BA 2XR9A 5GRRA 2NVYC 1O26A 3G4CA 5IYBK 3M4OC 3TFJA 3L4JA 4JK1A 2CFAB 4MIVA 3AD8C 1ISEA 3GTLA 1ZEFA 3S2DK 2W8SA 4LR8A 3S1NK 1VLOA 1K7HA 1KHLA 3GTPC 3NKQA 4Y7NC 1X31C 1EJJA 4GT9A 2IUCA 4KAWX 4LR9A 5LIAA 1IW7A 2A69A 4OIOA 1EW8A 2NVYA 1TWCK 1GE9A 4CXUA 4P5BA 2E2JK 4A3CK 4BY1C 1AJAA 1EW2A 1ALJA 4TN0A 2GSOA 3I4NK 2NVXC 1KH7A 2WAQL 4ZG6A 4LR2A 4UPIA 1XXCA 4G0UA 4NOIA 2JA5K 3HOWK 4UOPA 4UPLA 2VUMA 1YNNA 4A3IK 1K83C 3GTPA 3N3YA 1KQ4A 1ZEBA 2V6SA 3GTKC 5FLMK 3RZDC 2R92K 1EQRA 1WSVA 1O98A 1RU0A 4A93K 4BY7C 1KHKA 3AQOA 2FQOA 4Y52K 2W5VA 4KC6A 4OIQA 3BDHA 2NVTK 2RH6A 2CW0A 4M1XA 5IP9C 1N2KA 3UNYA 2GLQA 3WAVA 1J98A 2IFYA 3WODA 1O25A 1XPPA 3NKPA 1JOEA 3M3YC 1R9TK 1I6HK 3DPCA 3IGYB 3N0CA 1WCMK 2P8TA 1KHJA 3HOVC 1EW9A 1HDHA 5DLTA 3AH5A 1EFWA 3S14C 5E68A 1EK8A 2IUCB 3S16K 4A3FC 3S15K 2PMZL 4C2MK 1O24A 1ELYA 1WQFA 2O5IA 1DCHA 4LRFA 4KMAA 3ERED 2R93K 2R7ZC 4XSXA 1KHNA 1Y1VK 2W5QA 4MEYA 2D6FC 2B63K 2E2HA 1KH5A 3BP8C 3T02A 5IYBC 4KATA 1O2FB 3N0BA 1TWAA 3CMRA 4A3DC 3PO3K 5C3EK 1YNJA 3NKMA 1TWHA 3CAGA 4BXXK 3GIRA 2V6TA 1C0AA 1WORA 3S0XA 3FOEA 3NUHA 3GTGC 1AJDA 4LRAA 3OREA 1SHQA 5IP7C 4ZG7A 1JVIA 3M8WA 4LOWA 2KWAA 4XSZA 4LRDA 3EQLA 3KD8A 1DD5A 2YU9C 2E2JC 3H3VD 2JA8K 4XLNA 2P5MA 4LLGA 3I4NC 5CHPA 3VA7A 2E2IK 3HOZC 1TWFC 1Y1WK 2D1GA 3GTMC 1KH9A 3H0GC 2JA5C 3HOWC 3S17K 1WOOA 4A3LK 3ED4A 3LAJA 2GSUA 4GTLA 2GA3A 3GTGA 5TMCA 3UN2A 3GSIA 2PMZD 4C3HC 5FLMC 4OINA 4A3GK 2R92C 1ZXOA 4AH6A 5M5XK 1JQWA 3JSTA 4QAXA 4A93C 2JA6A 5C4XK 3AQPA 2YU9A 2NVTC 3GEHA 3IGZB 5DLVA 1SHNA 1EQJA 1HI9A 4C3IC 5IOQA 5TMFA 1V5VA 4N7TA 2PA8L 3GTMA 1O2AA 3H0GA 4KN7A 2W5SA 1AJBA 2RGRA 1I6HC 5C44K 1I3QK 4GFQA 1TWGA 2W8DA 1I50K 5EGEA 2XCQA 5C4JK 2XCRB 3GTQA 4QIWL 3K7AK 1WQGA 4A3MC 3NKRA 3OPFA 5IYDK 1HJKA 5GOVA 3TWZA 5IJSA 4OIPA 4KDDA 5LRNA 3G4AA 1SFOC 4P9SA 3GTJC 2GSNA 1Y1VC 4C3JC 5CJ9A 4CXSA 3A8KA 3FHZA 3S1QK 2B63C 3M8YA 2A6EA 1E2SP 1YCLA 1O27A 4QJVA 3S1RC 3GTOC 3HOUC 3PO3C 4MQ9A 5IORA 4KAYA 4LQYA 2JA7K 1XZPA 3MK1A 3GEIA 1I6VA 3BUEA 1URBA 3Q3QA 4GTBA 3FKIC 4LK0A 4G0VA 3CQZC 3HOXK 5IYCK 1SFOA 4KM8A 3GTJA 1XZQA 1O99A 2NVXA 3FOFA 3IPJA 4P5AA 3GTLK 4A3JC 2PA8D 3I4MK 1ALHA 1FSUA 1TWGK 3TTGA 1K83A 3RZOK 1KH4A 5IJQA 2E2IC 1Y1WC 3HOYK 3GTKA 1UV7A 2G9YA 4GTWA 4WJ3M 4A3BK 5LQQA 3LPXA 4A3LC 4NWXA 1WQHA 1J6XA 3L4KA 3S1MC 3FKIA 4YFXA 1Y6VA 4GTAA 2NVYK 2PPBA 2W5WA 4KJGA 4WILA 4GTXA 4KASA 5C4XC 4BBRC 2WB1L 3B5QA 2WAQD 1HQAA 2A68A 2VUMK 1E1ZP 3GTPK 4QJVB 3V4GA 4FZBA 3SZZA 4LK1A 5DLWA 3BDFA 4CYRA 4FDIA 4DDQA 1F7UA 3BDGA 2ANHA 3S2DC 1XZPB 2XCOA 2ZKTA 3S1NC 2Y0SL 4YFKA 4ILDA 3A8JA 3LAPA 5C4JC 5HRTA 1BGWA 5KXAA 4BY1K 4BKWA 3A8IA 1PJ5A 1L0WA 1YX2A 2O5JA 2R7ZA 1IE0A 1XZQB 4GTZA 3UN5A 4LJZA 3T01A 1ZBSA 1TWCC 3NVLA 4PAAA 4A3CC 1WOSA 1K83K 1BDFA 3GDZA 2QZUA 3S1QC 4XLPA 1F93A 3M7VA 2ZUEA 5L46A 1E3CP 5IOSA 3WAXA 4CXKA 1VRQC 4A3IC 1ZVUA 4BY7K 5M5WK 3UN3A 4RMFA 4OIRA 3NKNA 1ZEDA 4G7ZA 2JA7C 3HKZL 1VGXA 1IS1A 4XCHA 4AYBL 1EH1A 5IP9K 3BP3A 1B4BA 3MK2A 4YFNA 2Y3PA 3MMLB 4Y52C 2E2HK 4FM9A 3TX0A 4ZGAA
chains in the Genus database with same CATH topology
3LXQA 3M8YA 3NKPA 5L0EA 1E2SP 4YR1A 3DPCA 3IGYB 1AJCA 1KHJA 1URAA 3BDGB 1ANJA 5K4PA 1EW9A 1HDHA 4KAVA 5DLTA 1AUKA 3E2DA 4UPKA 1Y7AA 4KAYA 4LQYA 1ALIA 3SZYA 3MK1A 2IUCB 3T00A 1ELYA 1URBA 3Q3QA 4LRFA 4UORA 1E33P 4ZG9A 3TX0A 1KHNA 2W5QA 4UPHA 1O99A 3OT9A 1KH5A 1ELZA 2XRGA 5AJ9A 3T02A 3M8ZA 3CMRA 3UO0A 1ALHA 1FSUA 5L0KA 2W5XA 3NKMA 1P49A 1KH4A 5IJQA 3WBHA 4CYSA 5LRMA 2G9YA 4GTWA 4B56A 5LQQA 2X98A 4NWXA 1AJDA 4MHXA 1ALKA 4LRAA 1SHQA 4ZG7A 4NWJA 3M8WA 1N2LA 1Y6VA 4UOOA 4LR7A 1B8JA 2W5WA 4KJGA 4GTXA 2XR9A 3KD8A 4LRDA 5GRRA 3B5QA 3IDDA 1HQAA 4MIVA 1E1ZP 1ZEFA 5INHA 3SZZA 2W8SA 2D1GA 4LR8A 1ED9A 1KH9A 3BDFA 5DLWA 4CYRA 4MY4A 4FDIA 1K7HA 1KHLA 3BDGA 2ANHA 3ED4A 2GA3A 1ELXA 2GSUA 3NKQA 2ZKTA 3UN2A 1EJJA 4KJDA 2IUCA 5HRTA 4LR9A 5LIAA 5KXAA 1EW8A 4QAXA 5TJ3A 1ANIA 4CXUA 3WAYA 1ED8A 1AJAA 4GTZA 1EW2A 3NKOA 4FDJA 3IGZB 4TN0A 3T01A 3UN5A 1ALJA 3NVLA 2GSOA 5DLVA 1KH7A 4ZG6A 1SHNA 4LR2A 1EQJA 3MK0A 4UPIA 2QZUA 4LRBA 4N7TA 3DYCA 4UOPA 2W5SA 4UPLA 3M7VA 1AJBA 1E3CP 4KM4A 2W5TA 1ZEBA 1EI6A 3WAXA 4CXKA 3TG0A 2W8DA 4LRCA 5EGHA 5EGEA 4LREA 3UN3A 3NKNA 1ZEDA 2W5RA 5L0BA 1O98A 3A52A 3WAWA 1KHKA 3NKRA 1HJKA 2W5VA 2VQRA 5GOVA 3TWZA 3BDHA 5IJSA 5LRNA 3MK2A 4GTYA 2RH6A 1N2KA 3UNYA 5C66A 2GLQA 3WAVA 2IFYA 2GSNA 4CXSA 4ZGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LXQ A;  3M8Y A;  3NKP A;  5L0E A;  1E2S P;  4YR1 A;  3DPC A;  3IGY B;  1AJC A;  1KHJ A;  1URA A;  3BDG B;  1ANJ A;  5K4P A;  1EW9 A;  1HDH A;  4KAV A;  5DLT A;  1AUK A;  3E2D A;  4UPK A;  1Y7A A;  4KAY A;  4LQY A;  1ALI A;  3SZY A;  3MK1 A;  2IUC B;  3T00 A;  1ELY A;  1URB A;  3Q3Q A;  4LRF A;  4UOR A;  1E33 P;  4ZG9 A;  3TX0 A;  1KHN A;  2W5Q A;  4UPH A;  1O99 A;  3OT9 A;  1KH5 A;  1ELZ A;  2XRG A;  5AJ9 A;  3T02 A;  3M8Z A;  3CMR A;  3UO0 A;  1ALH A;  1FSU A;  5L0K A;  2W5X A;  3NKM A;  1P49 A;  1KH4 A;  5IJQ A;  3WBH A;  4CYS A;  5LRM A;  2G9Y A;  4GTW A;  4B56 A;  5LQQ A;  2X98 A;  4NWX A;  1AJD A;  4MHX A;  1ALK A;  4LRA A;  1SHQ A;  4ZG7 A;  4NWJ A;  3M8W A;  1N2L A;  1Y6V A;  4UOO A;  4LR7 A;  1B8J A;  2W5W A;  4KJG A;  4GTX A;  2XR9 A;  3KD8 A;  4LRD A;  5GRR A;  3B5Q A;  3IDD A;  1HQA A;  4MIV A;  1E1Z P;  1ZEF A;  5INH A;  3SZZ A;  2W8S A;  2D1G A;  4LR8 A;  1ED9 A;  1KH9 A;  3BDF A;  5DLW A;  4CYR A;  4MY4 A;  4FDI A;  1K7H A;  1KHL A;  3BDG A;  2ANH A;  3ED4 A;  2GA3 A;  1ELX A;  2GSU A;  3NKQ A;  2ZKT A;  3UN2 A;  1EJJ A;  4KJD A;  2IUC A;  5HRT A;  4LR9 A;  5LIA A;  5KXA A;  1EW8 A;  4QAX A;  5TJ3 A;  1ANI A;  4CXU A;  3WAY A;  1ED8 A;  1AJA A;  4GTZ A;  1EW2 A;  3NKO A;  4FDJ A;  3IGZ B;  4TN0 A;  3T01 A;  3UN5 A;  1ALJ A;  3NVL A;  2GSO A;  5DLV A;  1KH7 A;  4ZG6 A;  1SHN A;  4LR2 A;  1EQJ A;  3MK0 A;  4UPI A;  2QZU A;  4LRB A;  4N7T A;  3DYC A;  4UOP A;  2W5S A;  4UPL A;  3M7V A;  1AJB A;  1E3C P;  4KM4 A;  2W5T A;  1ZEB A;  1EI6 A;  3WAX A;  4CXK A;  3TG0 A;  2W8D A;  4LRC A;  5EGH A;  5EGE A;  4LRE A;  3UN3 A;  3NKN A;  1ZED A;  2W5R A;  5L0B A;  1O98 A;  3A52 A;  3WAW A;  1KHK A;  3NKR A;  1HJK A;  2W5V A;  2VQR A;  5GOV A;  3TWZ A;  3BDH A;  5IJS A;  5LRN A;  3MK2 A;  4GTY A;  2RH6 A;  1N2K A;  3UNY A;  5C66 A;  2GLQ A;  3WAV A;  2IFY A;  2GSN A;  4CXS A;  4ZGA A; 
#chains in the Genus database with same CATH topology
 3LXQ A;  1TWA K;  1HQM A;  1SMY A;  1TWH K;  1TWF A;  1WIH A;  2JH3 A;  3GTL C;  1AJC A;  2GAG C;  3ADA C;  4KB2 A;  2JA5 A;  1USO A;  1R9T C;  3BDG B;  1F7V A;  5K4P A;  1XXA A;  1WCM C;  4KAV A;  2EBB A;  4A3F K;  1WOP A;  2Y0S D;  3E2D A;  3HOY C;  1Y7A A;  4UPK A;  2FQT A;  2R92 A;  4A3B C;  3T00 A;  1IQ0 A;  4KMH A;  4MEX A;  4A3E K;  4WJ4 A;  4KMD A;  4X6A K;  3PO2 K;  3S16 C;  1O29 A;  3S15 C;  1E33 P;  4C2M C;  4KM9 A;  4BBS K;  4UPH A;  5HL8 A;  2R93 C;  1ELZ A;  4A3D K;  4KN4 A;  5M3M K;  3M8Z A;  2GAH C;  3UO0 A;  1O28 A;  1R9T A;  2VUM C;  3TFH A;  2W5X A;  1P49 A;  1INN A;  4CYS A;  1WCM A;  2NVQ K;  5LRM A;  3GTG K;  4GTD A;  1WSR A;  5C3E C;  4BXX C;  5IP7 K;  5JFE A;  2X98 A;  1DCP A;  4MHX A;  3HKZ D;  4AYB D;  2W7V A;  4J3N A;  4NWJ A;  2ZFZ A;  2JA6 K;  4LR7 A;  1VH2 A;  1IBA A;  5IOT A;  3GEE A;  2YU9 K;  4C45 A;  3DXJ A;  2R93 A;  1Y1V A;  3IDD A;  1F9N A;  3HOZ K;  1TWF K;  2B63 A;  4G7O A;  3GTM K;  3H0G K;  5M5Y K;  5INH A;  2JA8 C;  2ZUF A;  1J6V A;  3S2H K;  3GTO A;  1ED9 A;  4GTC A;  1XXB A;  4MY4 A;  4O2D A;  4ZH4 A;  2BE5 A;  4C3H K;  4A3K K;  3GTQ K;  1ELX A;  4Q5S A;  3QX3 A;  3S17 C;  4QIW D;  1J6W A;  4KJD A;  1ZQ1 C;  1AB4 A;  5TJ3 A;  4A3G C;  1ANI A;  3CQZ A;  1DCO A;  3M4O K;  3WAY A;  1ED8 A;  2V6U A;  5JVO A;  3NKO A;  4C3I K;  4FDJ A;  3H3V L;  2E2H C;  4YG2 A;  3MK0 A;  1BJT A;  4LRB A;  1TWA C;  4GTF A;  3DYC A;  4KM4 A;  1PJ6 A;  2E2I A;  2W5T A;  1TWH C;  1Y1W A;  1EI6 A;  1B4A A;  4Y7N K;  3TG0 A;  4G7H A;  5M3F K;  4KAR A;  5EGH A;  4A3M K;  4GZY A;  4LRC A;  5FJ8 K;  4LRE A;  5C44 C;  1I3Q C;  5L0B A;  2W5R A;  1I50 C;  3A52 A;  3WAW A;  2PHC B;  2VQR A;  3K7A C;  1USM A;  1SFO K;  4A3E C;  3GTJ K;  4C3J K;  4X6A C;  3PO2 C;  5IYD C;  3AD7 C;  4GTY A;  5C66 A;  2NVX K;  4BBS C;  4BLA A;  3AD9 C;  3S1R K;  3GTO K;  5L0E A;  4Q4Z A;  2CFA A;  3HOU K;  4YR1 A;  1G51 A;  4KMU A;  3GTK K;  1URA A;  4KB4 A;  3HXA A;  1VJE A;  3RZD K;  1ANJ A;  4BLB A;  1AUK A;  2NVQ C;  1I3Q A;  1ALI A;  3SZY A;  1BS2 A;  3FKI K;  1I50 A;  4PAB A;  3CQZ K;  4UOR A;  2JA6 C;  4ZG9 A;  2A6H A;  4A3J K;  1TWC A;  3OT9 A;  2WB1 D;  2XRG A;  3M3Y K;  3TFI A;  5IYC C;  3HOX C;  5AJ9 A;  1ZYR A;  3HOV K;  1PJ7 A;  5L0K A;  3WBH A;  4G0W A;  3I4M C;  3S14 K;  1IL2 A;  3S2H C;  1TWG C;  4B56 A;  3S1M K;  3RZO C;  4GTE A;  4A3K C;  3GTQ C;  5D4D A;  1ALK A;  2JA7 A;  1N2L A;  2R7Z K;  4UOO A;  3OEP A;  1B8J A;  4BBR K;  1O2B A;  2XR9 A;  5GRR A;  2NVY C;  1O26 A;  3G4C A;  5IYB K;  3M4O C;  3TFJ A;  3L4J A;  4JK1 A;  2CFA B;  4MIV A;  3AD8 C;  1ISE A;  3GTL A;  1ZEF A;  3S2D K;  2W8S A;  4LR8 A;  3S1N K;  1VLO A;  1K7H A;  1KHL A;  3GTP C;  3NKQ A;  4Y7N C;  1X31 C;  1EJJ A;  4GT9 A;  2IUC A;  4KAW X;  4LR9 A;  5LIA A;  1IW7 A;  2A69 A;  4OIO A;  1EW8 A;  2NVY A;  1TWC K;  1GE9 A;  4CXU A;  4P5B A;  2E2J K;  4A3C K;  4BY1 C;  1AJA A;  1EW2 A;  1ALJ A;  4TN0 A;  2GSO A;  3I4N K;  2NVX C;  1KH7 A;  2WAQ L;  4ZG6 A;  4LR2 A;  4UPI A;  1XXC A;  4G0U A;  4NOI A;  2JA5 K;  3HOW K;  4UOP A;  4UPL A;  2VUM A;  1YNN A;  4A3I K;  1K83 C;  3GTP A;  3N3Y A;  1KQ4 A;  1ZEB A;  2V6S A;  3GTK C;  5FLM K;  3RZD C;  2R92 K;  1EQR A;  1WSV A;  1O98 A;  1RU0 A;  4A93 K;  4BY7 C;  1KHK A;  3AQO A;  2FQO A;  4Y52 K;  2W5V A;  4KC6 A;  4OIQ A;  3BDH A;  2NVT K;  2RH6 A;  2CW0 A;  4M1X A;  5IP9 C;  1N2K A;  3UNY A;  2GLQ A;  3WAV A;  1J98 A;  2IFY A;  3WOD A;  1O25 A;  1XPP A;  3NKP A;  1JOE A;  3M3Y C;  1R9T K;  1I6H K;  3DPC A;  3IGY B;  3N0C A;  1WCM K;  2P8T A;  1KHJ A;  3HOV C;  1EW9 A;  1HDH A;  5DLT A;  3AH5 A;  1EFW A;  3S14 C;  5E68 A;  1EK8 A;  2IUC B;  3S16 K;  4A3F C;  3S15 K;  2PMZ L;  4C2M K;  1O24 A;  1ELY A;  1WQF A;  2O5I A;  1DCH A;  4LRF A;  4KMA A;  3ERE D;  2R93 K;  2R7Z C;  4XSX A;  1KHN A;  1Y1V K;  2W5Q A;  4MEY A;  2D6F C;  2B63 K;  2E2H A;  1KH5 A;  3BP8 C;  3T02 A;  5IYB C;  4KAT A;  1O2F B;  3N0B A;  1TWA A;  3CMR A;  4A3D C;  3PO3 K;  5C3E K;  1YNJ A;  3NKM A;  1TWH A;  3CAG A;  4BXX K;  3GIR A;  2V6T A;  1C0A A;  1WOR A;  3S0X A;  3FOE A;  3NUH A;  3GTG C;  1AJD A;  4LRA A;  3ORE A;  1SHQ A;  5IP7 C;  4ZG7 A;  1JVI A;  3M8W A;  4LOW A;  2KWA A;  4XSZ A;  4LRD A;  3EQL A;  3KD8 A;  1DD5 A;  2YU9 C;  2E2J C;  3H3V D;  2JA8 K;  4XLN A;  2P5M A;  4LLG A;  3I4N C;  5CHP A;  3VA7 A;  2E2I K;  3HOZ C;  1TWF C;  1Y1W K;  2D1G A;  3GTM C;  1KH9 A;  3H0G C;  2JA5 C;  3HOW C;  3S17 K;  1WOO A;  4A3L K;  3ED4 A;  3LAJ A;  2GSU A;  4GTL A;  2GA3 A;  3GTG A;  5TMC A;  3UN2 A;  3GSI A;  2PMZ D;  4C3H C;  5FLM C;  4OIN A;  4A3G K;  2R92 C;  1ZXO A;  4AH6 A;  5M5X K;  1JQW A;  3JST A;  4QAX A;  4A93 C;  2JA6 A;  5C4X K;  3AQP A;  2YU9 A;  2NVT C;  3GEH A;  3IGZ B;  5DLV A;  1SHN A;  1EQJ A;  1HI9 A;  4C3I C;  5IOQ A;  5TMF A;  1V5V A;  4N7T A;  2PA8 L;  3GTM A;  1O2A A;  3H0G A;  4KN7 A;  2W5S A;  1AJB A;  2RGR A;  1I6H C;  5C44 K;  1I3Q K;  4GFQ A;  1TWG A;  2W8D A;  1I50 K;  5EGE A;  2XCQ A;  5C4J K;  2XCR B;  3GTQ A;  4QIW L;  3K7A K;  1WQG A;  4A3M C;  3NKR A;  3OPF A;  5IYD K;  1HJK A;  5GOV A;  3TWZ A;  5IJS A;  4OIP A;  4KDD A;  5LRN A;  3G4A A;  1SFO C;  4P9S A;  3GTJ C;  2GSN A;  1Y1V C;  4C3J C;  5CJ9 A;  4CXS A;  3A8K A;  3FHZ A;  3S1Q K;  2B63 C;  3M8Y A;  2A6E A;  1E2S P;  1YCL A;  1O27 A;  4QJV A;  3S1R C;  3GTO C;  3HOU C;  3PO3 C;  4MQ9 A;  5IOR A;  4KAY A;  4LQY A;  2JA7 K;  1XZP A;  3MK1 A;  3GEI A;  1I6V A;  3BUE A;  1URB A;  3Q3Q A;  4GTB A;  3FKI C;  4LK0 A;  4G0V A;  3CQZ C;  3HOX K;  5IYC K;  1SFO A;  4KM8 A;  3GTJ A;  1XZQ A;  1O99 A;  2NVX A;  3FOF A;  3IPJ A;  4P5A A;  3GTL K;  4A3J C;  2PA8 D;  3I4M K;  1ALH A;  1FSU A;  1TWG K;  3TTG A;  1K83 A;  3RZO K;  1KH4 A;  5IJQ A;  2E2I C;  1Y1W C;  3HOY K;  3GTK A;  1UV7 A;  2G9Y A;  4GTW A;  4WJ3 M;  4A3B K;  5LQQ A;  3LPX A;  4A3L C;  4NWX A;  1WQH A;  1J6X A;  3L4K A;  3S1M C;  3FKI A;  4YFX A;  1Y6V A;  4GTA A;  2NVY K;  2PPB A;  2W5W A;  4KJG A;  4WIL A;  4GTX A;  4KAS A;  5C4X C;  4BBR C;  2WB1 L;  3B5Q A;  2WAQ D;  1HQA A;  2A68 A;  2VUM K;  1E1Z P;  3GTP K;  4QJV B;  3V4G A;  4FZB A;  3SZZ A;  4LK1 A;  5DLW A;  3BDF A;  4CYR A;  4FDI A;  4DDQ A;  1F7U A;  3BDG A;  2ANH A;  3S2D C;  1XZP B;  2XCO A;  2ZKT A;  3S1N C;  2Y0S L;  4YFK A;  4ILD A;  3A8J A;  3LAP A;  5C4J C;  5HRT A;  1BGW A;  5KXA A;  4BY1 K;  4BKW A;  3A8I A;  1PJ5 A;  1L0W A;  1YX2 A;  2O5J A;  2R7Z A;  1IE0 A;  1XZQ B;  4GTZ A;  3UN5 A;  4LJZ A;  3T01 A;  1ZBS A;  1TWC C;  3NVL A;  4PAA A;  4A3C C;  1WOS A;  1K83 K;  1BDF A;  3GDZ A;  2QZU A;  3S1Q C;  4XLP A;  1F93 A;  3M7V A;  2ZUE A;  5L46 A;  1E3C P;  5IOS A;  3WAX A;  4CXK A;  1VRQ C;  4A3I C;  1ZVU A;  4BY7 K;  5M5W K;  3UN3 A;  4RMF A;  4OIR A;  3NKN A;  1ZED A;  4G7Z A;  2JA7 C;  3HKZ L;  1VGX A;  1IS1 A;  4XCH A;  4AYB L;  1EH1 A;  5IP9 K;  3BP3 A;  1B4B A;  3MK2 A;  4YFN A;  2Y3P A;  3MML B;  4Y52 C;  2E2H K;  4FM9 A;  3TX0 A;  4ZGA A; 
#chains in the Genus database with same CATH homology
 3LXQ A;  3M8Y A;  3NKP A;  5L0E A;  1E2S P;  4YR1 A;  3DPC A;  3IGY B;  1AJC A;  1KHJ A;  1URA A;  3BDG B;  1ANJ A;  5K4P A;  1EW9 A;  1HDH A;  4KAV A;  5DLT A;  1AUK A;  3E2D A;  4UPK A;  1Y7A A;  4KAY A;  4LQY A;  1ALI A;  3SZY A;  3MK1 A;  2IUC B;  3T00 A;  1ELY A;  1URB A;  3Q3Q A;  4LRF A;  4UOR A;  1E33 P;  4ZG9 A;  3TX0 A;  1KHN A;  2W5Q A;  4UPH A;  1O99 A;  3OT9 A;  1KH5 A;  1ELZ A;  2XRG A;  5AJ9 A;  3T02 A;  3M8Z A;  3CMR A;  3UO0 A;  1ALH A;  1FSU A;  5L0K A;  2W5X A;  3NKM A;  1P49 A;  1KH4 A;  5IJQ A;  3WBH A;  4CYS A;  5LRM A;  2G9Y A;  4GTW A;  4B56 A;  5LQQ A;  2X98 A;  4NWX A;  1AJD A;  4MHX A;  1ALK A;  4LRA A;  1SHQ A;  4ZG7 A;  4NWJ A;  3M8W A;  1N2L A;  1Y6V A;  4UOO A;  4LR7 A;  1B8J A;  2W5W A;  4KJG A;  4GTX A;  2XR9 A;  3KD8 A;  4LRD A;  5GRR A;  3B5Q A;  3IDD A;  1HQA A;  4MIV A;  1E1Z P;  1ZEF A;  5INH A;  3SZZ A;  2W8S A;  2D1G A;  4LR8 A;  1ED9 A;  1KH9 A;  3BDF A;  5DLW A;  4CYR A;  4MY4 A;  4FDI A;  1K7H A;  1KHL A;  3BDG A;  2ANH A;  3ED4 A;  2GA3 A;  1ELX A;  2GSU A;  3NKQ A;  2ZKT A;  3UN2 A;  1EJJ A;  4KJD A;  2IUC A;  5HRT A;  4LR9 A;  5LIA A;  5KXA A;  1EW8 A;  4QAX A;  5TJ3 A;  1ANI A;  4CXU A;  3WAY A;  1ED8 A;  1AJA A;  4GTZ A;  1EW2 A;  3NKO A;  4FDJ A;  3IGZ B;  4TN0 A;  3T01 A;  3UN5 A;  1ALJ A;  3NVL A;  2GSO A;  5DLV A;  1KH7 A;  4ZG6 A;  1SHN A;  4LR2 A;  1EQJ A;  3MK0 A;  4UPI A;  2QZU A;  4LRB A;  4N7T A;  3DYC A;  4UOP A;  2W5S A;  4UPL A;  3M7V A;  1AJB A;  1E3C P;  4KM4 A;  2W5T A;  1ZEB A;  1EI6 A;  3WAX A;  4CXK A;  3TG0 A;  2W8D A;  4LRC A;  5EGH A;  5EGE A;  4LRE A;  3UN3 A;  3NKN A;  1ZED A;  2W5R A;  5L0B A;  1O98 A;  3A52 A;  3WAW A;  1KHK A;  3NKR A;  1HJK A;  2W5V A;  2VQR A;  5GOV A;  3TWZ A;  3BDH A;  5IJS A;  5LRN A;  3MK2 A;  4GTY A;  2RH6 A;  1N2K A;  3UNY A;  5C66 A;  2GLQ A;  3WAV A;  2IFY A;  2GSN A;  4CXS A;  4ZGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...