3T01A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with phosphonoformate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords phosphonoacetate hydrolase
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t01A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t01A01
1URBA 4UPIA 1EW8A 3DPCA 2ANHA 3BDHA 3TG0A 2W5RA 1EJJA 3IDDA 4YR1A 5EGHA 4UOPA 1N2KA 4GTYA 3UN2A 4LREA 2GSOA 4KAYA 5KXAA 1EW2A 1SHQA 4LRDA 1ELYA 1KHNA 3CMRA 1Y7AA 2QZUA 3E2DA 4KJDA 4KAVA 1KH5A 1EW9A 3BDFA 5LQQA 1ZEFA 2IUCA 2W5VA 3NKRA 3IGZB 1E3CP 3SZZA 5EGEA 1HDHA 3T02A 4MHXA 5GOVA 4KJGA 1EI6A 1KH9A 1AJCA 3LXQA 1ZEBA 3NKMA 1K7HA 2W5TA 4ZG6A 3NKOA 4CYRA 3M8WA 1B8JA 5LRMA 5IJSA 5L0KA 2VQRA 3BDGB 5DLVA 2IFYA 4NWXA 2XR9A 4MY4A 1E2SP 3WAYA 1E1ZP 1FSUA 3T01A 4UPKA 4UPLA 1ED8A 4LRAA 5INHA 3MK1A 1AJDA 2GSUA 4FDJA 3Q3QA 2D1GA 4LR8A 5TJ3A 1ALIA 3M8ZA 4LR2A 3BDGA 1AUKA 3DYCA 4GTXA 5L0EA 3NVLA 4UPHA 1ALHA 1URAA 3TWZA 1ANIA 1ZEDA 3NKPA 4ZGAA 1N2LA 5K4PA 1KHLA 4TN0A 3M8YA 5LIAA 1ELXA 3MK0A 3WAWA 4LRBA 4GTWA 3UO0A 5AJ9A 5GRRA 4CXKA 5IJQA 2W8DA 3IGYB 1HJKA 3TX0A 2GA3A 5L0BA 5HRTA 2GLQA 4LQYA 4UOOA 3SZYA 2RH6A 4LRFA 4ZG9A 2W5QA 3UNYA 3ED4A 5C66A 3WAVA 1ALJA 1SHNA 3A52A 1EQJA 3WAXA 2XRGA 1KHJA 1KHKA 3NKNA 3UN5A 4LR9A 1KH4A 4NWJA 3B5QA 2W5SA 3M7VA 5DLWA 1ED9A 2ZKTA 2GSNA 1O98A 3MK2A 4FDIA 3WBHA 1P49A 2IUCB 4GTZA 4ZG7A 1ELZA 4CYSA 2W5WA 4KM4A 4LRCA 3UN3A 4QAXA 4N7TA 1AJBA 1E33P 4CXUA 3T00A 1HQAA 1O99A 2G9YA 2X98A 2W8SA 1AJAA 1Y6VA 4B56A 2W5XA 3KD8A 3OT9A 5LRNA 4CXSA 1KH7A 1ANJA 4LR7A 1ALKA 4UORA 5DLTA 4MIVA 3NKQA
chains in the Genus database with same CATH superfamily
4GTFA 4UPIA 3TG0A 3NUHA 2EBBA 5EGHA 1VRQC 3IPJA 5FJ8K 4UOPA 1N2KA 4GTYA 5IYCC 1G51A 4GTEA 1K83A 3GDZA 4AYBD 1B4BA 2PA8L 3WODA 1O25A 2E2IK 3AQPA 3GEEA 5LQQA 2Y0SL 1ZEFA 2IUCA 2W5VA 2B63C 1O26A 3IGZB 4A3KK 1GE9A 1AJCA 1KH9A 3LXQA 1K7HA 4WILA 4CYRA 3I4MK 3M4OK 2R92C 2E2JK 2P8TA 1XZPA 5IYBC 4XSXA 2IFYA 4YFNA 4MY4A 3I4MC 2JA5C 2GAGC 1EH1A 3V4GA 1JOEA 3HOWC 3N0CA 4UPLA 1ED8A 1Y1WA 4C3IC 5IYBK 4XSZA 1AJDA 1WCMC 4XCHA 3Q3QA 4LK0A 2A6EA 3M8ZA 3BP8C 5L0EA 4A3GK 1ALHA 3GTOK 1O28A 1ANIA 2A68A 3A8IA 4BBSC 3NKPA 4A3CK 3S1RC 5E68A 3HOZK 1N2LA 2JA6K 3S1MC 5LIAA 1IW7A 1PJ6A 1TWCC 2P5MA 4WJ3M 3S1RK 3GTGC 4KARA 1WQGA 4A3JK 4LJZA 3RZOK 2NVQK 1XPPA 2GLQA 4DDQA 2CFAB 2PMZD 4GTLA 3S15C 3UNYA 5M3MK 3WAVA 4C45A 1ALJA 1O29A 2CFAA 2KWAA 3A52A 2XRGA 5CHPA 3TFHA 4PAAA 1TWFK 1ZQ1C 3ERED 1J6XA 1ED9A 2YU9A 3WBHA 5M5XK 3G4CA 4AH6A 4QIWD 1TWFC 3GTMA 1ELZA 2W5WA 4LRCA 4CYSA 1KQ4A 1F7VA 4GTCA 1AJBA 4CXUA 1O2AA 4LK1A 5IOQA 4Q4ZA 2JA6A 5M5YK 3PO3K 3HOUC 4CXSA 4XLNA 1L0WA 2VUMA 4LR7A 3HOVC 4A3DK 4MIVA 3NKQA 4KN7A 4GTDA 3TTGA 3DPCA 3BDHA 3N3YA 2VUMC 1I6VA 2JA8C 3MMLB 3CAGA 4BLAA 1Y1WK 3UN2A 4BY7C 4A93K 4ILDA 3CQZA 4GTBA 2JA7C 5KXAA 5TMCA 2NVTK 3HKZD 2VUMK 4LRDA 4A3BC 2O5JA 1KHNA 4BXXK 5FLMK 4Y7NC 4KJDA 4QJVA 3BDFA 4KM8A 2NVTC 2FQOA 1VJEA 3K7AC 1RU0A 3FOFA 1J6WA 1HDHA 3GTPC 4Y52K 2W5TA 3NKMA 4C3JK 3EQLA 5LRMA 2D6FC 3OPFA 5IP7K 4BBRK 5IYDC 4KATA 3GTQK 2E2IA 5DLVA 3TFJA 1F9NA 5HL8A 4Y52C 4C3HC 4P5AA 5IOTA 3GTQA 4C3JC 4C2MC 1R9TC 4UPKA 3A8JA 3GTQC 3MK1A 5INHA 1WSRA 2XCQA 1INNA 3VA7A 4X6AC 5C3EK 4JK1A 1HQMA 3M4OC 2R92K 5TJ3A 4KM9A 1ZBSA 3AD8C 2RGRA 3H3VL 1USMA 4UPHA 1F7UA 3OREA 3TWZA 3TFIA 3GTJC 1ZEDA 1WOPA 4A3EC 3S1NC 1BJTA 1WQHA 5K4PA 3CQZC 2JA7A 5L46A 5IOSA 2O5IA 4KMAA 3MK0A 4OIRA 5D4DA 1SFOK 2V6TA 3S1NK 3G4AA 3H0GK 5C44C 3AD9C 3CQZK 5AJ9A 3S1QC 4KMUA 3GIRA 1EFWA 2JA5A 4BBSK 4A3CC 1WIHA 4LQYA 3GEIA 4ZG9A 4LRFA 2JA6C 3S1MK 2W5QA 1DCOA 1ZXOA 3H3VD 3ED4A 3S1QK 5C66A 1TWCK 1EQJA 1KHKA 3NKNA 4G0VA 2JA7K 3B5QA 1VH2A 3S14K 3BUEA 1O98A 4KB2A 2IUCB 2YU9C 3S14C 1PJ5A 3ADAC 3GTJA 3UN3A 2V6SA 4QAXA 4N7TA 4GTAA 2X98A 2YU9K 1K83C 1TWFA 1I6HK 1AJAA 1Y6VA 2FQTA 3KD8A 1WOSA 1KH7A 4BBRC 1ZYRA 4FZBA 5DLTA 4GZYA 1R9TA 3GTGA 1F93A 1XZQB 3L4JA 1EW8A 4A3LK 1URBA 2ANHA 3HXAA 4KAWX 1TWHC 3IDDA 4YR1A 2E2IC 3N0BA 2B63K 3GEHA 5C3EC 4KAYA 4LREA 2PA8D 1SHQA 5M3FK 4A3LC 4A3KC 4BKWA 3GTPA 1TWHK 3CMRA 2QZUA 4A3DC 4KAVA 4KMHA 1BDFA 4MQ9A 5IYCK 4BLBA 1I3QA 1WCMA 4OIPA 1WQFA 5EGEA 3SZZA 1Y1WC 1E3CP 5IP9K 4MHXA 5GOVA 3I4NC 4KJGA 1EI6A 3S17C 4ZG6A 1O2FB 2JA5K 3HOYK 3PO2C 4A3BK 3NKOA 3OEPA 1XZPB 5L0KA 3K7AK 1JQWA 4KASA 5M5WK 1E2SP 1EK8A 4A3GC 5C4XC 1E1ZP 1FSUA 1HI9A 4G7ZA 4FM9A 2E2JC 2E2HK 2GSUA 3GTKA 4FDJA 2D1GA 2B63A 5IP7C 5IYDK 1ALIA 3S2DK 5IORA 2R92A 3NVLA 4C3HK 3HOWK 4GFQA 3GTLK 3GTGK 4A3FK 1R9TK 4NOIA 2XCRB 4ZGAA 1IL2A 1J6VA 3GTMC 3RZOC 4TN0A 3QX3A 1ELXA 3WAWA 3RZDC 4LRBA 4A3FC 3GTOC 1YCLA 4WJ4A 3BP3A 1O24A 5IJQA 1HJKA 5HRTA 1J98A 2GA3A 1USOA 4RMFA 1TWGA 2WAQD 1I3QK 2NVYA 3WAXA 1IE0A 3JSTA 4YG2A 1XXCA 4J3NA 4A3MK 1SFOC 1IBAA 1IQ0A 1XZQA 3S0XA 5C44K 2R93K 3M7VA 3S16K 5DLWA 2NVXA 2ZKTA 1TWCA 2PHCB 4A3IC 3S15K 1P49A 4BY1C 2W7VA 1DCPA 1IS1A 3S16C 3HOUK 5JFEA 1WOOA 4YFKA 2ZUEA 1B4AA 2WAQL 1ISEA 3T00A 3I4NK 1HQAA 2JH3A 1BGWA 1Y1VA 1O27A 2W8SA 2Y0SD 2W5XA 1VLOA 3OT9A 5LRNA 4A93C 5C4JC 1TWAK 1ANJA 4G7HA 4KDDA 4OIQA 4UORA 1O2BA 2A6HA 1I50K 2R7ZK 1WORA 4KMDA 2A69A 4BXXC 2W5RA 4Y7NK 4YFXA 1EJJA 2ZUFA 1DCHA 3FKIC 2E2HC 2GSOA 1I50C 5JVOA 1PJ7A 2R7ZC 1YNNA 4MEXA 1EW2A 1EQRA 3GSIA 1TWAA 3FHZA 5TMFA 1ELYA 3S2DC 1Y7AA 1YNJA 3E2DA 2JA8K 2PMZL 3FKIK 3LPXA 1KH5A 1EW9A 3GTLC 4Q5SA 4BY7K 4OIOA 2PPBA 3NKRA 3AD7C 4GT9A 3T02A 5FLMC 3H0GA 3RZDK 1ZEBA 4C3IK 1XXAA 3M8WA 1WCMK 1B8JA 3AQOA 2NVYC 2XCOA 4KB4A 4X6AK 2VQRA 5IJSA 3BDGB 2R93A 4MEYA 4NWXA 1TWGC 2ZFZA 2XR9A 1AB4A 3WAYA 3GTPK 3AH5A 5IP9C 3T01A 3S17K 4LOWA 4G0WA 4LRAA 3HOYC 3PO2K 1SMYA 3GTOA 4P9SA 1TWGK 4LR8A 1YX2A 2R93C 4G0UA 4QJVB 4LR2A 3LAPA 3BDGA 1AUKA 3DYCA 4GTXA 4C2MK 4XLPA 1URAA 2NVQC 4BY1K 1V5VA 3FOEA 3H0GC 5C4XK 4LLGA 1KHLA 2V6UA 3M8YA 3FKIA 3HKZL 3M3YC 3GTLA 4GTWA 3HOXC 3GTKC 3UO0A 3S2HC 3GTJK 5GRRA 4A3EK 4CXKA 2W8DA 2GAHC 5C4JK 3IGYB 3TX0A 1TWAC 5L0BA 4M1XA 4UOOA 3M3YK 1I50A 3SZYA 3HOXK 3GTMK 3GTKK 2RH6A 4O2DA 3S2HK 2E2HA 2R7ZA 4ZH4A 1C0AA 4P5BA 1DD5A 2BE5A 4AYBL 1XXBA 3L4KA 1SHNA 2CW0A 1KHJA 1JVIA 3UN5A 4LR9A 1VGXA 4KC6A 1KH4A 4NWJA 4PABA 1Y1VK 4G7OA 2W5SA 4OINA 4FDIA 2GSNA 3MK2A 1K83K 2Y3PA 3LAJA 1I6HC 3PO3C 1I3QC 4KN4A 4GTZA 2NVXC 4ZG7A 1Y1VC 1WSVA 4QIWL 3HOVK 4KM4A 3HOZC 2WB1D 1BS2A 4A3MC 1SFOA 1E33P 5CJ9A 1O99A 2G9YA 1ZVUA 1X31C 2NVXK 4B56A 2WB1L 4A3IK 1TWHA 4A3JC 2NVYK 3A8KA 3DXJA 1ALKA 1UV7A
chains in the Genus database with same CATH topology
1URBA 4UPIA 1EW8A 3DPCA 2ANHA 3BDHA 3TG0A 2W5RA 1EJJA 3IDDA 4YR1A 5EGHA 4UOPA 1N2KA 4GTYA 3UN2A 4LREA 2GSOA 4KAYA 5KXAA 1EW2A 1SHQA 4LRDA 1ELYA 1KHNA 3CMRA 1Y7AA 2QZUA 3E2DA 4KJDA 4KAVA 1KH5A 1EW9A 3BDFA 5LQQA 1ZEFA 2IUCA 2W5VA 3NKRA 3IGZB 1E3CP 3SZZA 5EGEA 1HDHA 3T02A 4MHXA 5GOVA 4KJGA 1EI6A 1KH9A 1AJCA 3LXQA 1ZEBA 3NKMA 1K7HA 2W5TA 4ZG6A 3NKOA 4CYRA 3M8WA 1B8JA 5LRMA 5IJSA 5L0KA 2VQRA 3BDGB 5DLVA 2IFYA 4NWXA 2XR9A 4MY4A 1E2SP 3WAYA 1E1ZP 1FSUA 3T01A 4UPKA 4UPLA 1ED8A 4LRAA 5INHA 3MK1A 1AJDA 2GSUA 4FDJA 3Q3QA 2D1GA 4LR8A 5TJ3A 1ALIA 3M8ZA 4LR2A 3BDGA 1AUKA 3DYCA 4GTXA 5L0EA 3NVLA 4UPHA 1ALHA 1URAA 3TWZA 1ANIA 1ZEDA 3NKPA 4ZGAA 1N2LA 5K4PA 1KHLA 4TN0A 3M8YA 5LIAA 1ELXA 3MK0A 3WAWA 4LRBA 4GTWA 3UO0A 5AJ9A 5GRRA 4CXKA 5IJQA 2W8DA 3IGYB 1HJKA 3TX0A 2GA3A 5L0BA 5HRTA 2GLQA 4LQYA 4UOOA 3SZYA 2RH6A 4LRFA 4ZG9A 2W5QA 3UNYA 3ED4A 5C66A 3WAVA 1ALJA 1SHNA 3A52A 1EQJA 3WAXA 2XRGA 1KHJA 1KHKA 3NKNA 3UN5A 4LR9A 1KH4A 4NWJA 3B5QA 2W5SA 3M7VA 5DLWA 1ED9A 2ZKTA 2GSNA 1O98A 3MK2A 4FDIA 3WBHA 1P49A 2IUCB 4GTZA 4ZG7A 1ELZA 4CYSA 2W5WA 4KM4A 4LRCA 3UN3A 4QAXA 4N7TA 1AJBA 1E33P 4CXUA 3T00A 1HQAA 1O99A 2G9YA 2X98A 2W8SA 1AJAA 1Y6VA 4B56A 2W5XA 3KD8A 3OT9A 5LRNA 4CXSA 1KH7A 1ANJA 4LR7A 1ALKA 4UORA 5DLTA 4MIVA 3NKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1URB A;  4UPI A;  1EW8 A;  3DPC A;  2ANH A;  3BDH A;  3TG0 A;  2W5R A;  1EJJ A;  3IDD A;  4YR1 A;  5EGH A;  4UOP A;  1N2K A;  4GTY A;  3UN2 A;  4LRE A;  2GSO A;  4KAY A;  5KXA A;  1EW2 A;  1SHQ A;  4LRD A;  1ELY A;  1KHN A;  3CMR A;  1Y7A A;  2QZU A;  3E2D A;  4KJD A;  4KAV A;  1KH5 A;  1EW9 A;  3BDF A;  5LQQ A;  1ZEF A;  2IUC A;  2W5V A;  3NKR A;  3IGZ B;  1E3C P;  3SZZ A;  5EGE A;  1HDH A;  3T02 A;  4MHX A;  5GOV A;  4KJG A;  1EI6 A;  1KH9 A;  1AJC A;  3LXQ A;  1ZEB A;  3NKM A;  1K7H A;  2W5T A;  4ZG6 A;  3NKO A;  4CYR A;  3M8W A;  1B8J A;  5LRM A;  5IJS A;  5L0K A;  2VQR A;  3BDG B;  5DLV A;  2IFY A;  4NWX A;  2XR9 A;  4MY4 A;  1E2S P;  3WAY A;  1E1Z P;  1FSU A;  3T01 A;  4UPK A;  4UPL A;  1ED8 A;  4LRA A;  5INH A;  3MK1 A;  1AJD A;  2GSU A;  4FDJ A;  3Q3Q A;  2D1G A;  4LR8 A;  5TJ3 A;  1ALI A;  3M8Z A;  4LR2 A;  3BDG A;  1AUK A;  3DYC A;  4GTX A;  5L0E A;  3NVL A;  4UPH A;  1ALH A;  1URA A;  3TWZ A;  1ANI A;  1ZED A;  3NKP A;  4ZGA A;  1N2L A;  5K4P A;  1KHL A;  4TN0 A;  3M8Y A;  5LIA A;  1ELX A;  3MK0 A;  3WAW A;  4LRB A;  4GTW A;  3UO0 A;  5AJ9 A;  5GRR A;  4CXK A;  5IJQ A;  2W8D A;  3IGY B;  1HJK A;  3TX0 A;  2GA3 A;  5L0B A;  5HRT A;  2GLQ A;  4LQY A;  4UOO A;  3SZY A;  2RH6 A;  4LRF A;  4ZG9 A;  2W5Q A;  3UNY A;  3ED4 A;  5C66 A;  3WAV A;  1ALJ A;  1SHN A;  3A52 A;  1EQJ A;  3WAX A;  2XRG A;  1KHJ A;  1KHK A;  3NKN A;  3UN5 A;  4LR9 A;  1KH4 A;  4NWJ A;  3B5Q A;  2W5S A;  3M7V A;  5DLW A;  1ED9 A;  2ZKT A;  2GSN A;  1O98 A;  3MK2 A;  4FDI A;  3WBH A;  1P49 A;  2IUC B;  4GTZ A;  4ZG7 A;  1ELZ A;  4CYS A;  2W5W A;  4KM4 A;  4LRC A;  3UN3 A;  4QAX A;  4N7T A;  1AJB A;  1E33 P;  4CXU A;  3T00 A;  1HQA A;  1O99 A;  2G9Y A;  2X98 A;  2W8S A;  1AJA A;  1Y6V A;  4B56 A;  2W5X A;  3KD8 A;  3OT9 A;  5LRN A;  4CXS A;  1KH7 A;  1ANJ A;  4LR7 A;  1ALK A;  4UOR A;  5DLT A;  4MIV A;  3NKQ A; 
#chains in the Genus database with same CATH topology
 4GTF A;  4UPI A;  3TG0 A;  3NUH A;  2EBB A;  5EGH A;  1VRQ C;  3IPJ A;  5FJ8 K;  4UOP A;  1N2K A;  4GTY A;  5IYC C;  1G51 A;  4GTE A;  1K83 A;  3GDZ A;  4AYB D;  1B4B A;  2PA8 L;  3WOD A;  1O25 A;  2E2I K;  3AQP A;  3GEE A;  5LQQ A;  2Y0S L;  1ZEF A;  2IUC A;  2W5V A;  2B63 C;  1O26 A;  3IGZ B;  4A3K K;  1GE9 A;  1AJC A;  1KH9 A;  3LXQ A;  1K7H A;  4WIL A;  4CYR A;  3I4M K;  3M4O K;  2R92 C;  2E2J K;  2P8T A;  1XZP A;  5IYB C;  4XSX A;  2IFY A;  4YFN A;  4MY4 A;  3I4M C;  2JA5 C;  2GAG C;  1EH1 A;  3V4G A;  1JOE A;  3HOW C;  3N0C A;  4UPL A;  1ED8 A;  1Y1W A;  4C3I C;  5IYB K;  4XSZ A;  1AJD A;  1WCM C;  4XCH A;  3Q3Q A;  4LK0 A;  2A6E A;  3M8Z A;  3BP8 C;  5L0E A;  4A3G K;  1ALH A;  3GTO K;  1O28 A;  1ANI A;  2A68 A;  3A8I A;  4BBS C;  3NKP A;  4A3C K;  3S1R C;  5E68 A;  3HOZ K;  1N2L A;  2JA6 K;  3S1M C;  5LIA A;  1IW7 A;  1PJ6 A;  1TWC C;  2P5M A;  4WJ3 M;  3S1R K;  3GTG C;  4KAR A;  1WQG A;  4A3J K;  4LJZ A;  3RZO K;  2NVQ K;  1XPP A;  2GLQ A;  4DDQ A;  2CFA B;  2PMZ D;  4GTL A;  3S15 C;  3UNY A;  5M3M K;  3WAV A;  4C45 A;  1ALJ A;  1O29 A;  2CFA A;  2KWA A;  3A52 A;  2XRG A;  5CHP A;  3TFH A;  4PAA A;  1TWF K;  1ZQ1 C;  3ERE D;  1J6X A;  1ED9 A;  2YU9 A;  3WBH A;  5M5X K;  3G4C A;  4AH6 A;  4QIW D;  1TWF C;  3GTM A;  1ELZ A;  2W5W A;  4LRC A;  4CYS A;  1KQ4 A;  1F7V A;  4GTC A;  1AJB A;  4CXU A;  1O2A A;  4LK1 A;  5IOQ A;  4Q4Z A;  2JA6 A;  5M5Y K;  3PO3 K;  3HOU C;  4CXS A;  4XLN A;  1L0W A;  2VUM A;  4LR7 A;  3HOV C;  4A3D K;  4MIV A;  3NKQ A;  4KN7 A;  4GTD A;  3TTG A;  3DPC A;  3BDH A;  3N3Y A;  2VUM C;  1I6V A;  2JA8 C;  3MML B;  3CAG A;  4BLA A;  1Y1W K;  3UN2 A;  4BY7 C;  4A93 K;  4ILD A;  3CQZ A;  4GTB A;  2JA7 C;  5KXA A;  5TMC A;  2NVT K;  3HKZ D;  2VUM K;  4LRD A;  4A3B C;  2O5J A;  1KHN A;  4BXX K;  5FLM K;  4Y7N C;  4KJD A;  4QJV A;  3BDF A;  4KM8 A;  2NVT C;  2FQO A;  1VJE A;  3K7A C;  1RU0 A;  3FOF A;  1J6W A;  1HDH A;  3GTP C;  4Y52 K;  2W5T A;  3NKM A;  4C3J K;  3EQL A;  5LRM A;  2D6F C;  3OPF A;  5IP7 K;  4BBR K;  5IYD C;  4KAT A;  3GTQ K;  2E2I A;  5DLV A;  3TFJ A;  1F9N A;  5HL8 A;  4Y52 C;  4C3H C;  4P5A A;  5IOT A;  3GTQ A;  4C3J C;  4C2M C;  1R9T C;  4UPK A;  3A8J A;  3GTQ C;  3MK1 A;  5INH A;  1WSR A;  2XCQ A;  1INN A;  3VA7 A;  4X6A C;  5C3E K;  4JK1 A;  1HQM A;  3M4O C;  2R92 K;  5TJ3 A;  4KM9 A;  1ZBS A;  3AD8 C;  2RGR A;  3H3V L;  1USM A;  4UPH A;  1F7U A;  3ORE A;  3TWZ A;  3TFI A;  3GTJ C;  1ZED A;  1WOP A;  4A3E C;  3S1N C;  1BJT A;  1WQH A;  5K4P A;  3CQZ C;  2JA7 A;  5L46 A;  5IOS A;  2O5I A;  4KMA A;  3MK0 A;  4OIR A;  5D4D A;  1SFO K;  2V6T A;  3S1N K;  3G4A A;  3H0G K;  5C44 C;  3AD9 C;  3CQZ K;  5AJ9 A;  3S1Q C;  4KMU A;  3GIR A;  1EFW A;  2JA5 A;  4BBS K;  4A3C C;  1WIH A;  4LQY A;  3GEI A;  4ZG9 A;  4LRF A;  2JA6 C;  3S1M K;  2W5Q A;  1DCO A;  1ZXO A;  3H3V D;  3ED4 A;  3S1Q K;  5C66 A;  1TWC K;  1EQJ A;  1KHK A;  3NKN A;  4G0V A;  2JA7 K;  3B5Q A;  1VH2 A;  3S14 K;  3BUE A;  1O98 A;  4KB2 A;  2IUC B;  2YU9 C;  3S14 C;  1PJ5 A;  3ADA C;  3GTJ A;  3UN3 A;  2V6S A;  4QAX A;  4N7T A;  4GTA A;  2X98 A;  2YU9 K;  1K83 C;  1TWF A;  1I6H K;  1AJA A;  1Y6V A;  2FQT A;  3KD8 A;  1WOS A;  1KH7 A;  4BBR C;  1ZYR A;  4FZB A;  5DLT A;  4GZY A;  1R9T A;  3GTG A;  1F93 A;  1XZQ B;  3L4J A;  1EW8 A;  4A3L K;  1URB A;  2ANH A;  3HXA A;  4KAW X;  1TWH C;  3IDD A;  4YR1 A;  2E2I C;  3N0B A;  2B63 K;  3GEH A;  5C3E C;  4KAY A;  4LRE A;  2PA8 D;  1SHQ A;  5M3F K;  4A3L C;  4A3K C;  4BKW A;  3GTP A;  1TWH K;  3CMR A;  2QZU A;  4A3D C;  4KAV A;  4KMH A;  1BDF A;  4MQ9 A;  5IYC K;  4BLB A;  1I3Q A;  1WCM A;  4OIP A;  1WQF A;  5EGE A;  3SZZ A;  1Y1W C;  1E3C P;  5IP9 K;  4MHX A;  5GOV A;  3I4N C;  4KJG A;  1EI6 A;  3S17 C;  4ZG6 A;  1O2F B;  2JA5 K;  3HOY K;  3PO2 C;  4A3B K;  3NKO A;  3OEP A;  1XZP B;  5L0K A;  3K7A K;  1JQW A;  4KAS A;  5M5W K;  1E2S P;  1EK8 A;  4A3G C;  5C4X C;  1E1Z P;  1FSU A;  1HI9 A;  4G7Z A;  4FM9 A;  2E2J C;  2E2H K;  2GSU A;  3GTK A;  4FDJ A;  2D1G A;  2B63 A;  5IP7 C;  5IYD K;  1ALI A;  3S2D K;  5IOR A;  2R92 A;  3NVL A;  4C3H K;  3HOW K;  4GFQ A;  3GTL K;  3GTG K;  4A3F K;  1R9T K;  4NOI A;  2XCR B;  4ZGA A;  1IL2 A;  1J6V A;  3GTM C;  3RZO C;  4TN0 A;  3QX3 A;  1ELX A;  3WAW A;  3RZD C;  4LRB A;  4A3F C;  3GTO C;  1YCL A;  4WJ4 A;  3BP3 A;  1O24 A;  5IJQ A;  1HJK A;  5HRT A;  1J98 A;  2GA3 A;  1USO A;  4RMF A;  1TWG A;  2WAQ D;  1I3Q K;  2NVY A;  3WAX A;  1IE0 A;  3JST A;  4YG2 A;  1XXC A;  4J3N A;  4A3M K;  1SFO C;  1IBA A;  1IQ0 A;  1XZQ A;  3S0X A;  5C44 K;  2R93 K;  3M7V A;  3S16 K;  5DLW A;  2NVX A;  2ZKT A;  1TWC A;  2PHC B;  4A3I C;  3S15 K;  1P49 A;  4BY1 C;  2W7V A;  1DCP A;  1IS1 A;  3S16 C;  3HOU K;  5JFE A;  1WOO A;  4YFK A;  2ZUE A;  1B4A A;  2WAQ L;  1ISE A;  3T00 A;  3I4N K;  1HQA A;  2JH3 A;  1BGW A;  1Y1V A;  1O27 A;  2W8S A;  2Y0S D;  2W5X A;  1VLO A;  3OT9 A;  5LRN A;  4A93 C;  5C4J C;  1TWA K;  1ANJ A;  4G7H A;  4KDD A;  4OIQ A;  4UOR A;  1O2B A;  2A6H A;  1I50 K;  2R7Z K;  1WOR A;  4KMD A;  2A69 A;  4BXX C;  2W5R A;  4Y7N K;  4YFX A;  1EJJ A;  2ZUF A;  1DCH A;  3FKI C;  2E2H C;  2GSO A;  1I50 C;  5JVO A;  1PJ7 A;  2R7Z C;  1YNN A;  4MEX A;  1EW2 A;  1EQR A;  3GSI A;  1TWA A;  3FHZ A;  5TMF A;  1ELY A;  3S2D C;  1Y7A A;  1YNJ A;  3E2D A;  2JA8 K;  2PMZ L;  3FKI K;  3LPX A;  1KH5 A;  1EW9 A;  3GTL C;  4Q5S A;  4BY7 K;  4OIO A;  2PPB A;  3NKR A;  3AD7 C;  4GT9 A;  3T02 A;  5FLM C;  3H0G A;  3RZD K;  1ZEB A;  4C3I K;  1XXA A;  3M8W A;  1WCM K;  1B8J A;  3AQO A;  2NVY C;  2XCO A;  4KB4 A;  4X6A K;  2VQR A;  5IJS A;  3BDG B;  2R93 A;  4MEY A;  4NWX A;  1TWG C;  2ZFZ A;  2XR9 A;  1AB4 A;  3WAY A;  3GTP K;  3AH5 A;  5IP9 C;  3T01 A;  3S17 K;  4LOW A;  4G0W A;  4LRA A;  3HOY C;  3PO2 K;  1SMY A;  3GTO A;  4P9S A;  1TWG K;  4LR8 A;  1YX2 A;  2R93 C;  4G0U A;  4QJV B;  4LR2 A;  3LAP A;  3BDG A;  1AUK A;  3DYC A;  4GTX A;  4C2M K;  4XLP A;  1URA A;  2NVQ C;  4BY1 K;  1V5V A;  3FOE A;  3H0G C;  5C4X K;  4LLG A;  1KHL A;  2V6U A;  3M8Y A;  3FKI A;  3HKZ L;  3M3Y C;  3GTL A;  4GTW A;  3HOX C;  3GTK C;  3UO0 A;  3S2H C;  3GTJ K;  5GRR A;  4A3E K;  4CXK A;  2W8D A;  2GAH C;  5C4J K;  3IGY B;  3TX0 A;  1TWA C;  5L0B A;  4M1X A;  4UOO A;  3M3Y K;  1I50 A;  3SZY A;  3HOX K;  3GTM K;  3GTK K;  2RH6 A;  4O2D A;  3S2H K;  2E2H A;  2R7Z A;  4ZH4 A;  1C0A A;  4P5B A;  1DD5 A;  2BE5 A;  4AYB L;  1XXB A;  3L4K A;  1SHN A;  2CW0 A;  1KHJ A;  1JVI A;  3UN5 A;  4LR9 A;  1VGX A;  4KC6 A;  1KH4 A;  4NWJ A;  4PAB A;  1Y1V K;  4G7O A;  2W5S A;  4OIN A;  4FDI A;  2GSN A;  3MK2 A;  1K83 K;  2Y3P A;  3LAJ A;  1I6H C;  3PO3 C;  1I3Q C;  4KN4 A;  4GTZ A;  2NVX C;  4ZG7 A;  1Y1V C;  1WSV A;  4QIW L;  3HOV K;  4KM4 A;  3HOZ C;  2WB1 D;  1BS2 A;  4A3M C;  1SFO A;  1E33 P;  5CJ9 A;  1O99 A;  2G9Y A;  1ZVU A;  1X31 C;  2NVX K;  4B56 A;  2WB1 L;  4A3I K;  1TWH A;  4A3J C;  2NVY K;  3A8K A;  3DXJ A;  1ALK A;  1UV7 A; 
#chains in the Genus database with same CATH homology
 1URB A;  4UPI A;  1EW8 A;  3DPC A;  2ANH A;  3BDH A;  3TG0 A;  2W5R A;  1EJJ A;  3IDD A;  4YR1 A;  5EGH A;  4UOP A;  1N2K A;  4GTY A;  3UN2 A;  4LRE A;  2GSO A;  4KAY A;  5KXA A;  1EW2 A;  1SHQ A;  4LRD A;  1ELY A;  1KHN A;  3CMR A;  1Y7A A;  2QZU A;  3E2D A;  4KJD A;  4KAV A;  1KH5 A;  1EW9 A;  3BDF A;  5LQQ A;  1ZEF A;  2IUC A;  2W5V A;  3NKR A;  3IGZ B;  1E3C P;  3SZZ A;  5EGE A;  1HDH A;  3T02 A;  4MHX A;  5GOV A;  4KJG A;  1EI6 A;  1KH9 A;  1AJC A;  3LXQ A;  1ZEB A;  3NKM A;  1K7H A;  2W5T A;  4ZG6 A;  3NKO A;  4CYR A;  3M8W A;  1B8J A;  5LRM A;  5IJS A;  5L0K A;  2VQR A;  3BDG B;  5DLV A;  2IFY A;  4NWX A;  2XR9 A;  4MY4 A;  1E2S P;  3WAY A;  1E1Z P;  1FSU A;  3T01 A;  4UPK A;  4UPL A;  1ED8 A;  4LRA A;  5INH A;  3MK1 A;  1AJD A;  2GSU A;  4FDJ A;  3Q3Q A;  2D1G A;  4LR8 A;  5TJ3 A;  1ALI A;  3M8Z A;  4LR2 A;  3BDG A;  1AUK A;  3DYC A;  4GTX A;  5L0E A;  3NVL A;  4UPH A;  1ALH A;  1URA A;  3TWZ A;  1ANI A;  1ZED A;  3NKP A;  4ZGA A;  1N2L A;  5K4P A;  1KHL A;  4TN0 A;  3M8Y A;  5LIA A;  1ELX A;  3MK0 A;  3WAW A;  4LRB A;  4GTW A;  3UO0 A;  5AJ9 A;  5GRR A;  4CXK A;  5IJQ A;  2W8D A;  3IGY B;  1HJK A;  3TX0 A;  2GA3 A;  5L0B A;  5HRT A;  2GLQ A;  4LQY A;  4UOO A;  3SZY A;  2RH6 A;  4LRF A;  4ZG9 A;  2W5Q A;  3UNY A;  3ED4 A;  5C66 A;  3WAV A;  1ALJ A;  1SHN A;  3A52 A;  1EQJ A;  3WAX A;  2XRG A;  1KHJ A;  1KHK A;  3NKN A;  3UN5 A;  4LR9 A;  1KH4 A;  4NWJ A;  3B5Q A;  2W5S A;  3M7V A;  5DLW A;  1ED9 A;  2ZKT A;  2GSN A;  1O98 A;  3MK2 A;  4FDI A;  3WBH A;  1P49 A;  2IUC B;  4GTZ A;  4ZG7 A;  1ELZ A;  4CYS A;  2W5W A;  4KM4 A;  4LRC A;  3UN3 A;  4QAX A;  4N7T A;  1AJB A;  1E33 P;  4CXU A;  3T00 A;  1HQA A;  1O99 A;  2G9Y A;  2X98 A;  2W8S A;  1AJA A;  1Y6V A;  4B56 A;  2W5X A;  3KD8 A;  3OT9 A;  5LRN A;  4CXS A;  1KH7 A;  1ANJ A;  4LR7 A;  1ALK A;  4UOR A;  5DLT A;  4MIV A;  3NKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...