3T01A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with phosphonoformate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
b'MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphonoacetate hydrolase
molecule tags Hydrolase/hydrolase inhibitor
source organism Sinorhizobium meliloti
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t01A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t01A01
3MK2A 1EQJA 5IJSA 1AUKA 3M8ZA 2W8SA 2GLQA 3UN2A 1O98A 4LR2A 3UN5A 4UPLA 2W5XA 4LRBA 4CYSA 2IUCB 4ZG6A 1AJBA 4LREA 1Y6VA 1ZEDA 3NKPA 2W5WA 3E2DA 1AJCA 5LQQA 1ALHA 1EW8A 3UN3A 4QAXA 1B8JA 2RH6A 1N2KA 3SZYA 1ELZA 4KJGA 3TG0A 3TX0A 4LRCA 4LR8A 1E3CP 4B56A 3BDFA 3DYCA 5L0KA 1URAA 3IGYB 4ZGAA 1P49A 4MIVA 1ZEFA 1Y7AA 1EI6A 5TJ3A 4KM4A 3T01A 4N7TA 3WAXA 3UO0A 4KAVA 1O99A 1ALKA 1KHNA 4CXUA 1ALIA 1ANJA 1SHQA 2GSUA 3ED4A 4GTXA 3NKOA 4LR7A 4LQYA 3BDHA 5K4PA 1URBA 1HDHA 4CYRA 1EW2A 5INHA 1ED8A 3BDGB 5DLVA 1ANIA 5C66A 3NKQA 3WAYA 3T02A 4NWJA 2W5TA 4UOOA 3IDDA 4UPKA 2IUCA 4LRFA 3TWZA 1KHKA 4UOPA 2IFYA 2QZUA 3B5QA 3M8WA 2W5SA 1ELXA 3MK1A 2ANHA 3MK0A 5L0BA 5LRMA 5KXAA 4MHXA 3WBHA 3NKRA 4ZG7A 1KHLA 5L0EA 2X98A 3NVLA 4NWXA 3NKNA 4KJDA 5LIAA 1ELYA 3M7VA 2GA3A 1KH9A 4GTYA 5EGEA 1FSUA 3SZZA 2D1GA 4FDJA 1EJJA 2VQRA 4CXKA 2W8DA 3BDGA 1KHJA 3KD8A 3NKMA 4ZG9A 3T00A 2W5VA 3M8YA 3DPCA 4LR9A 3IGZB 2XRGA 3LXQA 2GSOA 1N2LA 2W5QA 1E33P 4FDIA 4GTZA 1AJDA 4UORA 5DLWA 3UNYA 3WAVA 4CXSA 5HRTA 3Q3QA 1ALJA 4LRAA 2GSNA 5DLTA 2XR9A 1SHNA 1KH4A 2ZKTA 5AJ9A 1HJKA 2W5RA 3A52A 4LRDA 1EW9A 3WAWA 4YR1A 3CMRA 1E2SP 1AJAA 2G9YA 5GRRA 5LRNA 1E1ZP 3OT9A 1ED9A 1KH7A 4TN0A 5EGHA 4UPIA 4GTWA 4MY4A 5GOVA 1HQAA 1K7HA 4KAYA 5IJQA 1KH5A 1ZEBA 4UPHA
chains in the Genus database with same CATH superfamily
3MK2A 1I50C 1TWCK 4LJZA 3I4MK 4P9SA 3UN2A 1TWGC 4XSZA 1O98A 4UPLA 1K83C 4P5BA 4LRBA 4A3KC 4OINA 1AJBA 4RMFA 4LREA 1INNA 1Y6VA 3HOVC 4KMDA 3BUEA 1BGWA 4DDQA 1EH1A 1WOSA 4A3IC 3LAPA 1O2BA 4QAXA 2RH6A 2P5MA 1N2KA 3SZYA 1ELZA 5C44K 4YFNA 3VA7A 4BY7K 1E3CP 1XZPA 1K83K 4MEYA 1SFOA 4BLAA 3I4MC 1O29A 3BDFA 3DYCA 5L0KA 1URAA 2E2HC 1VRQC 3IGYB 4ZGAA 1USMA 4MIVA 3PO2C 1PJ6A 4GT9A 3UO0A 4KAVA 4C3JC 3H0GC 1ALKA 4C3IK 4A3JK 2VUMA 4CXUA 2WB1L 4LQYA 4YFXA 3BDHA 5K4PA 1Y1VA 2B63K 2NVYK 1URBA 4CYRA 3S2DK 1JVIA 5C3EK 2R92C 3G4CA 5C66A 1VH2A 1R9TA 3LPXA 3MMLB 3T02A 4NWJA 4UOOA 3AH5A 4XCHA 3S2HC 5M3MK 4KMUA 1IW7A 5IYBK 1ZYRA 4UPKA 1WQFA 4LRFA 1O27A 2CW0A 3M8WA 1JOEA 2W5SA 2XCQA 4GTLA 2ANHA 3MK1A 3MK0A 2NVYC 4OIQA 2O5IA 3HOWC 5IORA 1BJTA 1F7VA 3S1QK 3NKRA 2FQTA 5FLMK 1DCHA 5L0EA 1Y1VC 2X98A 5E68A 1I3QA 4OIRA 3GTLK 3NKNA 5D4DA 4KJDA 1XXCA 1B4BA 1TWGA 4LLGA 4C2MK 3LAJA 3G4AA 3TTGA 4LRDA 4G7ZA 3S17K 2GAGC 4BY1K 4GTYA 5HL8A 1ISEA 2E2HK 4O2DA 1FSUA 2ZUEA 2JA7K 3S14K 1I6HK 1VJEA 2W7VA 1G51A 5L46A 4KN4A 4A3FC 3GTPC 4QIWL 3DPCA 2E2HA 4FDIA 2GSOA 1E33P 3K7AK 1AJDA 1WQHA 4Y7NK 5C4JK 4WJ3M 1EQRA 4KM9A 3GTJK 2E2JC 1ALJA 1WCMK 4FZBA 4A3CC 2ZKTA 3ERED 5AJ9A 1HJKA 4GTDA 2W5RA 1DD5A 3WAWA 4OIOA 4YR1A 5LRNA 2A6HA 1E1ZP 2R93C 4TN0A 1IE0A 2R7ZC 4MY4A 3OPFA 1I6VA 1O26A 1XPPA 3S0XA 1USOA 2JA6K 1YNNA 4XSXA 3DXJA 3S16K 4G0VA 5JVOA 1EK8A 4ILDA 1R9TC 4LR2A 4A3BC 4A3DK 2EBBA 2A68A 4A3GC 2NVYA 1EFWA 5IP7C 3BP3A 1BS2A 4KARA 3GTMK 3NKPA 5LQQA 4GZYA 4GTBA 4Y52K 4C3HC 3M3YK 3WODA 3GTLA 3A8JA 2NVTC 2V6TA 4LRCA 3TX0A 3CQZC 1L0WA 2ZUFA 3GTMA 3FKIK 2JA8K 4P5AA 2B63A 4KN7A 1UV7A 3CQZK 5M5WK 1P49A 1ZEFA 4QJVA 1Y7AA 3HOYK 1WORA 3FKIA 5JFEA 4C3HK 2JA5K 3M3YC 2R7ZA 1XXAA 3AQPA 1O99A 3GEIA 3GTMC 1O24A 1BDFA 4LR7A 3GTQK 3S15C 3QX3A 2WB1D 4A3DC 2R93A 3HOXC 2V6UA 3GIRA 3S1RK 1O28A 2FQOA 3GEHA 2JA5C 4G7OA 1I3QK 4XLPA 2IUCA 4LOWA 2QZUA 2YU9K 3GTOK 5IOTA 3FKIC 2JA8C 5L0BA 3RZOC 3TFJA 1WSRA 4KMAA 1HQMA 5KXAA 3GDZA 3M4OC 3WBHA 2NVTK 4BLBA 3GTOA 1KQ4A 2ZFZA 1O2FB 2XCRB 3M7VA 3V4GA 4BXXK 1TWAA 4A3FK 3GTPK 1Y1WK 1TWHC 4FDJA 5IOQA 1I6HC 1IBAA 4A3BK 1R9TK 3S14C 1KHJA 3KD8A 1TWAK 3M8YA 4BY1C 3LXQA 1N2LA 2W5QA 5HRTA 3UNYA 2KWAA 4CXSA 2BE5A 2GSNA 4A3MC 5DLTA 1Y1VK 2R7ZK 2JA5A 1KH4A 3H0GA 1SHNA 2PPBA 3GTKK 3A52A 3S1QC 3HOWK 3CMRA 1E2SP 1ED9A 3UN5A 4ZH4A 4YG2A 4UPIA 1PJ7A 4GTWA 5IJQA 3I4NK 5M3FK 3CQZA 1V5VA 4Y7NC 5C4JC 4UPHA 1WOPA 4MEXA 1EQJA 5IJSA 4JK1A 1AUKA 2W8SA 4KM8A 3N3YA 3S1MC 3S2DC 3CAGA 2W5XA 4CYSA 3ADAC 2IUCB 4ZG6A 1TWHA 2Y0SD 4C2MC 2W5WA 3E2DA 4C3JK 1AJCA 1X31C 3UN3A 3H3VD 3TG0A 1F93A 1HI9A 3OREA 4M1XA 1ZBSA 4A3LK 3H3VL 1J98A 4B56A 2PA8D 1IQ0A 1JQWA 3HKZL 4OIPA 3GTQA 4BY7C 5C44C 3GEEA 1YCLA 1C0AA 5TJ3A 3S2HK 1YX2A 4A3IK 4GTEA 1GE9A 3I4NC 3AD9C 4BBSC 1SMYA 3HXAA 1O2AA 1ALIA 2R92K 3HOVK 2GSUA 1SHQA 3ED4A 3NKOA 4GTXA 4NOIA 2B63C 4A3KK 1HDHA 5INHA 2XCOA 1O25A 1ANIA 4A3JC 4C3IC 3NKQA 4A3MK 2W5TA 1TWFA 1B4AA 3PO2K 3S1NC 3TWZA 3IPJA 4UOPA 2IFYA 3B5QA 1TWCA 1Y1WC 2GAHC 4A3EK 2WAQL 4MHXA 4BXXC 5IOSA 5TMCA 4G0WA 4ZG7A 3HKZD 1F9NA 3BP8C 4NWXA 2PA8L 4BBSK 3L4KA 5LIAA 1RU0A 5C4XK 3GTGA 1ELYA 1ZVUA 2YU9A 5EGEA 3PO3C 1TWFC 4A93C 4KMHA 4X6AK 2PMZD 3NUHA 3RZOK 2D1GA 4C45A 1EJJA 1TWGK 1XZQB 4KASA 2Y0SL 4KDDA 3EQLA 3GTOC 3NKMA 3AD7C 2W5VA 4A3LC 2PMZL 1TWCC 1VLOA 1VGXA 1I50K 4BKWA 1XXBA 2E2IA 1DCPA 2XR9A 5TMFA 3GTQC 4PABA 2CFAA 3N0CA 3TFHA 5M5XK 2NVQC 4QJVB 3S15K 1EW9A 4PAAA 4GTFA 3S1MK 1AJAA 3N0BA 2G9YA 5GRRA 1WCMA 5GOVA 1KH7A 2CFAB 5EGHA 1IL2A 4G7HA 1HQAA 4GTAA 4LK0A 1ZEBA 1AB4A 2A69A 3AQOA 3OEPA 3RZDK 4QIWD 4GTCA 5IP9K 5IYCC 4KB2A 4FM9A 3M8ZA 2GLQA 1YNJA 1DCOA 1ZXOA 3L4JA 1XZQA 1SFOK 1J6WA 3GTKC 1ZEDA 2P8TA 1ZQ1C 4BBRK 3JSTA 3HOZK 1IS1A 4YFKA 4WJ4A 1ALHA 1EW8A 4KC6A 4XLNA 5IYDK 1B8JA 1Y1WA 4KJGA 3GTGK 4LR8A 2VUMK 1TWAC 4A3GK 2E2IC 2NVXK 4Q4ZA 1TWHK 4Q5SA 1J6VA 3GTGC 1EI6A 2JA6C 4KB4A 4J3NA 5IYDC 5FJ8K 3T01A 4KM4A 4N7TA 3WAXA 2O5JA 3GTKA 1KHNA 1ANJA 2R93K 1WSVA 3M4OK 3HOUC 3HOUK 4AYBL 1EW2A 2JA7A 4A3CK 1ED8A 3BDGB 5DLVA 1WCMC 2YU9C 3WAYA 5CHPA 2E2JK 3GTJC 4AYBD 5IYCK 5IP9C 3K7AC 1I50A 2RGRA 3IDDA 2Y3PA 1I3QC 1J6XA 4AH6A 1KHKA 3FOFA 3S1RC 2JA6A 4WILA 5CJ9A 3HOXK 3FOEA 2NVXC 2E2IK 2A6EA 1ELXA 2JA7C 5LRMA 2D6FC 1PJ5A 1F7UA 2VUMC 1KHLA 3S17C 1XZPB 4G0UA 3GTPA 3NVLA 3GTLC 3HOZC 4GFQA 4BBRC 2R92A 2GA3A 3GSIA 5FLMC 1K83A 1WQGA 2V6SA 3HOYC 1KH9A 4KAWX 1SFOC 3SZZA 2VQRA 4CXKA 2W8DA 3BDGA 4ZG9A 3T00A 2PHCB 5M5YK 1TWFK 4A93K 2NVXA 4X6AC 3PO3K 4LR9A 3RZDC 3IGZB 2XRGA 5IYBC 5DLWA 4GTZA 4UORA 2WAQD 2JH3A 3WAVA 5C4XC 3Q3QA 4MQ9A 4Y52C 4LRAA 3A8IA 5IP7K 5C3EC 4LK1A 4A3EC 2NVQK 3A8KA 1WOOA 3OT9A 3TFIA 3H0GK 3FHZA 1K7HA 3AD8C 1WIHA 3S16C 4KAYA 4KATA 1KH5A 3S1NK 3GTJA
chains in the Genus database with same CATH topology
3MK2A 1EQJA 5IJSA 1AUKA 3M8ZA 2W8SA 2GLQA 3UN2A 1O98A 4LR2A 3UN5A 4UPLA 2W5XA 4LRBA 4CYSA 2IUCB 4ZG6A 1AJBA 4LREA 1Y6VA 1ZEDA 3NKPA 2W5WA 3E2DA 1AJCA 5LQQA 1ALHA 1EW8A 3UN3A 4QAXA 1B8JA 2RH6A 1N2KA 3SZYA 1ELZA 4KJGA 3TG0A 3TX0A 4LRCA 4LR8A 1E3CP 4B56A 3BDFA 3DYCA 5L0KA 1URAA 3IGYB 4ZGAA 1P49A 4MIVA 1ZEFA 1Y7AA 1EI6A 5TJ3A 4KM4A 3T01A 4N7TA 3WAXA 3UO0A 4KAVA 1O99A 1ALKA 1KHNA 4CXUA 1ALIA 1ANJA 1SHQA 2GSUA 3ED4A 4GTXA 3NKOA 4LR7A 4LQYA 3BDHA 5K4PA 1URBA 1HDHA 4CYRA 1EW2A 5INHA 1ED8A 3BDGB 5DLVA 1ANIA 5C66A 3NKQA 3WAYA 3T02A 4NWJA 2W5TA 4UOOA 3IDDA 4UPKA 2IUCA 4LRFA 3TWZA 1KHKA 4UOPA 2IFYA 2QZUA 3B5QA 3M8WA 2W5SA 1ELXA 3MK1A 2ANHA 3MK0A 5L0BA 5LRMA 5KXAA 4MHXA 3WBHA 3NKRA 4ZG7A 1KHLA 5L0EA 2X98A 3NVLA 4NWXA 3NKNA 4KJDA 5LIAA 1ELYA 3M7VA 2GA3A 1KH9A 4GTYA 5EGEA 1FSUA 3SZZA 2D1GA 4FDJA 1EJJA 2VQRA 4CXKA 2W8DA 3BDGA 1KHJA 3KD8A 3NKMA 4ZG9A 3T00A 2W5VA 3M8YA 3DPCA 4LR9A 3IGZB 2XRGA 3LXQA 2GSOA 1N2LA 2W5QA 1E33P 4FDIA 4GTZA 1AJDA 4UORA 5DLWA 3UNYA 3WAVA 4CXSA 5HRTA 3Q3QA 1ALJA 4LRAA 2GSNA 5DLTA 2XR9A 1SHNA 1KH4A 2ZKTA 5AJ9A 1HJKA 2W5RA 3A52A 4LRDA 1EW9A 3WAWA 4YR1A 3CMRA 1E2SP 1AJAA 2G9YA 5GRRA 5LRNA 1E1ZP 3OT9A 1ED9A 1KH7A 4TN0A 5EGHA 4UPIA 4GTWA 4MY4A 5GOVA 1HQAA 1K7HA 4KAYA 5IJQA 1KH5A 1ZEBA 4UPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MK2 A;  1EQJ A;  5IJS A;  1AUK A;  3M8Z A;  2W8S A;  2GLQ A;  3UN2 A;  1O98 A;  4LR2 A;  3UN5 A;  4UPL A;  2W5X A;  4LRB A;  4CYS A;  2IUC B;  4ZG6 A;  1AJB A;  4LRE A;  1Y6V A;  1ZED A;  3NKP A;  2W5W A;  3E2D A;  1AJC A;  5LQQ A;  1ALH A;  1EW8 A;  3UN3 A;  4QAX A;  1B8J A;  2RH6 A;  1N2K A;  3SZY A;  1ELZ A;  4KJG A;  3TG0 A;  3TX0 A;  4LRC A;  4LR8 A;  1E3C P;  4B56 A;  3BDF A;  3DYC A;  5L0K A;  1URA A;  3IGY B;  4ZGA A;  1P49 A;  4MIV A;  1ZEF A;  1Y7A A;  1EI6 A;  5TJ3 A;  4KM4 A;  3T01 A;  4N7T A;  3WAX A;  3UO0 A;  4KAV A;  1O99 A;  1ALK A;  1KHN A;  4CXU A;  1ALI A;  1ANJ A;  1SHQ A;  2GSU A;  3ED4 A;  4GTX A;  3NKO A;  4LR7 A;  4LQY A;  3BDH A;  5K4P A;  1URB A;  1HDH A;  4CYR A;  1EW2 A;  5INH A;  1ED8 A;  3BDG B;  5DLV A;  1ANI A;  5C66 A;  3NKQ A;  3WAY A;  3T02 A;  4NWJ A;  2W5T A;  4UOO A;  3IDD A;  4UPK A;  2IUC A;  4LRF A;  3TWZ A;  1KHK A;  4UOP A;  2IFY A;  2QZU A;  3B5Q A;  3M8W A;  2W5S A;  1ELX A;  3MK1 A;  2ANH A;  3MK0 A;  5L0B A;  5LRM A;  5KXA A;  4MHX A;  3WBH A;  3NKR A;  4ZG7 A;  1KHL A;  5L0E A;  2X98 A;  3NVL A;  4NWX A;  3NKN A;  4KJD A;  5LIA A;  1ELY A;  3M7V A;  2GA3 A;  1KH9 A;  4GTY A;  5EGE A;  1FSU A;  3SZZ A;  2D1G A;  4FDJ A;  1EJJ A;  2VQR A;  4CXK A;  2W8D A;  3BDG A;  1KHJ A;  3KD8 A;  3NKM A;  4ZG9 A;  3T00 A;  2W5V A;  3M8Y A;  3DPC A;  4LR9 A;  3IGZ B;  2XRG A;  3LXQ A;  2GSO A;  1N2L A;  2W5Q A;  1E33 P;  4FDI A;  4GTZ A;  1AJD A;  4UOR A;  5DLW A;  3UNY A;  3WAV A;  4CXS A;  5HRT A;  3Q3Q A;  1ALJ A;  4LRA A;  2GSN A;  5DLT A;  2XR9 A;  1SHN A;  1KH4 A;  2ZKT A;  5AJ9 A;  1HJK A;  2W5R A;  3A52 A;  4LRD A;  1EW9 A;  3WAW A;  4YR1 A;  3CMR A;  1E2S P;  1AJA A;  2G9Y A;  5GRR A;  5LRN A;  1E1Z P;  3OT9 A;  1ED9 A;  1KH7 A;  4TN0 A;  5EGH A;  4UPI A;  4GTW A;  4MY4 A;  5GOV A;  1HQA A;  1K7H A;  4KAY A;  5IJQ A;  1KH5 A;  1ZEB A;  4UPH A; 
#chains in the Genus database with same CATH topology
 3MK2 A;  1I50 C;  1TWC K;  4LJZ A;  3I4M K;  4P9S A;  3UN2 A;  1TWG C;  4XSZ A;  1O98 A;  4UPL A;  1K83 C;  4P5B A;  4LRB A;  4A3K C;  4OIN A;  1AJB A;  4RMF A;  4LRE A;  1INN A;  1Y6V A;  3HOV C;  4KMD A;  3BUE A;  1BGW A;  4DDQ A;  1EH1 A;  1WOS A;  4A3I C;  3LAP A;  1O2B A;  4QAX A;  2RH6 A;  2P5M A;  1N2K A;  3SZY A;  1ELZ A;  5C44 K;  4YFN A;  3VA7 A;  4BY7 K;  1E3C P;  1XZP A;  1K83 K;  4MEY A;  1SFO A;  4BLA A;  3I4M C;  1O29 A;  3BDF A;  3DYC A;  5L0K A;  1URA A;  2E2H C;  1VRQ C;  3IGY B;  4ZGA A;  1USM A;  4MIV A;  3PO2 C;  1PJ6 A;  4GT9 A;  3UO0 A;  4KAV A;  4C3J C;  3H0G C;  1ALK A;  4C3I K;  4A3J K;  2VUM A;  4CXU A;  2WB1 L;  4LQY A;  4YFX A;  3BDH A;  5K4P A;  1Y1V A;  2B63 K;  2NVY K;  1URB A;  4CYR A;  3S2D K;  1JVI A;  5C3E K;  2R92 C;  3G4C A;  5C66 A;  1VH2 A;  1R9T A;  3LPX A;  3MML B;  3T02 A;  4NWJ A;  4UOO A;  3AH5 A;  4XCH A;  3S2H C;  5M3M K;  4KMU A;  1IW7 A;  5IYB K;  1ZYR A;  4UPK A;  1WQF A;  4LRF A;  1O27 A;  2CW0 A;  3M8W A;  1JOE A;  2W5S A;  2XCQ A;  4GTL A;  2ANH A;  3MK1 A;  3MK0 A;  2NVY C;  4OIQ A;  2O5I A;  3HOW C;  5IOR A;  1BJT A;  1F7V A;  3S1Q K;  3NKR A;  2FQT A;  5FLM K;  1DCH A;  5L0E A;  1Y1V C;  2X98 A;  5E68 A;  1I3Q A;  4OIR A;  3GTL K;  3NKN A;  5D4D A;  4KJD A;  1XXC A;  1B4B A;  1TWG A;  4LLG A;  4C2M K;  3LAJ A;  3G4A A;  3TTG A;  4LRD A;  4G7Z A;  3S17 K;  2GAG C;  4BY1 K;  4GTY A;  5HL8 A;  1ISE A;  2E2H K;  4O2D A;  1FSU A;  2ZUE A;  2JA7 K;  3S14 K;  1I6H K;  1VJE A;  2W7V A;  1G51 A;  5L46 A;  4KN4 A;  4A3F C;  3GTP C;  4QIW L;  3DPC A;  2E2H A;  4FDI A;  2GSO A;  1E33 P;  3K7A K;  1AJD A;  1WQH A;  4Y7N K;  5C4J K;  4WJ3 M;  1EQR A;  4KM9 A;  3GTJ K;  2E2J C;  1ALJ A;  1WCM K;  4FZB A;  4A3C C;  2ZKT A;  3ERE D;  5AJ9 A;  1HJK A;  4GTD A;  2W5R A;  1DD5 A;  3WAW A;  4OIO A;  4YR1 A;  5LRN A;  2A6H A;  1E1Z P;  2R93 C;  4TN0 A;  1IE0 A;  2R7Z C;  4MY4 A;  3OPF A;  1I6V A;  1O26 A;  1XPP A;  3S0X A;  1USO A;  2JA6 K;  1YNN A;  4XSX A;  3DXJ A;  3S16 K;  4G0V A;  5JVO A;  1EK8 A;  4ILD A;  1R9T C;  4LR2 A;  4A3B C;  4A3D K;  2EBB A;  2A68 A;  4A3G C;  2NVY A;  1EFW A;  5IP7 C;  3BP3 A;  1BS2 A;  4KAR A;  3GTM K;  3NKP A;  5LQQ A;  4GZY A;  4GTB A;  4Y52 K;  4C3H C;  3M3Y K;  3WOD A;  3GTL A;  3A8J A;  2NVT C;  2V6T A;  4LRC A;  3TX0 A;  3CQZ C;  1L0W A;  2ZUF A;  3GTM A;  3FKI K;  2JA8 K;  4P5A A;  2B63 A;  4KN7 A;  1UV7 A;  3CQZ K;  5M5W K;  1P49 A;  1ZEF A;  4QJV A;  1Y7A A;  3HOY K;  1WOR A;  3FKI A;  5JFE A;  4C3H K;  2JA5 K;  3M3Y C;  2R7Z A;  1XXA A;  3AQP A;  1O99 A;  3GEI A;  3GTM C;  1O24 A;  1BDF A;  4LR7 A;  3GTQ K;  3S15 C;  3QX3 A;  2WB1 D;  4A3D C;  2R93 A;  3HOX C;  2V6U A;  3GIR A;  3S1R K;  1O28 A;  2FQO A;  3GEH A;  2JA5 C;  4G7O A;  1I3Q K;  4XLP A;  2IUC A;  4LOW A;  2QZU A;  2YU9 K;  3GTO K;  5IOT A;  3FKI C;  2JA8 C;  5L0B A;  3RZO C;  3TFJ A;  1WSR A;  4KMA A;  1HQM A;  5KXA A;  3GDZ A;  3M4O C;  3WBH A;  2NVT K;  4BLB A;  3GTO A;  1KQ4 A;  2ZFZ A;  1O2F B;  2XCR B;  3M7V A;  3V4G A;  4BXX K;  1TWA A;  4A3F K;  3GTP K;  1Y1W K;  1TWH C;  4FDJ A;  5IOQ A;  1I6H C;  1IBA A;  4A3B K;  1R9T K;  3S14 C;  1KHJ A;  3KD8 A;  1TWA K;  3M8Y A;  4BY1 C;  3LXQ A;  1N2L A;  2W5Q A;  5HRT A;  3UNY A;  2KWA A;  4CXS A;  2BE5 A;  2GSN A;  4A3M C;  5DLT A;  1Y1V K;  2R7Z K;  2JA5 A;  1KH4 A;  3H0G A;  1SHN A;  2PPB A;  3GTK K;  3A52 A;  3S1Q C;  3HOW K;  3CMR A;  1E2S P;  1ED9 A;  3UN5 A;  4ZH4 A;  4YG2 A;  4UPI A;  1PJ7 A;  4GTW A;  5IJQ A;  3I4N K;  5M3F K;  3CQZ A;  1V5V A;  4Y7N C;  5C4J C;  4UPH A;  1WOP A;  4MEX A;  1EQJ A;  5IJS A;  4JK1 A;  1AUK A;  2W8S A;  4KM8 A;  3N3Y A;  3S1M C;  3S2D C;  3CAG A;  2W5X A;  4CYS A;  3ADA C;  2IUC B;  4ZG6 A;  1TWH A;  2Y0S D;  4C2M C;  2W5W A;  3E2D A;  4C3J K;  1AJC A;  1X31 C;  3UN3 A;  3H3V D;  3TG0 A;  1F93 A;  1HI9 A;  3ORE A;  4M1X A;  1ZBS A;  4A3L K;  3H3V L;  1J98 A;  4B56 A;  2PA8 D;  1IQ0 A;  1JQW A;  3HKZ L;  4OIP A;  3GTQ A;  4BY7 C;  5C44 C;  3GEE A;  1YCL A;  1C0A A;  5TJ3 A;  3S2H K;  1YX2 A;  4A3I K;  4GTE A;  1GE9 A;  3I4N C;  3AD9 C;  4BBS C;  1SMY A;  3HXA A;  1O2A A;  1ALI A;  2R92 K;  3HOV K;  2GSU A;  1SHQ A;  3ED4 A;  3NKO A;  4GTX A;  4NOI A;  2B63 C;  4A3K K;  1HDH A;  5INH A;  2XCO A;  1O25 A;  1ANI A;  4A3J C;  4C3I C;  3NKQ A;  4A3M K;  2W5T A;  1TWF A;  1B4A A;  3PO2 K;  3S1N C;  3TWZ A;  3IPJ A;  4UOP A;  2IFY A;  3B5Q A;  1TWC A;  1Y1W C;  2GAH C;  4A3E K;  2WAQ L;  4MHX A;  4BXX C;  5IOS A;  5TMC A;  4G0W A;  4ZG7 A;  3HKZ D;  1F9N A;  3BP8 C;  4NWX A;  2PA8 L;  4BBS K;  3L4K A;  5LIA A;  1RU0 A;  5C4X K;  3GTG A;  1ELY A;  1ZVU A;  2YU9 A;  5EGE A;  3PO3 C;  1TWF C;  4A93 C;  4KMH A;  4X6A K;  2PMZ D;  3NUH A;  3RZO K;  2D1G A;  4C45 A;  1EJJ A;  1TWG K;  1XZQ B;  4KAS A;  2Y0S L;  4KDD A;  3EQL A;  3GTO C;  3NKM A;  3AD7 C;  2W5V A;  4A3L C;  2PMZ L;  1TWC C;  1VLO A;  1VGX A;  1I50 K;  4BKW A;  1XXB A;  2E2I A;  1DCP A;  2XR9 A;  5TMF A;  3GTQ C;  4PAB A;  2CFA A;  3N0C A;  3TFH A;  5M5X K;  2NVQ C;  4QJV B;  3S15 K;  1EW9 A;  4PAA A;  4GTF A;  3S1M K;  1AJA A;  3N0B A;  2G9Y A;  5GRR A;  1WCM A;  5GOV A;  1KH7 A;  2CFA B;  5EGH A;  1IL2 A;  4G7H A;  1HQA A;  4GTA A;  4LK0 A;  1ZEB A;  1AB4 A;  2A69 A;  3AQO A;  3OEP A;  3RZD K;  4QIW D;  4GTC A;  5IP9 K;  5IYC C;  4KB2 A;  4FM9 A;  3M8Z A;  2GLQ A;  1YNJ A;  1DCO A;  1ZXO A;  3L4J A;  1XZQ A;  1SFO K;  1J6W A;  3GTK C;  1ZED A;  2P8T A;  1ZQ1 C;  4BBR K;  3JST A;  3HOZ K;  1IS1 A;  4YFK A;  4WJ4 A;  1ALH A;  1EW8 A;  4KC6 A;  4XLN A;  5IYD K;  1B8J A;  1Y1W A;  4KJG A;  3GTG K;  4LR8 A;  2VUM K;  1TWA C;  4A3G K;  2E2I C;  2NVX K;  4Q4Z A;  1TWH K;  4Q5S A;  1J6V A;  3GTG C;  1EI6 A;  2JA6 C;  4KB4 A;  4J3N A;  5IYD C;  5FJ8 K;  3T01 A;  4KM4 A;  4N7T A;  3WAX A;  2O5J A;  3GTK A;  1KHN A;  1ANJ A;  2R93 K;  1WSV A;  3M4O K;  3HOU C;  3HOU K;  4AYB L;  1EW2 A;  2JA7 A;  4A3C K;  1ED8 A;  3BDG B;  5DLV A;  1WCM C;  2YU9 C;  3WAY A;  5CHP A;  2E2J K;  3GTJ C;  4AYB D;  5IYC K;  5IP9 C;  3K7A C;  1I50 A;  2RGR A;  3IDD A;  2Y3P A;  1I3Q C;  1J6X A;  4AH6 A;  1KHK A;  3FOF A;  3S1R C;  2JA6 A;  4WIL A;  5CJ9 A;  3HOX K;  3FOE A;  2NVX C;  2E2I K;  2A6E A;  1ELX A;  2JA7 C;  5LRM A;  2D6F C;  1PJ5 A;  1F7U A;  2VUM C;  1KHL A;  3S17 C;  1XZP B;  4G0U A;  3GTP A;  3NVL A;  3GTL C;  3HOZ C;  4GFQ A;  4BBR C;  2R92 A;  2GA3 A;  3GSI A;  5FLM C;  1K83 A;  1WQG A;  2V6S A;  3HOY C;  1KH9 A;  4KAW X;  1SFO C;  3SZZ A;  2VQR A;  4CXK A;  2W8D A;  3BDG A;  4ZG9 A;  3T00 A;  2PHC B;  5M5Y K;  1TWF K;  4A93 K;  2NVX A;  4X6A C;  3PO3 K;  4LR9 A;  3RZD C;  3IGZ B;  2XRG A;  5IYB C;  5DLW A;  4GTZ A;  4UOR A;  2WAQ D;  2JH3 A;  3WAV A;  5C4X C;  3Q3Q A;  4MQ9 A;  4Y52 C;  4LRA A;  3A8I A;  5IP7 K;  5C3E C;  4LK1 A;  4A3E C;  2NVQ K;  3A8K A;  1WOO A;  3OT9 A;  3TFI A;  3H0G K;  3FHZ A;  1K7H A;  3AD8 C;  1WIH A;  3S16 C;  4KAY A;  4KAT A;  1KH5 A;  3S1N K;  3GTJ A; 
#chains in the Genus database with same CATH homology
 3MK2 A;  1EQJ A;  5IJS A;  1AUK A;  3M8Z A;  2W8S A;  2GLQ A;  3UN2 A;  1O98 A;  4LR2 A;  3UN5 A;  4UPL A;  2W5X A;  4LRB A;  4CYS A;  2IUC B;  4ZG6 A;  1AJB A;  4LRE A;  1Y6V A;  1ZED A;  3NKP A;  2W5W A;  3E2D A;  1AJC A;  5LQQ A;  1ALH A;  1EW8 A;  3UN3 A;  4QAX A;  1B8J A;  2RH6 A;  1N2K A;  3SZY A;  1ELZ A;  4KJG A;  3TG0 A;  3TX0 A;  4LRC A;  4LR8 A;  1E3C P;  4B56 A;  3BDF A;  3DYC A;  5L0K A;  1URA A;  3IGY B;  4ZGA A;  1P49 A;  4MIV A;  1ZEF A;  1Y7A A;  1EI6 A;  5TJ3 A;  4KM4 A;  3T01 A;  4N7T A;  3WAX A;  3UO0 A;  4KAV A;  1O99 A;  1ALK A;  1KHN A;  4CXU A;  1ALI A;  1ANJ A;  1SHQ A;  2GSU A;  3ED4 A;  4GTX A;  3NKO A;  4LR7 A;  4LQY A;  3BDH A;  5K4P A;  1URB A;  1HDH A;  4CYR A;  1EW2 A;  5INH A;  1ED8 A;  3BDG B;  5DLV A;  1ANI A;  5C66 A;  3NKQ A;  3WAY A;  3T02 A;  4NWJ A;  2W5T A;  4UOO A;  3IDD A;  4UPK A;  2IUC A;  4LRF A;  3TWZ A;  1KHK A;  4UOP A;  2IFY A;  2QZU A;  3B5Q A;  3M8W A;  2W5S A;  1ELX A;  3MK1 A;  2ANH A;  3MK0 A;  5L0B A;  5LRM A;  5KXA A;  4MHX A;  3WBH A;  3NKR A;  4ZG7 A;  1KHL A;  5L0E A;  2X98 A;  3NVL A;  4NWX A;  3NKN A;  4KJD A;  5LIA A;  1ELY A;  3M7V A;  2GA3 A;  1KH9 A;  4GTY A;  5EGE A;  1FSU A;  3SZZ A;  2D1G A;  4FDJ A;  1EJJ A;  2VQR A;  4CXK A;  2W8D A;  3BDG A;  1KHJ A;  3KD8 A;  3NKM A;  4ZG9 A;  3T00 A;  2W5V A;  3M8Y A;  3DPC A;  4LR9 A;  3IGZ B;  2XRG A;  3LXQ A;  2GSO A;  1N2L A;  2W5Q A;  1E33 P;  4FDI A;  4GTZ A;  1AJD A;  4UOR A;  5DLW A;  3UNY A;  3WAV A;  4CXS A;  5HRT A;  3Q3Q A;  1ALJ A;  4LRA A;  2GSN A;  5DLT A;  2XR9 A;  1SHN A;  1KH4 A;  2ZKT A;  5AJ9 A;  1HJK A;  2W5R A;  3A52 A;  4LRD A;  1EW9 A;  3WAW A;  4YR1 A;  3CMR A;  1E2S P;  1AJA A;  2G9Y A;  5GRR A;  5LRN A;  1E1Z P;  3OT9 A;  1ED9 A;  1KH7 A;  4TN0 A;  5EGH A;  4UPI A;  4GTW A;  4MY4 A;  5GOV A;  1HQA A;  1K7H A;  4KAY A;  5IJQ A;  1KH5 A;  1ZEB A;  4UPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...