3T0SA

Crystal structure of pseudomonas aeruginosa occk4 (opdl)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
389
structure length
361
Chain Sequence
LADSSAHLDLRNFYQLRDYRQSQAGNWSQGFVLRLQSGFTGGPLGFGLDATGLLGVKLPVDDYSHLGLTAKLRYSQTQLQVGILMPQLPVAFRDDVRLLPQTFDGALLTSSEIEGLTLTAGQLWKSRTRESDDMYIMGRDKAHASDEFNLAGATYAFTPRLSASYYYGQLKDIYRQHYLGLLHTLPLGEGLSLRSDLRYFDSGEDGAAISGPVDNRNLNAMLTLRAGAHAFGIGVQKMIGNDAFPVLNGYTTPYVANLMAYQTFTRPQEKSWQLRYDYDFAGLGLPGLNLMTRYVQGRDIDRGAGRADDSEWERNTDLSYVIQSGPLKSVALKWRNITYRSRYGADLDENRFIVNYTLKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords porin
total genus 92
structure length 361
sequence length 389
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3t0sA01
7PRNA 4RJWA 3WI4A 3SZDA 2XG6A 2J1NA 3K19A 2XE2A 4JFBA 3VZTX 3SYSA 8PRNA 3UU2A 3SY9A 4KR4A 3T0SA 4FRTA 3FYXA 4FOZA 2QTKA 4LSHA 4LSFA 4D65A 1HXXA 3POXA 3HWBA 2XE5A 5FVNA 1HXUA 2ZFGA 2PORA 4LSIA 3POUA 2J4UP 2ODJA 5DL7A 2FGRA 5DL8A 6PRNA 2Y0HA 3A2SX 3SZVA 3PRNA 4FSOA 5JDPA 1H6S1 1PRNA 1GFQA 3POQA 4C69X 3EMNX 3VZUX 4RJXA 3SY7A 1BH3A 2PRNA 3O0EA 3WI5A 4D64A 1MPFA 3T20A 2XE1A 3JTYA 4FRXA 4FSPA 3HW9A 4FMSA 2XE3A 1OPFA 4AUIA 4FT6A 5DL6A 4BUMX 1HXTA 1BT9A 4GCQA 1GFMA 4GCSA 3UPGA 3NSGA 2Y0LA 2FGQX 2Y0KA 5PRNA 3SYBA 2Y2XA 1OSMA 4KR8A 1GFNA 2ZLDA 4LSEA 5DL5A 3VY9X 4D5UA 2O4VA 3T24A 1PHOA 2OMFA 3VZWX 3VY8X 1GFPA 3PORA 4GCPA 1GFOA 2K4TA 1E54A 4KRAA
chains in the Genus database with same CATH superfamily
7PRNA 4RJWA 4RLBA 2MNHA 3HOEA 4N75A 3WI4A 3QRCA 3SZDA 2M06A 4UB6O 2XG6A 2J1NA 4AYID 3K19A 4O3WA 3A0BO 2XE2A 4N74A 4G76A 4IL6O 2LHFA 2KDYA 4JFBA 3QRAA 3VZTX 3A0HO 4U9CA 3AA1B 3SYSA 4C4VB 8PRNA 2LFUA 3UU2A 3SY9A 2JQYA 2Y7SA 4KR4A 2KXPB 1QJPA 3T0SA 4Z3TA 5H2FO 4FRTA 4AYMC 3FYXA 4FOZA 2QTKA 3AA7A 3G7GA 3PGRA 4LSHA 4AKMA 3AAAA 3BRYA 4LSFA 4D65A 1HXXA 4AYEC 3POXA 3HWBA 4PJ0O 2XE5A 4B61A 1Q9FA 5FVNA 4G75A 3AA6A 3JCUO 1HXUA 4K3CA 2PORA 2ZFGA 4CTDA 2XTRA 2YPVA 4LSIA 4O49A 4O4UA 3POUA 2R4OA 2KC0A 4XNKA 2J4UP 2ODJA 4F4BA 5DL7A 2FGRA 4RL9A 3LK2A 2R4LA 4GF4A 4PR7A 3C5OA 3GP6A 5DL8A 2WVPA 6PRNA 2F1TA 3BRZA 5AFUL 1S5LO 2Y0HA 2GE4A 3A2SX 2N2LA 3SZVA 1ZHTA 3PRNA 3LK42 4FSOA 1ZHXA 5JDPA 4O4XA 5E79O 1H6S1 3AA7B 3KVDD 4FZLA 2F1CX 2XTQA 2R4NA 5T5FA 1ZHZA 1PRNA 3AA1A 4AFKA 1GFQA 3POQA 5D5DA 3VE1A 5KAFO 4C69X 3DZMA 1T1LA 4N59A 4AYDC 3PQSA 3EMNX 2WJRA 3VZUX 4RJXA 4FZNA 3AA0B 3AAEB 2AXTO 2KZ7B 1BH3A 3SY7A 4AZLA 2PRNA 3AAAB 3NSGA 3LK3A 2X27X 3LK2B 3O0EA 4UB8O 3WI5A 4D64A 1IZNA 2XMXA 4O3XB 3RBHA 3DWNA 3DWOX 5EE2A 3WU2O 2WJQA 1ZHYA 3PGUA 1MPFA 3T20A 4N58A 2XE1A 2ERVA 1T16A 3JTYA 4FRXA 4FUVA 4FSPA 3BS0A 3HW9A 4C00A 5G3AA 5PRNA 4FMSA 2MHLA 5B5EO 5AFUK 2R8AA 2XE3A 1Q9GA 2R4PA 1OPFA 3SYBA 4AKRB 4AUIA 5ADXK 4O3YA 5G39A 4FT6A 3AAEA 5DL6A 2R88A 2R89A 5GTIO 3LK41 4BUMX 1HXTA 3LK3B 2W80C 4K3BA 1BT9A 3HOLA 3PQUA 1QJ9A 1G90A 3KZIO 4GCQA 3PGSA 1GFMA 4GCSA 5G38A 3UPGA 4FESA 2FGQX 1ORMA 1P4TA 1QJ8A 2Y0KA 2F1VA 1ZHWA 2X9KA 2Y0LA 1OSMA 2KZ7A 2Y2XA 2YNKA 3AA0A 3UAQA 5TISO 2IWWA 1IZNB 4KR8A 1GFNA 4RLCA 5B66O 5GV0A 2N2MA 4FZMA 2ZLDA 3DA4A 4GHBA 4LSEA 3VE2A 5GTHO 4O3ZA 4E1SA 2KXPA 2M07A 5DL5A 3PF1A 3VY9X 4D5UA 4AYNA 5KAIO 3NJTA 3DA3A 5G26A 3TZGA 2O4VA 2K0LA 4PUXA 4QQ1A 4C4VA 4FQEA 3T24A 3V8UA 4E1TA 1YS5A 5IYUA 1MM4A 1PHOA 2OMFA 3VZWX 3AA6B 1MM5A 3VY8X 4AKRA 1BXWA 4XNLA 2IWVA 1GFPA 3PORA 4JCHA 4GCPA 5ADXL 1GFOA 1THQA 2K4TA 1E54A 4KRAA 2JMMA 2W81C
chains in the Genus database with same CATH topology
7PRNA 4RJWA 4RLBA 2MNHA 3HOEA 3WI4A 3QRCA 3SZDA 2M06A 2XG6A 2J1NA 4AYID 3K19A 4O3WA 2XE2A 4G76A 2LHFA 2KDYA 4JFBA 3QRAA 3VZTX 4U9CA 3AA1B 3SYSA 8PRNA 2LFUA 3UU2A 3SY9A 2Y7SA 4KR4A 2KXPB 1QJPA 3T0SA 4Z3TA 4FRTA 4AYMC 3FYXA 4FOZA 2QTKA 3AA7A 3G7GA 4LSHA 4AKMA 3AAAA 4LSFA 4D65A 1HXXA 4AYEC 3POXA 3HWBA 2XE5A 4B61A 1Q9FA 5FVNA 4G75A 3AA6A 1HXUA 2ZFGA 2PORA 2XTRA 2YPVA 4LSIA 4O49A 4O4UA 3POUA 4XNKA 2KC0A 2J4UP 2ODJA 4F4BA 5DL7A 2FGRA 4RL9A 3LK2A 4GF4A 3C5OA 3GP6A 5DL8A 6PRNA 2F1TA 5AFUL 2Y0HA 2GE4A 3A2SX 2N2LA 3SZVA 1ZHTA 3PRNA 3LK42 4FSOA 1ZHXA 5JDPA 4O4XA 1H6S1 3AA7B 3KVDD 4FZLA 2XTQA 5T5FA 1ZHZA 1PRNA 3AA1A 4AFKA 1GFQA 3POQA 5D5DA 3VE1A 4C69X 4N59A 4AYDC 3PQSA 3EMNX 3VZUX 4RJXA 4FZNA 3AA0B 3AAEB 3SY7A 2KZ7B 1BH3A 4AZLA 2PRNA 3AAAB 3NSGA 3LK3A 2X27X 3LK2B 3O0EA 3WI5A 4D64A 1IZNA 2XMXA 4O3XB 3RBHA 5EE2A 1ZHYA 1MPFA 3T20A 4N58A 2XE1A 2ERVA 3JTYA 4FRXA 4FUVA 4FSPA 3HW9A 4FMSA 2MHLA 5AFUK 2XE3A 1Q9GA 1OPFA 4AKRB 4AUIA 5ADXK 4O3YA 4FT6A 3AAEA 5DL6A 4BUMX 3LK41 1HXTA 3LK3B 2W80C 1BT9A 3HOLA 3PQUA 1QJ9A 1G90A 4GCQA 1GFMA 4GCSA 3UPGA 2Y0LA 4FESA 2FGQX 1ORMA 1P4TA 1QJ8A 2Y0KA 2F1VA 1ZHWA 2Y2XA 2YNKA 1OSMA 2KZ7A 3AA0A 5PRNA 3SYBA 3UAQA 1IZNB 4KR8A 1GFNA 4RLCA 5GV0A 2N2MA 4FZMA 2ZLDA 3DA4A 4GHBA 4LSEA 3VE2A 4O3ZA 4E1SA 2KXPA 2M07A 5DL5A 3VY9X 4D5UA 4AYNA 3DA3A 5G26A 3TZGA 2O4VA 2K0LA 4PUXA 4QQ1A 3T24A 3V8UA 4E1TA 1YS5A 5IYUA 1MM4A 1PHOA 2OMFA 3VZWX 3AA6B 1MM5A 3VY8X 4AKRA 1BXWA 4XNLA 1GFPA 3PORA 4JCHA 4GCPA 5ADXL 1GFOA 1THQA 2K4TA 1E54A 4KRAA 2JMMA 2W81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7PRN A;  4RJW A;  3WI4 A;  3SZD A;  2XG6 A;  2J1N A;  3K19 A;  2XE2 A;  4JFB A;  3VZT X;  3SYS A;  8PRN A;  3UU2 A;  3SY9 A;  4KR4 A;  3T0S A;  4FRT A;  3FYX A;  4FOZ A;  2QTK A;  4LSH A;  4LSF A;  4D65 A;  1HXX A;  3POX A;  3HWB A;  2XE5 A;  5FVN A;  1HXU A;  2ZFG A;  2POR A;  4LSI A;  3POU A;  2J4U P;  2ODJ A;  5DL7 A;  2FGR A;  5DL8 A;  6PRN A;  2Y0H A;  3A2S X;  3SZV A;  3PRN A;  4FSO A;  5JDP A;  1H6S 1;  1PRN A;  1GFQ A;  3POQ A;  4C69 X;  3EMN X;  3VZU X;  4RJX A;  3SY7 A;  1BH3 A;  2PRN A;  3O0E A;  3WI5 A;  4D64 A;  1MPF A;  3T20 A;  2XE1 A;  3JTY A;  4FRX A;  4FSP A;  3HW9 A;  4FMS A;  2XE3 A;  1OPF A;  4AUI A;  4FT6 A;  5DL6 A;  4BUM X;  1HXT A;  1BT9 A;  4GCQ A;  1GFM A;  4GCS A;  3UPG A;  3NSG A;  2Y0L A;  2FGQ X;  2Y0K A;  5PRN A;  3SYB A;  2Y2X A;  1OSM A;  4KR8 A;  1GFN A;  2ZLD A;  4LSE A;  5DL5 A;  3VY9 X;  4D5U A;  2O4V A;  3T24 A;  1PHO A;  2OMF A;  3VZW X;  3VY8 X;  1GFP A;  3POR A;  4GCP A;  1GFO A;  2K4T A;  1E54 A;  4KRA A; 
#chains in the Genus database with same CATH topology
 7PRN A;  4RJW A;  4RLB A;  2MNH A;  3HOE A;  4N75 A;  3WI4 A;  3QRC A;  3SZD A;  2M06 A;  4UB6 O;  2XG6 A;  2J1N A;  4AYI D;  3K19 A;  4O3W A;  3A0B O;  2XE2 A;  4N74 A;  4G76 A;  4IL6 O;  2LHF A;  2KDY A;  4JFB A;  3QRA A;  3VZT X;  3A0H O;  4U9C A;  3AA1 B;  3SYS A;  4C4V B;  8PRN A;  2LFU A;  3UU2 A;  3SY9 A;  2JQY A;  2Y7S A;  4KR4 A;  2KXP B;  1QJP A;  3T0S A;  4Z3T A;  5H2F O;  4FRT A;  4AYM C;  3FYX A;  4FOZ A;  2QTK A;  3AA7 A;  3G7G A;  3PGR A;  4LSH A;  4AKM A;  3AAA A;  3BRY A;  4LSF A;  4D65 A;  1HXX A;  4AYE C;  3POX A;  3HWB A;  4PJ0 O;  2XE5 A;  4B61 A;  1Q9F A;  5FVN A;  4G75 A;  3AA6 A;  3JCU O;  1HXU A;  4K3C A;  2POR A;  2ZFG A;  4CTD A;  2XTR A;  2YPV A;  4LSI A;  4O49 A;  4O4U A;  3POU A;  2R4O A;  2KC0 A;  4XNK A;  2J4U P;  2ODJ A;  4F4B A;  5DL7 A;  2FGR A;  4RL9 A;  3LK2 A;  2R4L A;  4GF4 A;  4PR7 A;  3C5O A;  3GP6 A;  5DL8 A;  2WVP A;  6PRN A;  2F1T A;  3BRZ A;  5AFU L;  1S5L O;  2Y0H A;  2GE4 A;  3A2S X;  2N2L A;  3SZV A;  1ZHT A;  3PRN A;  3LK4 2;  4FSO A;  1ZHX A;  5JDP A;  4O4X A;  5E79 O;  1H6S 1;  3AA7 B;  3KVD D;  4FZL A;  2F1C X;  2XTQ A;  2R4N A;  5T5F A;  1ZHZ A;  1PRN A;  3AA1 A;  4AFK A;  1GFQ A;  3POQ A;  5D5D A;  3VE1 A;  5KAF O;  4C69 X;  3DZM A;  1T1L A;  4N59 A;  4AYD C;  3PQS A;  3EMN X;  2WJR A;  3VZU X;  4RJX A;  4FZN A;  3AA0 B;  3AAE B;  2AXT O;  2KZ7 B;  1BH3 A;  3SY7 A;  4AZL A;  2PRN A;  3AAA B;  3NSG A;  3LK3 A;  2X27 X;  3LK2 B;  3O0E A;  4UB8 O;  3WI5 A;  4D64 A;  1IZN A;  2XMX A;  4O3X B;  3RBH A;  3DWN A;  3DWO X;  5EE2 A;  3WU2 O;  2WJQ A;  1ZHY A;  3PGU A;  1MPF A;  3T20 A;  4N58 A;  2XE1 A;  2ERV A;  1T16 A;  3JTY A;  4FRX A;  4FUV A;  4FSP A;  3BS0 A;  3HW9 A;  4C00 A;  5G3A A;  5PRN A;  4FMS A;  2MHL A;  5B5E O;  5AFU K;  2R8A A;  2XE3 A;  1Q9G A;  2R4P A;  1OPF A;  3SYB A;  4AKR B;  4AUI A;  5ADX K;  4O3Y A;  5G39 A;  4FT6 A;  3AAE A;  5DL6 A;  2R88 A;  2R89 A;  5GTI O;  3LK4 1;  4BUM X;  1HXT A;  3LK3 B;  2W80 C;  4K3B A;  1BT9 A;  3HOL A;  3PQU A;  1QJ9 A;  1G90 A;  3KZI O;  4GCQ A;  3PGS A;  1GFM A;  4GCS A;  5G38 A;  3UPG A;  4FES A;  2FGQ X;  1ORM A;  1P4T A;  1QJ8 A;  2Y0K A;  2F1V A;  1ZHW A;  2X9K A;  2Y0L A;  1OSM A;  2KZ7 A;  2Y2X A;  2YNK A;  3AA0 A;  3UAQ A;  5TIS O;  2IWW A;  1IZN B;  4KR8 A;  1GFN A;  4RLC A;  5B66 O;  5GV0 A;  2N2M A;  4FZM A;  2ZLD A;  3DA4 A;  4GHB A;  4LSE A;  3VE2 A;  5GTH O;  4O3Z A;  4E1S A;  2KXP A;  2M07 A;  5DL5 A;  3PF1 A;  3VY9 X;  4D5U A;  4AYN A;  5KAI O;  3NJT A;  3DA3 A;  5G26 A;  3TZG A;  2O4V A;  2K0L A;  4PUX A;  4QQ1 A;  4C4V A;  4FQE A;  3T24 A;  3V8U A;  4E1T A;  1YS5 A;  5IYU A;  1MM4 A;  1PHO A;  2OMF A;  3VZW X;  3AA6 B;  1MM5 A;  3VY8 X;  4AKR A;  1BXW A;  4XNL A;  2IWV A;  1GFP A;  3POR A;  4JCH A;  4GCP A;  5ADX L;  1GFO A;  1THQ A;  2K4T A;  1E54 A;  4KRA A;  2JMM A;  2W81 C; 
#chains in the Genus database with same CATH homology
 7PRN A;  4RJW A;  4RLB A;  2MNH A;  3HOE A;  3WI4 A;  3QRC A;  3SZD A;  2M06 A;  2XG6 A;  2J1N A;  4AYI D;  3K19 A;  4O3W A;  2XE2 A;  4G76 A;  2LHF A;  2KDY A;  4JFB A;  3QRA A;  3VZT X;  4U9C A;  3AA1 B;  3SYS A;  8PRN A;  2LFU A;  3UU2 A;  3SY9 A;  2Y7S A;  4KR4 A;  2KXP B;  1QJP A;  3T0S A;  4Z3T A;  4FRT A;  4AYM C;  3FYX A;  4FOZ A;  2QTK A;  3AA7 A;  3G7G A;  4LSH A;  4AKM A;  3AAA A;  4LSF A;  4D65 A;  1HXX A;  4AYE C;  3POX A;  3HWB A;  2XE5 A;  4B61 A;  1Q9F A;  5FVN A;  4G75 A;  3AA6 A;  1HXU A;  2ZFG A;  2POR A;  2XTR A;  2YPV A;  4LSI A;  4O49 A;  4O4U A;  3POU A;  4XNK A;  2KC0 A;  2J4U P;  2ODJ A;  4F4B A;  5DL7 A;  2FGR A;  4RL9 A;  3LK2 A;  4GF4 A;  3C5O A;  3GP6 A;  5DL8 A;  6PRN A;  2F1T A;  5AFU L;  2Y0H A;  2GE4 A;  3A2S X;  2N2L A;  3SZV A;  1ZHT A;  3PRN A;  3LK4 2;  4FSO A;  1ZHX A;  5JDP A;  4O4X A;  1H6S 1;  3AA7 B;  3KVD D;  4FZL A;  2XTQ A;  5T5F A;  1ZHZ A;  1PRN A;  3AA1 A;  4AFK A;  1GFQ A;  3POQ A;  5D5D A;  3VE1 A;  4C69 X;  4N59 A;  4AYD C;  3PQS A;  3EMN X;  3VZU X;  4RJX A;  4FZN A;  3AA0 B;  3AAE B;  3SY7 A;  2KZ7 B;  1BH3 A;  4AZL A;  2PRN A;  3AAA B;  3NSG A;  3LK3 A;  2X27 X;  3LK2 B;  3O0E A;  3WI5 A;  4D64 A;  1IZN A;  2XMX A;  4O3X B;  3RBH A;  5EE2 A;  1ZHY A;  1MPF A;  3T20 A;  4N58 A;  2XE1 A;  2ERV A;  3JTY A;  4FRX A;  4FUV A;  4FSP A;  3HW9 A;  4FMS A;  2MHL A;  5AFU K;  2XE3 A;  1Q9G A;  1OPF A;  4AKR B;  4AUI A;  5ADX K;  4O3Y A;  4FT6 A;  3AAE A;  5DL6 A;  4BUM X;  3LK4 1;  1HXT A;  3LK3 B;  2W80 C;  1BT9 A;  3HOL A;  3PQU A;  1QJ9 A;  1G90 A;  4GCQ A;  1GFM A;  4GCS A;  3UPG A;  2Y0L A;  4FES A;  2FGQ X;  1ORM A;  1P4T A;  1QJ8 A;  2Y0K A;  2F1V A;  1ZHW A;  2Y2X A;  2YNK A;  1OSM A;  2KZ7 A;  3AA0 A;  5PRN A;  3SYB A;  3UAQ A;  1IZN B;  4KR8 A;  1GFN A;  4RLC A;  5GV0 A;  2N2M A;  4FZM A;  2ZLD A;  3DA4 A;  4GHB A;  4LSE A;  3VE2 A;  4O3Z A;  4E1S A;  2KXP A;  2M07 A;  5DL5 A;  3VY9 X;  4D5U A;  4AYN A;  3DA3 A;  5G26 A;  3TZG A;  2O4V A;  2K0L A;  4PUX A;  4QQ1 A;  3T24 A;  3V8U A;  4E1T A;  1YS5 A;  5IYU A;  1MM4 A;  1PHO A;  2OMF A;  3VZW X;  3AA6 B;  1MM5 A;  3VY8 X;  4AKR A;  1BXW A;  4XNL A;  1GFP A;  3POR A;  4JCH A;  4GCP A;  5ADX L;  1GFO A;  1THQ A;  2K4T A;  1E54 A;  4KRA A;  2JMM A;  2W81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...