3T0SA

Crystal structure of pseudomonas aeruginosa occk4 (opdl)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
389
structure length
361
Chain Sequence
LADSSAHLDLRNFYQLRDYRQSQAGNWSQGFVLRLQSGFTGGPLGFGLDATGLLGVKLPVDDYSHLGLTAKLRYSQTQLQVGILMPQLPVAFRDDVRLLPQTFDGALLTSSEIEGLTLTAGQLWKSRTRESDDMYIMGRDKAHASDEFNLAGATYAFTPRLSASYYYGQLKDIYRQHYLGLLHTLPLGEGLSLRSDLRYFDSGEDGAAISGPVDNRNLNAMLTLRAGAHAFGIGVQKMIGNDAFPVLNGYTTPYVANLMAYQTFTRPQEKSWQLRYDYDFAGLGLPGLNLMTRYVQGRDIDRGAGRADDSEWERNTDLSYVIQSGPLKSVALKWRNITYRSRYGADLDENRFIVNYTLKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords porin
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 92
structure length 361
sequence length 389
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3t0sA01
3SYSA 2QTKA 3NSGA 3PORA 4GCPA 2PRNA 3VZTX 1BT9A 3UU2A 1OSMA 1MPFA 1GFMA 1BH3A 2XE1A 3JTYA 1GFPA 7PRNA 3PRNA 1OPFA 3SYBA 3K19A 5DL6A 1HXXA 2OMFA 4KR4A 3WI4A 2J4UP 4KRAA 1HXUA 3SY7A 4D65A 1E54A 2FGQX 4FOZA 4FRXA 2XE3A 4LSHA 3A2SX 3HWBA 3T0SA 4LSFA 3VZWX 4RJWA 4LSEA 3SZDA 2Y0LA 4AUIA 2Y0HA 5FVNA 1PHOA 4BUMX 3EMNX 3O0EA 4D64A 3POQA 4GCQA 5JDPA 4FRTA 3UPGA 2Y0KA 3POUA 3POXA 8PRNA 3VZUX 3T20A 5PRNA 2FGRA 1GFOA 4D5UA 3SY9A 4FSPA 5DL5A 1GFQA 3WI5A 2XG6A 4JFBA 2Y2XA 2PORA 4C69X 4KR8A 4FMSA 3VY9X 4LSIA 2XE5A 6PRNA 4FT6A 2ODJA 3VY8X 3T24A 2ZFGA 2ZLDA 4GCSA 2J1NA 4FSOA 3FYXA 2XE2A 3HW9A 2K4TA 1H6S1 4RJXA 5DL8A 2O4VA 5DL7A 3SZVA 1HXTA 1PRNA 1GFNA
chains in the Genus database with same CATH superfamily
2YPVA 3AA0A 3SYSA 4AYDC 1P4TA 2QTKA 1MM5A 2WJQA 3NSGA 3PORA 4GCPA 1ORMA 4FUVA 2R4NA 2PRNA 1ZHXA 2R4OA 2R89A 3C5OA 3KZIO 4AKMA 2IWWA 7PRNA 3QRCA 1QJPA 3VZTX 4E1SA 1BT9A 4AKRB 4XNKA 3UU2A 4O3WA 4AKRA 4CTDA 1OSMA 1MPFA 1GFMA 1BH3A 2XE1A 3JTYA 1GFPA 2JMMA 3PF1A 4O3YA 3LK41 3PRNA 3PGSA 2XMXA 1OPFA 5G39A 3PGUA 1ZHZA 4XNLA 3SYBA 5GV0A 3K19A 2LFUA 5DL6A 2MNHA 4FESA 4AFKA 1HXXA 2KZ7B 3BRYA 2WVPA 2X9KA 2OMFA 1T16A 3TZGA 3LK3B 2KZ7A 5ADXL 4KR4A 2LHFA 3WI4A 2K0LA 2W81C 1Q9GA 3LK3A 4K3CA 4O4UA 5EE2A 5B66O 4KRAA 2N2LA 2J4UP 1HXUA 2KDYA 3SY7A 2R8AA 4C69X 3WU2O 3QRAA 4B61A 1QJ8A 4D65A 5ADXK 1E54A 2F1TA 1Q9FA 2FGQX 2JQYA 3PQUA 4FOZA 3AA6A 4FRXA 3A0BO 2XE3A 4LSHA 3A2SX 2R4LA 3HWBA 2M06A 5D5DA 4C4VB 3T0SA 2XTQA 4LSFA 4QQ1A 3VZWX 1YS5A 4FZLA 4RJWA 4C4VA 4LSEA 3SZDA 4N59A 2Y0LA 4AUIA 4U9CA 2Y0HA 3AAAB 3A0HO 4K3BA 4O4XA 4RLCA 2Y7SA 3GP6A 4JCHA 5FVNA 1PHOA 3AAAA 1ZHYA 3VE1A 4E1TA 1G90A 4BUMX 3EMNX 4IL6O 4RL9A 2ERVA 3O0EA 4O49A 4D64A 1THQA 4O3XB 3POQA 4UB8O 3V8UA 5GTHO 2M07A 4GCQA 4AYNA 5G3AA 2R4PA 5AFUK 5JDPA 2GE4A 4N58A 3AA6B 2KXPB 4FRTA 2Y0KA 3POUA 3UPGA 4AYEC 3POXA 3VE2A 4N75A 2KXPA 8PRNA 5H2FO 3BS0A 2YNKA 3VZUX 3T20A 5PRNA 2F1CX 5TISO 4PR7A 2FGRA 1GFOA 4FZNA 4D5UA 3KVDD 3LK2B 2N2MA 5GTIO 3DA3A 3SY9A 4AYMC 2WJRA 4FSPA 3LK2A 3BRZA 5DL5A 1S5LO 1GFQA 4N74A 4RLBA 3DWOX 3WI5A 2XG6A 5IYUA 4G76A 3DZMA 4JFBA 4G75A 5B5EO 4AYID 4FZMA 2Y2XA 3G7GA 2PORA 3AA1B 2R88A 1ZHTA 4KR8A 4UB6O 4FMSA 1T1LA 4LSIA 5E79O 5KAFO 1ZHWA 4GF4A 2AXTO 3AA1A 4GHBA 3VY9X 5AFUL 5G26A 2XE5A 3AA7B 3AAEB 2MHLA 6PRNA 2IWVA 4FT6A 2ODJA 5KAIO 3AAEA 3AA7A 2F1VA 3VY8X 3UAQA 3T24A 2W80C 2ZFGA 3HOLA 4C00A 2KC0A 2ZLDA 4GCSA 4AZLA 3PGRA 3DA4A 1QJ9A 2J1NA 3JCUO 1BXWA 4FSOA 3FYXA 4F4BA 2XE2A 3HW9A 4FQEA 3DWNA 2K4TA 1H6S1 3LK42 4RJXA 2XTRA 5DL8A 3NJTA 2O4VA 1IZNB 4O3ZA 3PQSA 4PJ0O 5DL7A 5T5FA 1MM4A 1HXTA 1PRNA 5G38A 3RBHA 1IZNA 2X27X 3SZVA 4Z3TA 3AA0B 3HOEA 4PUXA 1GFNA
chains in the Genus database with same CATH topology
2YPVA 3AA0A 3SYSA 4AYDC 1P4TA 2QTKA 1MM5A 3NSGA 3PORA 4GCPA 1ORMA 4FUVA 2PRNA 1ZHXA 4AKMA 3C5OA 3QRCA 1QJPA 3VZTX 4E1SA 1BT9A 4AKRB 4XNKA 3UU2A 4O3WA 4AKRA 1OSMA 1MPFA 1GFMA 1BH3A 2XE1A 3JTYA 1GFPA 2JMMA 4O3YA 7PRNA 3LK41 3PRNA 2XMXA 1OPFA 1ZHZA 4XNLA 3SYBA 5GV0A 3K19A 2LFUA 5DL6A 2MNHA 4FESA 4AFKA 1HXXA 2KZ7B 2OMFA 5ADXL 3TZGA 3LK3B 2KZ7A 4KR4A 2LHFA 3WI4A 2K0LA 2W81C 1Q9GA 3LK3A 4O4UA 5EE2A 2J4UP 4KRAA 2N2LA 1HXUA 2KDYA 3SY7A 4D65A 4B61A 3QRAA 5ADXK 1QJ8A 1E54A 2F1TA 1Q9FA 2FGQX 3PQUA 4FOZA 3AA6A 4FRXA 2XE3A 4LSHA 3A2SX 3HWBA 2M06A 5D5DA 3T0SA 2XTQA 4LSFA 4QQ1A 3VZWX 1YS5A 4FZLA 4RJWA 4LSEA 3SZDA 4N59A 2Y0LA 4AUIA 4U9CA 2Y0HA 3AAAB 4O4XA 4RLCA 2Y7SA 3GP6A 4JCHA 5FVNA 1PHOA 3AAAA 1ZHYA 3VE1A 4E1TA 1G90A 4BUMX 3EMNX 4RL9A 2ERVA 3O0EA 4O49A 4D64A 1THQA 4O3XB 3POQA 3V8UA 2M07A 4GCQA 4AYNA 5AFUK 5JDPA 2GE4A 4N58A 3AA6B 2KXPB 4FRTA 2Y0KA 3POUA 3UPGA 4AYEC 3POXA 3VE2A 2KXPA 8PRNA 2YNKA 3VZUX 3T20A 5PRNA 2FGRA 1GFOA 4FZNA 4D5UA 3KVDD 3LK2B 2N2MA 3SY9A 3DA3A 4AYMC 4FSPA 3LK2A 5DL5A 1GFQA 4RLBA 3WI5A 2XG6A 5IYUA 4G76A 4JFBA 4G75A 4AYID 4FZMA 2Y2XA 3G7GA 2PORA 3AA1B 4KR8A 1ZHTA 4C69X 4FMSA 3VY9X 4LSIA 5AFUL 1ZHWA 4GF4A 4GHBA 3AA1A 5G26A 2XE5A 3AA7B 3AAEB 2MHLA 6PRNA 4FT6A 2ODJA 3AAEA 3AA7A 2F1VA 3VY8X 3UAQA 3T24A 2W80C 2ZFGA 3HOLA 2KC0A 2ZLDA 4GCSA 4AZLA 3DA4A 1QJ9A 2J1NA 1BXWA 4FSOA 3FYXA 4F4BA 2XE2A 3HW9A 2K4TA 1H6S1 3LK42 4RJXA 2XTRA 5DL8A 2O4VA 1IZNB 4O3ZA 3PQSA 5DL7A 5T5FA 1MM4A 1HXTA 1PRNA 3RBHA 3SZVA 1IZNA 2X27X 4Z3TA 3AA0B 3HOEA 4PUXA 1GFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYS A;  2QTK A;  3NSG A;  3POR A;  4GCP A;  2PRN A;  3VZT X;  1BT9 A;  3UU2 A;  1OSM A;  1MPF A;  1GFM A;  1BH3 A;  2XE1 A;  3JTY A;  1GFP A;  7PRN A;  3PRN A;  1OPF A;  3SYB A;  3K19 A;  5DL6 A;  1HXX A;  2OMF A;  4KR4 A;  3WI4 A;  2J4U P;  4KRA A;  1HXU A;  3SY7 A;  4D65 A;  1E54 A;  2FGQ X;  4FOZ A;  4FRX A;  2XE3 A;  4LSH A;  3A2S X;  3HWB A;  3T0S A;  4LSF A;  3VZW X;  4RJW A;  4LSE A;  3SZD A;  2Y0L A;  4AUI A;  2Y0H A;  5FVN A;  1PHO A;  4BUM X;  3EMN X;  3O0E A;  4D64 A;  3POQ A;  4GCQ A;  5JDP A;  4FRT A;  3UPG A;  2Y0K A;  3POU A;  3POX A;  8PRN A;  3VZU X;  3T20 A;  5PRN A;  2FGR A;  1GFO A;  4D5U A;  3SY9 A;  4FSP A;  5DL5 A;  1GFQ A;  3WI5 A;  2XG6 A;  4JFB A;  2Y2X A;  2POR A;  4C69 X;  4KR8 A;  4FMS A;  3VY9 X;  4LSI A;  2XE5 A;  6PRN A;  4FT6 A;  2ODJ A;  3VY8 X;  3T24 A;  2ZFG A;  2ZLD A;  4GCS A;  2J1N A;  4FSO A;  3FYX A;  2XE2 A;  3HW9 A;  2K4T A;  1H6S 1;  4RJX A;  5DL8 A;  2O4V A;  5DL7 A;  3SZV A;  1HXT A;  1PRN A;  1GFN A; 
#chains in the Genus database with same CATH topology
 2YPV A;  3AA0 A;  3SYS A;  4AYD C;  1P4T A;  2QTK A;  1MM5 A;  2WJQ A;  3NSG A;  3POR A;  4GCP A;  1ORM A;  4FUV A;  2R4N A;  2PRN A;  1ZHX A;  2R4O A;  2R89 A;  3C5O A;  3KZI O;  4AKM A;  2IWW A;  7PRN A;  3QRC A;  1QJP A;  3VZT X;  4E1S A;  1BT9 A;  4AKR B;  4XNK A;  3UU2 A;  4O3W A;  4AKR A;  4CTD A;  1OSM A;  1MPF A;  1GFM A;  1BH3 A;  2XE1 A;  3JTY A;  1GFP A;  2JMM A;  3PF1 A;  4O3Y A;  3LK4 1;  3PRN A;  3PGS A;  2XMX A;  1OPF A;  5G39 A;  3PGU A;  1ZHZ A;  4XNL A;  3SYB A;  5GV0 A;  3K19 A;  2LFU A;  5DL6 A;  2MNH A;  4FES A;  4AFK A;  1HXX A;  2KZ7 B;  3BRY A;  2WVP A;  2X9K A;  2OMF A;  1T16 A;  3TZG A;  3LK3 B;  2KZ7 A;  5ADX L;  4KR4 A;  2LHF A;  3WI4 A;  2K0L A;  2W81 C;  1Q9G A;  3LK3 A;  4K3C A;  4O4U A;  5EE2 A;  5B66 O;  4KRA A;  2N2L A;  2J4U P;  1HXU A;  2KDY A;  3SY7 A;  2R8A A;  4C69 X;  3WU2 O;  3QRA A;  4B61 A;  1QJ8 A;  4D65 A;  5ADX K;  1E54 A;  2F1T A;  1Q9F A;  2FGQ X;  2JQY A;  3PQU A;  4FOZ A;  3AA6 A;  4FRX A;  3A0B O;  2XE3 A;  4LSH A;  3A2S X;  2R4L A;  3HWB A;  2M06 A;  5D5D A;  4C4V B;  3T0S A;  2XTQ A;  4LSF A;  4QQ1 A;  3VZW X;  1YS5 A;  4FZL A;  4RJW A;  4C4V A;  4LSE A;  3SZD A;  4N59 A;  2Y0L A;  4AUI A;  4U9C A;  2Y0H A;  3AAA B;  3A0H O;  4K3B A;  4O4X A;  4RLC A;  2Y7S A;  3GP6 A;  4JCH A;  5FVN A;  1PHO A;  3AAA A;  1ZHY A;  3VE1 A;  4E1T A;  1G90 A;  4BUM X;  3EMN X;  4IL6 O;  4RL9 A;  2ERV A;  3O0E A;  4O49 A;  4D64 A;  1THQ A;  4O3X B;  3POQ A;  4UB8 O;  3V8U A;  5GTH O;  2M07 A;  4GCQ A;  4AYN A;  5G3A A;  2R4P A;  5AFU K;  5JDP A;  2GE4 A;  4N58 A;  3AA6 B;  2KXP B;  4FRT A;  2Y0K A;  3POU A;  3UPG A;  4AYE C;  3POX A;  3VE2 A;  4N75 A;  2KXP A;  8PRN A;  5H2F O;  3BS0 A;  2YNK A;  3VZU X;  3T20 A;  5PRN A;  2F1C X;  5TIS O;  4PR7 A;  2FGR A;  1GFO A;  4FZN A;  4D5U A;  3KVD D;  3LK2 B;  2N2M A;  5GTI O;  3DA3 A;  3SY9 A;  4AYM C;  2WJR A;  4FSP A;  3LK2 A;  3BRZ A;  5DL5 A;  1S5L O;  1GFQ A;  4N74 A;  4RLB A;  3DWO X;  3WI5 A;  2XG6 A;  5IYU A;  4G76 A;  3DZM A;  4JFB A;  4G75 A;  5B5E O;  4AYI D;  4FZM A;  2Y2X A;  3G7G A;  2POR A;  3AA1 B;  2R88 A;  1ZHT A;  4KR8 A;  4UB6 O;  4FMS A;  1T1L A;  4LSI A;  5E79 O;  5KAF O;  1ZHW A;  4GF4 A;  2AXT O;  3AA1 A;  4GHB A;  3VY9 X;  5AFU L;  5G26 A;  2XE5 A;  3AA7 B;  3AAE B;  2MHL A;  6PRN A;  2IWV A;  4FT6 A;  2ODJ A;  5KAI O;  3AAE A;  3AA7 A;  2F1V A;  3VY8 X;  3UAQ A;  3T24 A;  2W80 C;  2ZFG A;  3HOL A;  4C00 A;  2KC0 A;  2ZLD A;  4GCS A;  4AZL A;  3PGR A;  3DA4 A;  1QJ9 A;  2J1N A;  3JCU O;  1BXW A;  4FSO A;  3FYX A;  4F4B A;  2XE2 A;  3HW9 A;  4FQE A;  3DWN A;  2K4T A;  1H6S 1;  3LK4 2;  4RJX A;  2XTR A;  5DL8 A;  3NJT A;  2O4V A;  1IZN B;  4O3Z A;  3PQS A;  4PJ0 O;  5DL7 A;  5T5F A;  1MM4 A;  1HXT A;  1PRN A;  5G38 A;  3RBH A;  1IZN A;  2X27 X;  3SZV A;  4Z3T A;  3AA0 B;  3HOE A;  4PUX A;  1GFN A; 
#chains in the Genus database with same CATH homology
 2YPV A;  3AA0 A;  3SYS A;  4AYD C;  1P4T A;  2QTK A;  1MM5 A;  3NSG A;  3POR A;  4GCP A;  1ORM A;  4FUV A;  2PRN A;  1ZHX A;  4AKM A;  3C5O A;  3QRC A;  1QJP A;  3VZT X;  4E1S A;  1BT9 A;  4AKR B;  4XNK A;  3UU2 A;  4O3W A;  4AKR A;  1OSM A;  1MPF A;  1GFM A;  1BH3 A;  2XE1 A;  3JTY A;  1GFP A;  2JMM A;  4O3Y A;  7PRN A;  3LK4 1;  3PRN A;  2XMX A;  1OPF A;  1ZHZ A;  4XNL A;  3SYB A;  5GV0 A;  3K19 A;  2LFU A;  5DL6 A;  2MNH A;  4FES A;  4AFK A;  1HXX A;  2KZ7 B;  2OMF A;  5ADX L;  3TZG A;  3LK3 B;  2KZ7 A;  4KR4 A;  2LHF A;  3WI4 A;  2K0L A;  2W81 C;  1Q9G A;  3LK3 A;  4O4U A;  5EE2 A;  2J4U P;  4KRA A;  2N2L A;  1HXU A;  2KDY A;  3SY7 A;  4D65 A;  4B61 A;  3QRA A;  5ADX K;  1QJ8 A;  1E54 A;  2F1T A;  1Q9F A;  2FGQ X;  3PQU A;  4FOZ A;  3AA6 A;  4FRX A;  2XE3 A;  4LSH A;  3A2S X;  3HWB A;  2M06 A;  5D5D A;  3T0S A;  2XTQ A;  4LSF A;  4QQ1 A;  3VZW X;  1YS5 A;  4FZL A;  4RJW A;  4LSE A;  3SZD A;  4N59 A;  2Y0L A;  4AUI A;  4U9C A;  2Y0H A;  3AAA B;  4O4X A;  4RLC A;  2Y7S A;  3GP6 A;  4JCH A;  5FVN A;  1PHO A;  3AAA A;  1ZHY A;  3VE1 A;  4E1T A;  1G90 A;  4BUM X;  3EMN X;  4RL9 A;  2ERV A;  3O0E A;  4O49 A;  4D64 A;  1THQ A;  4O3X B;  3POQ A;  3V8U A;  2M07 A;  4GCQ A;  4AYN A;  5AFU K;  5JDP A;  2GE4 A;  4N58 A;  3AA6 B;  2KXP B;  4FRT A;  2Y0K A;  3POU A;  3UPG A;  4AYE C;  3POX A;  3VE2 A;  2KXP A;  8PRN A;  2YNK A;  3VZU X;  3T20 A;  5PRN A;  2FGR A;  1GFO A;  4FZN A;  4D5U A;  3KVD D;  3LK2 B;  2N2M A;  3SY9 A;  3DA3 A;  4AYM C;  4FSP A;  3LK2 A;  5DL5 A;  1GFQ A;  4RLB A;  3WI5 A;  2XG6 A;  5IYU A;  4G76 A;  4JFB A;  4G75 A;  4AYI D;  4FZM A;  2Y2X A;  3G7G A;  2POR A;  3AA1 B;  4KR8 A;  1ZHT A;  4C69 X;  4FMS A;  3VY9 X;  4LSI A;  5AFU L;  1ZHW A;  4GF4 A;  4GHB A;  3AA1 A;  5G26 A;  2XE5 A;  3AA7 B;  3AAE B;  2MHL A;  6PRN A;  4FT6 A;  2ODJ A;  3AAE A;  3AA7 A;  2F1V A;  3VY8 X;  3UAQ A;  3T24 A;  2W80 C;  2ZFG A;  3HOL A;  2KC0 A;  2ZLD A;  4GCS A;  4AZL A;  3DA4 A;  1QJ9 A;  2J1N A;  1BXW A;  4FSO A;  3FYX A;  4F4B A;  2XE2 A;  3HW9 A;  2K4T A;  1H6S 1;  3LK4 2;  4RJX A;  2XTR A;  5DL8 A;  2O4V A;  1IZN B;  4O3Z A;  3PQS A;  5DL7 A;  5T5F A;  1MM4 A;  1HXT A;  1PRN A;  3RBH A;  3SZV A;  1IZN A;  2X27 X;  4Z3T A;  3AA0 B;  3HOE A;  4PUX A;  1GFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...