3T0VA

Unliganded fluorogen activating protein m8vl
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
EPVLTQSPSVSGTPGQKVTIFCSGSSSNVEDNSVYWYQQFPGTTPKVLIYNDDRRSSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCLSWDDSLNGWVFGGGTKVTVLDAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A variable light domain fluorogen activating protein homodimerizes to activate dimethylindole red.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dye-binding protein
molecule keywords immunoglobulin variable lambda domain
total genus 28
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3t0vA00
2IMMA 3VMPA 1FC2D 3VXMD 4C56D 2F5BL 1JWMB 1XCQB 1SEQH 2X4OB 3D85A 1MSPA 2E27L 3BX7C 3S34H 4U49A 2EEBA 4GW1A 2ORBL 5I74C 3QG7L 3GSXB 3QCVL 1B9ZA 3MODL 3CH1A 4PJGE 3OKYA 4JFEA 2ZP0T 3NIGE 1A6AB 2HTLC 4PJ9A 3JV6A 4HH9B 5JR1H 1QBAA 1DLFH 4JHWH 1MH5A 3B2VH 4KTDH 1I7TA 4EI5C 4P3WA 4J8RB 2VDRL 1IARB 3WDHA 1E4JA 3VG9B 4GKZB 4GMTH 1U3HC 5JLZB 5KJRH 2XT1B 1YZZA 4M7JL 3RFZC 1H5BA 4UUJB 4Q2ZB 1H3PL 4P2QE 4WV1A 3X3GH 1FE8H 1AO7E 1I1AD 3DX9B 2AK1L 1JBJA 3M45A 4KK9C 3BKCH 4R4NC 1JYWA 5D7LB 3LHPH 3RRQA 2C1OB 1FGNH 4LDOB 5E2JA 3KPOB 4PS4H 1MRDL 1W0YT 4KRPB 4LSQL 1LHZA 1K3IA 1TZGH 1NJ9B 1OARL 4PV9B 3HNTL 1EUTA 1PJ9A 1WBYA 3VG9C 2N1KA 1DBML 4HUVB 4P9MH 5DJAA 4XP6H 4ERSH 4J8RA 1VEPA 5JQ6H 1FV1B 3LEVH 1W8OA 1AIFA 1PEZA 1YY8A 1UB5A 1RPQA 2AS5M 3BUTA 1KTDA 3VI4E 2ICWA 3NPSB 1M71B 3CFEA 3AREA 4OQ1A 2UWEB 4U2ZA 3I3DA 3OJVC 4UQ3B 1I7UA 4GW4B 4RWYH 5E2WL 5JORB 3VXMB 4YAQB 2GITA 3JV0A 4KQ4L 3N50A 4OT1H 4TSBL 3SJVA 1F11B 4R4FH 4NO3B 2ARWA 2MJWA 3SY0B 3P30L 3WIHA 3KLAA 5L8LB 3QDHA 1V7MH 2ERJB 2XPGB 4FTVB 5CZVH 1CDBA 4HDIA 1P7KA 1T22A 1T5WB 2CR3A 4U6HA 3THML 1QEWB 3IFNH 1CU4H 4C59B 3MODH 4RGNE 1VGEH 1DJSA 5JDSA 1N3NA 5HYJB 3DX7B 3MLTB 4ZUTB 4GRMB 1GVIA 4P3DA 5DJ2B 1A6WL 3T0WA 4PRBA 1A1NA 3CDGB 1ZE3C 4N90E 5ALBH 1F45A 3RKDC 4KROB 3RJDA 3H8NA 5C0BB 3QNYB 1CLOL 3NZHL 2V2TA 3QRGH 5F89B 1BIIA 4EJ1C 4M7KL 4LVOB 4JHAH 3BGMA 3DXAA 3IS1X 4Y5YC 4P49A 4JPWL 1REIA 5FGBC 5EWIL 4WI6A 4OUOA 4H0GA 3HR5A 3RUGB 5C08B 1AKJA 2CK0L 5EO1B 4OLZH 3WFBH 3WKML 4C55A 4I18A 5EC1A 4MXWH 1ACZA 1R3JA 4P48A 1CFBA 5I30H 2Y36H 3JWOC 3MCLH 2C3VA 4KUZL 2FD6L 4OGAD 1P69B 1JPST 3RVTC 3OKOB 3TP4A 3KPLB 3BVNA 2HWZH 3FO0L 2XQBH 5I1IL 1XF2B 1T83C 4LHUG 3R06B 4N0YH 3UTTA 3LMJL 1W72L 3GHBH 4M7LH 1H5BC 1RFDL 1V5JA 4L3EE 2RR3A 2HFTA 2VDOH 4WI4A 5DT1H 1YA5A 4LARH 3IDJA 1D9KD 4G8IB 4XAWH 4NPYA 5FYJD 4DVBB 1QA9A 2MCPL 4CBPA 2YMXL 1MCJA 2EDLA 3WHE0 2QQQA 5FHBL 3VXME 2YBRA 3W39A 1I1RA 4BQ8A 2BNQA 4QXGH 4UAOB 3MLYH 4OLXH 1ZLSL 1FZJA 5LWYH 2APFA 5D2NC 5FYKL 4KJPD 1XF1A 1HHIA 1OW0C 5DEFB 1OLZA 3RX5A 4Y16D 3SPVA 1I1YB 4GAJH 4HV8A 3OKNA 3RQ3A 3X12A 4OLUH 2HJFA 4HWEH 4FZEH 3EFDL 1CLYH 1FZMA 3O2VH 5KSUB 4LSQH 3WO4C 3IDUA 3TN0A 3PNWA 4D0DA 3UTTB 2CDEB 4HWBA 4IBLT 3N9GL 4G80A 4F7MB 1JHTB 1EBAA 3BDBA 1AGDA 1U36A 3LPWA 3BZ4A 4RFOH 4APQC 4I0PB 4XPGL 4GAGL 2DQFA 4K94H 4KVCH 3BP6A 4IRZL 5ID0A 5HGHB 1GAFH 2NW2A 1M7DA 2GCYB 5KW9L 5FDWA 1EHXA 3BEVB 5JA9A 1YY9D 3PQYD 5DTFB 3SDDD 2WV3A 5ERWB 4X6EB 3BDXA 1T2QL 1XGYL 5IF0B 4W4OA 3BO8A 2D7MA 4RGNC 4G6KL 2VL4A 5FKAB 4I0CC 4P2OA 4N0CD 4RCAA 5C08A 3EFDH 3TIDB 2XQYK 4GLRH 1J0ZA 5DC0A 1FG9C 4HS8H 4UT7L 5HYJD 1F02I 1T1WB 5GIRB 3ZTJG 2W9LA 1MHCA 4M7JH 4G8GD 1T89A 1DBJH 2ZOKB 5DQJA 5IFHL 3ARGD 4ZFFB 2CDGA 4L4JA 5T1MA 4XCYB 3MBED 1CK0H 3WLWC 2XTLA 1FVEA 1RZ7L 4GRMA 1UJ3B 4N0YL 5D96B 2X05A 5I8CB 5FUZL 1A6WH 3ULVL 3FB6B 2Q3ZA 2PW2B 3V5DA 1ZVHA 5DGQA 5TH2B 2BRRH 1YEJL 3FO2A 3TBVA 3L3GB 3QG7H 3TIDA 3ZDXE 5KVGL 3PL6D 3MRHA 4KTEL 2FGWL 4JZOB 4HUWB 2Y25A 4W4OC 3S3SA 1CGTA 4PJIA 2ZUQB 4LRNL 4OF5A 5MI0C 4GRLB 3HE6A 2WIIB 1TZIB 4K7PL 5MHSE 4YO0A 5D1XA 4JVPA 3HKFA 5DA0B 1A7RH 2J8HA 1HK6A 1KPVA 1C5BH 1I4FB 1KUMA 4R26L 1OQOA 3L5XL 4I0PC 4W6XB 3PGFH 5CJ5A 4GJTB 5GS2D 3REWB 2XFXA 4PG9A 5BRZE 2AQ2A 3QJHB 3O3BB 2ESVA 3KPSD 4RMTA 3U0WH 3H9SA 5ISZE 2PTTA 4NGHH 4S1DC 2NTFA 4JR9H 1NJ9A 2EEDA 2J8UA 12E8L 2GK0B 2OX5A 3CZFA 4KRLB 1P4BL 3L3HA 5C07D 3MSPA 1CR9H 3OKDB 4TPRL 1Z9SA 5TDOA 3TPUA 4LDEB 3SO5A 4HS6A 2N7AA 4PJCE 1TENA 4DOHB 1FNEA 5D7JC 5EU3A 2YEZB 2CO6B 3HC0B 5FM5O 2YD8A 4BSVB 1Y6KR 4TNWK 4NZRL 1GH7A 2VQUA 3SGJA 2A77H 3ALWA 4OCMC 3E3QE 5SX4I 5TE6L 2E9WA 2FO4B 4ZOBA 3O3EA 4XP9H 1AP2A 3ARPA 4IMLB 3ES6A 1J1XL 1KULA 2FECI 2QBWA 4YIQB 4EUPG 3VH8G 5E03A 3BEWB 1JPTH 1KN4L 4KDVA 4M00A 1C5CL 2IADB 1Q38A 4PJFE 5GRYA 3NIFF 4OJFL 5B38G 5EIVA 3NCJH 1U8JB 2V2XA 3VFOA 4OCSH 3HC3L 4PBXA 4QLRA 1RIHH 4Y2DA 2FLRT 5LGKA 2WBWB 1E28B 3OJMB 1JF6A 3MLXH 4E42A 4DKEL 4AY0A 3OZ9L 4JEGB 4K94L 4ODUB 3VWKD 2HKFL 3GSNA 2M8XA 2R8SH 1SYSB 2XKNA 3PP3K 4XCNA 3VXRD 4AL8L 3MLPA 1AC0A 2JB6A 3X14A 2JELL 2BY1A 1ETZA 4LCIL 1BD2A 2FZ3B 2IC2A 1TJIH 4NNPL 4NBZB 1MAML 5DJCA 3KR3H 4D2NA 4YFLF 3MGTA 3B9VA 3DVNB 4LCYA 4XMKH 4O51A 5HYIA 3IETB 3EW3B 1F4XH 2NLJB 2Q7NA 1HHHB 4DN4H 5ISZB 2R2EB 5KS9B 3HPJB 4LIQE 4EIZC 1I8MB 4YR6A 2X40A 2VLRB 2E7LC 3QIBC 1BBDH 4OZGA 5L8KB 1R3IL 2C1PA 4CVXA 1LEIB 4PYHA 4JZJA 3VFTB 1F6AA 3MLUL 3MV8E 4L8SA 3NCEB 4F8TA 4JM2D 2B1HH 2BVYA 2HT2D 1CWVA 1GC1C 3VFUB 2X89D 4XCNB 1TXKA 3P4MA 3MROA 5EZOH 1N0XL 2HFFB 3G5ZA 3BP5A 3LS4L 2VXSH 3ULVE 1KPRB 2BVTA 4M43L 4PJEF 1KCSL 4KJWC 2VDKH 1HXMA 4K55A 4YBLC 3B5HA 4AENB 4MWFA 3LRSB 2F54A 4XPBH 3LQMA 5GGRA 4PJDB 5JOPE 4PJDF 3X3FL 4IMLA 4O02H 5E1HB 2BNQD 3ZDYF 1I8MA 1RZJH 3K1DA 3PHSA 1JGVL 4XT1C 1BM3L 1ZANL 2BC4B 2CGRH 2X4QB 2ZG2A 4JPIB 5HDBE 1C1EH 3K8MA 3PHOA 1EGJH 1JGUH 4F7PB 1NUGA 4ODSH 4BZ1L 1JNHA 2DQTH 2FX8L 4L3ED 2FJGB 2EECA 4UMGA 5EBMA 2XICA 3DRTA 2FJFB 3RAJL 1FBIL 1I9JH 3S96A 5L0QC 3LQAL 2FJFA 5D1QB 1YEKL 3SGJC 4HULB 5MHSD 3OJDA 2YEZA 2O61A 2LAAA 2F19L 1LILA 3IFOB 1GJIA 3WE6A 3ECBA 5ITBL 3QUMA 3DSFH 1ROWA 5T1DH 2HG5A 4JN2A 1CG9B 3ZT5A 4O2EA 4WI7A 4TSCH 5E4IA 1BFVH 3CU1A 4U6XB 2MKLC 4FZ8L 2KBGA 3MFGB 4PJBF 1R3KA 5DEGA 3D0LA 3ALPA 3VFGL 1WK0A 4KV5F 4L5FH 3NCBB 3ULUC 4JG1H 4NO0D 4I3SL 5KS9E 1M1SA 1B0RA 5DJ6B 3ULUL 4PRPB 4F80A 1IAMA 3T0DA 5F3HA 3O9WA 4U1MB 3DURB 4U1LB 1NC4A 5HYFA 2XWJA 1MWAA 1T6WA 4XHJD 3ZDZF 3MV8B 1VACA 4G8GB 3DUSA 1EEYA 3BDYH 2E6PA 4U7KA 3IFOA 1RUAL 5AG8A 1JPSL 1JPGB 2FJHB 1P6FA 2IWGA 2D7NA 1HH9B 3SE8H 4F2MB 3A6OA 4PJ9C 2EH7H 3FTGB 1W72B 3GB7B 5EO9A 3HI5L 5K9QI 4ZXBC 3X11A 3EO0B 3HC4L 3ZMRA 1TNNA 1U8NA 3C5ZB 3TBWB 2CUIA 4Y89A 1X4YA 1WEJH 1NAMA 1Q9KA 5ILTL 4CW1A 2NXZB 2ZSWA 5E8PA 4P3CL 3FN3A 4AEFA 4YFEA 1DUYB 3QT2A 5KSAC 1ND0B 3BZEB 3MRCB 1I3UA 4BQ9A 1E27B 3QG6A 3DMMB 1Q0XH 2ZOKA 1FIEA 3LKRA 4YPJA 5SWQA 5ESQA 1CF8H 1Q9LB 1CLZH 2Y4SA 3DJ9A 5D70H 5FYLE 2DBLL 1INEL 3V95A 2WM0A 4GOSA 3ZDZE 2MCG1 3N85L 1KG0A 4KRMB 2WAHA 5CMAB 5IV2A 3O8XC 3T77A 4JRYB 5DJZA 3EOBA 3KHOA 4NHUB 5CSBA 2R0KH 4P9HC 1JGDA 3HC3H 4L1DA 2NY4B 3HI1A 3P4MB 2GJJA 2P7TA 5HGDB 2FEEI 1CXIA 3DTXA 3VXTA 5KG9A 3C60B 5DWUL 2ZZUT 2OLDA 2VXVH 2PW1B 3VGHA 5LBSL 5IVXF 3CH8A 1MVUB 2NY5L 5EFIA 3ROLB 3QI9A 4OUUA 4ONHB 2AJVL 7FABL 3T0EE 5I8KH 5D5MB 1FIGL 3D18A 4FQXA 1QACA 3QUYD 4MD0B 1N2RA 3O3EB 3V7AE 5B39G 3BKML 1JWSA 1T0NA 1I1AA 2BDNH 4WW2F 1J0JA 2X4SA 1UWGL 2DD8H 1SBSL 2DIJA 4NZTH 2ITCB 5B8CA 3PP3H 5T1KA 3MV7B 3O3AB 4R7NB 5EO0B 3IS0X 5SV4A 3TLRA 5B4MC 2O93L 2X1WL 3NFNB 4KRNA 1J1OH 2J7LA 4OD3L 5TDOB 3RKPA 1A1MA 4URTB 1PFCA 5T3XE 1R6VA 4L8DB 2FDBP 1CQKA 2RFXA 1WZMA 2R4SH 3ZYIA 5DJXA 2YPKA 1S3KL 4IHOA 3WIHH 4KU1A 4JANB 4H8WL 3WXWL 4ODWA 3U0PB 3UO1L 3OTTA 1RAMA 3BPOB 5C0DB 4S0SD 4XPHL 1S5HB 2UZIL 3GIZH 3RUGF 3KPTA 5FO7B 3BVNB 5CIPB 3MREB 3TBTA 2GSGA 4WCYL 4XWOD 1OTSC 1U8IB 3O11B 4KK8D 1J5OL 4OFYA 1CGSH 1H15A 4HJ0D 3PJSB 3G5XA 4Z7UE 1OAKL 2SEBA 4P5KA 3AC0A 1QD0A 5BVJA 5CWSB 5KSBE 4RGND 1EIBA 1D5ZA 1BJ1H 5HI5C 4D8PB 1Z3GL 3C8HA 2D0GA 4WW2A 4M03A 1QBLH 3AS2A 3CC5B 3H9ZA 3ULUH 1NMBL 4QHMB 5L88H 1GPOH 3NFNA 4RGOH 1NGPH 4Y5VA 1U93B 3EOBB 2Q8AL 1A1MB 2VDQL 1MIEH 4B41A 3C09B 3WFHA 1P2CA 1KENH 1FJ1A 3VH8A 4GXVH 1IQWH 5DR5L 3AB0B 5I8CA 2GY5A 3P0GB 2EC9U 1B0WA 3CDCA 4HZAA 4I2XB 3S36L 3PE9A 2I27N 1LNUA 5FKPA 3C5SB 1RIUL 4WFFD 1AO7B 3ZE2F 3FRPA 1QSFE 5HSFA 5EU6D 4YHIB 3I50L 2JLLA 4JKLA 2X41A 1QR1B 2XPGA 5I1JH 3X17A 4OGAC 1QEWA 1I4FA 1UWXK 3TH3T 4NUGH 1FZKB 4RSVA 5C92A 5JPMB 2FHCA 1FFQA 3U83A 3VXMA 2W60B 3ARVA 4QXUH 4FQHA 1F11A 4NUJB 4X5XB 4XVSH 5JPMA 3X3FH 4XWGL 4QTHA 3RPIB 3QZWB 3EUUA 4RGMC 4F15B 2GJ6A 3QDJD 1JZ5A 4QXTA 4F37F 4ZO9A 3TO2B 3JWDL 1CGWA 3RA7H 3O2DH 4FQXC 5FO8A 1M7XA 3C5SA 4TULH 2UWEE 5CP7B 1CFVL 4BUHA 4YK4C 3RWGB 3DO7B 1FO0H 3O6LH 4JB9H 5HHME 2CDGB 2VXTH 4R96B 2VISB 4HV8B 3BQUD 3H3PL 2AJSL 4J3XA 1IJ9A 5I1AA 3BGFC 2QQNL 2GHWB 3WHXA 4E41B 3KAAA 1DQQA 3IFNL 4OLWL 3QUYC 5GSVB 4R7NA 2W0KA 5A3ID 5KSBB 5KANG 3HG1B 4BFIA 4P2OB 3UTZA 5DT1L 4R7DA 5D7LD 3STLB 3CFBB 2R9HC 2W9DH 1U6AL 5EBMB 3U1SH 4U3CA 5B39B 2ADIB 1MNUL 2CPCA 2GCYA 2BMKA 1ZVSB 5BVPH 5BV7B 3S36X 2O5ZL 1YY9C 3AREB 2J6EH 1UA6L 1JK8B 4ZSOE 3L7EA 4QCIB 3M17B 4HJGB 2YN5A 3G6DH 1VFMA 1S9YA 4PRDB 1FRGH 2VRAA 2KUTA 5J11C 3VXRE 1H3XA 5HHXL 2VLLA 3MLRH 2X4NB 2W0LA 1R0AL 5TE7L 2YOCA 2IBBA 4HZLA 2JJSA 4ZS6C 2B8OT 3IJYB 1IAIH 5HHOA 2MQ3A 3AU1B 4X7EC 1P5UA 1ZLWH 3LHPL 4HJ0C 3UZQA 2LV4A 3SKMA 4PJ8B 1QPXA 5GGUA 1DP0A 4Q9QL 2W0FB 1IM9D 4KZDL 5IB2A 4K7PH 1CLOH 5LCVL 4NKDB 1AXIB 2WLZA 1IBGH 5F7DA 3SKNA 1NQBA 5EZLA 2FL5A 4HKBB 4JM2C 5EA0L 5CBAA 3L5JA 4LCCB 5C07A 1DBKL 4H0IA 5B8CC 2X1XR 3QH3B 3P11H 4LSPL 1JYNA 1RZKC 2OJEB 1U3HD 2Z35B 3H3KA 4QRUA 5BS0E 1YEDB 3R06A 3MRJB 2NXYD 4Y4FB 2A2QT 3GMPB 1NCWL 3L3IA 3IKCA 3U48A 4O51B 1R24A 1OSZB 1CL7L 1YDPA 4R4FL 1FFOB 4NQEA 2VN4A 5EZIH 4JVWA 4JLRB 3FL7A 4AEHL 4S1QH 2Q87A 1CE6B 4FQQB 4L4VE 5TDPB 1INQB 2A0LD 4MQSB 4ZMAT 5E2TL 4N68A 5J1SC 3GIZL 2PF6A 3L3DB 1BGXH 3QRFM 4U3HA 4ZAKD 4M62H 1V3MA 3D25A 3C5JA 1KEML 5AYUL 1JHKH 1KIRB 2ARJQ 1BLNA 5DSCB 3I75B 3ZKNC 2VZUA 2HRPH 1IE5A 8FABB 2VE6A 5HHPB 5IM7B 3F58L 4UTAH 5F6HI 2JJVA 5TPWH 4PV8A 3P4LA 4OZIB 5B3JF 4NCC1 5E56A 5EUOF 1P9MA 1MAKA 3UJTH 2PR4H 7CGTA 2ICEA 1CICA 1NCBH 3ILQC 1DFBL 5JOPD 3EO9H 3QXDA 3TYGL 1X5KA 1E6JL 3QCUL 3VI3E 4KKLD 4PJ5D 1TETL 2R0LL 1C12B 3QIUC 3BWUC 3QAZB 1MCPL 1INDH 1BWWA 1FNHA 3H42H 3PWVA 2LU4A 4IJ3B 4XVJH 4LSUH 5K33A 4IRSC 1YJDL 3FRUB 5GS2H 3MACH 1B3JA 1UH3A 2JTDA 3CU7A 2VLKD 2MFNA 5DHVH 5LAXB 5HHOB 1Z2KA 2R0ZH 4YXLL 4MLSA 3RVWC 3ULVD 4P4KA 1IGMH 4O2CA 1KTDB 3K2UL 2XWBB 2F8OA 5E5MA 5F3HB 3WIIH 4BUGA 1MFCH 5C09A 5IT2H 4G9FD 2CKBH 2DLTA 4JZJC 2PN5A 4EOWL 1XGYH 3BGFB 4AH2A 2H9GA 1UZ8A 2CH8A 2DYPB 1MFBH 1RUKH 5E5MB 4QGYA 4HJGA 4TVPH 4OAWA 4FMKA 4OFYD 3BHBA 1N5YL 4Y2OA 5IVZA 5BS0D 1RUQH 4OM1H 1NCTA 1CDGA 1LO2L 4UT6H 5DMIL 1J0HA 3A67H 3ARBB 5C8JA 4FA8A 1FSKC 4JZNB 5DJYA 4GQPH 4MJ4A 5D2LF 4HFUH 4CU7A 1BFOA 5GRUH 5FHAL 1CTNA 3L6FB 5FUCE 4HMCA 3BW9A 3UPRB 3HC0A 1PAMA 4KY1L 2CLZB 4XBGB 3RWHA 4R97C 4XC1H 1G7MB 1LEIA 1P84K 1IAIL 2Y06H 4AK1A 2R15A 1X5GA 4GXUN 2HKFH 2HVJB 1WFOA 5D7KD 1N5AB 4QRRB 3CAFA 2I9TB 2JB5H 2Y6SC 3T2NH 3KLDA 4JM4H 1V05A 3MZTA 3KYMB 3UBXG 3KJ6L 1IILE 5BXFB 2NY1C 3ULSA 1MCFA 4NC2B 1I7ZB 1Q0YH 2J8UE 4PJCB 1GIGL 4F3FB 5IM7A 2IQ9H 5DQ9A 5DUML 5IVXB 1H8NA 3GSNL 2UUDK 1JPTL 4JFDD 3LPFA 4P2RD 1MFAH 4QRQA 3OAUH 4XB7A 5D93B 2PO6B 2XFXB 4TN9A 2H8PA 1JGEA 5D7IB 1XCQA 1YUHA 5CINL 2ICWI 5IROA 5SX5H 2RIKA 4YPGA 1Q9WA 1ZHKA 1CFVH 1UFUA 5FYJL 4KMTH 2B4CH 1FZKA 4U1IA 4UOW1 4EN3D 3F6IA 3TNNA 5L7XH 3VFTA 5J57B 1SMOA 1LE5A 1FDLH 4HEPG 1G1YA 4YXLH 4LPUA 3QCTH 1GSMA 5EBGA 3OXRA 4R8WL 4GQ9L 4M8QB 2OK0H 4ZFGL 5J9PB 5DD1H 3V4VL 4JREC 5FUZH 1JZ3A 2B0SH 5DRXA 3V52L 2VTFA 2NY2B 4OV6F 5IUSA 4P4KD 3RHWF 5JW5A 1QRNA 3N06B 5ABDE 2VZ3A 3GSWB 1A0QL 1KACB 3TV3H 4XNMB 4UTAL 4XXDB 1IGCH 4NQDE 4BZ2H 1DBKH 3WNOA 2DI9A 2J4WL 5GRWA 4J4PC 3WJLC 2HT4C 4WNQB 4KVNL 4XH2A 4YBQC 5MEND 2XA8H 4ODSL 3X14B 4IRSA 4YC2B 2DDQL 1DN0B 4U3XA 5INCA 4HAGA 2HT3C 4ZD3H 1IAII 3WS3B 1A6TA 5D71H 5B38A 3SQOH 5EN2B 4QTIH 3BPCB 5GS0C 1ZS8A 5KVEL 4R0LB 3BKCL 1A5FH 4QRPD 3WLBA 1UH4A 3HZYA 3MRKA 4YHOL 4Y2DB 3BAEL 1OL0A 4UNVA 1IAKB 5F7HA 4DUWA 3FFCD 4JO3L 1V3KA 4Z76B 1A0QH 1TTFA 3OKKB 4QGTA 4ZYKB 5C0CA 4XMPL 5I6XB 5DMJB 1BOGB 1GGTA 1ORSA 2BHYA 4X80H 4M43H 1IAIM 1EFQA 4AMKH 4JFDA 1DANU 3CK0L 3BD4A 4MS8D 4YC2C 3HLAB 4TTGA 2BSSB 4DEPC 1BF2A 1YECH 2CD0A 5IBLD 4PLJD 4YHPA 1KC5L 1FYTB 2EYSB 1Q8MA 4LSDA 2WBJD 1DQDH 4I3SH 1NC2D 5EN2A 1DBAH 2YR3A 1KJ3L 3SE4C 5KVEH 3MYJA 4PPTA 1S7XA 4FQIL 1WC7B 4C57C 5CJBA 1D5BB 3QA3B 1T3FB 4L3CA 3HHRB 4PGDB 3H0TB 5E08L 4DEPB 2MSPA 3BOVA 1JL8A 5J11B 4S1SL 2FWOA 3RAJH 2EIZB 2AK4B 2BOCA 1UJ3A 3JWOL 2NY6C 1A4JA 4NQED 3PV7A 3RWCA 3U4EB 3UPAA 1TVDA 2WBJC 5DXWA 5C6TH 2EYSA 2CMRL 5JXEC 2NY6D 5C9JA 3T0EB 2Y06L 4BSWA 1C7SA 1I9JL 1NFDB 1N2RB 3HZMA 4M8QA 4XVTL 3H42L 1UKQA 4KC3B 1T20B 3HA0A 4WHYH 3PWNA 2P43B 1PVHA 1F3DH 1HCVA 3QXAA 5KZCD 5HY9B 3RPIA 1TZGL 4NQDB 3GKZA 4MQ7B 3SE4A 5MENA 1T03H 2HJLB 1J05A 4Z76A 4LHQB 4QTHB 4G6MH 3SDAB 4FQ2H 2FIRT 3O4LE 4HXAH 1FL6B 3EYVB 4MHHI 2H8PB 2DQGH 3NVQA 4JFED 1FL6A 2QSTA 3EYVA 5FYKH 5GS3A 4OLZL 1MAJA 1YUHB 4OZFB 1CBVH 3VXUD 4JY6B 2JIXB 1XR9A 3S98A 4Z0BH 3QHZH 2DKUA 1EHLL 4JRYA 5DJZB 5A3IC 3ULUF 3A6BL 4ELMB 3QNZA 3NFPB 4Y4FC 3TWCL 1T20A 2EH7L 4LAQL 3IU3B 3QFJA 4OIBA 2DLHA 5DJ0B 2QR0B 5E00B 5FYJE 1IGFL 5E8PB 2IMNA 4GAYB 1ZAGA 1TJHH 5K9OA 4FQPA 2E5EA 2B5IB 3KHQA 1UADC 4MNGA 4TUJA 1IMHC 2OSLB 1D5MB 2YKLL 5KW9H 4FTVE 3RIFF 4Y4KA 5HHQB 1BFVL 5F21B 1YEHH 1QKZL 5JDSB 4K23H 4C56A 5I2IA 3D5OF 1XR9B 2WP3T 2P8LB 3RGHA 4MHHG 3B5TA 4HLZG 4OZHF 1A7QH 4N8CH 1UXSA 4ZD3L 5JNYB 2GITB 2G75A 3FQTB 4Q6IB 4YFLI 3DV4A 4ALAL 4HSQA 1H15B 1FL3B 4X4XA 5HGBB 5E8EA 3IAQA 1WICA 4XP1L 2GSGB 1HSBA 5IFAL 3N1MC 1EEUA 2FSEB 3MRFB 1FHGA 4JN1L 3BKJH 4ZO6A 1B6DA 2VZ1A 1AIFB 4BKLB 1ZANH 5DJ6A 3RI5K 4PJGB 3GMMA 4PJHF 1NGXB 1S7UB 1IC5H 4MA3B 3HE6D 4L29A 1WVZA 4IHOB 4GW1B 3RBSA 3V8OA 3FZUD 1Q72H 4IIQC 2A6DA 3KNBA 4JJ5B 4LQ1A 5HHVL 1LO0L 3EHBC 4HGWB 4NWTL 4PTTB 2APWA 5CEZH 4AMKL 4U33A 4U1SB 3HRZB 3LMJH 4JKMA 5EPMB 2PO6C 3A6CH 5EO0A 2DM2A 3O3AA 2OQJB 3LS4H 4MA1B 1S7XB 2C3WA 5IK3A 5ACLA 2PXYC 3HE7A 3QEQA 3O45A 4UU9B 2YD6A 1RULL 1UWGH 1NGQH 2V5SA 2EE9A 3DX9A 1TMCB 4UUJA 4ISVB 2NY6B 1D6VH 4DVBA 4X7SL 4DVRL 2OL3H 4NM8L 4UV4H 1I85A 5ETUA 4HXBH 5HVGB 1XIWB 5HYJA 1CK0L 2AK4D 2R2HA 5A2FA 1WITA 2JF1A 1MH5B 4I9WD 5HVWA 2P8MB 3DSNA 5FCUL 5IB5A 2QKIA 4XAKD 2RQ8A 4WCYH 1WCQA 4ZO7A 2X4OA 4YDLC 2EKSA 4XPHH 2GIYA 1FBIH 1PZUB 4P0DA 2AI0H 3B2UD 3RDTC 4G7YH 4P23B 3T08A 4M4PA 4WFGE 1JN6A 3KPSB 5CCKL 4HWUA 1T80A 4XCFL 4GLRI 5BO1H 3X3GL 1WAAF 4LSSH 4LBEA 5C0GB 5F89A 1VKXA 5DFWH 4WHYG 1CDYA 3C08H 1UM5H 4S1SH 2Z92A 1W0WA 1BQSA 4NT6A 1TITA 1W0WB 2D4DA 3EIFA 2OZ4L 2CR6A 4PJIF 1JUFA 4ZUTA 4U6HB 3RWFB 2OJZH 1BQLL 4OLYL 5ESAA 1MCQA 1ORQA 4NO2A 4HC1L 5AWNH 1T5XB 4N0UA 3RZCB 4UILH 3W0WA 1OM3H 4ORGA 1LD9B 2FH8A 1A4KA 5E6YA 3INUH 1RMFH 2C3XA 3B2VL 3UBXA 4Z9KB 3ZSTA 3S97C 4OGYH 1MQKL 1CDJA 2NY1B 3TZVD 4YE4H 1OAQH 3RUGE 4R4BB 3DV6B 4UQ3A 1EZVX 1MCRA 3TIEB 1HZHH 2QHRL 1URLA 3FFCA 1KXTB 3QQ3B 2VLLB 3GMMB 3UTOA 1JHLL 2XY2A 4LOUC 5L88L 5A43C 1CFQA 2Z93A 3IAPA 1X5FA 4LF3B 2C3HA 4IIQA 3BMVA 1GZPB 1HI6A 3KYKH 3TZVC 2ADIA 5BRZD 5ETUB 5JNYA 3MJ8A 2YSSA 3QFJE 4JE4B 4Z77A 4NM4H 3DECA 1IC5L 5I18L 2NZIA 3H7BB 2XNAA 3MRPB 1MJUL 2NY7L 4FOMA 4BFIB 1PG7W 5EZLB 4MYWB 5D1ZA 4LLUA 4YK4B 4R7DB 3F7YB 3JWDC 3ZKQD 3P9MB 2BXYA 1YYMH 2BP3A 1NGWB 1CI5A 2XZCH 4GFTB 1QFPA 5E2VH 1WBXA 1U8LB 4LEXL 1T4KA 3ARUA 5A2KH 4OCRH 3K4DA 5JOFA 4LSVL 2R56H 4OF0A 4I3GA 4NZRH 5F9JB 1RUAH 3HR6A 3T65A 3B9DA 1A7PH 3O3BA 4K7FA 4PRDA 2QLVB 3ILPA 2H32A 3S37X 1KJ2A 3W9EB 2ATPA 3D25B 2E9IA 1U3YA 4MDIB 3BN3B 4PG9B 4QXTB 5D6DC 1DEEB 1U2HA 3MLUH 1EHLH 5EUKB 1B2WH 3DBXA 3VU2A 2EKSB 3IDXH 5IWLC 4GRLD 1NC4D 4NJ9H 4YO0B 3O0RL 4ZXBD 4JLRA 4MAYC 1Q72L 5HHOE 3SDCA 4OFPA 4Y5VC 4W70A 4OLEA 3ARDD 1BQHA 4OV5A 3NIDE 3HPJA 5BS0A 5DD5L 4Z7OE 1B6UA 4N5ED 1PX4A 5DHVA 4M5YH 3IKKA 3I50H 4ENEC 3N1GC 4FXLA 3ARYA 4FS0A 2Z35A 3ZYOA 4M7ZC 2AV7B 3ARGB 4TNVF 1XR8B 3K4AA 3SDDB 3SJVD 4RRPA 3GHEL 4JHBA 3I75A 3IRPX 2KZ1B 2QR0A 4KVCL 4HJJL 5E00A 5FCSH 2IH1A 1JF1B 4QHUB 5J56B 4PJ8A 2JK5A 1HQRB 4GS7B 4OBSA 2X10A 5HPMB 1EAPA 2AJXH 3GSNB 3U30B 4WJ5A 1EFXB 5BRZA 4X5WA 5JIHA 4TNVK 5DTFA 2NY1D 5HVHC 2UWEF 4GUPA 2EYTB 3MGOA 1E28A 4D9LL 5ESVB 4G43A 2AP2A 3U46B 2X4NA 5DJ8B 1WGOA 3QUMH 4QF1B 2VC2H 4Y19E 2Q8BH 2VXUL 1H3TA 2YA1A 4OCWH 3EOYG 5IW1A 3WIIL 4G80B 4HUKB 1YEEL 2E7BA 1XT5A 4JFFB 2FHFA 4PJ8C 1TCMA 1BIHA 4RRPG 4XMKL 1T2JA 3K8KA 1G0DA 3ARFA 5CGTA 2PXYD 4XCFH 4NO0A 3UTPE 5IG7A 1JYXA 1EJOH 1F4AA 2A38A 1FNFA 4TOYL 3C08L 3LN4A 4WUUB 3ARTA 6FABH 1TQBC 4FQ2L 1H3VA 4M1CD 1NFIA 1IC1A 1OAUH 1DVFB 2FB4H 1K8IB 5JTWA 3CX2A 4P2RA 3ZDYE 2VABB 5GHWL 1G0YR 4BH8B 1MCWW 4LLVA 2GTWB 3ARQA 3B9EA 3MYJB 3OPZH 3DMMD 4XC1L 2FX9L 3V0AC 3EYSH 5FYJU 1UCBH 4KFZC 4JFOA 3VCLA 3BRFA 2R2BB 3H7LA 3HMWH 1D7FA 3VXOB 1E4XH 4DAGH 3DIFA 3D87B 4MD4B 3T8XB 3WNLA 3L95A 3IDMB 5C0JA 1E4KA 3OBAA 3S7GA 1JJUA 4DK6A 1G9ML 3Q5OA 4XNXH 1ORSB 3OV6A 4BH7B 4XNZB 1NBZA 4HIXH 5ESVA 5H94B 5L2JA 3V6OA 1IGML 1FO0B 5C09E 4E0RB 4PJ7F 4JDZA 5F6IB 4WY7L 2EDTA 4D0CA 4GBXD 4RBPK 2MNUA 3VFNB 4XTRC 2JCCA 3C6LA 2P7TB 1PD6A 1IM3B 3C2AL 4YEEA 1RUML 3ZKXC 1EAPB 2BNUA 2R1XB 5C0AB 4BFBD 4HWBL 4OQTL 2P48B 3OL2A 3FN0H 5TE6H 1ODAA 2ZJSH 4KUZH 1YNLH 3TYGH 2MKWA 4MNGB 4NZUH 4TUJB 5EU4B 5F1SA 2B4CL 1LEKA 1V7ML 4AG4H 3MV9A 1FVDB 4PTUB 4XNXL 1K2DB 1NBVH 1INDL 4K8RC 1S8DB 4CJ0A 4NSKA 1VPOH 3BJ91 5DHVB 4FQCH 1FG2B 1CICD 1X7QA 4JAMB 5DD5H 1LP9F 2RBLA 4ZOCA 4IOFD 3PGFL 5F97E 1ZLWK 4WFHD 2IQ9L 5DUMH 1CTOA 3FQRB 3O3UN 4BZ2L 1VADA 1VGKB 1TQBB 3RZWA 2WUCL 4OD2B 4OFVA 1QLEH 4G8GA 1T1YA 2FBOJ 3ARRA 2DWEB 2Z4QB 2Y5TB 2NW2B 4M93C 5IMLB 4WUUE 4JFXA 2BY0A 5FV1L 2KH2B 1VACB 4U1MA 1Q9WB 1NBZB 2EO9A 2BVEA 1BOYA 2MPAL 4S1DD 1YEIH 1NEZB 5GZND 1HXYB 5DYOA 5EOQL 3U79A 1RJCA 5JW4N 1IGJB 1BVLA 5EU6A 3MJ6A 3S9DB 2VJXA 3HN3A 2F15A 4PP1D 1X5YA 3D9AL 3Q1SH 3QIWA 3KXFB 3H9SD 1QKZH 5EG6C 1MCSA 2ZCLH 1R3KB 3QP3A 5DEGB 2K7QA 1U8MB 1PG7H 4PV9A 2OTPA 5IESH 1EHNA 3QUXB 2A6JB 2F74B 2X4UA 1KLUA 1UZ6F 4KAQL 5AWNL 4LPXA 4K3DH 3LDBC 2P8PB 4H26B 1OAKH 3GMOB 3OF6A 4M93B 2FATL 3KPMA 1NAKH 3QHTC 2M26A 1XAUA 2VZVA 3RZCD 5EZOL 2HVJA 4FQIH 1NUDA 1N7MH 3MRNA 4P46D 4P9ML 1QP1A 4F7PA 1LDPH 4OSUH 4UB0L 2P47B 32C2A 1WC7A 2CRMA 5I1CL 3U2SB 3SEPA 4QXWA 1S7QB 2EXYD 4U1JB 1IT9L 1FAIL 1SEQL 1JZ6A 3N0PB 1ACYL 3S35X 2W0PA 3WN5C 5FV2A 1B0RB 4Z7UA 3VA6A 2G5RA 4M48L 2R29L 2WINA 4OD1L 4UNUA 1QLFA 2CMRH 1HXMB 1OT2A 3UTQA 3RL2B 4EN3C 3EYQD 5I8EB 5ACMA 1NCBL 3L1OH 4PJ9B 5F1NB 5I71C 3L3DA 3ZKXB 4JCLA 2G60H 5SWSE 3BP5B 2C9AA 3STBA 1HILB 3P77A 4GG6E 1DBBL 5C1MB 4P2YA 1JZ2A 1KJ2L 4YH6A 3KLSA 2HFGH 1HINH 3FQWB 1CDCA 1FLRH 4APQD 3OJDB 4G8GE 1YC7A 1YPZE 4EI5D 3MV9D 1DUYA 4PJXA 4Z0BL 4XH2B 1WJ3A 1NMAL 4ZUSA 3FN0L 1VCAA 1FYTE 4PLJC 5CP3A 1JYVA 2HMID 4MQXD 4J23A 2F5BH 3QEUB 3RU8L 5GJTH 1MLBA 2BY2A 2G5BB 3TO4D 2HMIC 43CAB 1XH3A 3EO0A 5I16B 2O5YL 4GXUM 2CRIA 3MPCA 3OXRB 4N5EC 5DRXB 3IRZA 1N6QL 5C3LD 5C0BE 1DR9A 3MV7D 5HPOA 1QQDB 1CR9L 2W65B 4ZPTA 3UAJD 1WT5C 5HI4D 5J06A 2XA3A 3KLAB 1CXLA 1WTLA 3R8QA 1KPUB 4KKBC 4NQCD 4DKFL 3DURA 1MCEA 4WEMB 1E4XL 2YK1L 2OP4L 3JTSA 5JUEL 4DAGL 4JRYE 1U41A 2NX5E 1GOHA 3UJJL 4RWYL 4X9FA 1QSFB 5IV2B 2DYPA 2PR4L 2CLRA 1DVFD 2H26A 4ZXBA 1S9YB 2DQIH 3V6ZA 4HK0A 1X6NA 3KXFD 3TV3L 1WIUA 4PJ5E 4HKJA 2ZUUA 3VA2C 2BJML 2DIAA 4HGKC 5TQ0L 4J6RL 4DGIL 1OF2A 4F9PA 4NN7B 1U8HB 3PG2A 1U91A 4CW1B 1J11A 4JPWH 2BHUA 2NY4D 1HHHA 1YEDA 3BWAB 2WBJA 4UAOC 5E6ZA 4IRSD 1KIUA 3ARFD 4HC1A 1Q9OB 5B3JE 3G6JE 1RZIA 4XPFH 5SWSB 2OQJA 4X0KA 3EZJB 3KPNB 1Q9OA 2LVEA 4FQJH 4XRCA 1YN7B 3FT2A 1MHPL 4DN3L 5JZ7C 4WV1B 4LKXA 2RCSL 3BZDA 2YSSB 3MR9B 3RWIA 4NKDA 2Z31B 4MQTB 3D3VD 1QO3A 3RZCC 5HHMB 3TC9A 3LH2L 5HYQA 2Q8BL 3DETC 5I0DA 5J12B 4PJ7A 3RKDD 3QHFH 1LO5A 4HKJB 4E41E 1JV5B 2X4UB 2M1KA 3NAAL 1CGSL 5BV7H 3OAYK 1P9MC 2B2XL 2D0FA 3KPRE 1SJVA 5CP7A 1HN1A 4HZLB 5HDOA 3P4OA 5CHNB 5FO8B 3QO0B 1KIRA 2R9HD 1T2XA 3LRSA 3NCYS 1IL1A 1NGXA 4UTBL 2IQAB 1OAZH 1QSFA 1AGBA 4WFGD 1QOKA 4TTDD 3ULVC 2ED9A 3DETD 4ZSOA 5DS8B 5C0FA 4OKVB 1ZVSA 3TN0D 4JKPL 4POUB 3GUTB 1YYLH 3OB0K 1RFDH 1CE6A 2ATKA 2BERA 4EUPB 5CKAA 3X13A 4DTGL 4TVPD 4EDWH 3LKPB 1FRGL 3IXAB 4Y1AA 2XZAL 4KUCF 5C2UB 1YQVL 1FLTX 5DUBA 5EIIB 3RWFA 1TVHB 1S5IH 4KKLC 3HG1A 4WHCA 1HSAA 5CCKH 3IKCB 4OF8A 1CD9B 2EXWD 3SE3A 4G7YL 4YHIA 3LN9A 1ZT4A 3U36A 4OZIA 3SCMC 2OR9H 3QEUA 5T3ZH 3KDMA 2VISA 3WFBL 3SN6N 1NL0H 5DUPL 1HKFA 3JV4A 3FQUA 3FFDB 3KWWB 4PV8B 4MCZA 2AJYL 4RBPH 2AJ3A 3E2HC 1KCUH 1FVDA 2NY2C 3GBMH 4KKAD 5FF6B 3MYZA 5T1LA 2VXVL 3EKCA 1UM6L 1FNLA 2GT9A 3BKYH 3AXLA 2XRAH 4G6JL 1OSPH 2H3NA 3F65A 5KSVB 4YXKH 4QHKI 2MWCA 4F57L 2AXJA 2XQYG 4PBWD 1W72H 4JFQA 4WW2B 1MHPH 4DN3H 3WS6A 1WZ1L 3P3YA 3NPSC 2AXGA 3MRQA 2IGFH 1KCVL 1QSEB 3T0ED 5FK9B 1U8JA 3HB3C 4GO6B 5ITFB 4Q6YA 1YDPB 1OGAE 5HJ3B 4ZFOB 3S34L 5L6YH 4Z8FL 4KK9D 1JHTA 2D31A 2AV1B 3GHEH 4IRJB 5C86A 1CXHA 1OB1A 4OZFG 4RZCB 5FO7A 3OKLB 2A83B 4QCIA 1NGPL 2Z0BA 4QNPE 2EYRA 3HZMB 4S1RL 4Y4FA 1KNOB 3G08B 5DD3H 1OOAA 4RQQA 4L4VB 3U6RA 1F4YL 3LV3B 5GZOD 4JDTL 4U1JA 1A64A 1PBYA 1MRCL 2FYYA 1A9BB 1HEZA 3O45B 1LNUB 2A73B 4PRHE 1NFIB 1T7YA 4KK5C 2EIZA 5F72S 2BJMH 3QEQB 5EB9A 3Q6FA 4AIOA 5IEKB 4HS3A 3CDYA 2CGRL 1BJ1J 4N8CL 2YBRB 1CZ8H 4X5LA 4F7EA 1A3RL 1U93A 3QEGL 4P99A 5GGTH 5IB2B 3SKMB 3TVMA 3GMNA 3L3JB 2A9NH 4XP5L 2FX8H 3HI5H 4E42B 1RZKL 4JJ5A 2HLFC 2PYEB 3K46A 4H5SB 4XTRD 1VGEL 3LVEA 2FYYB 2IPUG 2CDFB 3BISA 4HBQA 3UTTE 3MX0A 3QJHA 5EBLB 4XBEL 1I8LA 4RQQB 2COQA 2Z8WC 4GSDL 2ZCKL 4FQXD 4X8JB 1SVZA 3CFJA 4RGOL 2QEJA 1HIMH 3KYNB 2IH3B 3QHFL 1HZHL 2QHRH 4X8JA 3QIWC 4FFWC 4LU5L 3VFPA 1NLDH 4G7VH 5HDQL 1XF3B 5DLML 1FH5H 3ZDXF 1FFNB 2YRZA 3P0YH 1A3LH 4N0UE 3V0VB 4PUBH 4I18B 1NMCB 3N1FC 1RD6A 1ZEAH 2DQJH 2WIIA 5MERB 3RTQA 4J6RH 2EYTA 5DD0H 3TT3L 3WV0A 3BPNB 4HGMA 2APTA 2AEIT 3GMNB 4EDXA 3BGAA 1A21A 4XNQB 3WN5B 3TBVB 1T6VN 1XGTA 1CFNA 1EX0A 1OAYH 2PW2A 4H25B 1JF1A 3VGFA 4ETYA 4NSKB 4JRXA 4JO2H 4X7CC 2IAND 4NJAH 3SE9L 5EC2A 3JZ7A 2FR4B 1XIWC 4LGRB 5E8NA 1F2XK 1KEGL 2DQCL 4WV1C 1WLHA 4KY1H 1SY6A 5C2BH 1G7LA 4JRXB 1CD1A 4MA8H 4PRBB 3D0VA 2MMXA 4RIRB 1P2CB 5C70A 3RTQC 4RZCA 5BS0B 5ILTH 1P4LB 5GS1C 3T0EC 2D2OA 2E7CA 3BE1H 1HXYA 5IQ9B 4EDXB 3SY0A 3MRGB 4MJ2A 3WXVL 2VYRE 2P5WD 5I1EL 4JDZB 3GSOB 3F7VA 3TM6A 5BOPA 3JTTB 3MGOB 4ZUWB 1BX2A 1UJ3C 5BVJB 4XHQA 2EIEA 4U7MA 1IGYB 1VADB 1VGKA 2ZCHL 3EJZC 5IVXE 4NHCH 4NBXB 5DRZB 5BRZB 3P2TA 1IGIL 5HPMA 4LMQE 1RULH 1AGDB 5LXGL 4M5ZH 3WIFA 5HHNA 3FT3B 4OI9A 2OL3A 3ILPB 4WUKH 4M9OA 5D1ZC 1I7ZA 3C6LD 1MEXH 5MI0B 1ZLUH 3VGBA 4L8CB 4FFVD 3M07A 1T66D 3QUML 3SDXE 2V6HA 4FHBD 4ZNEE 3U4EA 5CBEB 4H5SA 5DMKB 4LLVB 1K8IA 3C6LC 4X7DC 2A0LC 3GNMH 4HH8A 4G7VL 1YECL 3LD8B 3T3ME 1WBXB 3CK0H 4OZIE 1S9WA 4YDVA 4M7LL 4BQBA 1T2QH 1NBQA 1Z9LA 3P9MA 3K81A 1G7IB 2BVQB 3WJJC 3UEZA 5IMKA 4HIHA 2EDDA 4XBGA 4HW6A 4Z77B 1LK3L 4PGBA 1IC7H 4PY7A 4Q9RH 2WUBH 3N85H 4W6YB 3RIFK 1TLKA 4AQOA 1G84A 3UJIH 5DK3A 3IB4A 3BEVA 1NDGB 4PLNC 4YHYB 2I25N 3JWOH 3SDDC 2VDPL 5CLTA 2XN9B 4BYHA 2LAGB 1MCHA 5EBWA 4MDIA 5IEHB 3E8UH 3IF1A 1RZJL 3ARXA 5DMIH 4NKIL 2VLKA 5D1QD 3MJ9L 3U4BH 3MUZ1 3SDCC 4EUPH 1DLFL 4JHWL 4U6YB 4WEBH 5D9SB 4WWKA 2D3VA 5I1JL 4BZ1H 4K7PX 1HHKB 5HGDA 2FGWH 2XY1A 3KJ4B 1JZ8A 1ONQA 5JOFB 1LO3L 3K2MC 5FGCE 2LU7A 4YWGH 5JHDB 4CAGA 3OQ3B 3QUMB 4Q6IC 3WMSA 4NBYB 3OKMB 4XC3L 4X80L 5K9QG 1ZA3A 5IB3A 1NEUA 1ZTXH 3S37L 4OIAA 5J6GA 5DI8B 3MRRA 1RJZB 3UYOD 4M3JA 4GBXA 5E1AA 4OQTH 1MCOL 1C12A 4QOKA 4Z95L 2JIXD 2D7OA 1A7PL 5CJQH 4K8RL 1MCBA 2FJGA 3VFGH 1YEGL 3LQZA 4WUKL 1AXSA 1KF9B 1M7IA 3VD3A 2VXQL 2AJZB 1CZ8L 3QDAA 2YD2A 3I2CH 4LF3A 4TVSa 4HCRH 5K59E 1DBBH 1DBJL 3EYFA 4YHOH 5FEBA 1DVFC 2AV1A 4FFZH 2J6EA 4HUUA 2Y36L 4OUUB 4N8PA 2XG4A 2HTLD 3U46A 3DWTA 1F4WL 1NCDH 5IJKC 4R97B 1MAMH 5CEZE 3NCYP 4LVOC 4CMHB 1PKQB 1L0QA 3D69B 3RPKA 1KTLB 1EO8L 1KPRA 1L6XA 1I1FA 3WUWA 5JIKA 1D6EA 2JKXA 3VWKA 3VFMB 1FNGB 1PYWA 1JGUL 1MY5A 3ARFC 3O4LA 1EO7A 2I5YH 1AQDB 1KXVC 4MA7L 1DQLL 2L7JA 2P4AB 1F13A 2WINB 1CGXA 5ESQB 4YJZL 2XTJD 1BP3B 4JZJB 2VLRA 5IGXH 1VEMA 4XCEB 5E9DE 1TZHB 5I17A 1B4JL 2LVCA 3MRCA 5ELIA 4ZUVB 5C6PB 5DJ2A 3CMOL 5LXGH 4Q97A 2CUMA 4I0KA 5L2KD 4YXHH 5BQ7B 4QOKB 1MFAL 3DPBA 5F9OL 3QH3A 2NR6C 3MR9A 4UTBH 5EO9B 1MCDA 5I19H 3MO1B 4KAQH 2NQCA 4MAYD 3QCVH 4PG2C 4F57H 3F62A 1ZA6A 1SYVB 1BD2B 2FZ3A 1L0XA 2DQEL 2VXTL 3BT2H 4MNGE 1LVEA 3MC0A 5CSGA 3UTSB 5EPMA 2Q3AA 4M6OH 4LHUD 2AVGA 3BP7A 4WTXA 1R5IB 1XGPB 1GL4B 1EEYB 2BK8A 3P9WB 4C56E 1NLDL 2VLME 1KLUB 1F8TH 1MWAB 2A77L 1B4JH 3EFFB 1S5IL 1VENA 3OWEA 4I13B 3MV8D 3SOBL 3FOLA 3DHMA 3GBNL 5IHZA 1Y18A 2DOCA 4I77H 3EFFA 4KI5C 3L3OA 2ZNWA 4IS6B 3QCUH 4X7FC 2CUHA 3O6FC 4OIIL 2J6EL 1AQKL 4G8FB 1P6AB 1UB6B 3DV4B 4D94A 5A2IH 3WFEH 3WJLA 6FABL 1SQ2N 3FT4A 1QBML 4P2OD 5CZXC 4KH2A 5CJXC 1RIHL 1A1OB 3ECBB 3UTSA 4ZFOL 3B3IA 3ISWA 1UG9A 4KWUA 2Y7QB 4LPCA 3WE6B 5D1QA 3VXPA 1F8TL 4BSVA 4BJLA 2O61B 2E3VA 2P8LA 2OI9C 4PRHA 5FHBH 1MHEA 1U58B 4JM2F 3RWEB 1TDQA 4GW5A 5HI3C 2NZ9C 5BQ7A 4ELMF 5I16A 4FMFA 4NN5B 2F8XC 3B9KD 1DL7L 3P73A 3UROR 1X7QB 2BRRL 4JAMA 3D3VE 2DQUL 4LLWB 2VDRH 4EOWH 4Z7VA 5IHLB 3VW3H 1D5IL 3KNBB 2A6DB 4MJIA 5GSVA 5BZDA 2A1WH 5F7KC 1WISA 1OF2B 4KTDL 1A6PA 5DO2C 5DJ0A 3CPLA 4P59H 2VERN 4NDMA 2YRLA 4ETQA 5FYKE 4I2XE 3P0YL 4G9DB 1BZ7B 1IFHH 2HRLA 3NMEA 4MWFB 4MNHA 2XI9A 2ZOLA 1E4KC 5F88A 3MOAL 3TA3C 3MFFA 3ZKND 4BKLA 1K4DA 4J1UB 4XX1E 4ZPVA 1UM4L 5IB1A 4QY8A 5D4QA 1QSVA 3M8OH 4QNPF 4PGZA 1NEZG 4XVJL 2XACC 3FKUS 4CN4A 3MMEB 1MQ8A 1FSKB 1NANI 4QYOA 3WUWB 4LNRA 5J13B 1MREH 4K3JL 4CKVX 1DL7H 4L9LA 5D1ZD 1X5ZA 3CXHJ 4KI1A 2HJLA 1HCFX 3QWRA 4IDJL 2YS4A 5B4MD 5HY9A 5DRWB 3O6FB 4X9IA 3HCVA 4JFPB 2W1NA 3O8XB 4JHZA 4WIQA 4Z7WE 1OP3H 3EYOA 4JHAL 3VFRA 1FORL 4HUUB 1AGEB 3VDAA 4NQDD 4NKOB 3CVHB 3S5LG 5J1TC 1I3RB 1AO7A 1OW0A 3WUZA 3VXUA 1LGVA 4QRTB 1S9VB 4M8VA 2QSCL 4GG6B 1D3CA 4CJ1A 1A4JB 2HT3D 5AD0B 5CBAB 1WQVT 1MJ7H 1TFHA 3KPSE 5F7DB 4LPWA 4KQ3H 1G1CA 4LCUB 5DVKA 1W2KT 1Z0NA 1CFSB 1H3PH 5FB8A 3QNZB 1PW3A 2V9QA 5KJRL 3SJVE 4M7ZB 4MJ5B 5FGSA 1T3FA 1BFTA 5FM5M 4LHUA 5E24E 1QG3A 3HAEB 1S9KC 4C4KT 2AXFA 4F58L 1BEYH 3LS5H 5CUSH 2AJVH 1N59B 4EN3A 5F3BA 5GRZA 3TO4B 3SDCD 2SEBB 1HWGB 1XZ0A 5I8EA 5I1DB 4LAJH 3DSFL 2JJTC 2R0ZL 1N0LA 2RGSA 4YWGL 2PXYB 4OCRL 4MA1C 5C0CD 2R2HB 3D85D 5CIPA 2DS4A 5HGBA 1G6RL 3QUXC 1NAMH 3VD4A 3TPKA 5EBWB 1UXSB 3CJJA 4LQFH 4K94C 1U42A 3VJ6A 4WWKD 5K9JH 4A2LA 3MXWL 1FFRA 3VXRB 1N59A 4EN3B 5DD6A 4PJBE 3ZT7A 4JG0H 1AI1L 1OTSD 3CFBA 1N6VA 4JM2A 2HJFB 4UIKH 1NFKA 4P23D 3EYSL 3QUKB 3QDGD 4IEFB 3TH2T 3QWQB 3RUGA 4PRID 4M7LT 4H8WH 3DO3A 4M6NH 5D8JL 4MXVE 5D2NE 2OSLA 4QHUA 1E6JH 1XGQA 1UEYA 4E41A 3EGSA 2O5ZH 3W39B 5F7EL 3RNQA 4C58B 1RZFL 3WHXB 1PZ5B 4Z7WB 3QFJB 5D6CA 5GGVH 1QHPA 5EOTA 1T7VA 1P1ZA 3EJYD 5IQ7H 5DK2A 2IBZY 3IU3A 2P24B 1AGEA 1UH2A 4J3OC 3FQXB 4L3EA 5HDBF 5BVPL 4WO4A 3WL9B 4YE4L 1MVUA 2YPLA 1SVCP 2MCPH 3HTLX 1BGXL 4ONFH 2BNRA 4KKNA 4YHNB 3VRLF 5D5MF 4CVWA 4OLXL 4CN6A 2CKBL 4IOIA 3GSQB 3LZFH 1R3JB 1EEZB 1LEGB 3GSQA 3W0WE 1FO0L 1RHHA 3GBLA 1NSNH 4NO3A 2BNQE 1QRKA 1LEGA 4YHNA 2KQMA 2AJXL 4Y5XC 2YXFA 1NLBH 4A6YL 5JW4R 4JKKA 4X6FA 3T0BA 4NRYB 3V5DB 5IQ9A 4NQDA 3SGKC 1SM3L 4MNHB 3FB6A 4MMXC 4KMTL 3MXVL 1UQSA 3HB3D 3BGMB 1W0VB 3DXAB 3FQNA 4Q0XH 4LCIH 5GJTL 4PGEA 5FECA 3TH4T 4P5MB 2OR8A 1HDMA 4X6CF 3LKNA 2EZ0D 2UY7A 1JTOA 4EDWL 3MJ7A 4J3UA 3WO3B 3GZKA 2GTWA 5D2LB 3RP1A 1XGQB 1OPGH 1FNSH 4JPKH 4XCYA 3LKNB 4UQ2B 1U8LA 2IF7A 1MRFH 1QFUL 1OARH 2W9EH 2RJMA 3MOBH 3T4YB 4XNQA 1IGCL 4G6KH 3WFHB 2EE6A 2F8VA 3JWNC 4YBQD 1XGTB 4XP6L 4ERSL 4Y1AB 2DM7A 1A02N 4PJBA 2A74A 4OGXH 2EDKA 4TOYH 5C0NC 4FTVA 3Q0HA 4G8IA 4MX7B 2CJUL 3K80A 4XPBL 3NABL 5C8JB 2CKBB 3ARDB 2Q86A 3W82A 3ZE0F 4ZSOB 4PJAE 1P4IH 2C4FU 5GRXG 4OZ4A 5L0QB 4OD3H 5JO5B 3KYNA 3ULVH 1CFQB 2P5EE 4J7RA 3CVIH 3GJFB 3GGWB 1P7QB 3BXNA 4Z8FH 3BUYA 3BJLA 4O9HL 3IDMA 5C0JB 2CDFA 1T1ZB 2PYEA 4JFEB 5FO9B 3QPXH 3U9UA 2D4FA 1K8DB 1FZMB 5KSUA 4KHTL 4Z7WA 1SY6L 3WDJA 2OJZL 5F3BB 1KJMB 5FM4A 1WBYB 4CMMA 1M05A 4KJPC 2DMBA 1CE1H 4JFHE 4ZDHA 3INUL 2HT2C 3JVGC 1LD9A 4JY5H 2BNQB 3IU4H 2ZUVA 3S96B 1SJXA 3EJJX 2ARJB 3LCYA 4JFZH 1S9XA 3MCG1 1OAXL 2YWZA 1A3RH 3QEGH 4FXKB 3OSKA 1INEH 1QA9B 3U6RB 3UCRA 1MRDH 3QDMD 5GS0L 1WWBX 2X4PA 4X4YA 4M6NL 5F9WB 4FXGA 4O5LL 3CLEL 2EC8A 4Z5RA 3SCMA 2FHBA 1NUFA 4WO4C 4TULL 4LEOA 1RZFH 3LV3A 3QEQE 2V5TA 2NZ9D 2MQCA 1OQXA 2QSVA 2PYFB 1S3KH 3VGAB 3WIHL 3V4UL 3VWJC 2R8SL 2AGJH 1UZ8B 4P46A 5GHWH 1YYLL 4K71B 4P5TC 5CEYA 1F58H 3MBXL 1WZLA 5ITFA 2BY3A 1MFEL 1BLNB 3VMOA 5HJ3A 5F7WC 4X6CA 2IALB 3PGDA 3LB6C 4JFQB 1SEBB 2HTKC 1MWAL 3OF6D 4O2CB 2R0WL 1U6AH 4AQ1B 3RVWD 5ICZB 4K23L 5F96H 5I9QB 3I6KA 5BZWA 5JHLH 3MXWH 4CN1A 3B9AA 5TDPA 4LK4A 3BH8B 3E0GA 5FF6A 3KLHC 5EZJB 3BN9D 1G6RH 1KJ2B 2YPVL 4PJGF 1A3LL 1DZBA 1PGRB 1R24B 1D9KB 2L4OA 3NCJL 1IGTA 4PJCA 5JIIA 1JNLH 4M5ZL 4MJ6B 3H9SE 3PV6A 5GSRB 3C60C 3O41B 2BSRB 4KPHH 4WU5A 1T4KB 4P3DB 2DQDH 1ZHLA 4UT9H 1HOCB 3CDGA 1N3NB 1I9RL 1I3RA 4HT1L 5FM8A 1F90L 3L6FA 3MLZL 3QIWD 3ZKMC 5C0GA 1A8JH 4ODHL 5B21A 4LLUB 4DQOL 5TQ2H 5I30L 1MFDH 2FJHA 3MBEA 3MRPA 3C5JB 4PRAB 1FGVL 4WW1B 3AM8C 5A2JH 1DQLH 1S7RB 1LO4L 2VSDA 1X6LA 1MVFA 1SJHB 2UZIH 4N8VA 4UDUA 3BSZH 3F8UB 3I6GB 2ZWLT 4V1DB 2ICCA 2FEEL 3TT1H 3HNVL 1JTPA 1ES0B 4DWHA 4JRXE 5IVZB 2Z91A 5I1CH 2CLVB 3VRJA 3U82B 1IL1B 1YJDC 3L3OB 4IS6A 4NQCE 2VQTA 3EAKA 2ERJC 25C8L 2HLAB 2DQHL 2NY5C 2WUBL 5INDB 2Z91B 3NACH 5F9JA 2Q76B 5DFTA 4QRPA 1C5CH 5HGAA 1R5IA 1XGPA 2XN9A 5EOCH 2A6KA 3VRLE 4AIZB 3GDBA 3LRGA 3B4NA 1DEDA 4W6WB 1YNLL 5MEPB 4FABH 3MBEC 3WLWD 2P44B 4V1DA 2ZKHL 2R39A 4MD5B 1SJHA 4DKFH 4XI5C 2FO4A 4X9BA 5DK0B 2JJWA 4X6CE 5DK0A 4Q0XL 2YA0A 4LLAA 1KCSH 5LKNA 2DTSA 3S5LA 3MQIA 1RUPH 1G6VK 3DRTB 2GFBB 4KHTH 1ZXQA 4JQVA 2BVOB 3ZTNH 3DROA 3SKJL 1Y6MR 4G5ZH 5EU5B 4NQEE 1CXFA 5SWZE 3AMLA 4GSDH 2WWKT 1CN4A 5GZOC 3MJ8B 1JNNH 3K0WA 1WIPA 4OAWB 4BZYA 1PY9A 5TPWL 1ADQL 3P4NB 4H1LB 1F3JB 5E9DB 3H9SB 2E7LA 4R4ND 3UO1H 3VFMA 5EU6B 5IR1B 4WO4D 3AS3A 2DQTL 4NN6B 5DRZA 4R90H 3EJYC 5DZLA 4Q9CA 1PX3A 3B2UC 1KTLA 1ZLVH 3RDTD 3MJ9A 1VESA 1R3LA 2IALA 4AYFA 3LQAH 1TPXC 3MLRL 4HIIB 4JFXB 3QDJB 3LPGA 1PEWA 4OZFH 2C3GA 2YXMA 4EBQH 2YD7A 4XP4H 4P3CH 1I7RB 3NBNA 3GMQA 3G5YA 4C56B 3PWUB 5DRNA 1OAQL 3MRHB 3EO1B 4J4PD 3MO1A 5C2BL 2G5BA 1MUJB 1FG2A 1FPTH 1F6FB 5IBUG 1ZLSH 1CT8A 3P9LA 5FGCB 2XRAL 3LQZB 4M61A 4MB5A 4X6DA 4DKDC 4X9HA 4AT6A 5GSRA 2XTJC 1OAXH 1YPZA 4M1GH 2NLJA 3DVNA 4HEME 3AUVA 4HPOH 3T09A 1G9NL 4HUMB 2F53E 4HIXL 2FIKA 4KPHL 5IW3A 2BVPB 4LLYB 4HKBA 1ZA3B 1FH5L 3I2CL 2O5XL 5ANMA 3PQYB 4JRWA 3RNKB 5E8DH 2AEQL 1YPZF 5KN5A 3PWPD 1MCCA 2Y72A 4QHMA 2IAMB 5CEZD 4PJHE 4K2UL 2WBKA 5CP3H 3U9UB 4V1DD 4XPTL 5I19L 4OZHB 2XQBL 5I1IH 5F1NA 1MCPH 3QHZL 5CIPH 1YNTB 3P77B 1BD2D 4PD4J 2ZG3A 2W60A 1HNGA 1GAFL 1FYTA 2QKIB 4PJAF 4LLMA 3O2WL 3QJFB 3D3VB 3VD7A 4NQEB 4XNZC 4HQQL 5KVFL 4LCCC 1Q0XL 4XB8A 4YX2L 4KK6D 5KAQG 5T3ZE 4KZEL 3ARDA 1VDGA 4AL8H 1Z6JT 4Z7UB 5HTSA 5T1LD 3OKKA 3RA7L 1NDGA 1J8HA 4G6AD 4RDQF 1PKQE 25C8H 5D70L 3CVHL 2W9EL 2R69H 4GKNA 4YHLH 5DEZA 3CFKA 5KZCB 2YPKB 1RY7B 1CDHA 2RFXB 1KIQB 1MFBL 1QZ1A 1RUKL 4I8DA 4WWID 2W9DL 1RU9L 2B7DT 5F7LB 2VSCA 3RVUD 3A67L 4G3YL 1VEOA 4NZDA 4UV4L 3QUZC 4PJ5B 4ZTOH 1GGCH 4GT7A 1T0MA 2Y23A 2P45B 2FH6A 5T1KB 3KPMB 2A6JA 3VFWA 1Y0LA 3B43A 2P8PA 1WV7T 4H26A 5ACZA 2MTPA 1NFDE 2OL3B 2VDOL 3SDYL 3GHBL 4ZS7L 1QRNB 4M1CC 3RWGA 1DQJB 3D9AH 4LFHG 4RAUB 5EOCJ 5IOPA 1IGJA 3FO9A 3QO1A 4ZAKA 3HAEG 2NXYB 4Y4FD 2AJUH 5DYOB 2BOBA 3PWLA 4P2QA 3AY4C 4OQTA 4ACPA 5DMGD 3SQBA 3WHE1 3W11D 3U7WH 3M17A 2APVA 2DD8L 4NQCA 3S3PA 2VDKL 1Z9OA 5BJTB 1HSBB 3BYYA 3K74B 1MIEL 5C0IA 5FOJA 2FSEA 1AE6L 1VFAA 1T1YB 1IAKA 5C0IB 4ZTOL 1G6RB 3TVMC 2JE8A 4TTDC 4QTIL 3MRKB 5LCVH 5IHBA 1TNMA 1FL3A 4X4XB 1DQTA 3MA9L 3ZE2E 5CZKA 3W5NA 4WHDA 1I75A 1RZKH 4DZ8A 4OZHE 4FFWD 5I8OL 3GSUB 2E9BA 5DDHB 3WXWH 5ICXB 4ELME 2DKSA 4KROD 1ITBB 1DN0A 1OCWL 4PRIE 5GQBA 5HHQA 5I2IB 1KG0B 2X70B 4LVEA 3SO3C 2NR6D 4APQB 3E2HB 2A6IA 4UQ2A 4Q58C 3TN0C 4PRNB 2V2TB 4F3FA 3T1FB 3Q6GL 3T0EA 5ICYA 3LRHA 4CL7A 1F4XL 4PJ5A 2HKHH 4APQA 2Z8VC 3VI3F 2ICES 2XXMB 3HMXA 1DTUA 5T33L 5DMYA 3T1WA 4CRPA 2BOCB 3AFLA 3FO1B 3OR6A 3IYLW 4O2FB 3ORJA 4TRPH 3OKEA 1BFSA 1OP9A 1JIBA 5J6HA 2Q7YA 2V5MA 2FX7H 5DFVC 3R0NA 3V5HB 5EFIB 3KJ4C 2VB5A 4GAFB 1DDHA 4D8PA 5D7JB 4U1IB 5IJKA 4QXGL 4ELKB 3V0VA 3JUZA 1FO0A 2DRUA 4KDTC 4FQHB 1EEZA 3NCFB 4ZOAA 4P2CG 1UWXH 5D96C 1X5AA 3C6LB 5BJTA 2R4RL 5DS8A 1DEEA 4S0TD 1EERB 4PJ7E 3T77B 4Q7DA 3AB0C 4A6YB 3MREA 2DICA 3DUUB 4XXCC 4ZUUB 5A16A 5IQ7L 1Y0LB 2EDWA 3OAZK 4HUVA 4U2YA 5F9OH 3BRGC 2F53D 1VB9A 3Q2CA 4JANA 2HVKB 2R0LH 1PZ5A 1MI5E 1CIUA 1K5NA 1QSEE 4FG6D 4CVZB 4L8DA 4HAFA 4P46C 4H0HB 3RWIB 4Y16C 2OR9L 2H45A 3HFMH 5T3ZL 2C1OA 4X8XA 1J10A 1MF2L 2VH5H 3HUJE 1NCAL 4CVZA 1TETH 4GMSH 1KCKA 3DUHA 1KIQA 1P53A 3VJ6B 1JNHB 1MIML 5EU7C 4H8WC 3FN9A 1XEDA 2D03L 1YMME 2WBJB 5D8JH 3TJEL 2F9BT 3MV8A 4P4RA 4ODBD 1S9VA 4KK8C 4XPTH 3RVXC 4ZUUA 4IIQB 3LEXA 3QBTB 1XF3A 3ROLA 2D31B 4XCCL 4LSTL 4L9LC 2KZWA 1LQSR 1BJMA 2WNGA 3S36H 1Z0MA 3ULUD 1AR1D 4UI2A 4LNRB 4XPAL 4ODWB 4HK3J 3V5KA 5DJ8A 3HI1B 1NBYA 2GTZA 5JMRA 4D9QD 4R4BA 1J9CT 1RURH 4S1RH 5EO1A 5GISH 2ZCKH 2BVUA 3MFFB 4MVBD 3HR5B 1FPTL 2Q7YB 5I75B 4WFFE 1AKJB 4QY8B 4DUXA 3O3DA 2DQUH 5ANMB 1K4DB 1JRHH 1H8SA 3RZCA 1YEIL 1HQRA 5IBTH 1EXUA 4MDJB 4GG6A 2ZG1A 1OY3B 3KDMB 4XWGH 1EMTL 1IAOB 3HMXH 4G6AC 1FCGA 2A6IB 3KWWA 2K7PA 3VG0L 3QXVA 1KCRH 1ED3B 3PWUA 5DRNB 4LAQH 5I15L 4JFPA 2HFEA 1UM6H 3QPQD 3W5MA 1RK0A 3CVHA 3QFDB 4XVUC 1P7KB 1T22B 1T5WA 1UACH 5DJCB 5F7EH 1C08A 1HQ4A 4JPKL 4YZFF 1A47A 2B5IC 4FN0A 5CS7A 1G7QB 2E6JA 1KJ2H 2VLJE 3NH7L 4OM0H 2ESVD 3KPSA 3GMRB 3L9RA 5IMOA 1B0GB 3OHXB 3MOBL 4Y5YB 4TNWF 1A2YB 3D2UD 4QWWC 3QFJD 5M7QA 1UCTA 4U0QB 1DSFL 3PWPE 4YHYC 3FMGH 1KSRA 3FZUC 2YZ1A 4G8EB 1X44A 1YEHL 3KYKL 4GQ9H 4IRZH 1MIMH 5A40E 3I9GL 1MCLA 3WSQL 1XMWA 2EE3A 3U7WL 1F4YH 4XXCA 3FCTA 3MRDB 2YUZA 4K7FB 3EOAA 1MOEA 5C08D 1I1AC 5L9DL 5GZNC 2WANA 2H32B 3PF2A 2R1WB 4OKDA 3PL6A 1EK3A 1OGAB 1WWWX 5DQ9B 5DJAB 5IVXA 3SCMD 7FABH 4ODTH 4Y4HA 1NGWA 1QNZH 4YBLB 2J2ZA 3ZTJH 1MY7A 2BMKB 1TVBB 1RZ8A 2NTSP 1ZT4B 4LOUD 4JRYD 3DNKA 4OCSL 3SGDI 4NRZA 2AXHA 1ZHBA 2EEAA 2LABA 2GUOB 1JFQH 4GW5B 1PG7L 4I4WB 4WDIB 1P7HL 3H7BA 2ZCLL 5F96L 3SKNB 4WRLA 1UYWL 1AXTH 5JQ6L 3DVFA 5IFJA 4NRXB 5AEAA 1GZQA 2FX7L 1QPPA 1BWMA 3PP4L 2OCFD 1DQQB 5E0QA 3AAZB 3C87A 1UENA 3AU1A 1L7IH 2B4CC 1XCTA 1JGVH 5DZNA 3L3HB 4MZ3A 1TTGA 1IVLA 3PL6B 2PNDA 1KELL 4QHNA 3BH8A 3Q5TA 4PJGA 4ZXBB 5SWZD 5FA3A 3U7YH 4DGYH 1BVKA 5CEXA 3V4UH 2K1MA 5D7IE 3UP1A 2WWMC 5BW7A 1JWUB 4WW1A 5E8EB 3ES6B 2Z8SA 4UDUB 5M95B 1WT5A 4JO4H 3RX8A 4NGHL 4PRAA 4PJAB 1S7RA 1PKQA 3K4ZA 4P46B 4OTXL 4P9HL 3BIAX 1F6AB 4UZGA 4PJIB 3S6CA 2YUWA 5ESAB 2P5EB 1FYHB 5E95B 4NOBA 4X98A 2BSRA 1ZGLP 3UJJH 3ZHDA 3KYOA 2M2DA 1ZHLB 4MJ6A 1F3RB 1LP9A 1FVEB 1FCCA 4LP5A 1ED3A 4XNUL 4OFIA 1ZK9A 4MNQD 2OJEA 4X4MA 1CICB 3DRQB 5DQDL 1R5WB 1D9KA 2D7TL 4UV7H 3CCHA 2N7BA 5J6GB 4U1KA 5LGHL 3NABH 3I02A 3MRRB 1PG7X 4GRWF 2JB6B 4JRXD 5GIRA 3EJZD 4KJWD 1ETZB 3CFCL 4BK4A 3UJTL 5JHDA 2BZDA 5IF0A 1PYWB 1ONQB 4PRHD 4YHMH 2DI8A 4ODVL 4X6CB 4NN6C 5ICZA 1AO7D 4Y5XB 1I85C 4KJYB 3BXNB 1BVKB 1VSCA 3O81A 1NCNA 4D3CH 1MHHA 2QADC 5IBLC 5T1DL 1QLFB 5E6IA 3MLVL 3ZT6A 2P8MA 3TT1L 2JJSC 1F3JA 3OGOE 3Q6GH 3PDOA 3BSZL 1DN2A 3B9KA 4LPYA 3FOMB 3K1KC 4JCMA 4LEOB 2CXGA 5TH2A 3WDIA 4YIQA 5IEHA 2NY4C 5I76A 1DBMH 2B2XH 2ENYA 2AJZA 5E7BA 3ZYJA 2VAJA 3U2SA 3SOBH 4UOW0 4OCXL 4F33A 3GMPA 3L3IB 3ZHLA 2BVOA 1ZWIB 3RDTA 5B39A 3RWDA 4C83A 4YBHA 3VG0H 1OTTC 3SDXB 4L8BA 4NJ9L 5CD3B 1PLGH 3KLHD 4NO5A 3CDFA 1ZHBB 5FYJH 1TCRA 1HHIB 4X7SH 4DVRH 2MHAA 3WFZA 5FYLD 4HS6B 1JNLL 4U31A 3V6FA 4X99A 2APXA 5DMKA 4LP4A 4KI5F 1IKFL 2H2PC 2HT4D 4XNYL 3WFDL 2GY7B 1JPFA 1CL7H 5EUOA 4A6YH 3B6SB 2YHGA 4TUKH 4X6EA 2G2RB 2V7NB 1GRWA 1HILA 3IJYA 3UDWC 2X4SB 1AD9B 3U1SL 4NPYB 3QI9C 1JRHI 2GK0A 3CZFB 2EIDA 4QOKE 4P5KB 1U8MA 4WWKB 1N0XH 1U3HB 4J3SA 1BVLB 3STZB 1NL0L 5DUPH 3J8F7 3IVKB 4TSCL 1QFWL 3KJ6H 2YMXH 3L7EB 3UTSE 1NANH 1KN2L 4PGCB 1AD0A 1RHHB 4RMVA 4F7MA 3BZFA 2AJYH 1FNSL 2N56A 1NC2A 3QB7C 2LFGA 2XWTB 3QSKB 4HJJH 4B50A 4ENED 5KS9F 4KZDH 4HG4K 1CF8L 4U6VH 3Q3GA 1TJIL 4NNPH 4RAVB 5KVDL 4U1NB 3DYPA 2Q6WB 2DQHH 3FAWA 5C09D 1HNFA 2VL5A 1S9WB 4U1HB 5JPNA 1KEGH 2R0KL 3L3GA 4FQLH 1GGBL 4CNIA 4NHUA 4OIIH 4H88H 1HOCA 2JCCE 3KS0H 1DFBH 3S4SA 1I9RH 1SMAA 4XP4L 1MJ8H 1LDSA 5D1XD 2XZAH 4LNVA 3BD3A 1RV6X 3EDJA 4DFHA 4ZFFA 4DQOH 3MV9B 4PTUA 2JCCF 3QG6B 4XXDA 1D9KC 5D1XC 3QUXA 3NH7H 3N1QC 1LEKB 3O8XD 4L8CA 2X70A 2NY3B 1K2DA 1U0QA 2OL3L 1DBAL 1IRAY 3S35L 1J1XH 5HVFB 1XF2A 2UYLA 3NTCL 1T1WA 3VFSB 2JIXA 3QPXL 4LARL 1HWHB 5KSAD 3C2SA 1BZ9B 3ROOB 1W72A 3GB7A 1J18A 1OTUC 2DWDA 8CGTA 3FONB 4BELD 2RB8A 5DO2D 1IM3A 3HE6B 1BZ9A 2C7UB 5IMLA 3GBML 4LSRL 5IBTL 3AS0A 1AD0B 3PABA 4Y4HD 4RMUA 5D7IA 5MENB 3OJ2C 4BH7A 1BEYL 2CIIA 5CUSL 1RZGB 1NC4B 1BHGA 1UJTA 2AJSH 2IAMD 3SDAA 1X5XA 3EYUL 3W9EA 1U8PA 5ID1B 3T8XA 3FO2B 3VXUE 2VQ1A 3VWJD 4XC3H 1IM9B 1G0XA 4BSWB 3TBYA 1KFAH 3H2WA 2PCPB 5FHAH 1XF4A 3BH9B 4JO3H 4BH8A 2D9CA 1T03L 4Y19D 1OP3K 2FO1A 4H25A 5J1AA 1S78D 3QDJE 4Y1AD 2FR4A 4QRPE 1MJJB 3KPOA 3FRPG 4L8BB 5CD3A 3CVHH 5EU4A 3RWDB 3H0TA 4C83B 3H9HA 1AJ7L 3SDXA 3ZL4H 4F7CB 3VRIA 1MJJA 3VXNB 3ZLQC 1ADQH 4GKNB 2FBJL 4LASH 5H37H 3R4DA 1J0YA 2R1XA 4N9GB 5C0AA 3Q3GB 3GRWA 1KJ3H 3K2UH 5I76B 1BD2E 1I1AB 5EH1A 5EZIL 2JCCB 2UUDH 4JFDB 3HLAA 1S7TA 4YHPB 2F53B 3TFKC 5T5FL 5DFVD 5DF0A 3WNMA 3MV9E 3MCKA 1RZ7H 1NPUA 2FECL 4KMLB 5CEZL 1NGZA 1R3HA 2ZKHH 4NNXB 5HHOD 2X1PA 4PJHB 1KB9J 2AXFB 4NN5C 1FV1A 1FDLL 3HZYB 2XWBA 3CX5J 4UT9L 4ZFZA 1OD9A 3S35H 2ZUWA 2VR4A 3MRQB 5GS1A 5EA0H 1ZMYA 1FNAA 2J88L 1KJVB 1E4WL 3IXTA 4QT5B 3AREC 2IAMA 2HG5B 1FIGH 2HN7B 4PJFF 1A6TB 3ARSA 4LLQB 5B38B 1IZKA 2LE9A 5F1KC 5J8OA 2EDHA 2PTUA 3G9VA 4MJ5A 3S4SG 5E2VL 3WS3A 1YPZB 3NA9L 4HWZB 1A9BA 4HPOL 4XP1H 4LCUA 1AR2A 2VR9A 3EDKA 1VFBA 5ALCH 3IFLL 4F7TA 5BZDB 1A7RL 4AEEA 3SE3C 1HHJB 2H6PB 2HH0L 1CT8B 3P9LB 4ZTPL 4FQLL 5J3HC 3VXUB 5FOBA 9CGTA 1BQUA 4Q2ZA 5H37G 3G5YB 4LFHD 5ID1A 1V8HA 1T7XA 4AG4L 1QSZA 5D5MA 1UM4H 3GSUA 5DDHA 1EJ6A 2WSKA 3F6LA 4ONHA 5JPNB 1H0DA 2VDLL 4BFGA 4FZEL 4WU7B 5D2NB 1CLCA 3VD5A 3TNNB 4L9LB 5DUBB 3DYOA 3AVEA 2YUVA 5EIIA 3FONA 5D7IF 1A6AA 4DTGH 4QYOB 4FFVC 1YMHA 1ULVA 4EUPA 5KG9B 3C8DA 5KVGH 4XGZA 2UVFA 3KS0J 4YDLB 2WP3O 3G5ZB 1FFPB 3R1GH 3UAJC 4PUBL 1QFWH 3OAYH 3RU8H 1BVZA 1AGBB 4L8SB 4FTVD 3LZFL 5CMAA 2BSTB 3GEWB 4QHKJ 1EGJA 1CDUA 3EDEA 5D6CB 4K71C 2YD5A 3DMMA 3U36B 3P73B 4HC1H 2B1HL 3DX6B 4GRWE 3T3MF 2NXZD 1UEMA 2EZ0C 1IQWL 3L1OL 4OF6A 4X7TA 4KGJA 1WBZB 1T7ZA 4JM4L 2NW3A 5I74B 1HKLL 4O9HH 4N9OB 3U7YL 4DGYL 5TE7H 3IT8D 4JB9L 1HSAB 1QTYT 4XMLL 1P4BH 5FYKD 5JW3H 4PRIB 1XGRA 2VOTA 3SDYH 1KT2B 4PREB 1IKNC 4KK5D 5BW7C 1I3GH 1PSKH 4TRPL 5HHVH 1JPGA 4LSSL 5C0FB 5C7XH 2DBLH 2ED8A 5DA4A 5T33H 2A9ML 5D7KE 3SJVB 2X4QA 4RFOL 5H35A 1KN2H 3EOTH 5JORA 4OKVA 4HK0B 4LASL 3KPRB 1GZPA 5E6IC 1C1EL 2GAZB 1KOAA 2R2CA 4ZTPH 2ICWB 2PYEE 1ZHNA 3MRDA 1ERNA 4Y4KD 1ZHNB 1D6EB 3VWKB 3P4OB 5CHNA 3VGEA 2VC2L 1CD0A 1B88A 4IDJH 3QQ3A 3DV6A 5T5NG 1T21A 2IADA 5C0RH 3GJFH 5F8QC 4WFED 4BFEA 3DYMA 2K3TA 4O2EB 3CNKA 5E08H 4Z7NF 1DLHB 5KN5B 1KENL 3FT2B 4BM7A 5E8OB 1K85A 4N5UA 4LCWA 5SWSA 4N0UB 4EI6B 3QUXD 2XZQH 3V7AG 1SJEA 3QQNA 4LSVH 3HAEH 4HBCH 4NP4L 3GM0A 4NZTL 4X7TB 2Y1VA 3ZKMD 4BK5A 2W92A 1JVKA 4MQXC 4P2OC 2H32H 4M61B 1K6QL 3G04A 5IROC 1JF5A 4NYLA 4JPVL 2AABH 1OGTB 1U8KB 4NYLB 5L9DH 1HE7A 4RX4D 1HHJA 2YD1A 3DLQR 5GGTL 3O41A 3NACL 4NKOA 1U91B 5F71A 3NFSH 1I9IL 3QDGA 5D71L 4DJMA 4TSBH 3IDIB 1NMAH 3FJTA 4MDJA 4ONFL 2Z93B 2ITDA 4LBEB 4H20H 1VKXB 2BFVH 2B1AL 3LQAC 3RVTD 2I9LB 2YC1A 4ZNCD 1A14L 2PKDA 3OR7A 5BZWB 2NXYC 3WYRA 4QRSB 4HCRL 1PQZA 3W2DL 3E8UL 1UGNA 1X5JA 1PQZB 1FORH 4JN1H 1C7TA 2EDQA 3GI8L 3VI4F 3KYAA 3V52H 2XOTA 3IFPA 3MXVH 2HTKD 2CK2A 1NFDF 5IB5B 2DLEA 2PYFA 1F58L 3MBXH 4Y19B 5C7XL 2HFFA 1GOFA 3V4PL 4AM0A 4BSJA 2EDJA 3W0WB 2HJKB 2D7TH 4UV7L 5FXCH 1ORQB 2LQRA 4NO2B 4JY4A 4YDKL 1MQKH 4I0PA 1OWWA 2P49B 2VMFA 1AGFB 4FXGB 4FXKA 1ZLUK 2C4XA 1O0VA 2ARJA 3G6AA 2WWKO 5E4EB 3RWEA 1I8KA 4GS7C 1S9XB 4MAUL 3VFVA 1K9TA 3RI5F 1I1YA 1P5VA 3IDYC 1KJMA 4CMMB 1S7WB 4Y16A 5KSAB 2BCKB 3TZVB 1BBJB 1YC8A 4UNTA 1NCUA 1DLHA 1VFUA 1L7TH 3ALXA 2HWZL 3FO0H 4NM4L 2HVKA 3R0MA 1OGAA 2JJUA 3NIDF 1J8KA 4MA3A 2JB5L 3T2NL 3W9DA 4TUOB 5FDWB 3GGWA 2BSSA 4PS4L 1YJDH 1PSKL 4MNQA 1UXWA 3HZVB 3QIUA 3AM8A 1EO8H 2NNAA 3PWPA 1RSFA 5TE4L 3QWRD 4UIKL 2Z9TA 1JCKA 2HP4A 1L6ZA 3CXHK 2R1YB 3AAZA 4R9HA 3KPRA 3O2DA 2I26N 4PY8J 2CKBA 3JTTA 4ZUWA 4N8VB 3OMZA 3ARGC 3L9RB 5IMOB 2JELH 4I77L 5IMKB 3F5WB 3NPZB 3QUZA 3TNMB 3V5HA 4Y2DC 3T4AA 1XFPA 5CILL 3IU4L 2YZ8A 2ZPKH 3O4LD 3RY6A 4WI9A 4YDVB 2EDNA 4JO1L 2HH0H 5CKGA 1M6OA 3T4YA 5CSZA 2BVQA 4F15C 3BP4B 1FZJB 4K8RH 4Z7OF 4ONGL 4OFDA 2HYMA 4B7IA 4AIXA 1GHFL 4U1SA 4D9LH 4ZUVA 1V3JA 1X4ZA 1AXTL 4KHXH 4N8VG 1N6QH 1KTKE 2DM3A 2IG2H 3THMH 2CIKA 2WK2A 3MJ7B 1QUNA 4KMQA 5DD3L 3PDDA 1C5DB 4HWZA 5I1EH 3TF7C 2UV3A 5HYEA 3S4SB 1WIOA 1UQSB 3GI9L 2EICA 3MRIA 3O3DB 1K6QH 4RMQA 1Z5LB 4XP9L 1QBLL 1OWRM 3SDXF 3BPLB 1WFUA 5DHYB 1CFTB 3F7QA 4G8EA 5EULV 4NCDA 1MJ7L 4NQXA