3T0VA

Unliganded fluorogen activating protein m8vl
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
EPVLTQSPSVSGTPGQKVTIFCSGSSSNVEDNSVYWYQQFPGTTPKVLIYNDDRRSSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCLSWDDSLNGWVFGGGTKVTVLDAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dye-binding protein
molecule keywords immunoglobulin variable lambda domain
publication title A variable light domain fluorogen activating protein homodimerizes to activate dimethylindole red.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3t0vA00
4L3CB 1HYSD 2QSCL 4ORZC 4M1GL 2RCSH 3GMPA 1DQLH 3GMOB 1N3NA 1UZ6F 2X4PA 1ZLUK 4QHUA 4XX1E 1KBGH 1UCBH 2JELH 4QRRE 4WDIB 4WU7B 2CIKA 4K94H 5AZ2H 1KTDB 4KJYA 3ZKXB 5CD5D 1AY1L 4HXAH 5F72S 1JPTH 2H2SC 5C0GB 2HTLD 3QHFH 4OCRL 5JDJA 4U05A 4PJFF 3ZKMD 2V6HA 3IJHB 2MCPL 4P5TB 4UOW0 3TO4B 3HUJF 5EU7C 5GRYA 1A7BA 2OK0L 2X1XR 4ZSOB 3A6OA 4LBEA 4PJAB 4LVOC 1CGYA 3MODL 2R0KL 1KLFA 2KDGA 4WUUD 2P8PA 5IMLA 5HHOB 4NQTA 2QJDA 4KVNH 5DJZB 4KRLB 3S34L 2DLHA 3ARFC 3QEHB 3MLWL 2N7BA 4U4BA 2YC1A 3Q5TA 1T2QH 1J0YA 3LKRA 3NPSC 4YHKH 3V52H 5AUMB 5KTEL 2KZ1B 2AGJH 1MY5A 4U31A 1ZWIB 3KPRB 1BF2A 5IMKB 1PKQA 5IVOA 4YDIL 5J13B 4Z7VB 5E24E 3P0YH 5FKPA 1BGXH 5ISZD 1LEKB 2CLRA 3OKEA 4PRHA 3AROA 4CADB 1RIHH 4X7FC 3VXMB 2KH2B 3S96B 1SEBB 1JPSL 2H8PA 1D5ZA 3VD3A 2ZP0T 4J3TA 3GI8L 1UGNA 2IAMC 4LLQA 5F7FA 1A3LL 3TWCH 4NO5A 2VDLH 4X6DA 1EBPA 4GKOA 5CP3A 3L1OL 4D0BA 1PYWA 4PJEE 4UDTB 4NN6B 2H2SD 4L8BA 1IC7H 4NIKB 2FGWH 5B8CB 3BW9A 3OGCB 5HGDA 3TYGH 3GSQA 3HHRB 1IKFH 1DBBL 3LSOA 3QCTH 2YA2A 5IW6A 5SWZD 1I3VA 4FFVC 4NUJB 4CVUA 3H3PL 1NFIB 5FHBL 3PV6B 4TTDD 4MX7B 4X7EC 3OKKA 1T1XB 3PWNB 1I9RH 4FFYL 2AKRA 1FE8H 3P9WB 4N0CD 5HVHC 1NQBA 4M6NH 5IB4A 3UTSB 3VRJA 3CSGA 1ZA6A 3ZKNC 1M7IA 4FQJL 1ZTXH 4FMFA 5H37G 3BIBX 4U1IB 1F97A 3LIZL 1BP3B 1PDKA 2D7OA 1MFAL 4XNYH 1XF2B 1F90L 4KTEH 5HYJD 4Z7WB 2GTZA 3VXTA 4LL9A 1DN0B 4M61B 1BMGA 3RWIB 3VXSB 4ETQB 3QCVL 4DGYL 4OD1L 3WO4C 3WN5A 2NXYD 2P7TA 1F6AA 3LN5A 3MCKB 5GIRA 4RAHA 1JZ6A 1IGML 5MI0C 5K9KB 4ODUB 4Y5YC 1PG7H 2HJFB 4FP8L 2B39A 3CPLA 3DHJA 1NGYA 2VZ3A 5A3IC 3SGKC 3VJ6A 1PVHA 3MLZL 3GRWL 3HA0A 4J6RL 5KVDH 4L1DA 4N0FA 4OAWB 6FABL 4FFVD 3IFPB 4GRWF 4XCYB 5IB2A 2A38A 3GK8L 3DO3A 1A8JH 3NA4A 5C0JA 3MV01 5EORL 4XRCB 3TGXA 3TVMD 5C0RH 1MVFA 2LTQC 3IFNH 4LLDA 1U3HC 2VQUA 3RL1A 1JF5A 3DGGB 2EC9T 2Q8AH 4Y4KB 2YBRB 3HPLA 4FXGB 5DRWA 2I60L 1DSFH 2E7BA 4PTUB 1ADQA 4F15C 1CDUA 1PFCA 3NOIA 1P9MC 3VGBA 1S9YB 3KPLA 5JOPD 2QQLL 3GUTB 5C6TL 3C6LA 4RMTA 2AJVL 3R8BB 1ZLUH 3MLXH 2E6QA 3LEYL 4QRTB 3DSFL 3TPKA 1NH6A 1ERNA 3RIAK 3BH8B 3LQMA 1KJ3H 4Q74A 4YGVB 1HNFA 4R8WL 5L2JB 4LSRL 4NWUH 4JPKH 4ZO9A 3KWWA 3SQOH 4XAWH 1X5HA 2P49B 4KUCF 3UJTL 15C8H 1CGSH 4M8VA 1JHKL 5A3ID 4AM0B 3LMJH 1MCPL 3QI9C 1U8MA 3IDNB 4XPFL 5J11C 1ZHNB 4XMLL 5FYJD 3AB0B 3OKDA 1NLDH 5LBSL 4AJ0A 3F12B 3IAQA 4X9FA 4HMDA 4HZLB 4Q6IA 3QDMD 2VIRB 1B0RA 5DZNA 4G6FD 1KJ2H 1HCFX 4Y19B 2FX8H 4M6MH 4MAYB 1MLCA 1QSVA 5IVXB 4R26H 2ATPB 2HWZL 5FUCC 5L8KB 1MSPA 3KYNA 1C5CL 3NFSL 4JHWH 4HX1B 5HI4C 3SDDC 1DVFC 4PJCA 4L4JA 1T66C 4UNTA 5HHXH 1FHGA 4WW2C 4NP4H 1OPGL 4JRYB 1CL7L 5K93A 1BFVL 1RK1B 1DBML 3VFUB 1FBIH 4TSBL 2A6IB 4FNLH 4GKZB 1ZLVH 4AEIH 5JR1L 1ZHBB 1G9EA 4LSPH 3FT3A 4NJ9L 5K9JL 1NC2D 2RFXA 2EIEA 3C8KB 4LHUA 3RGVA 5M94B 2D7NA 2I27N 3IF1A 1AP2B 3BPLC 3WIIH 4YXHL 1OP9A 1PQZB 3IFLH 3IDYC 1S7SB 4KUCD 5E1AB 4X7TA 5BRZD 1M6OB 3VFWA 1LE9B 5D93C 3NAAL 4HWEL 1EEUA 3D0VA 3FRUA 2C3VB 4EUPA 3ARGD 4LIQL 3U4AA 4MD5A 4HUMB 2FO4A 1HQ4B 4HBCH 2HT2C 4OIBA 5GGQL 1WISA 5FGSA 3NA9L 5E56A 3M1BA 4JHAL 1A4KA 3UO1L 3OKMA 4NNPH 4TVPE 1QSFD 4EKXA 1XIWB 5IBTL 3SPVA 3VFGL 1AGDA 2V5MA 3DO7B 4QHNB 1KYOJ 2VISA 1DZBA 3B2UD 2KPNA 3GMMA 4NQSB 5DJYA 1KSRA 4X5WB 4I18A 3IU3A 3G04B 3RZCB 2J8UE 2AK4B 4OKVA 1BVLA 1VFMA 4HV8B 3P77B 1RURL 1YEHH 5I74C 2EXYC 1EH9A 4XP4H 1QNZL 1S7WA 4HLJA 3PG2A 4Q58C 4Y4FB 1XGUB 4P57A 1ZLWK 1UWGL 4P2QB 2XZQH 2VLLB 4JY6B 1YMME 1BBJA 1YNLL 3FTGB 4PJ8C 4NNYA 4A6YB 2PYEE 4CMHC 4W4OA 1CLYL 1I8IB 2OX5A 2VITA 3FT4A 3FO1A 4ONHB 4HHAB 1BOYA 4WHCA 5EU4A 2FHBA 4DWHA 1FAKT 2EE9A 4AIXA 4FQXD 2HT2D 4KJPD 1KEGL 1H3VA 3QNXB 1MVUB 2B5IB 2YK1H 5HDOA 3DVNB 1JE6A 4HCRH 1YNKL 4MCYA 2FJHA 5T1KA 4LLMA 3RGHA 1JTTA 3EUUA 2DM7A 2IH3B 1T80A 3O3DB 3TNMB 4KJWC 3TNNA 5MENB 1AJ7H 4YX2L 3DX6A 2JJTA 4IBLT 4P9HH 4OFKA 3MLYL 5CKGA 4S10A 4U6XA 4LOUC 4I9WD 3CXDL 4PFEA 3HMXH 4PYGA 2R4RL 1J86A 3PIQA 2R2BA 4PY7A 1D3CA 3VFPB 4N0YH 1DFBH 3QQ4A 1C7SA 1R3IH 5ANMB 1CXEA 5MHSD 3OJ2C 4U3HA 2EXYD 4FG6C 4G8FA 3L6FB 3STZA 3UTPD 1J05B 3FOLB 3B5GA 4UIKL 4XVTH 4PGZA 4WFED 4NFDA 1IEBA 4MCZB 2WSKA 5EOCH 1ZK9A 4RDQF 2H9GA 1OARL 2GY5A 4PPTA 5FIEA 4LLUB 4PBWD 5EU5B 1QLFA 5DHVH 5GS1C 1JGDB 2WWKT 3O9WD 1OLLA 2R0LH 1CU4L 1OAYH 1JI1A 2DQIL 5EULV 1JRHL 1KCVH 2W65B 3STLB 1FL6B 2ZSWA 4NRXB 4W6WB 4LEOA 4E0RB 2CIIB 3EYOA 5C0IA 1UZ6E 1T3FA 1DBJL 4XC1H 1ETZB 1FL5B 1QR1A 3BJ91 3NIFF 3GI9L 4ODWA 4F37F 3RY6A 5FECA 4OCXH 2YPLE 5JPMA 3ILQD 4P5KB 3I6GB 1A7PH 4KFZC 4YHZL 1M7XA 4I0KA 1MCDA 4PJAF 3L3OB 5KJRH 4PP2B 4PJFE 1EJOL 5C9JB 3GIVB 4JB9H 4L4VD 1F5WA 3HUJE 4HK0A 1IBGH 3I2CL 4OLYL 5MEPB 1YMMA 3KLAA 4P4RB 4KKCC 2A74B 5C07E 1JCKA 2PYEA 2BOCA 3NCYS 4PRPB 2J88L 4Y5VA 3TO4C 3WFDL 4CVXA 1CG9B 5CILH 5IEKB 3BDXA 1UWEH 4N1EA 3HE6A 5AZEH 2ZCLH 4RAVA 2IG2H 5H37H 1FVEA 4JFED 5FA4B 4LEXL 5SWSD 1RHHB 5ENWA 5T5NF 5I6XB 3U4BL 1W2KT 2NX5E 2FH8A 3DV6A 4APQD 4JZJB 3DSNA 3OG4B 3HPJB 4J3XA 2X4RA 5KSVB 4PG2A 5IBLC 3FO2A 4KMTH 3ZL4H 1L7IL 2LVEA 3T0EB 3UYRL 2CD0A 2Q86B 5FB8B 2ZCHL 4WTZA 4NYLA 4ALAL 1K5NA 3TBWB 3TCLB 3X3FL 4LVNC 4B7IA 1X5JA 2VDRL 5FYJL 4F33B 5J13C 1JK8A 5E6YA 2W0FA 2MQ0A 1KJVA 5EPMB 5KVGH 3SDXB 4BK5A 4UV7L 3GBNL 4Y4HB 3JSSA 1LK2B 3KPSB 2EIZB 4I4WB 4IRJB 1CXKA 5GQBA 1GGIL 4PY8J 2JJUA 4EZMA 4FZ8L 3I84A 2FO1A 5H35A 2XWJA 1VPOH 1NSNL 3KHQA 3X17A 3PUCA 3DUSB 1ORQA 3MRDA 1UH2A 5E6IC 2F8OA 1CFTA 2IBZY 3D3VE 4DKFL 5T3XE 2R29L 3F58H 1I3RA 3CMOL 5B8CC 2BHYA 4P5TD 1M4KA 3TO4D 3ZZ1A 3O3AB 5I15L 2IBZX 5GGVL 1ZLWH 1N64L 4XP9H 4KUZL 2CKBA 4P46A 4CVWA 4GO6B 5I1GH 2E27H 5ERWB 5HHOD 5JW4N 2ZJSH 4YHML 5KZCB 1OLZA 2NY4B 1NUGA 1KCUL 2WUCH 1HILA 4LPYA 3HNSL 4GH7B 5HJ3B 4UT9L 3SKUD 2YPLA 2YD4A 2PR4H 3GMRB 1FFNB 3KPRD 1DBAL 1R3LB 1S7RB 4H26B 4M7KH 3MV7A 3T8XB 3RVTD 3FAWA 1KLUA 4PJFA 1K2DA 4Z95H 3TBVB 1N2RB 2CK0L 3HUJA 3QFDB 3IS0X 1FZMB 4H0HB 4ISVA 3VXMD 1X5ZA 2D0FA 4JKMA 5C07A 5LWYH 1FL3B 3OL2A 1Y6MR 3DNKA 2BFVL 4FQ1L 2V7NB 4PJ7E 1AXSA 4Y5XA 2WNGA 2VAJA 3PHOA 2I9TA 1OWRM 4DUVA 4ZOEA 4DN4L 4O02H 1J0KA 2FL5B 4JKWA 2IBBA 2P5EE 3OGOE 5BJTB 1GGUA 2NX5A 2ZUQB 1MOEA 2EIBA 4GRWE 5IB1B 1AE6L 5LGJB 4RIRB 3D0LB 2NY0B 1EMTL 2QADB 2J1KA 3E3QE 3MJ9H 4WCYH 4RWHA 4F2MB 4LNVA 4XMPH 3RWEB 1SVCP 4GXUN 3IDJB 2YD2A 4BFIB 4YUEH 3WJLC 2EKSB 3G5ZA 2A9NH 4O9HH 5BO1L 3MRNB 1IGTB 5JIIA 4FN0A 2QQNL 1U8KA 3I02A 1QKZL 3WLBA 3E2HB 4J8RA 4LSTL 3UTSD 3S7GA 1KB9J 4R90L 5DMKA 5C0EB 5GSRB 2VLJB 4H88H 3DI3B 2OMNA 4X9GA 4TSCL 1JPFB 5T1MB 1AD0A 1H8NA 2DMBA 2DLGA 5D9SA 3VDBA 1S3KH 1XGYH 1NMBL 3WCYA 3D3VA 5E08L 2NNAA 3ULVC 1J1XH 2AABH 1P4BL 4N1HB 5TDNB 5KBNC 4NNXA 4RCAA 4NZDA 4KROB 4OLWL 4XBEL 1TETL 1N4XL 4ZYKB 3VGEA 3BRFA 5BZWA 5SV3A 3CVHH 1AGFA 2W59A 5BQ7B 3S5LA 1TPXB 4HIJA 3U0PB 1SMAA 3RWCA 3S4SA 4JJHA 5CLTA 5FUOL 3BD4A 2YKLL 2L7JA 3O2DL 1C16B 1KJMA 3D9AH 3KPPB 3DRQB 3HR5A 1QLRB 1WCBA 3ULUC 3WIFB 1ZLSL 3AB0C 4FQHA 5I2IB 3L5WA 5DSCA 4D3CH 4OJFL 2DLFH 1B4RA 1BFOA 3LKNB 3LRSB 3QRGL 3THML 4ERSL 4U6HB 4WIQA 1W0VB 4L8SB 5FYLD 1AKJA 2Y9RT 4Y4KD 3QIBB 5IM7A 4XTRD 1UYWL 4HEPG 4X7DC 1L0QA 3SDAA 4QTIH 4F3FA 4LGSB 1FYHB 4KRNA 3UBXI 1PKOA 5JW5B 2HKHH 3EYUL 2FYYA 3DETC 3ULVD 2P5EA 4QRPD 2ICWJ 4IIQA 2R2HB 4FRWA 4NCDA 5IOPB 4DW2L 2P8LB 1HI6A 1FGNH 5CJOH 3D85A 2GCYB 2A6DA 4OD3H 3ET9F 4KKAC 5I73B 4URTB 4GAJH 3K2MC 2X05A 4JQIH 2VC2H 4G8GB 4HIHB 1E28A 3GGWA 1AI1H 4BH7A 3PNWB 1MWAA 4YHPA 4PGDA 2EIDA 1I3GL 1MQKL 4M1CD 3ULUD 4I77L 5B38B 3AS3A 5I19L 3L5XL 1D9KC 5EBMB 1UM5L 3VE0B 3CCHB 3MRJB 1SEQL 3SKJL 2BVOA 4NZTH 4M4RA 1XH3B 2DQFA 5KSUA 1GZPA 4GKNA 4ZD3H 4HPOH 2LAAA 2I9LA 4Y19D 4MAYD 2J2ZA 5JNYA 4XX1G 5D7KE 4OZ4B 3VMOA 3ZHDA 5D1XB 1VFUA 3EFDL 1DQDL 4M6OH 4DZ8B 3RHWF 3V8OA 1FIGL 3JV5A 4Z9KB 2EZ0C 1HN1A 5F71A 3F6LA 5HGAB 4QEGA 1FZOA 1H3UA 1VGEH 4NQDA 1XIWC 5ECJE 4MJ5B 3UZQA 4PG9A 5EBLA 1B3JA 3CH8A 4G80B 3JVGA 5HHQA 1X5AA 4JRYD 5LJYH 5HD8C 2P24B 3BHBA 4MA7L 4OCMC 1VFAB 1ZT1B 4KKAD 4AEHL 3LHPH 5CAYB 4ESKA 4GAYA 4FABH 1A14L 2ZG2A 2V2TB 5AWNH 4R0LA 2AK1H 3VGFA 4RFNC 3LEVL 4KI1A 4EDXA 3CXHJ 1KJ2B 4PJ5E 3VWJA 1OAUH 1G0DA 1X5GA 4LK4A 2BXZA 3CSPA 3GJFK 3FZUD 1CVRA 5T1DL 1FIEA 2HTKD 3T65B 5ADOH 1E6OL 1H5BA 3VGGA 4FMKA 3GHEL 4XCNB 4Q0XH 4FQIL 4RBPK 2Q7NA 5I0DA 1TJHH 3PJSB 3QIWB 4P5MA 4ZQKB 5IQ7H 4OSUL 3NGBB 4J3OC 1C5DA 1F3DJ 3EYVA 1IARB 4ZAKC 1ZANH 1ACYH 2JB5H 1DUZB 4YHIB 4GAGL 3JUYA 3VXUE 3ORJA 3Q6FA 1E4WL 4WY7L 5DC0A 2B5IC 1N6QL 1JWMB 2EDDA 1EGJA 1FAIL 4QHMA 2VLKB 1C8PA 1XIWD 1UKTA 3D18A 1IQWH 4PD4J 2NY7L 4EQ3A 3NFNA 2VDNH 2QSQA 1UM6H 4UUJA 3S9DB 5CEZL 5HD8D 3QXTA 5FUZL 4NQUA 3LKPB 2XKSA 4RGMC 3C08L 4FA8A 5J7CC 4OGXH 1WIOA 3RZCD 2AK4D 2HN7A 4JFXA 5EH1A 2BVTA 1CLZH 3MTRA 3P73A 4AT6A 3RNQA 5F7WC 3FQXA 2R1WA 2EECA 4FQLH 4KGJA 4P4KB 2GKIA 4N9GB 4X7SL 1AR2A 4H25A 4RFEB 4F9LA 4Y4FD 5FF6B 2QTEA 3WEXA 4XB8A 3FQNB 1U6AL 2FX9L 4P2QD 2NY2C 5D1QC 4MZ2A 1TVBB 2YPVL 4LSDA 2ESVB 1EDQA 3QXDB 5HY9B 2DQGL 4GRLB 1GSMA 3BD5A 3H9SB 5DK3A 5C0AE 2X4UB 4AENA 1F8TH 1Q38A 4X6EB 4ZDHB 1UH4A 1KG0B 3PHQA 5IV2B 5IFJA 4S2SA 1HSBB 1MAKA 2OL3H 4I0PB 3CLFL 3T09A 4UQ2B 4AH2A 1NFKA 3NIFE 4PJXB 4ZS6C 1BFTA 5GISH 5TDOB 2FZ3B 1FG2A 3O9WA 1CDCA 2EH7H 4PJ5A 4KI5D 5MEND 2ADGB 3GHBH 4X8JA 4OF7A 5IJKC 5ICXA 1L7TL 3JV0A 4TUJB 1CGTA 3IXTA 3BIAX 4F58H 3BGMA 2IPTH 5DC4B 5HHNB 1MNUL 3AUVA 4QRQB 1RUAL 4NZRH 3D6GA 2A0LD 1IRAY 3L5HA 4KC3B 4Y1AB 2VE6B 1UB5B 1Z9LA 5EUOE 1QYGH 1TCMA 5GRVK 2FCBA 2XV6B 4HC1A 5EO1B 3MFFA 4LHUG 4PLKD 1CDGA 3BGFB 4KV5E 4C54A 5I1CH 3MRHA 1CT8B 1B6DA 1NGPH 2I07A 4N90D 4LCYA 4PJGF 3PQYE 3HC0A 3CFKB 2NY2D 3QO0A 3VW3L 2YA1A 4NSKA 4WFFD 4EUPG 4J4PC 1NBZA 1T89A 3I6LD 1JFQL 1MCOL 4TNWK 3MGOA 3OHXA 3DX9A 4HG4J 3W9EB 1SYSA 3V4VH 5HSFA 3REWA 4HT1H 1A6AB 2R0ZH 4M6AA 4J3WA 4X80L 2YZ1A 2AEPL 2C3WA 2X89D 4JY5L 4UTBL 4TUOB 4OLUH 1BBDL 5ADPL 4LSSL 2R56L 1WEJH 1HDMA 2OP4H 3GMNB 4Y4HC 1XT5A 3QEUA 4ZUUA 3FO9B 4QHKJ 4IRJC 1EHXA 5E8DL 1FLRH 1JGVL 3RWJA 5FYLL 1DP0A 1KPVB 4LLAA 3DYOA 2NY3B 1LP9B 2CLZB 1G0XA 1MFEL 5DHVB 3BGAA 4L4TB 3PWUB 4XWGL 3L7EA 1IAII 1A1NA 4MLIA 1M05B 2RJMA 4Q9BA 2XWTB 4PRPD 4TUKH 3ULVL 4K3EL 2NXZC 5C0AA 5D4QA 4MQ7B 4U1NB 1CK0H 3I50H 1KTLA 5CGYD 1QRNE 4RBPH 4M5YL 5TE4H 3WS3B 1YEDA 5CIPH 3KDMA 3ELAT 5DEFA 3S35H 3TYFB 3C09B 1BVKA 3OF6D 2R4SL 1TQCB 1S7VB 4TQEL 1T7YA 3EOTL 4GAFB 5BS0B 1ZT7A 1AQDA 1LDPL 4HUXB 2VDOL 5D2NB 3JTSA 3DURB 2DQHL 5ACLA 4G7YL 1J18A 1I8LC 3ZDYF 3EOBA 4W6YB 5E94A 1P4IH 2A83A 8FABB 2PETA 4HF5L 2W0KA 5DWUL 5GGRB 2PYFA 5TGBA 3ULUL 4D0DA 3L3IA 4KZEH 4G5ZH 4RAUA 2FLRT 3LKSA 2YXMA 4DVBB 3D69B 4Y4HD 1E4XI 2D4DA 3KPSD 3M17B 4IRJD 1GYAA 3W9DA 1F4HA 3UP1A 2HG5B 3ARDB 43CAB 2P46B 1SBSH 1UKSA 5KVMC 4M43L 1TJGL 4DUXA 4KMQA 5KS9B 3HB3D 5EZJA 4L9LA 2R2EB 5CJ5A 3PQYA 3MOAL 2GSIB 4BQ8A 4UOJA 1F4YH 5DD6B 1NUDA 1JZ8A 2ZUQC 3P40A 3QWRD 5CJBA 3VG0L 5D5MB 1G9MC 3OQ3B 4MS8C 1UXWA 3QIUA 4OQTL 1EUTA 1RJZB 1KC5H 2NY0C 3CDYA 3L3HB 1R24B 5F3BA 3IT8D 1DR9A 1G7JB 1MHPL 1KIQB 1WC7A 1G7LB 4HH8A 1HHIB 5C0CB 4U7KA 3T2NL 4BSVA 5I71C 2QR0A 3X3GL 5IP4A 5KZCD 2DQCH 4G6ML 2NY4D 3R0MA 2JK5B 3Q1SH 5D72H 1ND0B 1P6AB 4F8QA 1FVDA 1UM4L 3LQAL 3B3IA 1NCUA 1NFIA 4MA1C 5DRNB 2Z92B 1NUNB 1T0MB 1XCTB 4JANB 3E6HA 1F11A 3P4OA 4HMCA 4RISL 3MRLA 3WXWL 1JF1B 4NC2B 2G5BA 4OFVA 3NZ8B 4M8QA 4Z0XA 4KROC 5CJQH 4LCUB 5F6HI 2DBLL 1EO8H 2FIKA 3MXVL 1SJHB 4C4KT 1QRNA 2FECL 3WJJA 1D5XA 4JY4B 1NCBH 3FN0H 4YQXH 3RWIA 3VXSA 1I9JH 3MRGA 3AU1A 4S1QH 4BKLA 4OGAC 5E00A 1D5IL 1DANU 1QA9B 4NQEB 1RFDL 4GLRI 4UTAH 2AEQH 3TH4T 2R8SL 4LARH 3N1PC 3MBEB 3GKWH 2NY0D 3OXSB 2IGFL 1F3JB 2QADD 4HKZB 4P2CG 1TVHA 4JO3L 1NKOA 4IEFB 2BC4B 1QO3B 3HNTL 1DUYB 4JDTL 4ODVL 3IB4A 5F88B 5BZDA 1REIA 4WW1B 4LKXB 25C8H 1RZIB 1MCIA 1QFWL 5JA9A 2UVEA 1WZLA 3BQUA 1MCLA 3QIBC 2VLJD 4XCYA 3L3DB 4PRDA 5F96H 4J23A 3O6ML 3U7WL 1MCRA 1OAZH 1TQBC 2XA8H 1MFCL 5EO0B 4NRZA 5E5RB 4F57H 5JPNA 1LEIA 3E6FA 3DGGA 4O4YL 5JUEL 1WZMA 3HNVH 3DX7B 4NHCL 4FXGA 3QUZA 1V3JA 4KROD 4A6YL 5JW4R 3SKMA 1DL7L 2Z4QA 3EIFA 3V5DB 2EDNA 5I73C 1RD6A 3K2UH 5C0NC 1I8KA 3FQUB 5DVLA 4ZXBB 3ZTNH 5IMMA 3R1GL 4OGAD 1J0ZA 4B7LA 1NGXA 4QRTA 4Y8DC 1BZ7B 4IJ3C 3WHXB 4YAQA 3NPZB 3IDXL 3MQIA 3F8UB 4KKLC 5HDQL 1QSEE 1QQDA 3SDCA 1P69B 3MYZA 2D31B 3RA7H 1CGXA 3CFDA 1A4JA 4ZTPL 4UDUB 1KIPA 2WIIA 4PLNC 1U3ZA 3AREB 4KGLA 5DJ0A 3DUUB 2X70A 4GUPA 1ADQH 3U9PH 2EDRA 3WD5L 2LE9A 1FNEB 3QG6B 3B9AA 4PRIE 2XQYG 4UT6H 3GIZH 2HVJB 4YDVA 1YJDH 2OJZL 1EEZB 3QIBD 4I2XE 3CVHB 2Q8BL 3NCYP 1A7QL 5EU3B 4JFDE 2FEDD 4OFIA 5D70H 4EI5A 1H8SA 5HGHB 3GEWB 5F1NA 3HI6L 5L9DL 4MDJB 4X7CC 4NKMA 4OM1L 4ODTL 4GFTB 1N0XL 4YWGL 2DWEA 3GSRB 3LQZB 5DR5H 5ID1B 2IPKA 3UTQB 1GZQB 4X4XB 1G7MB 1NMAL 4I48A 4YO0B 5C08B 5C0ND 1I1FA 4G8GD 1TLKA 5HVGB 3H0TB 1CTNA 3D48R 3CSYB 3IDIA 3RVVD 2RAMA 3S8WA 4WW2F 3C9NA 3VH8G 1CICA 1YMHA 2ARJA 2C7UB 1BZ9A 4Y16B 1U3JA 1R3JB 1T7VA 3UXFA 3UX9B 2VAAB 4X4ZA 3DMMB 3OAZK 4QT5A 5E70A 2QSTA 5E5MB 1MCFA 5INDA 3VXOA 3QIWC 2BRRL 4L9DA 5KSBF 4QGTA 1T7WA 4YBQC 1KXTB 3FB7B 3RWGB 3BZFB 1YC8A 4XP6L 5SX4I 2QKIA 1XFPA 1B0GA 1ZHKB 5D1XD 4XVJL 2PTUA 1NDGA 4N0UB 1M6OA 1MIEH 3WDJA 3TV3H 5DVMA 5IKCA 1VKXB 5C7XH 1J10A 2I5YL 4R4NC 2OCFD 1JYXA 4HMEA 3DVFA 2V2WB 3D2UB 4JFQB 4RA3A 5KOVC 1OTUC 3MLUH 4GMTH 3VFTB 1DBKH 2XTJE 3HC3H 4AEEA 1CFQB 5MEQB 1N7ML 3S5LG 4D2NA 5TPWL 3OJDB 3S4SG 1SY6H 4QCIA 3QEQE 1DEEA 3LB6C 3SCMC 4MXQC 5E4EB 1XF5B 4PRIA 3ARQA 3V4PH 2A73A 2G2RB 4QXGH 4LCWB 2XZCL 2NW3B 1INQB 1MLBA 4HWBL 1V3KA 4HS8H 3WS6A 4I2XA 4EUPH 2AV1B 1TJIH 2X09A 1I7RB 5E4IA 3N0PB 4XVSL 1FFPB 5DUML 4LLYB 4ODHH 3QIWD 4UI2A 1FC2D 3H9ZA 4YBQD 2R1YA 1BEYL 3MO1A 1IAKB 2F15A 3F65A 2DD8L 5FHAH 2Z31A 1OAQL 4PV9B 3OJVC 3NACL 2DWDB 2JCCB 4YBHA 4EI6B 4K2UL 4LFHG 4XXDA 3A6CH 4LLWB 3IXAB 3K4DA 4R4ND 5FKAA 1IAMA 1VERA 2KKQA 2VLKD 4A2LA 5I8EB 1RZJH 3OAYH 2RCSL 4G42B 3ZKSD 5E8PB 3MNZA 4Z5RB 4OLVL 5CZVL 1MRCH 3RUGB 2JJSC 1UCBL 1Q0YH 1U95B 1UA6H 3TT1H 1NANH 5I75B 5IHLB 5E2UH 2HJLB 2XZAH 3IDGA 3AMLA 3F7RA 2OQJA 4S1DC 4HXAL 1CXIA 2VQ1B 3QHFL 4UNUA 1H15A 1XZ0A 3H7BB 5D7SH 4Z7UE 5D7IB 3JWDH 3NCJL 4PJGE 4R7DA 4JFYB 5DO2C 5E7FA 3T4AA 3VRIA 4P4KD 3PXHA 3NN8B 1QFPA 4JFFE 1QHOA 4JE4B 1EZVY 3RWHA 4MMZC 3QCUL 2XQYK 5BW7C 4PB0H 1JL8A 3PWLA 4JPVH 4OI9A 3TT3L 3U7YH 1A7NH 3OX8A 4KVNL 1BVZA 3FAXA 2ESVD 2XFXB 4XNQB 4E42A 4GRLD 2ZUXA 4P9HC 5AEAA 4RGNE 2VB5A 2F5AH 3H9SD 4KQ3H 1T2QL 1AGEA 3DI2B 4CGTA 1LK3H 4LCCA 5E2VL 4HXBH 1N5AA 1SJEA 2FSEB 2WW8A 3DYPA 4I0PD 5JHDE 1ES0B 4P3CH 4LDEB 2OXGA 1WITA 2VZVA 2P44B 3D87B 3QEQA 3QUYA 3MBXL 1RIHL 3BZDA 3I75A 3QA3A 3Q6GH 1FRGH 4NO0A 2W65A 2E9IA 2DRUA 1FL6A 4U1HA 5I1JH 2XWBA 4GG8A 4LASH 3TWCL 4BFEA 4OZHE 3OV6A 5CJXA 3ARBA 2VDLL 2NY3C 1SYVA 2NY5H 1XF4B 4Y1AD 4ZTOH 2YN5A 1IC7L 4WUKL 2VSCA 2FGWL 2MHAB 1HINH 3PP3K 3I6GA 4TVPH 5DJAA 3RKDD 1IKFL 2OZ4L 1S7UA 4PRNB 2OL3B 3QCTL 5I1KH 1ONQB 4BSWB 1JPGA 3QDHA 4ELKB 5H2BB 3Q5YA 3WHE1 3WNMA 2MMXA 5DJCB 4F7PB 3T1FB 3CDFA 5D1ZB 3P3YA 3CAFA 1J8HB 3C09C 4M48H 1U8OA 3C6SA 1HHHB 3FKUS 2CQVA 3HMWH 2HP4A 3P11L 1MAJA 4M6NL 1CG9A 5IEKA 1D5BB 1RV6X 3BZEB 5IROC 3OMZA 4HKJB 5KANG 1AQKL 2W60A 5DHYA 1RULH 4OT1H 2IH1B 4KTEL 2QHLA 5BV7C 5KS9F 2ADFH 4JZOA 4ZNEE 3T0EA 3L5JA 1VFBA 1RIVH 4H5SB 4XCFH 3S37L 2VMFA 1A02N 1VCAA 4PJGA 1ZT4B 4B5EA 3ARDC 2XTLA 2YOCA 4IOIA 5D5MF 3D25A 3G6AA 4JFFA 4P0DA 1IEAB 4IRSC 2XKNB 4I3RH 2NY3D 3FOMB 5AYUH 1A1OB 3QUMA 1INDH 1MHCA 2WBKA 4L4TD 4MA3A 5ILTH 3QXAB 2F53D 2EIZA 2H3NA 3T0DA 4F7EA 3U9UB 4WVRA 1F02I 2ITCB 1QLEH 3VFMA 3QEGL 2Q6WA 1AFVH 4V1DD 4WFGE 4ZFFB 4I8DA 1Q9WA 4OB5L 5JHDA 1JGEA 5FA3A 2IALB 2IC2A 4DKEH 2DI8A 3MLVH 1FFQA 1DCLA 3MV9B 5BS0D 5C0RL 4PREB 3IFNL 1G9NC 3O3AA 3RTQA 5DJ8A 2BNRB 4WO4B 3FT2B 3AAZA 2R15A 4OGYH 4G9DA 2Q8AL 2WWMC 1HHGA 1GGYA 5IWLC 5CBEB 4KJQC 4OZHA 4LVHB 2VXUH 4M93B 5IVZA 4P23B 4PJIF 3H42H 5HJ3A 1D6EA 1JNLH 3MLXL 3GSVB 1QBAA 3ARDD 3EBAA 4H26A 4B50A 2JB6B 4G9FE 5CIPB 4PRBA 3QRFM 1HH9A 1KJ3L 12E8H 4YPGA 2VABB 1N2RA 3QFDA 4JPKL 2ERJC 5DJ2B 4IS6A 3SQOL 2CKBH 4XAWL 4KHTH 4P2YA 1A21A 3OR6B 4R4BA 1GPOL 15C8L 5IUSA 2MKLC 5GGTA 3J8F7 3LMJL 4K23H 2XIDA 5KN5A 3GMPB 2WBJC 1N3NB 2X4PB 3QHTC 1CE1L 1YEKH 4QHUB 3ARFA 2Q1EA 4KTDH 4LRNH 3VI3F 5C0CD 2CIKB 5D8JH 4KJYB 1PG7X 4H8WC 4XAKD 1MJUH 2ED8A 2QQKH 4MMXC 5HI5C 5HDBF 5LGJA 4ZNEA 1DE4A 1WCQA 3PL6C 3PWPE 2XT1B 4JQVC 5BOZG 1KJ2L 4HK3J 3W0WD 4M6ML 5HYSA 1HZHL 1C12A 2C1PA 3QDME 4R26L 4KJQD 3O3EB 3UYPA 4ZOBA 2EYSA 2P8PB 1CBVH 3MV8E 4J3SA 5IMLB 3DROA 3R06A 1NCNA 2PTTA 4JHWL 2F19L 2UWEE 5LGHL 4ORGA 2YC1B 3T2OA 1HEZA 1NAKH 4RDQG 4F9PA 3FQTA 3HLAA 3ZYZA 2VXTH 3LKRB 1WVZA 1HWHB 1JF6A 2IF7A 1FBIL 4FNLL 4HIEA 4AEIL 5CINH 4AQOA 3V8CA 4G3YH 2B4CH 1PKQB 4C83A 4NKDA 1FORH 1SJVA 4ZXBC 5FKPB 2KQMA 2B1HH 3PP3H 3OKEB 2CLRB 4PRHB 4Q9QH 1PJ9A 2E6PA 4KRMB 4NQED 4BH8A 5DJXA 2R69H 4ZYKA 5B21A 3MBED 4X6BA 5LCVL 2IQ9H 3G6JF 3WIIL 4YHLH 1D5ZB 4I0CC 2CO6B 5T5FH 3T08A 4X6DB 1JNNH 3AREC 4D0BB 2KQNA 4WFHE 1NCWH 1PYWB 3O6KH 4DEPB 5EUKA 4L8BB 5HI5D 3PL6D 2FX7H 5DUPL 3BW9B 5HGDB 1U8IA 3GSQB 3EO1A 4U6TA 5T3XH 3LSOB 2V5TA 4O2EA 2VN4A 4G9FA 1Q9OA 5IW6B 4HJJH 4XNUL 3TJEH 1BJ8A 4JG1H 4K7FA 3LRSA 3OKKB 3EKCA 2VLMD 2AKRB 3WYRA 4DFHA 2FB4H 1MCKA 4JO1L 5E1HB 1VB9A 3P0VH 5D96B 5IR1A 1LNUA 5FUCE 5IB4B 3VRJB 2CJUL 1ZA6B 1C1EL 4WEBH 1ITCA 5T5NG 5JW5A 3QO1A 4KVCH 4QRRB 3NIDF 1FFRA 5I1DB 4ZXBD 5F1IA 4AK1A 2GTZB 3VXTB 2EDTA 5BMFL 3IVKA 2Y7QA 2C3GA 3BPNB 3PWPA 2X4OB 4LCIH 3WN5B 4YZFF 5KSBE 2P7TB 3TPUA 1F6AB 4WHYG 1U3HA 3LN5B 2K7PA 4MNGE 3W11C 4NCC1 5DT1H 5GIRB 3R8QA 4XPAH 3ARED 3WNNA 2XPGA 4W70A 3MV8A 5LGKA 1FPTH 3MNVA 3JV6A 2ZNXA 2UWEA 3CPLB 1NGYB 3VJ6B 1P9MA 4QOKE 4K7PH 4N0FB 4IMKC 4GRWH 3CCHA 5GHWH 3WIHA 5DJDA 1DQTA 5I16A 2XY2A 5IB2B 4WI6A 1FNGB 2YK1L 4NJAH 5C0JB 4KDWA 3BP4A 2C4XA 4HCRL 1SM3H 1ZHLA 4LLDB 3JWOC 5ELIA 3O3BA 3RL1B 1AJ7L 2IBGA 1MWAH 2BY2A 4P9HL 3IDMA 2CDFB 4HPYH 5JXAL 3HPLB 5DRWB 4GW4A 4DZ8A 4M03A 1QFUL 4PV8A 5C08D 4ZUSA 3QI9A 3KPLB 1KELH 4JHZA 1B0WA 4N0YL 1DFBL 3C6LB 4U0QB 1R3IL 2EDQA 3H8NA 5LXGL 5I8OL 5L2KE 2APBA 4Y16D 2Y6SC 1YYMH 2V2TA 3SE4C 3V4UH 3OKOA 2J5LB 4XVTL 4KZDH 1F2QA 3W11D 1GL4B 3DMMD 3KR3H 5MHSE 3KWWB 3ZE2F 2F54D 1T20A 3V0WL 3FB6A 2VOTA 5IIEA 1CR9H 3RX7A 3QAZC 1NL0H 1U8MB 4JPWH 1KCVL 4UV4H 1HIML 4XNXL 3MGTA 2ZZUT 3OPZH 3SDDA 1DVFA 2CMRH 3OKDB 2HLAA 2DTML 4JRWA 4DFIA 3IFOA 4WW2A 3WXVL 3MJ6A 1KYOK 4XC1L 4Q6IB 1B0RB 1KCSH 3KLSA 3D2UD 4YHIA 3BEVA 4OCXL 5D7LA 3KJ6L 1JHLH 4NCC2 2N4IA 1A7PL 1MLCB 5HHPA 2M26A 4QYOA 1F4XH 2AJSH 5KSBA 1KNOB 4FTVE 1I1AC 4O2FA 4MNGA 5I75C 5KJRL 1P7QA 4JB9L 1S9XA 1IBGL 3KYNB 1QACA 2W9LA 2WUBH 3MJGX 4KAQH 5EZOH 1TMCB 4HUNB 4K71B 4LCWD 2GJ6E 4I5BA 1WUNT 4F37K 2FECI 2Y6SD 2W0LA 4QOKA 4ENEC 2GUOA 1A9BA 5AZEL 2ZCLL 4X5LA 2AV7A 1ZVHA 1RAMA 1ZS8A 4XT1C 3FT3B 3N50A 3QDGE 3TJHC 3P9LA 1T5WA 3MZTA 1ODAA 2RFXB 5I1IL 2FRGP 4JJ5A 3SO3B 1EGJH 4LHUB 2W07A 4RFEA 3RGVB 4KMTL 2ED7A 3ZL4L 4MJ4A 3IF1B 1WFNA 3QJFA 2C3XA 1QPPA 1KENH 2RIKA 5D6DC 1EHNA 4X6CF 2EDFA 2ESVA 4X7TB 4GRLA 4HQQH 1S9KC 4J1UA 3UTTE 3TN0A 5KVGL 3VFWB 2X4UA 4M9PA 4K8RC 4JCMA 2X4QA 3D0VB 3FRUB 4EUPB 3UZEA 5L2KA 2OJEA 4MD5B 3B9KA 2FO4B 3SDYH 1VPOL 3QUKA 3N9GH 3B4NA 3G6DH 1IGIH 4ONFH 2X42A 4EVNA 4TOYH 3M1BB 2EC9U 1NGWA 1A4KB 1IKNC 3OKMB 4YDLB 3F58L 3SN6N 3NFPA 3WL9A 1A6PA 3SPVB 1F4WL 2VISB 4M7JH 4OCWL 5CS7A 1BX2A 1IQDA 3GKZA 5DVOA 3GMMB 1NLBH 1JNHA 5HPOA 4PJ8A 4XP9L 5DJYB 5DFVC 4GSDH 3E1F1 3U30C 4Y1AA 2VE6A 5I1GL 4MB4A 3SY0A 4I18B 3IU3B 1YC7A 1TZGH 5D1ZC 4OKVB 2ZJSL 1OAXH 2IFGA 3BN9C 4JM2C 1BVLB 4KK6C 1YEJH 5I30H 5LQBH 3WFEH 4BELD 5GRZA 1NEZA 2WUCL 4TNVF 1B88A 2BSRA 2PR4L 4FFZH 5KAQF 3TFKC 5CEZE 4P57B 4FTVA 4Q6YA 4XI5C 4Z95L 3W5MA 1YEEL 1BBJB 2EDXA 4NNYB 2E7HA 1T5XA 5LWYL 4H8WL 3BXNA 3U36A 4M7LL 2VITB 3HMXA 4Z7VE 4YH6A 2GJ6A 3FT4B 4NWTH 5IQ9A 3FO1B 4S1SH 1Z5LA 4HC1H 5F1OB 2O5XH 2OLDA 4E5XA 1N6UA 4ZFGL 5EU4B 4JREB 2DI9A 5DD1H 1NCCH 3T4YA 4JM4H 4O02L 1MI5E 5CWSA 5I0ZA 2DKMA 4LNRA 3QDGA 2FBJH 4MCYB 5T1KB 3BD3A 4LLMB 2YD3A 3TNNB 5F7DA 1HQRA 3DX6B 4LMQE 5IHZA 5F44A 1DANT 2WANA 2F5BH 5B3JE 1TNMA 3RPKA 2DKSA 3MJ9L 1OHQA 5GS1A 4WCYL 2ZKHH 1CD9B 4NRYB 4U6XB 4XMPL 3CZFA 4EN3C 5D1ZD 4MJ2A 1J8HD 4YUEL 1U8NA 3RFZC 2A9NL 4JM2D 1GRWA 3PIQB 4O9HL 4ZS7H 4PY7B 1G7QA 3UTTA 3ZDXF 3QUXA 3QQ4B 1Y18A 5DA0B 2V9QA 3K1DA 2UUDK 4WO4C 2O5YH 4EXKA 4G8FB 1DDHA 3KPOA 4PJIE 1KPUA 3STZB 4U3CA 1MHHB 4XPGL 1IEBB 4LVHC 2WINA 4XI5D 2GSGA 2H9GB 5KVFH 4HUXA 4P23C 3DURA 4AMKH 1OGAA 4JO4H 1QLFB 2NZ9D 3BOVA 1J1XL 4Z78A 2P5WE 4JKPL 4N8VA 4D9RD 3PV7A 3LRGA 2IQAA 5GRUL 2OS7A 1FGVL 3B2VL 3GSNA 3CVHL 2ZSWB 2D2OA 2G9HA 4LEOB 3EYOB 5C0IB 1RK0A 5DI8A 1T3FB 2ZUYA 3BUTA 1GC1C 4XPHL 1QR1B 1F58H 1KB5A 3VI3E 4ODWB 4TULL 1IL1A 1OM3H 5FECB 3D9AL 5JPMB 1WIUA 3GSUA 4PS4H 2E8YA 1K3IA 1QUNA 5HDBE 5DQJA 5CMAA 2H32A 4D3CL 2FD6L 2DLFL 4HK0B 4G8IA 3MV9D 3VFNA 1YMMB 3KLAB 5I8KL 5A2IH 3U1SH 3WKNA 2PYEB 2BNRD 2BOCB 4WO4D 4WI2A 4NZUH 4Y5VB 4CVXB 3HE6B 4MD0A 4QTIL 4HS6A 4RAVB 3BWAA 4KKBD 3N85H 2HKHL 1MI5A 2MPAH 3EDKA 1Q9LA 4P23D 5DUBA 1FVEB 3HZVB 4LQFL 1ND0A 2PCPA 5ENWB 3RBSA 2P1YA 3DV6B 4LAJH 2J4WH 5F7LB 2X4RB 1YZZA 3FO2B 5E6IA 1FGNL 3T3MF 2Z92A 3WE6A 4Z0BH 4NYLB 3ULVE 4QRPE 1K5NB 1PW3A 3RWFA 4GAJL 1ZOXA 2QV2A 4JQIL 3R4DA 1XR9A 2AJ3A 4G6KH 2X10A 3VFRA 2VC2L 1IVLA 1JK8B 1I7TB 1Q0XH 2W0FB 1RUMH 4U6YA 1AI1L 1FV1A 4WHYH 3G6JE 1KJVB 2AJYL 4LPUA 4MGXA 4DKDC 1XEDA 4XHJD 3JWOL 1P1ZB 3IETA 4PJIA 1H3PH 5KG9A 5GRWA 1YY9C 5H35B 2R23A 2XWJB 3UZVB 3MRDB 1ORQB 4X9HA 1KB9K 1CFTB 5GRJH 4DEPC 1G84A 4RX4A 1LGVA 4NZTL 4JDZA 1I3RB 2P5WA 5TQ0H 5IG7A 5F9JA 4ZD3L 4HPOL 2OTWA 5D6CA 4Y88A 1BPVA 2NW2A 4LSQH 1JV5A 2CKBB 4P46B 4L3EE 3KS0J 1W0WA 4M6OL 5TF1H 2P8MB 4PGBB 1VGEL 3HS0A 5D96C 3LVEA 1HILB 4OV5A 1MJJA 3NIDE 4HUKB 3VXPB 4BZ2H 5JO5A 2YPLB 4JQXC 1FP5A 3LHPL 2CDGA 4FABL 1KLUB 2H6PA 1QBMH 1K2DB 4PJFB 4WWKB 2B2XL 3RHWK 3HUJB 4PRHD 4ISVB 5LKNA 3EZJB 1AC0A 3QWOA 4YZFE 5C07B 2YRPA 1JTPA 4Y5XB 1AXSB 3WJLA 2Q7YA 3BKJL 3PHOB 2I9TB 4HKXA 3FQUA 3WN5C 1YY9D 5T33H 2J8HA 2A2QT 3DTXA 3WNOA 3S36H 2DI7A 3EO0A 1GHFL 1WBYA 3I85A 5AAWA 3EJZC 2UUDH 1MUJB 2OI9C 5IQ7L 2NX5B 3EYQD 4KMLB 3S6CA 1RVFH 4G6AD 3ROLA 1ZANL 1ACYL 2XXCB 4UU9A 2JB5L 1FH5H 5HYEA 1SQ2N 3ECBA 5E7BA 4NN7C 4NO3A 5L7XL 3G5ZB 3G6JA 2AJUL 4OCLC 3TBSA 1U8KB 4PJEF 3I02B 2E3VA 3WLBB 2VDNL 4GW1A 4J8RB 4LF3A 3TBYA 1H3TA 5DMKB 4Z8FH 3O8XB 2PKDA 3FJTA 2QSCH 4MDJA 4QRRD 4OGXL 2BNQE 1AD0B 2PTVA 5D9SB 1CLZL 3D3VB 4MZ3A 2NNAB 1VADA 3UTZA 1CF8H 4NNXB 1EEQA 1IC4L 5C08A 1AY1H 1RJCA 3GM8A 5J12C 2YA0A 5BZWB 2D7TH 1Z6JT 2DDQH 2P42B 1AGFB 5F1KC 3S5LB 4L3EA 4HIJB 4U7SA 3RWCB 3N1GC 3S4SB 2PO6C 1ROWA 3EJZD 3VRLE 3Q48A 5FDYA 3TC9A 4Y16A 3EJYC 2R0KH 4K3DH 2A77L 1KJMB 3STBA 5HYSG 3HR5B 2RGSA 3S34H 1G6VK 1WCBB 2OL3L 2VUYA 3CU7A 5JLZA 2H41A 4FQHB 5C8JA 3L5WB 3ZT7A 3W5NA 5GISL 5DSCB 2XOTA 3MRBA 3WSQL 1BFOB 2OR8A 5KTEH 2DL2A 4LRIA 1T4KA 1TTGA 4U1SA 1P4LB 1A47A 2Y06L 3IGAA 1G7PA 5H94A 4DGIH 4ODXA 1AKJB 1O5DT 1MIMH 5IM7B 1A6WH 4N0UA 3CLEL 2IPTL 3SDAB 4C58B 4F3FB 4NZRL 4OM0H 2FYYB 2H26A 2HT3D 1AO7E 2P5EB 1QYGL 3C6LD 4NM8H 1A3LH 4IIQB 1WZKA 4K71C 1D9KA 1HI6B 4GRWB 5I1CL 1OTTC 3D85B 2DLIA 1EERB 2A6DB 2XA3A 4KXZH 2D03H 1VHPA 2LABA 1S9VA 2VZSA 1NGPL 3IJYA 3IS1X 4JO2L 1NMCB 1E28B 3GGWB 4PBXA 2L4OA 4GW5A 4BH7B 1MWAB 4YHPB 4PGDB 3EJYD 3WDIA 1KPRA 3H3PH 3OKLA 3QYCA 4X6CE 3RGVC 2PXYA 5CSBA 3T0WA 1F00I 3NZHH 4FFYH 5FK9A 2R9HD 2L7UA 1GAFL 2VH5H 4A2MA 2FJFA 4HT1L 2R0ZL 1KFAH 4OI8A 2BNQA 3TESA 4OLUL 2BVOB 2XXMB 1WEJL 4XCEB 2DQFB 5KSUB 4GKNB 1MFAH 2I9LB 1BREA 1F90H 1FLRL 3O6FC 4EI6A 1KIRA 4FS0A 1AIFA 5JNYB 4MAUH 2N1KA 4FQCH 1WBXA 1WJ3A 1OW0A 3KPMA 5I8EA 3SBWC 1T03H 4K3HA 3EGSA 5I17A 4YDLC 1EO7A 4NQDB 2ORBH 2LV4A 4PG9B 4ZG1A 4TUKL 5HHQB 2VO5A 1IZKA 1UZ8A 3L9RA 1U95A 4IDJH 1IGMH 4MJIE 3BHBB 3I50L 4CVZA 1NBYA 3QXVA 4KHXL 4XXCA 1NEUA 4U0RC 4GAYB 3QR2A 1CGWA 1LMKA 4U1JA 3S35L 2VXVH 5I1EH 2X40A 1SJXA 1K8DA 4ACPA 2X4TA 2VZ1A 4ZAKA 4J6RH 4EDXB 2CRZA 6FABH 3VWJB 2V9TA 1INEH 4LHUD 3RGVD 1P4IL 1N59A 3OJMB 4NKIH 1C08A 2GEEA 1H5BB 4FQ2H 3MR9B 3BRGC 3UPCA 2Y1VA 4KZEL 4G5ZL 5JW4M 4P5MB 1AO7A 5D71L 1K4DA 4PGCA 4W4OC 2ZCKH 1C5DB 3EYVB 3WFCH 3OB0K 4OFDA 3MMEA 5EZLA 3AY4A 1B4JL 1KF9B 2EXWC 3Q6FB 7FABL 2AXFA 3DSFH 3QQ3A 5CFHA 1F4YL 4OZFH 2VZOA 4QHMB 4YK4C 3D18B 4X9IA 3NFNB 4LSRH 4UUJB 2P48B 2NYYC 1MCNA 3ES6A 4X6CA 4YIQA 2JJTC 4PTTA 1KC5L 4NFCA 5D1QA 3WUWA 3ZDXE 2VZTA 3UAJD 3UTOA 3ZTJG 1MCPH 1X5KA 5FM5O 3WFBH 4O2CA 4XPFH 2HN7B 3MLRL 4JFXB 3LY6A 1H0DA 3TO2A 4HG4K 4PRNA 2DQCL 1HSAA 2HFGL 3P73B 3Q1SL 4S11A 4AT6B 3G5XA 3RNQB 3FQXB 2R1WB 3SJVE 5ID0A 1BFSA 1FYTE 2Y72A 4Z77A 3S35X 4NO2A 3WEXB 2W9DL 5JOFA 4JG0L 3SE3A 2ENYA 3O2WH 3MC0A 2J8UF 4LSUH 1G7HA 1Z9OA 4AENB 3BKCH 5CJQL 3VXRE 3EHBC 2N7AA 1FNHA 1C5CH 3PHQB 4MJIA 3NFSH 4MDIB 4K3GA 5HGGS 4S2SB 5IFJB 4X4ME 1J87A 4JFHD 1J5OH 4AH2B 2EXWD 4YQXL 2YUWA 3FN0L 5GRVL 5JQHC 2VXQL 4QRSA 1CL7H 1FG2B 2H2PD 5E2JA 5T1KD 1A9EA 4TSBH 4LQ1A 4PJ5B 3VFSA 2AEQL 4X8JB 5ICXB 3RY6C 2NYYD 2JKXA 4AQ1B 1I8MA 3IXTB 2MFNA 4LGPB 1F3DH 3BGMB 1N26A 4J4PA 4CJ0A 4O5LH 5DMGC 2O61A 1HYSC 1FCGA 3U9UA 2ICCA 1U3YA 1V05A 25C8L 3V6OA 3MFFB 4OCSL 4MNHA 5GS0H 4YDJA 2A6KA 4R4FL 4Y5VC 3N1QC 2IALA 3LKOA 3MRHB 5F96L 2I07B 1OAZL 3VXUB 5CD5C 4LCYB 5ALBH 2X4SA 3HC0B 4U1KA 4PYHA 4TVPD 3QUMH 5DQ9A 3QO0B 3GBML 3UJIL 1ZVSA 1NBZB 5GGQH 4FZEH 4JHAH 3UO1H 4NC1C 3MGOB 3OHXB 3QPXL 1OCWH 3K2UL 4HLZH 2WQ8A 3TIDA 3REWB 32C2A 2J6EA 5IBTH 2BOBA 2AQ3A 3VFGH 3K8LA 3ZTNL 2PNDA 3WKML 4Q9RH 1HDMB 2P43B 3QEUB 3EAKA 4ZUUB 2HKFL 4OF3A 5F9OH 3SJVA 3RWJB 1A6VH 1U8HA 1FYTA 5SWQA 3MNWA 4ZO7A 5F9WB 1HOCA 3C5SA 1BJ1J 5DMGD 1ADQL 3L7EB 2OR7A 1A1NB 1MCHA 1S8DA 4HH9A 1YMMD 3EDDA 3ZYJA 2VZUA 1NEZG 4RA0C 3GIZL 2PYED 1L9MA 5C0AB 3LS5H 3MSPA 1YNTA 3VXRA 1YN6A 2NQCA 1U92A 3C2AH 4DN3H 5CLWA 1KTLB 4YFLI 5L88H 1YDPA 3HE6D 4X4MA 4DK6A 3L7FA 2R39A 1RMFH 1YEDB 1KN2H 3KDMB 1ORSA 1A64A 5DEFB 4K3JH 1TZHB 1BVKB 3ZYOA 3HZYA 4O00A 1ZT7B 2Z9TA 1AQDB 2CGRH 4GMSH 3OB0H 4ODSH 2NPLX 3JTSB 1TIUA 4H20L 3EOBB 3A67L 5E94B 5BXFA 3O3EA 2A83B 5GGTH 5DR5L 2W92A 4TTDC 4OTXL 1YNKH 5C0FA 3NCMA 3DBXB 3HG1E 2PYFB 5TGBB 3RY4A 4D0DB 3L3IB 4YX2H 4N0CC 2C5DC 4DKAA 4RAUB 3RVXD 4DAGL 3LKSB 5JW3L 3BUYA 1JN6A 1JYNA 1ULVA 3W9DB 4G8GE 2R4RH 1S5HA 4XC3L 1NBQA 5HDLA 4C55A 4PUBH 5EZJB 3K8KA 4L9LB 4MLSA 3G5YA 3PQYB 3AXLA 3HC4L 3MUGA 3GDBA 5AG8A 1PY9A 4XZUA 3QPQC 2JJWA 3OXRA 5JIKA 2NXYC 1UXWB 3QIUB 2IANE 1ZE3C 1LD9B 2B4CC 3VFOA 3FB5A 4JR9H 3CUPA 4CU8A 5F3BB 3UDWA 1ZLVK 4P46D 5HYQA 1WC7B 1MIEL 4BSVB 3TV3L 2QR0B 3CFEA 3MLPA 2ZPKH 5DK0A 1OQXA 4LPXA 5C09E 1JRHH 5ETUB 2DKUA 2VQTA 4N8VG 1ZSDB 1YECH 2QHRL 1LILA 1FVDB 3L5IA 1P84J 3V6ZA 2Y4SA 2YPLD 1OVZA 3B3IB 3B9EA 3O3UN 1UXSA 2EO1A 1RY7B 1Y0LB 4P9ML 2IADA 5I66A 3MV7D 5IT2H 3E6HB 1F11B 3TVMC 3P4OB 4WWKD 2EEDA 1IT9H 4M7ZB 3MRLB 5JTWA 2RQ8A 3OR7A 2YMXH 4OIIL 3ZMRA 3U46A 5C07D 3V4PL 2G5BB 1EJ6A 4QXGL 1FO0L 4U1GC 1LE5A 1EJOH 3OZ9H 1UADC 4M8QB 4NHUA 4Z0XB 4M5ZH 1SHMA 2FIKB 4OF8A 4QRRA 2QEJA 5INCA 5I1DA 1TJIL 3LS4L 1QRNB 2E8ZA 1B2WL 2J88H 1D5XB 3W2DH 2AEWA 3MRGB 4GQPH 3AU1B 4BKLB 2X4OA 2ARWA 1WF5A 5E00B 2VXSH 5ITBL 2VKWA 4PJDF 2F9BT 4WENB 2NX5D 3HKFA 4YXKL 3UYOD 4MSWB 3QPQD 2EDYA 2YR3A 1VEOA 4NOFA 4CN1A 1CD0A 1TVHB 4QO1A 4PJ7F 3A0OA 3HG1A 3A6CL 1L7IH 2OSLA 5BZDB 2ZCHH 4NN5B 3GO1L 3HAEH 4F80A 3BQUB 3BVNA 1MRCL 2VYRE 5EG6C 3S3SA 5FDWB 4PRDB 2X1WL 1UA6L 1FNGA 3ARRA 3TT1L 4XP1H 1XR8A 2GTWA 5MEOA 4NRZB 3D3VD 5JPNB 1LEIB 1XGQA 5T3XD 3E6FB 2DLTA 3QB7C 2CDFA 5D7SL 5CSZA 5L8LB 3JWDL 3QUZB 4UQ3B 4JN2A 4YFDB 3SKMB 4E41E 2IANA 2Z4QB 5FM5M 5IGXL 4TPRL 1VEMA 2XNAA 4PB0L 4PJEA 4CBPA 4PJ9A 1I8KB 1NMCC 1FSKB 4PRAA 3WIHH 5IMMB 3U7YL 4Q7DA 5C09A 1U93A 1NGXB 4YHNA 2DN7A 2HT4C 4YAQB 4KUZH 1RZ7H 2F5AL 4KQ3L 1QQDB 4DTGH 3LRHA 3SDCB 4YHMH 1BM3H 4HXBL 1M7DA 3CFDB 1A4JB 1RHFA 1KIPB 4P3CL 4X83A 2AXGA 2WIIB 1KCUH 3HNSH 2VNCA 5CEXA 3RPIA 5DJ0B 2X70B 4JVUA 4GUPB 5DC9B 2FH6A 2ADIB 1JGUH 1X5IA 5ACZA 5T3ZE 3WBDA 4DOHE 3Q6GL 1NC4B 4BQ9A 4YDVB 1DQJB 5E9DE 5KSAB 1AKJD 1NGZB 3GSWA 5I1JL 3OKNA 5C71A 3JTTA 4LASL 3U0WH 2IWGA 3SDAD 4EI5B 1CFNA 3CDGA 3EYFA 5CUSH 4LFHD 4GKSA 5LAXA 3TZVA 2JJVA 2X9XA 5F1NB 4ZTOL 2P5ED 4NKMB 3ZTJH 3ARGC 1HINL 1F3RB 3ESVF 1QRKA 3JVGC 1S7QA 2G75B 3CNKA 3MLTA 1URLA 1KNOA 3D85D 2DWEB 1Q72L 2BVEA 5I1KL 3RJQB 2VDQL 2IPKB 4ELMF 1FZKA 4I48B 1I1FB 4HJ0C 3QWQB 4R0LC 3VD7A 1IFHH 1EMTH 1IAIL 2HT4D 3IDIB 4OF0A 5IW1A 1J1PH 3B2UC 3BMWA 4HWNA 3MRFA 3PWVA 3EYSH 4CN6A 4NZJA 3C9NB 5JZ7D 1CICB 1YMHB 4AIOA 2ARJB 1A22B 1BZ9B 1YEFH 1TENA 2QQNH 2B1AH 3RI5F 5IHUL 1H5BC 1YYLH 4UOW1 1RULL 1QKZH 4OT1L 3HCVA 5L6YH 3LPFA 4QT5B 2BK8A 2ENSA 4R90H 5INDB 3HRPA 2ADFL 2BSTA 3VXOB 3FFDA 3I6KA 4F7TB 1Z9MA 1RIVL 1IILE 2V5RA 3VA6A 4XCFL 1AC6A 2CXKA 4GBXB 1VESA 1SY6A 2QKIB 1B0GB 4E41A 1UEYA 1NDGB 1P4BH 5AYUL 3L3JA 5IKCB 3P30H 4OLWH 4XBEH 4OZIF 1TETH 5EA0H 4GQ9H 4NQDD 3LOWA 1L0YA 1LP9E 1BLNA 1PX4A 2BERA 3P9MA 1E4XL 3PHSA 1EHAA 4XWOD 1F13A 5L0QB 2CO7B 4FQXC 2F53E 4KJPC 1RZ8A 1I7UA 2DQUH 1AFVL 2MTPA 4MD4A 5CEYB 1T6WA 3I3DA 2NZIA 2PN5A 1J88A 1PX3A 3BKYL 4HJ0D 5DD5H 4DCQA 4QCIB 1DEEB 4V1DE 3VWJD 1ZLSH 3ZT5A 5FCUL 4PRIB 2A73B 5E9DA 4I3SH 1MLBB 3DX8A 4R97B 4I2XB 1FG9C 2VXUL 5J3HD 3OG6B 3PGDA 2JJSA 3PDOA 4AL8H 2R1YB 1GIGL 2WWKO 3MO1B 5DMYA 1P2CA 5AYQA 2Z31B 5JMOC 5H8DA 12E8L 1KLGA 4XXDB 8CGTA 4DW2H 4YHYB 2CKBL 5FYKE 4KHTL 5FKAB 3ABZA 3WLWD 4PBVC 1VGKA 3O9WC 1QFHA 3V7AE 2ICWB 5BW7A 3DECA 5BCAA 5GZNC 4YBLB 3MNZB 1ZMYA 1YEKL 1MPAL 4GT7A 5GJSL 4NQCE 1UC6A 4KTDL 2BMKB 4POYA 1V3LA 2EE6A 5J0BA 5D8JL 1EAPA 1GGTA 4BFBD 3IDGB 3BE1H 2OQJB 2Z91A 3CFBA 4I77H 3CZJA 3TH3T 1H15B 1XZ0B 3L5XH 3ILQC 3T4AB 4R7DB 4NRYA 3VRIB 5DYOA 3SKJH 2ICEA 5D7KD 3RWHB 3X14A 1UEMA 1LO5B 4R2GB 2AP2A 3PWLB 2BSSA 3W0WE 4MJ6A 1UB6A 5CSGA 3OX8B 1BQSA 4ODBD 2JIXA 4R7NA 4FQPA 4E42B 1NAKL 1G0YR 1T89C 1DQDH 1MHHA 4HAFA 1AGEB 2VXTL 1FIGH 4OV6F 3DV4A 4LCCB 2APWA 4BQCA 1N5AB 1SJEB 1RUPH 1V7NH 3MACH 4G3YL 2B4CL 2WBWB 4E9LA 4P2OB 4APQC 4MA7H 2B1HL 4RMRA 3QEQB 3QUYB 1BWWA 5B39A 5E2WH 4PJ5D 3I75B 1A14H 3QA3B 5ICYA 5GZND 5SX5K 4NO0B 5F6IC 4Z7QE 1W8NA 2IQ9L 4QF1A 4U1HB 2XWBB 4GG8B 3LEVH 2J8UA 5T5FL 3ARBB 4U7MA 1SYVB 2YZ8A 1R5VA 5DJ6A 3CVIL 1NCWL 1YA5A 1NBVL 5CHNA 5DJAB 5T3XL 5IF0A 1S7UB 4W6XB 4MB3A 4BZ1H 1NPUA 4QY8A 3X13A 2XYCA 2A6JA 1J1OH 2UYLA 3TP4A 5TDPA 4D9LH 1JPGB 2Z8WC 4OSUH 4XNZB 3TJEL 3VXUD 3ZKXC 4JG1L 4WI4A 3GSNH 1GCFA 1X6LA 1U8OB 3C6SB 2HAZA 1T7XA 4FQQA 4IRSA 3P0VL 4GAGH 4P5TC 3S88H 3QQ9D 4JCLA 5EUOF 1O7VA 4WY7H 1KB5H 3VFVA 1J0JA 4WHTA 4NQCA 4L8DA 2GITA 2W60B 4KV5F 4NQVA 5DHYB 4ZMAT 4KVCL 3WFHA 3HZVA 1S5IL 3HFMH 3MFGB 4V2CB 4KH2A 4CMMA 1MJ7H 3RZWA 3PWJA 5CEZH 1BQLH 2H32H 4JZOB 4GXVH 1G6RA 4QNPF 1VFBB 3FQWA 1NCDL 2JTDA 4PJGB 2GT9A 5EOTA 4IOIB 3RVTC 3B8YA 1QBLH 3D25B 3G6AB 3SEPA 4JFFB 3WUWG 1NAMA 1I7TA 2Z8SA 4G43A 5DT1L 3QUMB 1HXYA 4XPAL 1MHCB 4L9LC 4MA3B 1OD9A 1CFSA 1FPTL 1I7ZB 5EOQL 3MXWL 5I1HH 2H3NB 5DQDL 3CMGA 2GIYA 4F7EB 5IWLA 1P1ZA 2ZNWA 5I9QB 3U48A 1CZ8H 5TQ2L 5JIPA 3BIKA 4RGNB 5C0AD 3VD9A 2J12B 3QIUC 3VFMB 2C9AA 2BRQA 5CD3A 5IHBA 2Q6WB 2YPVH 5GHWL 3WDHA 5F8QC 1Q9WB 1NGQH 5JHDB 2GK0A 1D5MA 4NN6C 1JGEB 5FA3B 4NJAL 3HI1A 4EOWL 4QTHA 4RMUA 3U4EA 1T0NA 3D39E 3RTQB 5DJ8B 3TEUA 1MWAL 2NLJA 3AAZB 4G9DB 1AGCA 4HPYL 1HHGB 3PF2A 3ZKQD 2P8MA 4OZHB 2W1NA 1VDGA 1L4IA 4PGBA 5IVZB 2D4FA 1MAMH 3GNMH 2WBJA 4WTXA 4M7ZC 1KELL 3VXPA 1D6EB 3SOBL 5KAQG 2D7MA 1MNUH 4JRXE 3SGDH 3QNZA 3MOQA 1YYML 1V5JA 1X6NA 1A6UH 3V4UL 4Q9CA 4KZDL 4PJDE 4PRBB 1QG3A 5GZOC 1HH9B 2EE2A 2X6MA 4WWKA 4YPGB 2E5EA 4JPIA 2NTFA 3WJJC 3W39A 4IS6B 3PQYD 4HIIA 2OTPA 4JZNA 2WV3A 5BOPA 4R4BB 4YR6A 4LVOB 1FDLH 2VL4A 1NL0L 3QIUD 5KN5B 2F54E 5GS2H 3ARFB 3OPZL 1T1ZA 2MQCA 3VW3H 4K7PY 5C92A 1ITBB 5ALCL 5E8EA 1MUJA 1H9VA 3EW3B 1KULA 2K1MA 3NPSB 5I1LA 1UVQA 2BVPA 3RY5A 4OFYA 1OF2A 1FN4A 5DZOA 2E9BA 1DE4B 5ACMA 4K7PX 1KCSL 1JHLL 1RJYA 5E8OA 2AEPH 3EFFA 5HYSB 4UTBH 3H9HA 2AJZA 1C12B 2C1PB 2AJSL 3P4NA 2A9ML 5DEZA 5EO9A 5HTSA 2EYSB 4PJBE 3DROB 3R06B 3WUZA 2PTTB 1ZGLA 1CVSC 3MUJA 2WUBL 3MREA 1JIBA 5SX5H 3INUH 4KAQL 3NIGF 2IAMB 5EZOL 1ED3A 3MRKA 4ORGB 1JZ3A 4Y4KC 3ZHLA 1HEZB 4XTRC 3C5JA 1AGBB 1MFEH 3FQTB 3HLAB 4PJHE 3O8XA 3MJ8A 5E03A 5GZOD 1QRND 4HIEB 3ZO0A 3ULVH 4ZNCD 4C83B 1NFDE 4CUCA 1FSKC 4NKDB 3VXSD 5FOJA 4BSJA 1L6XA 1CDYA 5A2FA 3KXFE 1ZAGA 2R1XA 4BH8B 5DJXB 4M5YH 1EGJL 3D39A 3RBGA 1PZ5A 5SV4A 2Y23A 3U7AA 4X6BB 3SDCC 2R4SH 3HZMB 2AS5M 5I8CA 4ONOA 5HXMA 3LZFH 1LDPH 2QSVA 1JVKA 1KENL 1T2JA 4YXLL 1ZGLP 4NM4H 4Y2DA 2FWOA 2YPKA 1CD8A 1UFUA 4OFPA 5EUKB 3BDYH 3FCTA 5F70A 3E0GA 4Z7OF 5DWUH 5JDSA 4C56E 4UILH 1V7MH 4M1CC 1U8IB 5KVEL 3EO1B 4JRXA 3BQUD 2EDOA 3HI5H 4X99A 4LLVA 4O2EB 1OD7A 4DK3A 1KEML 4G9FB 1Q9OB 2Z35A 1T7ZA 3SDYL 4PJDA 5J6HA 5CKAA 1KT2A 3V7MA 1IGIL 4ONFL 2RB8A 4K7FB 3I9GH 2APVA 5D2LE 3WO4B 1P4LA 5DS8A 3LEXA 4ELME 4M43H 4PJ7A 1TJGH 5C0BE 1LNUB 5IR1B 4MAYC 3ARSA 1MEXH 3QUZD 4M7JL 1I9IL 4QHLB 1FNSH 1NLBL 4GG6F 3G08A 4PIRF 2YWYA 3QO1B 1NCAH 1TZGL 3VG0H 1B6UA 3MRCA 5F1IB 4OQTH 3HAEB 2YUZA 4IMKA 5LQBL 3WFEL 3IVKB 4NKOA 2Y7QB 3PWPB 3TIEA 2HJKB 5A16A 1VENA 3X3GH 3SDCD 3RDTA 2AJXH 4PB9L 5TH2A 3TPUB 1OP5H 1U3HB 5B4MC 2VRAA 3QULA 2XPGB 3CX2A 3MV8B 4PJBA 2DM3A 3C60A 3MNVB 1CD1A 3JV6B 3LQAC 1RSFA 1TVDA 2UWEB 5F7MC 4F15B 1NC4D 4TNVK 5FOBA 3FZUC 5KSAD 4S1SL 2HTKC 1K3ZA 1R5IA 1LO2H 4HC1L 4PJHA 4LSVL 4OZIE 3WXWH 2YN3A 5DD1L 1I4FA 4EI5D 5DJDB 5I16B 3MCLL 1JMZA 4QXUL 1NFDA 3FO0H 4XCEA 2DBLH 3BP4B 2FBJL 3MXVH 4ZFOA 1ZHLB 3KXFA 3DRTA 2VDPL 3O3BB 1P5UA 5L0QC 3KVQA 3IDMB 3ROOA 4GW4B 3MRQA 2ZKHL 3U0TA 4PV8B 4D94A 1RFDH 1JZ5A 3LCYA 4ZUSB 3ULSA 4YC2B 2R8SH 3QI9B 1JMXA 4KK8D 1OL0A 5J11B 1Q1JH 3BT2L 4JO3H 4C56A 5EN2A 4JDTH 4UZGA 2O5YL 1CICD 4ODVH 4QRUA 3O6LH 4JFZH 2HVKA 3IJSA 3M8OL 3OKOB 2SEBA 3RZCC 2LAGB 2BVQA 1QFWH 5B4MD 4HUWA 2GFBA 5KVFL 2J7LA 3NCBB 4AMKL 1T20B 4JO4L 5D2LA 3FB6B 5K9QI 5IIEB 4U2ZA 4ELMA 1I1AA 5C0BA 4AIZA 1CDBA 4TRPH 4RZCA 3FFCE 4YE4H 4Y4FC 3MR9A 5F89A 4R6UA 4KRPB 2X2YA 2Z31C 3MGTB 3SDDB 1DVFB 1F2XK 2HLAB 4NHCH 3IFOB 4WW2B 4YHYC 5FO8A 1DL7H 1F58L 4FOMA 1S7XA 5TE7H 3BEVB 4YBLC 5D7LB 1EAJA 5HHPB 4IOFD 3NABL 4PS4L 4QYOB 1OSPL 5KSBB 4O2FB 4MNGB 3O2VL 1P7QB 5K33A 5HDQH 1S9XB 2A1WH 3BPLB 4KI5C 1UG9A 4LVEA 2DJSA 2DQJL 3I3BA 4ZTPH 3U1SL 2DBJA 4PRID 4I5BB 3GSXA 4NZUL 4QOKB 1PEZA 4RMVA 1X4XA 4OZIA 2A0LC 4P2RE 2GUOB 1W72A 1A9BB 4XBPA 5D93B 4QWWD 2VLRE 3BFOA 1CQYA 2AV7B 3N85L 3RWDA 1CXFA 1EUUA 3QH3A 2MPAL 3FONA 1ZS8B 3P9LB 3DYMA 1BD2E 1T5WB 4PLKC 1A0QH 1A7QH 1LO3L 1CGVA 4RWYH 4JJ5B 1AD9A 4HGWA 4LDLB 4YPJA 5C0DA 1R6VA 3NH7L 3QJFB 1I85A 2Z31D 4OM1H 3M45A 2RBLA 4G6KL 5HI3D 1IGFL 4J1UB 3TN0B 3QUYC 1MHEA 3QFJE 2N56A 1BZQK 2BDNH 3CFIC 3HZKA 4MDIA 2X4QB 1NANI 4QXTA 5L2KB 2OJEB 4AEFA 1H3PL 3E8UL 2ZUTA 3B9KB 3SE9H 3RAJH 3QHZL 2IFFH 2Y36H 1UKQA 3QUKB 4RQQB 4EVNB 4XPBH 3QP3A 4R9HA 3O45A 1NGWB 1GXEA 5K9QG 3OAUH 6CGTA 2YD1A 4EIZC 3GSOA 3NFPB 5I1AA 3WL9B 5TQ0L 1J11A 1DLFH 3FFCA 1BX2B 1IQDB 1JNHB 3O41A 3V6BR 4PJ8B 1JZ2A 3SGEH 4DGVH 3SY0B 5F6HJ 4HDIA 2AERT 5TF1L 1LO0H 1HHKA 5MP6H 3HE7A 4J3VA 2KUTA 4XVJH 2VL5A 4HULB 1NEZB 5DF0A 4WNQA 5CGYC 1K4CA 2BSRB 2I5YH 1WK0A 5MERA 4Z7UF 3VXUA 1U8LB 3REVA 4QNPE 3OTTA 1UQSA 4RRPA 4CU6A 4FTVB 5JXEA 1RZKH 1QBML 5I6XC 4P2OD 4JZJC 35C8L 2X44D 1A6TA 3QEQD 3QUYD 2F58L 1A7RH 3T0EC 1T5XB 3PGFH 4EN3A 3BXNB 3U36B 1PKQE 4NO0D 1XF1A 2GJ6B 3DXAE 2YS4A 5TPWH 5IQ9B 3B6SA 1Z5LB 3O4LE 3Q3GA 4E5XB 5HHVL 5T33L 5DRXA 4P2RA 3ARBD 3KHOA 4EIGB 1V3MA 3T4YB 2VLRA 5CWSB 2X9YA 4LNRB 3QDGB 1BD2A 4UINH 1FVCA 1RVFL 3BEWA 5F21B 5F7DB 4XVSH 2V5YA 1HQRB 5IHZB 1FH5L 4YGAB 3HB3C 5GS1B 2NY1B 2DMCA 3CZFB 2FEEI 1YPZF 4OZHF 1U8NB 2DD8H 1I9EA 1CFVL 2J6EH 1G7QB 3UTTB 4XVUD 3QUXB 3QFJA 1OAQH 1Y18B 5D7JA 1JTOA 3RTQC 1WZ1L 3BYTA 4X0KA 2ITDA 3AS1A 1N5YH 3BRDA 1DDHB 3KPOB 3P2TA 1KPUB 1YEIL 1RI8A 1U8QA 1TZHA 3MA9H 3KYOA 4HS3A 4BK4A 2WINB 3EJJX 5JORA 2GSGB 2CR3A 4TVSa 4U33A 4OLVH 5CZVH 2NY4C 1IM3A 1OGAB 2ATKA 3TA3A 5GS0D 2X4NA 4IRZH 3T0ED 4FHBD 4Z78B 4N8VB 1CF8L 1DQML 1E6JL 3IU4L 2IQAB 4K94C 1PSKL 4CU7A 3DBXA 3BESR 4JFFD 5EFIA 3GSNB 1LEGA 2D7TL 1J12A 2DDQL 1X4ZA 1I75A 4C4KO 3MV11 3BH9A 2G9HB 3LKQA 3BO8A 43C9A 3NCJH 5EUOA 1RK0B 3ZE0E 4XNMA 3DVGA 5DI8B 3T3PE 4MNQE 3G5VA 1KB5B 3QCUH 4K3DL 4RGND 1IL1B 1EFQA 3B5TA 2FATL 3TT3H 3GSUB 1FZJA 4FXKA 2Q3ZA 5DD0H 5DQJB 3S36X 5JHDD 5L8JB 5CMAB 5DK2A 2H32B 5T1LA 2Q87A 2CRIA 4BUHA 4G8IB 3VFNB 5E2VH 1XGRA 4LVNB 1G9MH 3GB7A 4RNRA 2ZUUA 3RTQD 4JEGB 1LD9A 1OAKL 2QADC 4YJZL 1AR1C 4PLJD 4Q2ZA 4DGIL 3DXAA 1MIML 1QZ1A 1A6WL 4JHBA 3O4LA 3MBXH 1HKLH 1HE7A 3NIGE 4MD0B 3TBTA 2HH0L 4HS6B 4OM0L 3BWAB 4ZPVA 4G7VH 3B83A 5ETUA 1MI5B 5EC2A 1Q9LB 1ZSDA 1WWBX 4NT6A 5DUBB 3S3JA 5IMOA 3E2HC 5B39G 2PCPB 2V9RA 4NM8L 1BQHA 4S1RH 1GGBH 2E7CA 4RGOL 4F9PC 5E6IB 1Y0LA 3WE6B 4U1MA 1T83C 1FNFA 2D03L 3RWFB 1P5VA 4WUKH 3VI4F 1XR9B 2AJ3B 4N0RA 4ZUVA 3VFRB 4YHOL 3CK0H 2OZ4H 3BN3B 1X7QA 4J3UA 3DJ9A 4U6YB 1FV1B 3LV3A 3MRMA 1WGOA 2DM4A 3ESUF 4EEEA 5CJ8A 1A3RL 3NZHL 3IETB 4PJIB 1YEGH 3ARFD 1TPXC 5KG9B 2VH5L 4Z7OE 2R23B 3P11H 1KFAL 1YN7A 5E8NA 4LKCA 4MSWA 1MH5A 1MRDH 2XACC 3H9YA 3HRZB 4JQXA 2V2XA 3V7AG 4HZAA 1AQKH 4JDZB 3MA7A 2P5WB 5IG7B 4KK5C 5HHME 3BDBA 5EC1A 1AR1D 3N06B 5F9JB 5ESAA 2OTWB 1QVOB 5TFSH 3G9AB 5D6CB 2ZSVA 3C5ZA 2NW2B 4KQ4L 4MAUL 1IC5L 1A2YA 1HXMA 4FQCL 1JV5B 4Z7NF 1BF8A 3WNKA 5F7KC 3KGRA 1W0WB 3S37H 1T03L 5EIIB 3VXQA 4L8SC 4GG6E 3NTCL 2IAMD 2ORBL 3HS0B 4MNQA 4WTZG 4WHDA 4OV5B 1MJJB 1OGTA 5FDWA 1N8ZA 5AD0A 2FEDC 4IDJL 5JO5B 3QQNA 4JDVA 2CDGB 3K4ZA 4PJCE 4WFGD 2WZPD 3SE8H 1JHTA 1E27A 2VXVL 5I1EL 2H6PB 4I1NB 4XBGA 5KW9L 4O51A 4O58H 1YUHA 4Q97A 4K9EH 4HGMA 3AVEA 3QEGH 3QWOB 4UQ3A 1INEL 3UBXA 2CDEA 4OB5H 3OAYK 2UWEF 2XN9E 2Q7YB 1FLTX 4NKIL 3IAPA 4HKXB 3HR6A 4HWZA 4FQ2L 1Z0NA 2ZUSA 2VDML 3DTXB 1T22A 5E0QA 5B3NA 3RVVC 2VWEC 3ZKND 3EO0B 1MCSA 1WBYB 2D0GA 4ONGL 4F7CA 5A2JH 5HYFA 4UBDC 2VJXA 3KAAA 5IK3A 4HWUA 5TE6L 4KK5D 2ZCKL 4M4PA 3K81A 3WFCL 3ROLB 4UU9B 1HH6A 4G9FD 1R3KA 2NTSP 4QRPB 2AEIT 3ECBB 3M07A 2DTSA 1FFOA 2ADIA 4NO3B 5CP7A 5J9PA 1NC4A 1DQJA 3G6JB 2WK2A 2APFA 5KSAA 1NGZA 3TBSB 4GW1B 4LF3B 3TBYB 3B9DA 4OUOA 4OZGF 5J1SC 4OCNC 5D1XC 1OSZA 3J7HA 2PO6A 1AHWA 4JAMA 1G7IA 4XMKH 5F7EL 2YEZA 1C5BL 1KCRH 2DYPA 1GPOH 2Y5TA 4AY0A 3ZLQC 5DEGA 4S0TD 3EO9L 3WFBL 2ILLA 1RJLA 1K6QL 4YC2C 4TSAH 1CE1H 1VADB 2G75A 3KS0H 3UTZB 5K59F 5EU6E 1PGRB 4WEMB 3PWPD 1A1MA 5AG9A 4EQ2A 1F42A 4S0SD 1KGCE 1U3HD 3D5OF 2V7HA 4KY1L 4L3EB 2EC8A 5J89A 3MV8D 3O2WL 1HZHH 2BZDA 4GG6A 3RQ3A 4LSUL 4UBDD 2F74A 1YQVH 5GS3A 4CL7A 3BSZL 2ED9A 3DIFA 3BKCL 5FGBA 4KRPC 2LFGA 2F19H 4P48A 5JLZB 1J5OL 5LGHH 2EH8L 5C8JB 4WI5A 4F7TA 4P59H 1BHGA 3NGBC 1QEWA 3MRBB 5IESL 4PLOB 1KCKA 3O0RH 4GBXA 4JFHE 4M7LT 1T4KB 4U1SB 5DURB 4L29A 3IGAB 5J6GA 1G7PB 2XN9A 3BAEH 5H94B 4ODXB 1X5LA 1JWSA 1PLGL 1NUFA 4MA8L 5E2TH 1R0AL 3FQRA 3SO5A 4WU5B 1WIPA 4O5LL 3QI9D 3AM8A 2IPUG 5LCVH 1BIHA 1N6VA 3UJJH 5GGSY 4WFHD 2H26B 2EDLA 3KYKH 1QSEA 3CU1A 3BPOB 1N0LA 4RFOL 5GS0L 5CEYA 1D9KB 3CFJA 3V5KA 4M62L 1RIUL 1I1YA 1TTFA 3X12A 1IM9A 5J57B 3RIFF 2EKJA 1FO0A 1S9VB 3IJYB 5DUPH 4GJTB 5ALBL 4H0IA 3A6BH 2O26U 5ITFA 3O6FA 3QUML 1HHJA 4OLXL 4GW5B 4BUGA 2IJ0C 4XNUH 4P4KC 3GMLA 1PG7W 1KPRB 4FZEL 5F97E 3EOYG 4DZBA 3OKLB 4LP4A 5JHLH 2PXYB 4JFDA 3SBWA 2XZZA 4KRPD 2ZOKB 5FK9B 1OCWL 4NKQB 5HI4D 3SDDD 1KN4H 1DVFD 4JO1H 5K9OA 1Q94B 4P3DA 1T66D 2FJFB 2ID5A 2KBGA 1EXUA 2BNQB 4ZUWA 3CC5B 2CJUH 4KK9C 4GRLC 1SVZA 3QDJE 1C1EH 5BVPL 3QJHA 4R3SA 4XH2A 3TN0C 4D9QE 1GGCL 4Q9RL 2UZXB 1P6FA 5EU6A 2C1OA 1FCCA 5F9OL 4I0PC 5D7LD 3PABA 5T3ZH 3GRWA 3KNBA 4RFNB 1A6VL 2FR4A 1KIRB 5F1SA 1AIFB 3B9KC 5BMFH 3BKML 5GJTL 1WBXB 1P7QD 1XCQA 2R2CA 2ICWA 3KPMB 4HK3N 1NJ9A 2AAVA 3EGSB 5I17B 5ICZA 1TNNA 4X5XA 1DQLL 3VCLA 2BCKA 1KBGL 3LS5L 1UZ8B 3L9RB 3RP1A 4QOKD 2JELL 2BMKA 3C2AL 4DN3L 4CVZB 1NBYB 4K94L 1WWCA 4ZUTA 5AZ2L 5KANI 1R3HA 5L88L 3R0NA 1RMFL 1KN2L 4U1JB 4G8EB 1JPTL 1WBZA 3ILPA 4K3JL 1K8DB 2X4TB 4ZAKB 4WJ5A 3VWKA 3RKDC 4GMSL 2CGRL 5FO7B 3BGFC 4JFPA 4ODSL 2JLLA 4WV1A 3B9VA 2HRPH 4LIQE 4MVBC 5J4MA 1MELA 5DD3H 5GGTL 1LO5A 3VDAA 1N59B 4OZFA 1C08B 4LGRB 1ZVYA 1WTLA 4KK9D 4NC1E 3K80A 1EZVX 1L0XA 4WUUE 3TN0D 2XI9A 5JXAH 3RJDA 1AO7B 4JKLA 4YHKL 3V52L 2YRLA 4RGMB 1K4DB 3T0AA 4F7MA 4PGCB 4FXLA 3VG9B 1QFUH 5GGSA 3VGDA 2AGJL 5L2KD 3FN9A 3LN4A 2EYRA 2X7LB 4X6FA 1CI5A 3MMEB 5EZLB 1U91B 3B9KD 4PUBL 4P2OA 3P0YL 1BGXL 5FGRA 5LXGH 5I8OH 2XY1A 2AXFB 5DMJB 2BHUA 3QQ3B 4LAQH 3DPBA 5I18H 5ISZE 1WT5A 4HUVA 4PR5A 1YPZE 3ES6B 4X6CB 4YIQB 5GSVA 2NY2B 4PTTB 2Q3AA 5D1QB 3MRIA 3V0WH 4JR9L 4PJ8D 3WUWB 2NY1C 4M3KB 1JBJA 4Z76B 3KPQA 4JVWA 2ZPKL 4KDTC 2EYTA 4O2CB 3QDJA 3TYGL 1H0DB 1KOAA 1CDJA 4JFOA 3TO2B 2YD8A 1HIMH 4XNXH 3QUXC 1HSAB 1YECL 2DTMH 3G5XB 4LDOB 2HFEA 5C3LD 1UJ3A 4MVBD