3T12B

Mgla in complex with mglb in transition state
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
132
structure length
131
Chain Sequence
LVLYGAPYAAAVEVLEETLRETGARYALLIDRKGVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKAAAAALAAIAEEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein mglA
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase/signaling protein
total genus 37
structure length 131
sequence length 132
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t12B00
1D1JA 2B95A 1ACFA 1SZVA 3MS6A 1G5UA 3D9YA 4X1MA 3CPTB 1SKOB 1J3WA 1CF0A 2PRFA 1A0KA 1PRQA 3L7HA 3T12B 3UB5P 1VETA 2PAVP 1AWIA 5EVEA 2V8FA 2ZL1A 1K0KA 3T1XA 3NECA 5FDSA 5EM1A 1VEUB 3T1SA 5FEGA 3L9KA 5FEFA 2JKFA 3MSHA 1CQAA 1SKOA 1F2KA 1VETB 2ACGA 3LEQA 1Y4OA 1YPRA 2ZL1B 2HZ5A 3CHWP 3NULA 4QWOA 4FTXA 4D60A 2V8CA 3CPTA 1VEUA 3T1QB 5EV0A 2JKGA 1Z09A 2BTFP 4X1LA 2E8JA 4ESPA 3U4LP 3DAVA 3T1RA 2PBDP 4X25A 1HLUP 3LGOA 1CJFA 2VK3A 3KYEA 1FIKA 4FUWA 1PFLA 5EM0A 1PNEA 1FILA
chains in the Genus database with same CATH superfamily
2ZQAA 2INWA 1LSVA 1G5UA 3IH8A 2ZC7A 2H10A 2I9VA 3P09A 2Q9NA 1WE4A 5AQ7A 2WAEA 5FATA 1K57C 2XR0A 3V5MA 5HFOA 3ZCZA 1T1AA 2K7SA 2ZMVA 1OJ5A 4IBXA 5FAPA 3RFBA 5EM1A 3MXSA 4KQDA 2GJ3A 2ZBBA 4L9EA 2YKFA 3WRTA 3EGDC 1LSWA 5HZHA 4HIAA 1G6OA 5JYOA 4E3LA 1S0WA 4KQOA 4FH2A 5E2FA 3U2AA 2Y2GA 4R4SA 3G31A 4PMAA 3MSHA 1JVJA 5GLBA 1K6SA 4PHTA 1QMEA 3LIFA 4UA9A 5HAIA 3LY4A 1GSWA 2KX6A 2IA2A 5IS1A 1YPRA 4UA6A 1FR6A 2VV6A 2HGVA 4QB8A 3JYIA 1KE0A 2J8YA 4LCMA 5MC7A 5I94A 3C7UA 1XXMA 4Y0OA 1JWVA 1XPBA 3DAVA 3PTEA 2J3WA 1E4DA 3LI8A 4O01A 1YLWA 2HP5A 1PWCA 4S2JA 4EQ1A 1CJFA 4WBGA 3BEBA 5AVFA 2VK3A 2ZM8A 4E3NA 4YFMA 1IEMA 1YAXA 4ME4A 1D7EA 4P85A 1D1JA 2OWJA 4JGOA 3GQZA 2WZXA 5HDCA 1SKOB 4XUZA 2Y59A 5HDSA 4DJ2A 2Y4AA 3SOIA 3BQAA 2XSSA 4HHDA 4OPZA 1AWIA 2P74A 4R4RA 3T4KA 2ZL1A 3JPUA 1LT0A 3LY3A 4K0WA 5J8XA 2P9VB 3SS3A 1OT6A 3EEHA 2ZQ9A 4EU0A 4LPZA 4DXCA 3RXXA 4H6JB 5TR7A 4B88A 5AQAA 2JKRI 4JKTA 2MJ6A 1F2KA 3OCLA 3FG8A 1XA7A 1I2WA 4CLCA 4I3IA 1JTGA 3LEQA 1N9LA 3A0RA 1ONGA 4DXBA 4LLOB 1L2SA 1MC0A 5CRFA 4I3JA 4DDSA 1S6RA 4BJPA 3A3FA 1BSGA 3FZCA 4CPKA 2M7UA 2Y2LA 4FTXA 2ZOIA 4NXEA 3DTMA 1GA0A 1DP6A 2Z6DA 4D2OA 3AGEA 1K56A 1T18A 4E3MA 2W3DA 4Q0IA 2GZAA 4X69A 1KDSA 2OLVA 4Y0UA 2V1ZA 2W3FA 4HOIA 3V3SA 3VOLA 4OOYA 3ZG7B 1PNEA 4Y17A 4ZDXA 3BRMA 2JHEA 3TSGA 2QWSA 2PD8A 1ES4A 4QHCA 4DE0A 1SZVA 4HNBA 4AFIA 4MNRA 2OV5A 3LIBA 3G30A 5CGWA 1MBLA 1G28A 3T12B 4K0XA 1XGIA 3IT9A 2BG1A 4YWZA 2O9BA 4ZJ3A 3HLWA 3IF6C 3ICYA 4EERA 3H7WB 3T4SA 1SKFA 3UB7A 1ES5A 2P08A 3VOYA 4KZ7A 2BASA 2X71A 3F1PB 2J80A 3V67A 1H3QA 4I5SA 2VLGA 3DWZA 1WYCA 4NEED 3KYQA 3CI6A 3UO9A 4C3QA 2A3UA 5EVLA 1LI9A 5IT5A 4GB7A 2W3HA 3FPVA 3Q82A 3BLMA 3OC2A 3DW0A 1XP4A 4LGWA 5CEDA 3FV7A 1SHVA 1PI4A 1N9BA 1JTDA 4DN0A 5E2GA 3ZNTA 2WUQA 2ZQ7A 1ZG6A 3HUOA 5G4YA 1VEUA 1K4EA 4MN7A 1VB6A 2HDQA 4PKYA 3V3RA 4ETZA 1NLYA 1K55A 5GLAA 3A0SA 3GVBA 1H8YA 4WEKA 3SH7A 4IJGA 1GSVA 3LGOA 3A3IA 3QP1A 1FCMA 5L8MA 1SDNA 1TDGA 5CEBA 2Y2KA 3KX0X 5LBRA 2FZ0A 1BYWA 1TS7A 4PPRA 1CEFA 3HL9A 2JN7A 4O0PA 2PT7A 2DMWA 2B95A 4CQHA 4PM6A 4S2OA 5J4EA 3C8CA 3HLCA 5DFXA 2Z6CA 5TJJA 5A91A 5IU1A 1V9ZA 5FASA 2X02A 2V8FA 4R38A 4RQ9A 3UDFA 2VZWA 4WYYA 2XA7M 4ZAMA 4Y5FA 3V50A 2JC7A 3MKEA 3UPPA 2HDSA 5CGXA 2V9AA 3BLSA 4Y15A 3MBZA 5CXWA 1ERMA 3ZQ5A 4ARZB 2HF6A 1FSWA 3EWKA 3Q81A 3RXWA 2EFXA 3CHWP 1STZA 4Y7PA 5AQ9A 3UNWA 2PU2A 2RL3A 5HL1A 4R3BA 5HX9A 1IKIA 3FC7A 3LR5A 3H82B 5DVAA 4HP4A 2XLNA 4L9GA 1I2SA 2NUTC 1Z09A 4X68A 2J9PA 2PBDP 1C3BA 2O99A 1MWSA 1HLUP 3MJQA 3CAXA 3KYEA 3GMWA 3KSFA 4IUHA 4OVDA 4P87A 1KDWA 1PFLA 4YNRA 2XF3A 5GHYA 2QMIA 4HJ6A 3CPTB 4LV3A 5F82A 5JYPA 2VGLS 3OCNA 4FCFA 2PRFA 3N6IA 2P04A 3UMDA 2ZC4B 3GDIA 2A2LA 2HJEA 3IF6B 3IS2A 3NDGA 2V20A 1YM1A 3ZHHA 1E25A 3PAGA 3H9WA 3S1YA 1V9YA 4Y0TA 1Z6FA 4S2KA 1VQQA 3VP4A 1S1ZA 1XX2A 2GNXA 3LUQA 5M18A 4JBFA 3GV9A 4ETXA 3JVUA 2RCXA 4S2IA 4OOMA 3TJZC 4NXFA 5FQKA 4MBKA 5EOEA 5I5LA 1RCJA 3O88A 3BJNA 2B5RA 4JGQA 1D06A 1NWZA 3PR6A 3LFVA 4QWOA 3N7WA 4WZ5A 3FWLA 1LLBA 3T1QB 1IYQA 4S2MA 1YLPA 1YKDA 1PWDA 5C5KA 4RX3A 4XUXA 3ISGA 4OPYA 4KZ9A 2B18A 4MMNA 2HV1A 3VP1A 5A93A 3MXRA 1XFNA 5EVIA 3QP4A 2VJWA 4LRXC 3Q7ZA 3MS6A 1ZC2A 1SDEA 4XT2B 4WN5A 1OTEA 2WGVA 4EUZA 3NJAA 4EUVA 2HDRA 2UWXA 3N8SA 2JKTI 2Q0OA 1LL8A 1E3UD 3NOUC 4HEFA 4MN6A 2W1TA 4M3KA 1ZTUA 3IXDA 1T1CA 4JXGA 5HWWA 4IVKA 4GS9B 5CHUA 4GKUA 3FKWA 3G35A 1BULA 2HP9A 4FD8A 2C5WB 4DE1A 2FFYA 5F83A 3T50A 4Q8IA 3P7NA 1S66L 1NY0A 1IFQA 1EI5A 4PM5A 3UE6A 3IWOA 5HL6A 1FCNA 1MWRA 3Q7VB 3EEAA 2VEAA 1NLZA 5J3WA 2WKIA 1RGZA 5TFQA 1ERQA 1W5DA 4ZJ2A 2G2UA 1H8ZA 4JXWA 3CUEC 3NI9A 4KZ4A 5TBMB 3VOZA 1OPXA 3BFEA 2W3GA 1BLCA 4OH0A 2O9AA 4QD4A 1YSQA 4OQHA 2J9OA 2QYBA 4MDZA 5A92A 3PBSA 1K38A 4OPQA 3TRCA 3HLGA 2Y91A 3MKFA 3CJMA 5KSCA 3P98A 4FUWA 3UY6A 3T4JA 3G32A 5CX7A 4RA7A 2EXBA 2V2FF 4BL2A 1P97A 4FOFA 4LRYC 5L10A 4RVAA 4Y13A 1PZOA 1K54A 5GLDA 4RX2A 2M1CA 4OKPA 2ZC5B 3C2WA 3W4PA 4N9KA 1K55C 5D3OA 1QMFA 3HUMA 4S2PA 1FOFA 5FI2A 3E4PA 2G2WA 1H8MA 1PZPA 4NKPA 4Z1WA 3LIAA 4DJ3A 2XDMA 1N9OA 3S4XA 3NBLA 2HPBA 4L9FA 3BFGA 3T1SA 1EW0A 3K3CA 4PM9A 2V0WA 4BENA 1K56D 3LR0A 1PWGA 4GOGA 1T1BA 5HAPA 3K2NA 3B42A 2ZQDA 3IX3A 1SKOA 4P6ZM 4ZJ1A 3UDXA 4OQ0A 1PIOA 1OT9A 3B47A 4WUJA 1IOUA 3IXGA 2ZL1B 3MFDA 2PHYA 4HH3A 2QJ5A 2JBFA 5CGSA 4B9OA 2P9VA 4WF0A 2WGIA 5A8BA 1TS8A 1LL5A 3VE3A 2YKHA 2QKPA 4EV4A 4H6JA 3EOIA 5FSRA 4Y2FA 5FQQA 5DKLA 3JVVA 4JGRA 4RYEA 3UB9A 3N4IA 2WKHA 1NJ4A 3WS4A 1NYMA 5EE8A 4R6LA 4OONA 5K5BA 5DTTA 2EX2A 4F3LB 1L0FA 3UPOA 3BFFA 1UWNX 1LSXA 1XJ2A 3BW6A 3T4LA 2KLIA 4GZBA 3ZG8B 4PAUA 1O7EA 3ITBA 4WLAA 4R3JA 1GA9A 3E2LA 1UWPX 3SH9A 4LENA 3QNBA 1W63Q 4BWIA 3ZDJA 4UEYA 1M40A 1JWPA 1K4FA 4YOFA 2PR6A 2ZQCA 4I39A 4ZTKA 1ESUA 2R9XA 3MZEA 5TGFA 4KZ5A 1FQGA 2KDKA 4BLMA 1ES2A 1OTIA 3MQQA 4DF6A 4HJ3A 3IX8A 2K31A 1IKGA 3VMAA 1YT4A 2W27A 4X6TA 5DTSA 1K57A 1HVBA 3RH8B 2QPNA 2V1BA 3KSGA 2HZ5A 4BBTA 1K25A 5GLCA 3LR4A 1P9WA 5FI6A 3QP5A 3F1PA 4H8RA 3F1OA 1W8QA 1FSYA 3S22A 3K3DA 2JKGA 3NOTC 3SH8A 4QJGA 2E8JA 3UB6A 3R4KA 3OZHA 3LICA 1M6KA 2EA9A 5L07A 1CI9A 1IELA 3E98A 5FQMA 4OPRA 1NRFA 1HTZA 3TE8A 3BYDA 1XJ3A 1UGUA 1WYBA 2EWVA 1N9NA 4WZ5C 1YLYA 1BZAA 2G7UA 2P7JA 5DKKA 4R3AA 1J3WA 3IHAA 4EWFA 3LEZA 2PAVP 3LI9A 3ITAA 2VGKA 3DTKA 1DJBA 4S2NA 3DTEA 3HLEA 4QY5A 4JGPA 4UQIM 5GL9A 3MQOA 1FR1A 3GR2A 5IHVA 2Y79A 4UA7A 5F1GA 4JLFA 3C38A 3BQ8A 3PBOA 2ZMFA 3A3DA 5HSQA 3NDEA 5F5YA 3M2JA 2Y2PA 4QPRA 2HP6A 3FPWA 3ZG0A 4HQAA 4OQIA 3UDIA 2XGNA 2ZQ8A 4C6YA 1Y28A 3AGFA 1XJ4A 4GCZA 4LRZE 1NRJA 3WS0A 4EETB 2WKEA 5HPFA 3IH9A 4MN5A 4IBRA 4ZBEA 4F94A 3NCKA 4IUKA 4OP5A 5E2HA 3R7WB 5KMWA 2V0UA 3LCEA 4R1GA 5M19A 1W63M 5FQ9A 3UMEA 1WA9A 4WELA 3ZVWA 3C30A 4ARZA 1BLSA 1MXOA 1GHMA 1K6RA 2X01A 2XROA 1CEGA 1KVMA 1FILA 3G2ZA 4XXRA 3G34A 4NXBA 4OLGA 1ACFA 1HD8A 4P6BA 3HJKA 1YMSA 1GHIA 3PBTA 2XEPA 2HDUA 3BFCA 1O07A 1IYSA 4CLCE 1CF0A 3AGDA 2A24B 5G18A 1VETA 1BLHA 4L0LA 3OPLA 1DJCA 4Q0HA 3UN7A 1T19A 2EX9A 3FYZA 4NG2A 3UE1A 3QP6A 5DF8A 4WMCA 3ZNYA 1Y54A 4BL3A 1Q2PA 2ZM0A 4KQQA 3M6HA 2W0NA 4M4XA 3VSLA 4U0TA 2JE5A 1JWZA 3VP0A 3VFFA 1W7FA 3D4FA 4YINA 5F6AA 2FFFB 4MEZA 3BWLA 4ZRRA 3IF6A 4KZ6A 2J3TC 3TG9A 3OBFA 3LYXA 4KZAA 3BM6A 4N92A 3ULFA 4IVIA 5FA7A 3C5AA 5HPIA 4GHIB 1L0DA 4JF5A 4B4XA 3MZFA 2WZZA 4OLDA 3MF0A 1CK3A 2XA7S 3GECA 4GDNA 3E0YA 1FIKA 4R0QA 4S2LA 1JNUA 2VKSA 3MXQA 1NYYA 2OLUA 2XRNA 4II7A 1CI8A 1MKMA 5DF9A 2H5SA 4DDYA 3F1NB 1G68A 4HH2A 1MWTA 3MFXA 4CLCC 4NK3A 4WL9A 4KG6A 2QJ7A 3VFHA 1RGYA 2GDNA 4B4ZA 5J7EA 1OTAA 4N9LA 2Z2LB 5A90A 3LR3A 1KGEA 2Y2HA 1W8YA 3Q07A 3T4QA 5CERA 3ZFZA 4A5RA 3ZGAB 1YMXA 5FEFA 2WAFA 2Q9MA 5AJGA 4XT2A 2JKFA 3IWQA 2OWHA 4GNUA 4EBLA 1DP8A 2HJ9C 4GLQA 3RJUA 4JXVA 3IXBA 5EUAA 4EEPA 1MKIA 5FQIA 2WGWB 5EFWA 1KE3A 1IYPA 1TD5A 3T4TA 4EESA 4UHUA 1OTBA 3CG5A 1GCEA 3PHYA 2UV0E 3TOIA 1DJAA 4GS9A 2J3TD 5CTNA 3HLDA 4MCWA 2ZLYA 3PAEA 4E3KA 2Y2OA 4ESPA 1TEMA 4MBHA 4DE2A 5CHJA 3G2YA 3HCYA 5HD3A 4OOLA 3BECA 3MR0A 3PBQA 3Q7VA 1HZOA 1PW1A 1S1YA 1VM1A 4PM7A 5AVEA 2XD5A 4BD0A 5TBMA 1PRQA 3EQUA 1YSPA 3QNCA 1KOUA 2Z2MB 1K0KA 1N4OA 1VHMA 4DRTA 5FDSA 2WK0A 3WS2A 4Q0JA 3A0VA 2J7VA 4JF6A 4KENB 5HARA 4N1HA 3OLOA 4CLCD 2K2NA 3WS1A 2OAP1 4KUKA 5FQJA 2V1AA 2NUPC 3N8LA 1E3UA 3QHYA 4KZ8A 1CQAA 3CMZA 3M6BA 3E4OA 3O86A 2VV7A 3FKVA 1U60A 3HLBA 3ZG5A 3SW1A 2EX8A 4KZ3A 3VSKA 3O3VA 4E6WA 4S2NC 5G4ZA 2XK1A 1DY6A 4DKIA 4KZBA 5U47A 3CWFA 4C75A 4JXSA 4MLLA 4EBNA 4X56A 3S7QA 3O5YA 1YLJA 4WM9A 3IBJA 3W4QA 2Y2IA 4HBUA 1F9IA 2WKQA 5M1AA 5FDHA 3LO7A 3NOPC 1DP9A 3BY9A 1ALQA 4WEJA 2OSUA 3KSIA 3UPNA 3CITA 1DRMA 2H28A 5DFYA 3SS4A 4IHQA 3TW8A 1L3LA 4QY6A 3QP8A 1ONHA 4JPMA 1YQSA 4U3TA 4O7DA 5HWTA 2PDRA 1KGGA 3P01A 4O8GA 4X1MA 5DJUA 3HUNA 2IWCA 2Y2MA 1H5XA 4CLCB 3OPHA 1LL9A 1I5QA 2D02A 2L4RA 2BLSA 2M7VA 4HI4A 2W3EA 3IWIA 3D72A 2VV8A 4X55A 4KUOA 5F1FA 1OTDA 1G6AA 3CLOA 3S7NA 4WZ4A 4K91A 4F3LA 2R78A 3L9KA 1W79A 4U0XA 4B93A 4KQRA 5HD5A 1KGFA 4E04A 4NETA 4G3KA 4GN2A 2C6WB 3IBRA 4KG2A 3VV4A 3GRJA 1MZUA 3UB8A 2PYPA 2B02A 5HDDA 4LV0A 4GJ4A 3IX4A 4EQIA 4EBPA 1H0MA 4D60A 2V8CA 3A3EA 2XFTA 2Y2NA 1YLTA 2EFUA 3MQ0A 2IWDA 3S7OA 2XD1A 2ZMAA 3HVFA 1LI0A 3KO6A 3H7WA 3NY4A 2LB5A 3OOVA 3PBNA 1MPLA 5L09A 3IQAA 3A3JA 3C4OA 1TF1A 3DTIA 5L2FA 4DE3A 5GHZA 3D9YA 3F1OB 4G3VA 3BY8A 4P6ZS 3CUEA 3GSGA 3W4OA 1XJ6A 1PI5A 3KSHA 3L7HA 3QP2A 5KZHA 3O87A 3N8RA 5EVEA 4BQMA 1P0ZA 1S4RA 2EXAA 4PKYG 2OOLA 2A49A 3T1XA 4GD6A 2JCHA 2EWWA 2ZD8A 4ID4A 2QZ6A 5E2EA 1VEUB 1ZKJA 3EQVA 1KE4A 3W8KA 5E43A 4OQGA 1SCWA 4E3IA 4UAAA 3VE4A 2AVXA 2ZOHA 2VGLM 1GSXA 5FAQA 3NHQA 4P0MA 2ACGA 3LIEA 5CHMA 3NC8A 2DCFA 2O0YA 1L0EA 1BUEA 1IYOA 1Y4OA 2WADA 1OMEA 5EVIC 5F69A 3ZYTA 4FH4A 5EPHA 2ZC6B 5EOOA 4OP8A 3HJIA 1TS6A 3MMHA 1NXYA 2Y2JA 1PW8A 2H0TA 1S67L 2D01A 3ZVTA 1XGJA 4X1LA 5KIZA 5AQBA 3U4LP 5GHXA 3Q1FA 3SZTA 4BBUA 5HWVA 4WMCD 1MWUA 2JKTM 1LHYA 2VGJA 2WYXA 5HW3A 4MBFA 4LFUA 1TVFA 3I7JA 2OAQ1 4I3AA 4R70A 5EM0A 2CMNA 2DNSA 2Y55A 3EGXC 1BT5A 1A0KA 4X53A 2O9CA 2E8IA 1XA1A 4I38A 4HP9A 3UB5P 1F98A 1XFQA 1ODVA 3R7WA 1S4SA 3PXPA 1F5MA 5BOHA 3M2KA 5FI7A 1ZG4A 2L1MA 1NZOA 3RTYA 3HBRA 1TDLA 1J9MA 3H82A 1BTLA 2L0WA 3WWXA 4HY8A 4R23A 4BBVA 2CC1A 2WKRA 4HJ4A 3IF5A 1VETB 2ZM2A 2A24A 1MY8A 4KG5A 1RP5A 3SS5A 2ZJ9A 4EEUA 4GD8A 3IHBA 4DMZA 5DTKA 3D3OA 1BLPA 2QHKA 1AXBA 4EW7A 4NXGA 2H0YA 3NULA 3OPRA 4E3JA 1NZUA 2PD7A 3DBAA 1EROA 4GDBA 4PM8A 1ZHHB 3CPTA 4G3WA 3BFDA 1K54C 2DRWA 4HESA 4K08A 1L0GA 2ZC3B 1Q2QA 5EVID 2BTFP 2XQZA 3IS2B 1GHPA 4LCLA 1PYYA 5KSHA 5FAOA 4CJNA 4FSFA 2I72A 3C7VA 1ES3A 2GX5A 4UQIS 4Z9QA 3G6OA 1EWZA 2EX6A 4LV1A 3NIAA 3UE3A 4N1XA 4E6XA 3B33A 3G4PA 4HBTA 4LV2A 2R9WA 3HLFA 2IWBA 1P9RA 4BD1A 2PR5A 3WRZA 4IEDA 5F68A 4GHIA 5EECA 3C4PA 2LB9A 4EXOA 5DF7A 3E2KA 2VA0A 1XKZA 3MZDA 2XH9A 3KYZA 3NECA 3OPPA 1KVLA 4JF4A 3E4QA 5DJTA 3DWKA 3S7PA 5FEGA 3VP3A 3ZG9B 2VX8A 2W1RA 2JKRM 1TS0A 3V39A 3IXHA 3F1NA 2FH5A 5EVIB 5CTMA 3PYPA 1FCOA 4QU3A 2XFSA 2PU4A 3UE0A 2PBYA 1OJGA 3PBRA 2KOIA 4E3OA 3T4OA 5EV0A 1YLZA 5CECA 2Y8HA 2Y2QA 3LIDA 5FL3A 3WS5A 3T1RA 2W1TB 4GW9A 4X25A 2WKPA 5HAQA 3GTCA 2PYRA 3HREA 3VP2A 4BMWA 3B3XA 3CZDA 1ESIA 3W2ZA 2WGWA 1X0OA 4Y3IA
chains in the Genus database with same CATH topology
1D1JA 2B95A 1ACFA 1SZVA 3MS6A 1G5UA 3D9YA 4X1MA 3CPTB 1SKOB 1J3WA 1CF0A 2PRFA 1A0KA 1PRQA 3L7HA 3T12B 3UB5P 1VETA 2PAVP 1AWIA 5EVEA 2V8FA 2ZL1A 1K0KA 3T1XA 3NECA 5FDSA 5EM1A 1VEUB 3T1SA 5FEGA 3L9KA 5FEFA 2JKFA 3MSHA 1CQAA 1SKOA 1F2KA 1VETB 2ACGA 3LEQA 1Y4OA 1YPRA 2ZL1B 2HZ5A 3CHWP 3NULA 4QWOA 4FTXA 4D60A 2V8CA 3CPTA 1VEUA 3T1QB 5EV0A 2JKGA 1Z09A 2BTFP 4X1LA 2E8JA 4ESPA 3U4LP 3DAVA 3T1RA 2PBDP 4X25A 1HLUP 3LGOA 1CJFA 2VK3A 3KYEA 1FIKA 4FUWA 1PFLA 5EM0A 1PNEA 1FILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1J A;  2B95 A;  1ACF A;  1SZV A;  3MS6 A;  1G5U A;  3D9Y A;  4X1M A;  3CPT B;  1SKO B;  1J3W A;  1CF0 A;  2PRF A;  1A0K A;  1PRQ A;  3L7H A;  3T12 B;  3UB5 P;  1VET A;  2PAV P;  1AWI A;  5EVE A;  2V8F A;  2ZL1 A;  1K0K A;  3T1X A;  3NEC A;  5FDS A;  5EM1 A;  1VEU B;  3T1S A;  5FEG A;  3L9K A;  5FEF A;  2JKF A;  3MSH A;  1CQA A;  1SKO A;  1F2K A;  1VET B;  2ACG A;  3LEQ A;  1Y4O A;  1YPR A;  2ZL1 B;  2HZ5 A;  3CHW P;  3NUL A;  4QWO A;  4FTX A;  4D60 A;  2V8C A;  3CPT A;  1VEU A;  3T1Q B;  5EV0 A;  2JKG A;  1Z09 A;  2BTF P;  4X1L A;  2E8J A;  4ESP A;  3U4L P;  3DAV A;  3T1R A;  2PBD P;  4X25 A;  1HLU P;  3LGO A;  1CJF A;  2VK3 A;  3KYE A;  1FIK A;  4FUW A;  1PFL A;  5EM0 A;  1PNE A;  1FIL A; 
#chains in the Genus database with same CATH topology
 2ZQA A;  2INW A;  1LSV A;  1G5U A;  3IH8 A;  2ZC7 A;  2H10 A;  2I9V A;  3P09 A;  2Q9N A;  1WE4 A;  5AQ7 A;  2WAE A;  5FAT A;  1K57 C;  2XR0 A;  3V5M A;  5HFO A;  3ZCZ A;  1T1A A;  2K7S A;  2ZMV A;  1OJ5 A;  4IBX A;  5FAP A;  3RFB A;  5EM1 A;  3MXS A;  4KQD A;  2GJ3 A;  2ZBB A;  4L9E A;  2YKF A;  3WRT A;  3EGD C;  1LSW A;  5HZH A;  4HIA A;  1G6O A;  5JYO A;  4E3L A;  1S0W A;  4KQO A;  4FH2 A;  5E2F A;  3U2A A;  2Y2G A;  4R4S A;  3G31 A;  4PMA A;  3MSH A;  1JVJ A;  5GLB A;  1K6S A;  4PHT A;  1QME A;  3LIF A;  4UA9 A;  5HAI A;  3LY4 A;  1GSW A;  2KX6 A;  2IA2 A;  5IS1 A;  1YPR A;  4UA6 A;  1FR6 A;  2VV6 A;  2HGV A;  4QB8 A;  3JYI A;  1KE0 A;  2J8Y A;  4LCM A;  5MC7 A;  5I94 A;  3C7U A;  1XXM A;  4Y0O A;  1JWV A;  1XPB A;  3DAV A;  3PTE A;  2J3W A;  1E4D A;  3LI8 A;  4O01 A;  1YLW A;  2HP5 A;  1PWC A;  4S2J A;  4EQ1 A;  1CJF A;  4WBG A;  3BEB A;  5AVF A;  2VK3 A;  2ZM8 A;  4E3N A;  4YFM A;  1IEM A;  1YAX A;  4ME4 A;  1D7E A;  4P85 A;  1D1J A;  2OWJ A;  4JGO A;  3GQZ A;  2WZX A;  5HDC A;  1SKO B;  4XUZ A;  2Y59 A;  5HDS A;  4DJ2 A;  2Y4A A;  3SOI A;  3BQA A;  2XSS A;  4HHD A;  4OPZ A;  1AWI A;  2P74 A;  4R4R A;  3T4K A;  2ZL1 A;  3JPU A;  1LT0 A;  3LY3 A;  4K0W A;  5J8X A;  2P9V B;  3SS3 A;  1OT6 A;  3EEH A;  2ZQ9 A;  4EU0 A;  4LPZ A;  4DXC A;  3RXX A;  4H6J B;  5TR7 A;  4B88 A;  5AQA A;  2JKR I;  4JKT A;  2MJ6 A;  1F2K A;  3OCL A;  3FG8 A;  1XA7 A;  1I2W A;  4CLC A;  4I3I A;  1JTG A;  3LEQ A;  1N9L A;  3A0R A;  1ONG A;  4DXB A;  4LLO B;  1L2S A;  1MC0 A;  5CRF A;  4I3J A;  4DDS A;  1S6R A;  4BJP A;  3A3F A;  1BSG A;  3FZC A;  4CPK A;  2M7U A;  2Y2L A;  4FTX A;  2ZOI A;  4NXE A;  3DTM A;  1GA0 A;  1DP6 A;  2Z6D A;  4D2O A;  3AGE A;  1K56 A;  1T18 A;  4E3M A;  2W3D A;  4Q0I A;  2GZA A;  4X69 A;  1KDS A;  2OLV A;  4Y0U A;  2V1Z A;  2W3F A;  4HOI A;  3V3S A;  3VOL A;  4OOY A;  3ZG7 B;  1PNE A;  4Y17 A;  4ZDX A;  3BRM A;  2JHE A;  3TSG A;  2QWS A;  2PD8 A;  1ES4 A;  4QHC A;  4DE0 A;  1SZV A;  4HNB A;  4AFI A;  4MNR A;  2OV5 A;  3LIB A;  3G30 A;  5CGW A;  1MBL A;  1G28 A;  3T12 B;  4K0X A;  1XGI A;  3IT9 A;  2BG1 A;  4YWZ A;  2O9B A;  4ZJ3 A;  3HLW A;  3IF6 C;  3ICY A;  4EER A;  3H7W B;  3T4S A;  1SKF A;  3UB7 A;  1ES5 A;  2P08 A;  3VOY A;  4KZ7 A;  2BAS A;  2X71 A;  3F1P B;  2J80 A;  3V67 A;  1H3Q A;  4I5S A;  2VLG A;  3DWZ A;  1WYC A;  4NEE D;  3KYQ A;  3CI6 A;  3UO9 A;  4C3Q A;  2A3U A;  5EVL A;  1LI9 A;  5IT5 A;  4GB7 A;  2W3H A;  3FPV A;  3Q82 A;  3BLM A;  3OC2 A;  3DW0 A;  1XP4 A;  4LGW A;  5CED A;  3FV7 A;  1SHV A;  1PI4 A;  1N9B A;  1JTD A;  4DN0 A;  5E2G A;  3ZNT A;  2WUQ A;  2ZQ7 A;  1ZG6 A;  3HUO A;  5G4Y A;  1VEU A;  1K4E A;  4MN7 A;  1VB6 A;  2HDQ A;  4PKY A;  3V3R A;  4ETZ A;  1NLY A;  1K55 A;  5GLA A;  3A0S A;  3GVB A;  1H8Y A;  4WEK A;  3SH7 A;  4IJG A;  1GSV A;  3LGO A;  3A3I A;  3QP1 A;  1FCM A;  5L8M A;  1SDN A;  1TDG A;  5CEB A;  2Y2K A;  3KX0 X;  5LBR A;  2FZ0 A;  1BYW A;  1TS7 A;  4PPR A;  1CEF A;  3HL9 A;  2JN7 A;  4O0P A;  2PT7 A;  2DMW A;  2B95 A;  4CQH A;  4PM6 A;  4S2O A;  5J4E A;  3C8C A;  3HLC A;  5DFX A;  2Z6C A;  5TJJ A;  5A91 A;  5IU1 A;  1V9Z A;  5FAS A;  2X02 A;  2V8F A;  4R38 A;  4RQ9 A;  3UDF A;  2VZW A;  4WYY A;  2XA7 M;  4ZAM A;  4Y5F A;  3V50 A;  2JC7 A;  3MKE A;  3UPP A;  2HDS A;  5CGX A;  2V9A A;  3BLS A;  4Y15 A;  3MBZ A;  5CXW A;  1ERM A;  3ZQ5 A;  4ARZ B;  2HF6 A;  1FSW A;  3EWK A;  3Q81 A;  3RXW A;  2EFX A;  3CHW P;  1STZ A;  4Y7P A;  5AQ9 A;  3UNW A;  2PU2 A;  2RL3 A;  5HL1 A;  4R3B A;  5HX9 A;  1IKI A;  3FC7 A;  3LR5 A;  3H82 B;  5DVA A;  4HP4 A;  2XLN A;  4L9G A;  1I2S A;  2NUT C;  1Z09 A;  4X68 A;  2J9P A;  2PBD P;  1C3B A;  2O99 A;  1MWS A;  1HLU P;  3MJQ A;  3CAX A;  3KYE A;  3GMW A;  3KSF A;  4IUH A;  4OVD A;  4P87 A;  1KDW A;  1PFL A;  4YNR A;  2XF3 A;  5GHY A;  2QMI A;  4HJ6 A;  3CPT B;  4LV3 A;  5F82 A;  5JYP A;  2VGL S;  3OCN A;  4FCF A;  2PRF A;  3N6I A;  2P04 A;  3UMD A;  2ZC4 B;  3GDI A;  2A2L A;  2HJE A;  3IF6 B;  3IS2 A;  3NDG A;  2V20 A;  1YM1 A;  3ZHH A;  1E25 A;  3PAG A;  3H9W A;  3S1Y A;  1V9Y A;  4Y0T A;  1Z6F A;  4S2K A;  1VQQ A;  3VP4 A;  1S1Z A;  1XX2 A;  2GNX A;  3LUQ A;  5M18 A;  4JBF A;  3GV9 A;  4ETX A;  3JVU A;  2RCX A;  4S2I A;  4OOM A;  3TJZ C;  4NXF A;  5FQK A;  4MBK A;  5EOE A;  5I5L A;  1RCJ A;  3O88 A;  3BJN A;  2B5R A;  4JGQ A;  1D06 A;  1NWZ A;  3PR6 A;  3LFV A;  4QWO A;  3N7W A;  4WZ5 A;  3FWL A;  1LLB A;  3T1Q B;  1IYQ A;  4S2M A;  1YLP A;  1YKD A;  1PWD A;  5C5K A;  4RX3 A;  4XUX A;  3ISG A;  4OPY A;  4KZ9 A;  2B18 A;  4MMN A;  2HV1 A;  3VP1 A;  5A93 A;  3MXR A;  1XFN A;  5EVI A;  3QP4 A;  2VJW A;  4LRX C;  3Q7Z A;  3MS6 A;  1ZC2 A;  1SDE A;  4XT2 B;  4WN5 A;  1OTE A;  2WGV A;  4EUZ A;  3NJA A;  4EUV A;  2HDR A;  2UWX A;  3N8S A;  2JKT I;  2Q0O A;  1LL8 A;  1E3U D;  3NOU C;  4HEF A;  4MN6 A;  2W1T A;  4M3K A;  1ZTU A;  3IXD A;  1T1C A;  4JXG A;  5HWW A;  4IVK A;  4GS9 B;  5CHU A;  4GKU A;  3FKW A;  3G35 A;  1BUL A;  2HP9 A;  4FD8 A;  2C5W B;  4DE1 A;  2FFY A;  5F83 A;  3T50 A;  4Q8I A;  3P7N A;  1S66 L;  1NY0 A;  1IFQ A;  1EI5 A;  4PM5 A;  3UE6 A;  3IWO A;  5HL6 A;  1FCN A;  1MWR A;  3Q7V B;  3EEA A;  2VEA A;  1NLZ A;  5J3W A;  2WKI A;  1RGZ A;  5TFQ A;  1ERQ A;  1W5D A;  4ZJ2 A;  2G2U A;  1H8Z A;  4JXW A;  3CUE C;  3NI9 A;  4KZ4 A;  5TBM B;  3VOZ A;  1OPX A;  3BFE A;  2W3G A;  1BLC A;  4OH0 A;  2O9A A;  4QD4 A;  1YSQ A;  4OQH A;  2J9O A;  2QYB A;  4MDZ A;  5A92 A;  3PBS A;  1K38 A;  4OPQ A;  3TRC A;  3HLG A;  2Y91 A;  3MKF A;  3CJM A;  5KSC A;  3P98 A;  4FUW A;  3UY6 A;  3T4J A;  3G32 A;  5CX7 A;  4RA7 A;  2EXB A;  2V2F F;  4BL2 A;  1P97 A;  4FOF A;  4LRY C;  5L10 A;  4RVA A;  4Y13 A;  1PZO A;  1K54 A;  5GLD A;  4RX2 A;  2M1C A;  4OKP A;  2ZC5 B;  3C2W A;  3W4P A;  4N9K A;  1K55 C;  5D3O A;  1QMF A;  3HUM A;  4S2P A;  1FOF A;  5FI2 A;  3E4P A;  2G2W A;  1H8M A;  1PZP A;  4NKP A;  4Z1W A;  3LIA A;  4DJ3 A;  2XDM A;  1N9O A;  3S4X A;  3NBL A;  2HPB A;  4L9F A;  3BFG A;  3T1S A;  1EW0 A;  3K3C A;  4PM9 A;  2V0W A;  4BEN A;  1K56 D;  3LR0 A;  1PWG A;  4GOG A;  1T1B A;  5HAP A;  3K2N A;  3B42 A;  2ZQD A;  3IX3 A;  1SKO A;  4P6Z M;  4ZJ1 A;  3UDX A;  4OQ0 A;  1PIO A;  1OT9 A;  3B47 A;  4WUJ A;  1IOU A;  3IXG A;  2ZL1 B;  3MFD A;  2PHY A;  4HH3 A;  2QJ5 A;  2JBF A;  5CGS A;  4B9O A;  2P9V A;  4WF0 A;  2WGI A;  5A8B A;  1TS8 A;  1LL5 A;  3VE3 A;  2YKH A;  2QKP A;  4EV4 A;  4H6J A;  3EOI A;  5FSR A;  4Y2F A;  5FQQ A;  5DKL A;  3JVV A;  4JGR A;  4RYE A;  3UB9 A;  3N4I A;  2WKH A;  1NJ4 A;  3WS4 A;  1NYM A;  5EE8 A;  4R6L A;  4OON A;  5K5B A;  5DTT A;  2EX2 A;  4F3L B;  1L0F A;  3UPO A;  3BFF A;  1UWN X;  1LSX A;  1XJ2 A;  3BW6 A;  3T4L A;  2KLI A;  4GZB A;  3ZG8 B;  4PAU A;  1O7E A;  3ITB A;  4WLA A;  4R3J A;  1GA9 A;  3E2L A;  1UWP X;  3SH9 A;  4LEN A;  3QNB A;  1W63 Q;  4BWI A;  3ZDJ A;  4UEY A;  1M40 A;  1JWP A;  1K4F A;  4YOF A;  2PR6 A;  2ZQC A;  4I39 A;  4ZTK A;  1ESU A;  2R9X A;  3MZE A;  5TGF A;  4KZ5 A;  1FQG A;  2KDK A;  4BLM A;  1ES2 A;  1OTI A;  3MQQ A;  4DF6 A;  4HJ3 A;  3IX8 A;  2K31 A;  1IKG A;  3VMA A;  1YT4 A;  2W27 A;  4X6T A;  5DTS A;  1K57 A;  1HVB A;  3RH8 B;  2QPN A;  2V1B A;  3KSG A;  2HZ5 A;  4BBT A;  1K25 A;  5GLC A;  3LR4 A;  1P9W A;  5FI6 A;  3QP5 A;  3F1P A;  4H8R A;  3F1O A;  1W8Q A;  1FSY A;  3S22 A;  3K3D A;  2JKG A;  3NOT C;  3SH8 A;  4QJG A;  2E8J A;  3UB6 A;  3R4K A;  3OZH A;  3LIC A;  1M6K A;  2EA9 A;  5L07 A;  1CI9 A;  1IEL A;  3E98 A;  5FQM A;  4OPR A;  1NRF A;  1HTZ A;  3TE8 A;  3BYD A;  1XJ3 A;  1UGU A;  1WYB A;  2EWV A;  1N9N A;  4WZ5 C;  1YLY A;  1BZA A;  2G7U A;  2P7J A;  5DKK A;  4R3A A;  1J3W A;  3IHA A;  4EWF A;  3LEZ A;  2PAV P;  3LI9 A;  3ITA A;  2VGK A;  3DTK A;  1DJB A;  4S2N A;  3DTE A;  3HLE A;  4QY5 A;  4JGP A;  4UQI M;  5GL9 A;  3MQO A;  1FR1 A;  3GR2 A;  5IHV A;  2Y79 A;  4UA7 A;  5F1G A;  4JLF A;  3C38 A;  3BQ8 A;  3PBO A;  2ZMF A;  3A3D A;  5HSQ A;  3NDE A;  5F5Y A;  3M2J A;  2Y2P A;  4QPR A;  2HP6 A;  3FPW A;  3ZG0 A;  4HQA A;  4OQI A;  3UDI A;  2XGN A;  2ZQ8 A;  4C6Y A;  1Y28 A;  3AGF A;  1XJ4 A;  4GCZ A;  4LRZ E;  1NRJ A;  3WS0 A;  4EET B;  2WKE A;  5HPF A;  3IH9 A;  4MN5 A;  4IBR A;  4ZBE A;  4F94 A;  3NCK A;  4IUK A;  4OP5 A;  5E2H A;  3R7W B;  5KMW A;  2V0U A;  3LCE A;  4R1G A;  5M19 A;  1W63 M;  5FQ9 A;  3UME A;  1WA9 A;  4WEL A;  3ZVW A;  3C30 A;  4ARZ A;  1BLS A;  1MXO A;  1GHM A;  1K6R A;  2X01 A;  2XRO A;  1CEG A;  1KVM A;  1FIL A;  3G2Z A;  4XXR A;  3G34 A;  4NXB A;  4OLG A;  1ACF A;  1HD8 A;  4P6B A;  3HJK A;  1YMS A;  1GHI A;  3PBT A;  2XEP A;  2HDU A;  3BFC A;  1O07 A;  1IYS A;  4CLC E;  1CF0 A;  3AGD A;  2A24 B;  5G18 A;  1VET A;  1BLH A;  4L0L A;  3OPL A;  1DJC A;  4Q0H A;  3UN7 A;  1T19 A;  2EX9 A;  3FYZ A;  4NG2 A;  3UE1 A;  3QP6 A;  5DF8 A;  4WMC A;  3ZNY A;  1Y54 A;  4BL3 A;  1Q2P A;  2ZM0 A;  4KQQ A;  3M6H A;  2W0N A;  4M4X A;  3VSL A;  4U0T A;  2JE5 A;  1JWZ A;  3VP0 A;  3VFF A;  1W7F A;  3D4F A;  4YIN A;  5F6A A;  2FFF B;  4MEZ A;  3BWL A;  4ZRR A;  3IF6 A;  4KZ6 A;  2J3T C;  3TG9 A;  3OBF A;  3LYX A;  4KZA A;  3BM6 A;  4N92 A;  3ULF A;  4IVI A;  5FA7 A;  3C5A A;  5HPI A;  4GHI B;  1L0D A;  4JF5 A;  4B4X A;  3MZF A;  2WZZ A;  4OLD A;  3MF0 A;  1CK3 A;  2XA7 S;  3GEC A;  4GDN A;  3E0Y A;  1FIK A;  4R0Q A;  4S2L A;  1JNU A;  2VKS A;  3MXQ A;  1NYY A;  2OLU A;  2XRN A;  4II7 A;  1CI8 A;  1MKM A;  5DF9 A;  2H5S A;  4DDY A;  3F1N B;  1G68 A;  4HH2 A;  1MWT A;  3MFX A;  4CLC C;  4NK3 A;  4WL9 A;  4KG6 A;  2QJ7 A;  3VFH A;  1RGY A;  2GDN A;  4B4Z A;  5J7E A;  1OTA A;  4N9L A;  2Z2L B;  5A90 A;  3LR3 A;  1KGE A;  2Y2H A;  1W8Y A;  3Q07 A;  3T4Q A;  5CER A;  3ZFZ A;  4A5R A;  3ZGA B;  1YMX A;  5FEF A;  2WAF A;  2Q9M A;  5AJG A;  4XT2 A;  2JKF A;  3IWQ A;  2OWH A;  4GNU A;  4EBL A;  1DP8 A;  2HJ9 C;  4GLQ A;  3RJU A;  4JXV A;  3IXB A;  5EUA A;  4EEP A;  1MKI A;  5FQI A;  2WGW B;  5EFW A;  1KE3 A;  1IYP A;  1TD5 A;  3T4T A;  4EES A;  4UHU A;  1OTB A;  3CG5 A;  1GCE A;  3PHY A;  2UV0 E;  3TOI A;  1DJA A;  4GS9 A;  2J3T D;  5CTN A;  3HLD A;  4MCW A;  2ZLY A;  3PAE A;  4E3K A;  2Y2O A;  4ESP A;  1TEM A;  4MBH A;  4DE2 A;  5CHJ A;  3G2Y A;  3HCY A;  5HD3 A;  4OOL A;  3BEC A;  3MR0 A;  3PBQ A;  3Q7V A;  1HZO A;  1PW1 A;  1S1Y A;  1VM1 A;  4PM7 A;  5AVE A;  2XD5 A;  4BD0 A;  5TBM A;  1PRQ A;  3EQU A;  1YSP A;  3QNC A;  1KOU A;  2Z2M B;  1K0K A;  1N4O A;  1VHM A;  4DRT A;  5FDS A;  2WK0 A;  3WS2 A;  4Q0J A;  3A0V A;  2J7V A;  4JF6 A;  4KEN B;  5HAR A;  4N1H A;  3OLO A;  4CLC D;  2K2N A;  3WS1 A;  2OAP 1;  4KUK A;  5FQJ A;  2V1A A;  2NUP C;  3N8L A;  1E3U A;  3QHY A;  4KZ8 A;  1CQA A;  3CMZ A;  3M6B A;  3E4O A;  3O86 A;  2VV7 A;  3FKV A;  1U60 A;  3HLB A;  3ZG5 A;  3SW1 A;  2EX8 A;  4KZ3 A;  3VSK A;  3O3V A;  4E6W A;  4S2N C;  5G4Z A;  2XK1 A;  1DY6 A;  4DKI A;  4KZB A;  5U47 A;  3CWF A;  4C75 A;  4JXS A;  4MLL A;  4EBN A;  4X56 A;  3S7Q A;  3O5Y A;  1YLJ A;  4WM9 A;  3IBJ A;  3W4Q A;  2Y2I A;  4HBU A;  1F9I A;  2WKQ A;  5M1A A;  5FDH A;  3LO7 A;  3NOP C;  1DP9 A;  3BY9 A;  1ALQ A;  4WEJ A;  2OSU A;  3KSI A;  3UPN A;  3CIT A;  1DRM A;  2H28 A;  5DFY A;  3SS4 A;  4IHQ A;  3TW8 A;  1L3L A;  4QY6 A;  3QP8 A;  1ONH A;  4JPM A;  1YQS A;  4U3T A;  4O7D A;  5HWT A;  2PDR A;  1KGG A;  3P01 A;  4O8G A;  4X1M A;  5DJU A;  3HUN A;  2IWC A;  2Y2M A;  1H5X A;  4CLC B;  3OPH A;  1LL9 A;  1I5Q A;  2D02 A;  2L4R A;  2BLS A;  2M7V A;  4HI4 A;  2W3E A;  3IWI A;  3D72 A;  2VV8 A;  4X55 A;  4KUO A;  5F1F A;  1OTD A;  1G6A A;  3CLO A;  3S7N A;  4WZ4 A;  4K91 A;  4F3L A;  2R78 A;  3L9K A;  1W79 A;  4U0X A;  4B93 A;  4KQR A;  5HD5 A;  1KGF A;  4E04 A;  4NET A;  4G3K A;  4GN2 A;  2C6W B;  3IBR A;  4KG2 A;  3VV4 A;  3GRJ A;  1MZU A;  3UB8 A;  2PYP A;  2B02 A;  5HDD A;  4LV0 A;  4GJ4 A;  3IX4 A;  4EQI A;  4EBP A;  1H0M A;  4D60 A;  2V8C A;  3A3E A;  2XFT A;  2Y2N A;  1YLT A;  2EFU A;  3MQ0 A;  2IWD A;  3S7O A;  2XD1 A;  2ZMA A;  3HVF A;  1LI0 A;  3KO6 A;  3H7W A;  3NY4 A;  2LB5 A;  3OOV A;  3PBN A;  1MPL A;  5L09 A;  3IQA A;  3A3J A;  3C4O A;  1TF1 A;  3DTI A;  5L2F A;  4DE3 A;  5GHZ A;  3D9Y A;  3F1O B;  4G3V A;  3BY8 A;  4P6Z S;  3CUE A;  3GSG A;  3W4O A;  1XJ6 A;  1PI5 A;  3KSH A;  3L7H A;  3QP2 A;  5KZH A;  3O87 A;  3N8R A;  5EVE A;  4BQM A;  1P0Z A;  1S4R A;  2EXA A;  4PKY G;  2OOL A;  2A49 A;  3T1X A;  4GD6 A;  2JCH A;  2EWW A;  2ZD8 A;  4ID4 A;  2QZ6 A;  5E2E A;  1VEU B;  1ZKJ A;  3EQV A;  1KE4 A;  3W8K A;  5E43 A;  4OQG A;  1SCW A;  4E3I A;  4UAA A;  3VE4 A;  2AVX A;  2ZOH A;  2VGL M;  1GSX A;  5FAQ A;  3NHQ A;  4P0M A;  2ACG A;  3LIE A;  5CHM A;  3NC8 A;  2DCF A;  2O0Y A;  1L0E A;  1BUE A;  1IYO A;  1Y4O A;  2WAD A;  1OME A;  5EVI C;  5F69 A;  3ZYT A;  4FH4 A;  5EPH A;  2ZC6 B;  5EOO A;  4OP8 A;  3HJI A;  1TS6 A;  3MMH A;  1NXY A;  2Y2J A;  1PW8 A;  2H0T A;  1S67 L;  2D01 A;  3ZVT A;  1XGJ A;  4X1L A;  5KIZ A;  5AQB A;  3U4L P;  5GHX A;  3Q1F A;  3SZT A;  4BBU A;  5HWV A;  4WMC D;  1MWU A;  2JKT M;  1LHY A;  2VGJ A;  2WYX A;  5HW3 A;  4MBF A;  4LFU A;  1TVF A;  3I7J A;  2OAQ 1;  4I3A A;  4R70 A;  5EM0 A;  2CMN A;  2DNS A;  2Y55 A;  3EGX C;  1BT5 A;  1A0K A;  4X53 A;  2O9C A;  2E8I A;  1XA1 A;  4I38 A;  4HP9 A;  3UB5 P;  1F98 A;  1XFQ A;  1ODV A;  3R7W A;  1S4S A;  3PXP A;  1F5M A;  5BOH A;  3M2K A;  5FI7 A;  1ZG4 A;  2L1M A;  1NZO A;  3RTY A;  3HBR A;  1TDL A;  1J9M A;  3H82 A;  1BTL A;  2L0W A;  3WWX A;  4HY8 A;  4R23 A;  4BBV A;  2CC1 A;  2WKR A;  4HJ4 A;  3IF5 A;  1VET B;  2ZM2 A;  2A24 A;  1MY8 A;  4KG5 A;  1RP5 A;  3SS5 A;  2ZJ9 A;  4EEU A;  4GD8 A;  3IHB A;  4DMZ A;  5DTK A;  3D3O A;  1BLP A;  2QHK A;  1AXB A;  4EW7 A;  4NXG A;  2H0Y A;  3NUL A;  3OPR A;  4E3J A;  1NZU A;  2PD7 A;  3DBA A;  1ERO A;  4GDB A;  4PM8 A;  1ZHH B;  3CPT A;  4G3W A;  3BFD A;  1K54 C;  2DRW A;  4HES A;  4K08 A;  1L0G A;  2ZC3 B;  1Q2Q A;  5EVI D;  2BTF P;  2XQZ A;  3IS2 B;  1GHP A;  4LCL A;  1PYY A;  5KSH A;  5FAO A;  4CJN A;  4FSF A;  2I72 A;  3C7V A;  1ES3 A;  2GX5 A;  4UQI S;  4Z9Q A;  3G6O A;  1EWZ A;  2EX6 A;  4LV1 A;  3NIA A;  3UE3 A;  4N1X A;  4E6X A;  3B33 A;  3G4P A;  4HBT A;  4LV2 A;  2R9W A;  3HLF A;  2IWB A;  1P9R A;  4BD1 A;  2PR5 A;  3WRZ A;  4IED A;  5F68 A;  4GHI A;  5EEC A;  3C4P A;  2LB9 A;  4EXO A;  5DF7 A;  3E2K A;  2VA0 A;  1XKZ A;  3MZD A;  2XH9 A;  3KYZ A;  3NEC A;  3OPP A;  1KVL A;  4JF4 A;  3E4Q A;  5DJT A;  3DWK A;  3S7P A;  5FEG A;  3VP3 A;  3ZG9 B;  2VX8 A;  2W1R A;  2JKR M;  1TS0 A;  3V39 A;  3IXH A;  3F1N A;  2FH5 A;  5EVI B;  5CTM A;  3PYP A;  1FCO A;  4QU3 A;  2XFS A;  2PU4 A;  3UE0 A;  2PBY A;  1OJG A;  3PBR A;  2KOI A;  4E3O A;  3T4O A;  5EV0 A;  1YLZ A;  5CEC A;  2Y8H A;  2Y2Q A;  3LID A;  5FL3 A;  3WS5 A;  3T1R A;  2W1T B;  4GW9 A;  4X25 A;  2WKP A;  5HAQ A;  3GTC A;  2PYR A;  3HRE A;  3VP2 A;  4BMW A;  3B3X A;  3CZD A;  1ESI A;  3W2Z A;  2WGW A;  1X0O A;  4Y3I A; 
#chains in the Genus database with same CATH homology
 1D1J A;  2B95 A;  1ACF A;  1SZV A;  3MS6 A;  1G5U A;  3D9Y A;  4X1M A;  3CPT B;  1SKO B;  1J3W A;  1CF0 A;  2PRF A;  1A0K A;  1PRQ A;  3L7H A;  3T12 B;  3UB5 P;  1VET A;  2PAV P;  1AWI A;  5EVE A;  2V8F A;  2ZL1 A;  1K0K A;  3T1X A;  3NEC A;  5FDS A;  5EM1 A;  1VEU B;  3T1S A;  5FEG A;  3L9K A;  5FEF A;  2JKF A;  3MSH A;  1CQA A;  1SKO A;  1F2K A;  1VET B;  2ACG A;  3LEQ A;  1Y4O A;  1YPR A;  2ZL1 B;  2HZ5 A;  3CHW P;  3NUL A;  4QWO A;  4FTX A;  4D60 A;  2V8C A;  3CPT A;  1VEU A;  3T1Q B;  5EV0 A;  2JKG A;  1Z09 A;  2BTF P;  4X1L A;  2E8J A;  4ESP A;  3U4L P;  3DAV A;  3T1R A;  2PBD P;  4X25 A;  1HLU P;  3LGO A;  1CJF A;  2VK3 A;  3KYE A;  1FIK A;  4FUW A;  1PFL A;  5EM0 A;  1PNE A;  1FIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...