3T16A

Crystal structure of staphylococcal nuclease variant nviaga/m98g at cryogenic temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
124
Chain Sequence
LHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIPYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKGVNEALVRQGLAKVAYVYKGNNTHEQHLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant NVIAGA/M98G at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 124
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t16A00
1A3TA 2F0UA 4PMBA 3HEJA 1SYBA 2F0JA 2EYOA 3TMEA 3TP5A 1SYEA 4KV6A 1JOKA 5CV7A 4TRDA 5KGUA 4K8JA 1KDBA 1SNQA 4DF7A 5C3XA 1KAAA 3SK8A 1U9RA 2F0TA 3D4DA 4E6IA 5ISRA 2EYPA 4WRDA 5CV9A 3SHLA 1A2UA 1SYCA 5CV6A 5IODA 5IGBA 1AEXA 3MXPA 5C5LA 4F7XA 3SK4A 2KQ3A 4KJNA 5EKLA 3P1HA 4F8MA 2PYKA 4ZQ3A 5IGEA 3S9WA 5JOBA 4K5VA 5J1ZA 2QDBA 4RKLA 5KIXA 2F3VA 4K14A 4NMZA 5KRUA 2EY5A 1EZ8A 4QB4A 3PMFA 5DAUA 1TT2A 1EY4A 2F0LA 4K5XA 2OF1A 5F2DA 2EY2A 5C3WA 1STBA 1KABA 2F0FA 2F0KA 2RKSA 4DU9A 1EQVA 4R8NA 1NUCA 1STHA 3ERQA 4MIUA 5DEHA 4J1MA 4OL7A 3NUCA 3MZ5A 1ENCA 2O4XA 3SK5A 1EY9A 3NP8A 4RKBA 3TP7A 5CV5A 3QOJA 1EYAA 5M9OA 4NKLA 3C1EA 1SNCA 4S3SA 5J39A 4PNYA 2F0VA 4ID6A 4K6DA 2EY6A 3EVQA 5KEEA 3SXHA 5C4ZA 4QMGA 3MEHA 2F0QA 2EYJA 3H6MA 1STNA 3EJIA 2F0SA 5C5MA 1STGA 2F0OA 3D4WA 3OMGA 4KY5A 4HMIA 4ME5A 3QB3A 3OWFA 4N9TA 1NSNS 4IALA 5E1FA 4I65A 5IGGA 5J22A 4LAAA 1A3UA 4EQOA 2KHSA 2RDFA 3SK6A 1EY6A 1SNPA 4K5WA 5IGFA 1KDCA 2SNMA 2F0MA 2EY1A 3NK9A 2RBMA 1II3A 1SNOA 5EKKA 1STAA 5CR3A 4ZUIA 2PZTA 2F0GA 2PZWA 5CV4A 5KYLA 4KHVA 4WORA 4YIJA 5C4HA 4EQNA 1STYA 2PQEA 3E5SA 5K5PA 4DGZA 3NXWA 3OMCA 3TP8A 5I6WA 1EYCA 4K2KA 4ODGA 1TR5A 2EXZA 2OXPA 2SNSA 1SYFA 2PZUA 3MVVA 4QF4A 5IIFA 1JOQA 4KY7A 5CV8A 4HTHA 3RUZA 3DHQA 1SNMA 3T16A 5IOCA 4ZUJA 4PMCA 4K2LA 4KD3A 2M00A 3EROA 4J6HA 3HZXA 3BDLA 1EY5A 2HQEA 3NQTA 4KTAA 4B9XA 5I9PA 2OEOA 4IZ8A 3VA5A 5CC4A 1JOOA 3TP6A 4EQPA 3QOLA 2F0HA 3NHHA 4B9WA 1TQOA 2ENBA 4KD4A 2EYMA 4HMJA 5C6AA 2F0NA 2F0DA 3C1FA 1SYGA 5KYIA 1SNDA 2EYLA 2WACA 4IUNA 3SR1A 4NDXA 5I6YA 5JAVA 2EYFA 2EYHA 3LX0A 3P75A 5IGCA 3D8GA 5HGTA 1EY7A 1EY8A 3R3OA 4H7BA 3U9OA 1IHZA 4EVOA 2PW5A 3BDCA 1A2TA 3ITPA 3V2TA 5HURA 3MHBA 2F0PA 5CGKA 5I9OA 1A3VA 3D6CA 2LKVA 1SYDA 3DMUA 5NUCA 2F0EA 1F2ZA 1F2YA 1RKNA 2F3WA 2NUCA 2F0IA 2SOBA 4G57A 5E3FA 3T13A 1EY0A 4N9PA 2F0WA 5EGTA 1JORA 1F2MA 4KY6A 5IGDA 1EYDA 4K8IA 4KJOA 4DFAA 3OSOA 4NP5A 1EZ6A 1ENAA 2PW7A 1KDAA
chains in the Genus database with same CATH superfamily
1SEBD 1PYBA 4HIOA 1Q3LA 3RZDB 4RHRA 3S1RH 3V96A 1STEA 3SHLA 5IODA 1PH5A 1IBKQ 3KJOA 3AFPA 4B3RQ 1OTCA 4JOIA 1V9PA 3OPOA 4LF6L 1BCPB 1WCMG 4K14A 4A3FB 2EZVA 2B2VA 1HZAA 3MXGA 3UE1A 1MHWC 1JT8A 5JJZA 1E1OA 4IJLA 1HXYD 2F0LA 4K5XA 3MAQA 1KABA 4L5TA 2EOTA 2VXWA 4R8NA 1AZQA 2XWBB 4J1MA 3E0JA 4OL7A 1CHQD 1ENCA 1Z7TA 2WAQG 2L55A 1A0IA 1NBWA 5I4DA 1B2TA 2EYJA 5C5MA 1NCVA 4JBWA 2FINB 2Q2IA 4DUYQ 2Q8RE 2EPBA 2J7ZA 2JA5B 4DV2L 3LGJA 1JJCB 1IL2A 1XTCD 4AYBB 4YWMA 3KJPA 4BXXG 4HJ9A 4GOPB 3L7ZC 4KHVA 2JA7B 3FKIB 1LTSD 1N34L 3NXWA 2OXPA 3Q22A 1ASZA 3MA2B 4Z9CB 5IIFA 1EYGA 5FO7B 4QUFA 4WFN3 3DHQA 1KD1C 3T16A 2KA7A 1RL2A 2JA6B 2HHHL 2VW9A 5ELCA 4I7AA 1VQMA 2PCFB 4JK1C 1HJPA 3M9BA 3KLSX 1BOSA 1YVCA 3PO2H 2RF4A 1SNDA 2ZJRA 2Z4HA 4KKTA 3J80c 4G7OC 4RHSA 1IHZA 1PDQA 2HCCA 1HNZL 4A3KG 5I9OA 2YU9B 4AIMA 1C0AA 3FPPA 2JXMB 2F0EA 1F2ZA 2JSOA 4X66Q 1YHAA 1VQIA 3T13A 2WAQE 3KF6A 2BA1A 1B4OA 1JORA 4ZK9B 1EYDA 4KJOA 2DJFC 2MO0A 4XXEA 3S15H 1XJVA 1ENAA 2B2WC 2K5VA 5DLQE 2F0JA 1CKOA 3VDYA 2JA8G 2NYZD 1LTGD 2K5HA 3STBC 3HS0C 4GKKL 4LF9Q 4DV1L 4J8QA 3CXCA 1WCMH 1SE8A 4NB3A 1A62A 1XTDA 4JBKA 1C4QA 2N88A 1HCZA 2JN4A 4A3GB 2WFWA 1BCPC 2EXDA 2AUJD 1ET9A 1TXYA 3P7JA 5KIXA 1FJGL 1VQKA 1F9QA 2F3VA 1EZ8A 1JWMD 2QEXA 4RH6A 5TSSA 5AJ3Q 5F2DA 4HCEA 2F0FA 2B2UC 3A74A 4GLAC 3VYTA 3PIO3 4Q5VA 3NTIA 4UP7A 1W6JA 4JI6L 2NTTA 1VQCA 3H3VI 1N32Q 2RHQB 4BXXH 3IAYA 4MZ9A 3EQLC 4KY5A 3QR8A 4R4CA 1K0SA 3AQQA 4O1NA 5HY6A 4L5QA 4LF5Q 1X3GA 4GOPC 4X65L 4C3IG 5CORA 2F0MA 2EY1A 4QY7A 2KVMA 4EQNA 5K5PA 1JC7A 3I72A 4QIWB 1ZEQX 3MEFA 1VQPA 1PYSB 3D31A 3S1MB 1NJIC 5EPLA 1BCPF 2E5LL 3I3CA 4DXGA 4GN5A 4JYAL 1EQTA 2VS1A 2KENA 1HA5A 2K05A 1EY5A 5T1IA 2OCEA 4QCLA 1DXMA 2ZT9C 1TQOA 3PO2B 5C6AA 4JI2Q 2DY8A 2F0DA 1Y14B 5KYIA 4A3KH 4DR2Q 4A93G 4IUNA 1PFSA 2UXBL 4DR1Q 4IUPA 3WDNA 2EIFA 5M5YB 3K58A 4G7HC 5FLMG 3OTOL 4LWCA 4MTNA 1R4PB 4NXNQ 3ITPA 4QUCA 3UDGA 2JK8A 1PH3A 2I0QA 2DY7A 1SAPA 2K52A 3D6CA 4DV3Q 2F4VL 3TQYA 2JA8H 4N9PA 3S15B 4GNXB 2KEEA 4BY7G 4UAIA 3GD7A 1XNRQ 4L8JA 3AU7A 1TY2A 2A5HA 1WCMB 1JJGA 1HUMA 3SK8A 2MJ8A 3ND9A 3CF5A 2MP1A 5CV9A 2NWGA 3K5MA 1L0WA 4PMWA 1V1OA 5FO8B 1IXRA 1KLGD 2B2UA 2PYKA 1VQ4A 3G6EA 2HDMA 1YHQA 4GZYC 2XWJB 3RZOH 2ICIA 2RKSA 2XSCA 3S2DH 1D5ZC 1EQVA 4MIUA 4B3SQ 4DK6C 4B3TL 1HNXL 1CSQA 1IYJB 1ESRA 3T1YL 5M9OA 1XNQQ 1Y1VG 3NTKA 4XTCS 5C4XH 3EBEA 2EY6A 4C3IH 1AE3A 2UUCQ 2SDFA 1SJHD 2UUAQ 3HRZC 2XVSA 1PTOB 1JB3A 3T1HQ 3A0JA 4P72A 2KEDA 3JAMc 1E1TA 5D14A 4F7XA 2ID0A 3MFGA 1UE5A 1NMFA 4X64L 3G71A 4DNRB 3M4OH 3MVVA 2PZUA 4QF4A 1NR4A 1L2FA 3CPFA 3SEBA 2PI2A 4CJ2C 1LTBD 1E24A 1VQ9A 4KD3A 3KBXA 1T5XD 4A93H 2JEAI 3HZXA 4I7ZC 1I6HH 2I5MX 3PIPA 4DK0A 4IPGA 4CDEC 5FLMH 1QVCA 3M7GA 2LXJA 1VDZA 3TREA 2EYFA 5JAVA 3KDFB 2Q2HA 3DEOA 2IHFA 3FDTA 4JI8L 1I3QH 1EWIA 2JA8B 2KOLA 2TMPA 4GNXC 4IOCA 1K28A 2D5DA 4LFAQ 2JEBI 2UXDL 2M2LA 3KBGA 4FXKC 5IGDA 4A3IB 1AFPA 5LMUQ 4LFCQ 1W3SA 4NP5A 1XX8A 5C0XJ 2K5WA 3CCMA 4ODGA 3F1ZA 2Q2UA 1G2TA 4EQ5A 2MPMA 4FF1A 3DWPA 4JI3L 2R61A 2Z6KC 1U9RA 1HTPA 1QWYA 1E3PA 4G7ZC 2QA4A 4FF4A 1SYCA 3TS0A 1WTRA 3ERSX 5J3BA 1ET6A 2BE5D 2H5XA 2KQ3A 5IGEA 3EFXD 3NBHA 1GJXA 1TWHH 1OXXK 4WJ4A 1E0BA 2GA4B 2XRSD 1Y1VH 4KLKA 5GQOA 3RN5A 1TT2A 3H0GH 3S2DB 3I91A 5C4JH 2E2DC 2WB1G 5C3WA 4LF8L 4LFBL 1NMGA 4LW1A 5M5XH 4A3BG 4K0KL 2VQEL 4UP8A 3NP8A 3G7LA 1IL8A 1U4MA 2R7DA 4NW2A 1U0LA 2ZXRA 4PNYA 4IUQA 2ATWA 4GKJL 1PLFA 4IFDI 1CZGA 1STNA 1O7LA 1XMQL 4LF7L 3OMGA 1Q86C 1VQGA 2ZJPA 2OT2A 3ULJA 5M3FG 1YJNA 1F9RA 1TS2A 1CA6A 2B2YC 2VB3X 1QZHA 2IY5B 2QKIC 4YIJA 3M4OB 1G8ZD 1K0RA 4PZ6A 1EYCA 5C0XG 1OXUA 4KHPL 1EU4A 4DV6Q 4A3FG 5LMNQ 3H91A 1TVXA 3BVMA 3RUZA 4OX9L 4LUOA 4A93B 3E9HA 2JE6I 2XTIA 2B2TA 3S24A 1I4QA 1IBLL 1LACA 2DJGC 3CP0A 1IKMA 4UPAA 4CKBA 5CC4A 4EQPA 1P16A 4GLVB 4R4IA 3IRBA 1E22A 2VZAA 1EFID 5DM63 3MC0B 5JJKA 2EDGA 5KNBA 1T5EA 4BY7B 3X3NA 3BDCA 4Q0FA 2WB1E 4U673 4NXML 3I7FA 3MTSA 1HQRD 4AYBG 4ZLTF 4JI1Q 1LM0A 1LLRD 1RJTA 3JAMi 5EGTA 4X3SA 2JA7G 2WIIB 1KDAA 1D6EC 3OWEB 2O5JC 2IHEA 1VQNA 3BVGA 1I94Q 1SYEA 3J7AF 4EGVA 1CTMA 5KGUA 1CA5A 4L5RC 5K36H 2K1BA 2F0TA 3D4DA 1F9PA 1O78A 3BDOA 1PRTB 5BN3A 1WTXA 4POGA 3K7AH 4B3MQ 3E6ZX 3L3OC 2A73B 4LMQD 3Q24A 1MKHA 3NWTA 4F8MA 4DR6L 2JA9A 1VQ6A 1Z47A 1XYIA 1DOKA 2C5CA 5C4JB 5LMNW 3BZDB 4DKAC 1HH2P 2EY2A 1BR9A 1H9SA 2A68D 4DU9A 1CSPA 5M5XB 1B1ZA 4B08A 5D3IB 1UEAB 4JW0A 2K32A 4XT1B 4BWGB 2N55A 3IFTA 3HOUG 1VMPA 3MWYW 1XPUA 3RZDH 2R7ZB 1IBKL 1A15A 1RTNA 4HJ7A 1EIGA 5M3FH 4B3RL 2A6ED 3EJIA 3I4LA 4XQJA 4MNOA 1HHVA 2H4OA 1Y1WB 5C0XH 1CQVA 2YTXA 4LUVA 1K8AC 2NN6I 4A3FH 3KLSA 3CCQA 1NTGA 1STAA 5I2XA 2Q8IB 1SMYD 3K6OA 4AYBE 4A3GG 4BY1B 3VYSA 5EKIA 2SNSA 3RLOA 4KY7A 2PNRC 4CJ0B 2IX3A 4PMCA 3ICEA 3PCOB 2HCIA 2YV5A 3URYA 4DUYL 1XWEA 4OO1G 1B8AA 1AW7A 3F2BA 3J7YW 1BCPD 3I70A 3KLRA 3UDFA 3I73A 2BE5C 4GS3A 3F2DA 4DR5Q 4CDFC 1HTLD 3R2IA 4M8AA 2JA7H 4HIMA 2N78A 4EVOA 4O2DA 5KNCA 4QL5A 2I07B 4FYDA 1Q46A 3GTQH 2VQFQ 2LKVA 4DV7Q 2ZTEA 2YTVA 4P75A 3JAML 4C3HB 1VQAA 1GO3E 1PH9A 1IYVA 3HEJA 3I55A 1B7YB 1Q8KA 2F4IA 4KK7A 2E74C 4XYOA 1CZWA 5IE8A 3QJYA 5ELFA 3CC4A 2WB1B 4KHZA 5CMDA 3VYRA 1TWAB 1S40A 4A3BB 4X66L 3CU7A 1F2LA 3VR5A 4K5VA 2YU9H 4CKCA 1WTPA 3HOUH 3N6RA 1G51A 3PMFA 2NZHA 5A35A 4C2MB 2NBFA 3CQZB 2CQAA 2WKCA 3M4PA 4C56C 1VQDA 4LF9L 3S1QH 4RG1A 3O13A 3OYYA 3B6YA 2EJFC 5M3FB 2B8GA 1M90C 1FGUA 2CWPA 2F0VA 2F0QA 1STGA 2F0OA 3TZUA 5FLXc 5M3MB 4L5SA 4A3GH 4N9TA 2B63G 1MD2D 3PUXA 5AJ3L 1FD7D 2Z0SA 3W1GA 4M1UB 2X6LA 3HOYG 1S5FD 4X3UA 1K83B 5CV4A 1UEBA 3UDIA 3S2HH 4OO1H 2CH4W 4C1NI 1TS5A 3GDEA 4HN7A 1Q81C 3PGZA 4OWWB 1N32L 5ELDA 2L5TA 4QIWE 4PV1C 4A3CG 1F9SA 2OEOA 4IZ8A 3E0EA 4LF5L 3F8TA 3CW2C 1I4XA 4CDCC 1LT6D 1IZ6A 1NR2A 2MNAA 2L0CA 1H9KA 1CKNB 3SR1A 4NDXA 1LYLA 1QVGA 1HFGA 4IPHA 1S72A 1C7YA 3GTLH 3GTQB 4FDBA 4CBVA 3MHBA 2A68C 3HP3A 3S1MH 2BA0A 2NUCA 4JI7Q 1F2MA 1ILPA 4AQYQ 2UU9Q 3DWQA 3OSOA 4ZYSA 2PW7A 4ILWA 4JI2L 4KI0A 1A3TA 4PMBA 4DR2L 5G3LD 3CAMA 4DR1L 3U50C 2A6EC 2NVYB 2KCCA 1X3EA 3CC2A 4E6IA 1VCIA 2EYPA 4NXNL 4A3LG 5M5YH 4DV3L 3CCSA 2RSOA 1LTLA 1S5ED 3HOUB 1XPOA 1SMYC 1HUNA 3V05A 1FNVA 2VNUD 2VUMB 4KKUA 4P74A 4WJ3M 3D6WA 4A3EB 1XNRL 3S1QB 2Q8TA 4GLXA 1STHA 4XQQA 4UDUC 4DUZQ 2RVLA 3HKZB 2DNCA 3W1BA 1ZXTA 3SK5A 4YHHQ 1RDPD 2K01A 3M4YA 1Y69U 1X55A 2IJ0A 4HCSA 4IPCA 4A3IG 2R93G 4N8FA 5FO9B 5JJIA 2KHIA 1FGBD 3R93A 3HOYH 3BG3A 2F0SA 4BBRB 1KAWA 3D4WA 2R3ZA 2WP8J 3OWFA 3J81i 5IGGA 4OGQC 1WD1A 4DAPA 3F2CA 3CCVA 1AE2A 4LUZA 3NK9A 4B3SL 1QUQB 2EE1A 3BJUA 4IN3A 4R1JA 3S2HB 4A3CH 3J81j 4DV4Q 1XNQL 1JICA 4DGZA 3I8ZA 4K2KA 3TBIB 2EXZA 2F03A 2FXQA 1LABA 1DCZA 4A3DB 2E2JB 2UUCL 2UUAL 2X69A 3SVMA 2Z9HA 3T1HL 1PTOH 1PH7A 1AN8A 1QZGA 1GUNA 1E7ZA 4FVMA 3BU2A 1QB5D 2F0NA 5CYUA 1HFNA 3RMHA 3A8JE 3LX0A 3NBHB 2Z8LA 3GTLB 1B3AA 2E2IB 3K59A 4ZAIA 1Q1BA 1YJWA 3W2DA 4R8IA 1PA6A 1SYDA 3I2ZA 2ZM6Q 1BDOA 2OQ0A 4DR4Q 1A6XA 1EIHA 3MXUA 3MXNB 2QEJC 2E2HB 3PUWA 4IO9A 4V190 3DWAA 4A3LH 1PTOD 3R8BA 2IWHA 1LO5D 2QF7A 2QILA 4TRDA 5JVG3 1VQ7A 3HOVB 1O80A 1KAAA 3TSSA 2OTJA 5JPMC 1Q1EA 4V0BA 1X3QA 1A2UA 1RIPA 1I50H 2B29A 1YJ9A 1V43A 5C5LA 2B2WA 3HOWG 4LJZC 4LFAL 2CKZB 5JOBA 3C2PA 4DR7Q 4JBJA 1J9OA 4LFCL 5LMUL 2K6AA 5GAHC 1UE7A 3AYHB 5DAUA 1Q12A 5JEAJ 4LF4Q 2K03A 4A3IH 3H3VH 1YIJA 1C8CA 4F88A 1KLUD 2PQAB 3OIQA 1S4ZA 2B63B 3FP9A 2PNHA 4QJFA 5ELNA 3GTPH 4HJAA 2ZXPA 2L9HA 3HOYB 1EL0A 2PPBC 1VMCA 1EUJA 1NSNS 2F1MA 3JAME 3J81L 3PQIA 5BR8Q 3A54A 4OEMB 4YCWA 3LWUA 1KRSA 4K5WA 3NPPA 3NENA 1CI3M 1QILA 3J80i 1KDCA 4X3TA 4ZUIA 3H94A 2PZTA 1VQFA 2PZWA 4Y7NH 4DR3Q 3FHWA 5H1SE 2RQXA 1NY4A 3K0XA 3VR2A 2E76C 4CGYB 2IT1A 2K04A 1K8OA 1TR5A 3M4QA 1OO9B 1LTID 1D1KA 2F3IA 2O5IC 2Y0SB 4FNFA 2MGSA 1EIYB 4GOPA 3I4OA 3IFDA 4J6HA 1SN8A 1W2BA 3D4RA 5LL6X 5IT9E 1RF2D 3EA6A 5IY0A 5FKAC 5EQ0A 2PMZB 2R7ZG 2A6HC 1OXTA 4FF3A 2DN8A 1IBMQ 1I5FA 1QNKA 3M85A 2SEBD 1CM9A 2NVXH 3HFZB 4HIKA 5JEAG 4DV6L 3I4NB 2OQKA 5LMNL 1GKHA 1UE1A 1Y1WG 1VS0A 1G6ZA 4BBSB 1PZID 1TIID 5E3FA 5IYDG 2HUGA 4K8IA 4BY1G 4MHEA 3CKIB 2L4NA 2Q2TA 3HOWH 3JC66 1J5EQ 1FNWA 1I50B 2IX1A 1SMXA 5G3LF 4BY7H 4QQBX 4H0LC 4JI1L 1WVLA 1FNUA 3CHBD 3CCUA 1J8IA 1BQQT 2QCPX 3L2PA 3A5UA 2R93B 1N36Q 1I94L 2B8FA 1PMRA 5BN5A 1B9NA 1DD2A 3RN2A 3GTPB 4BA2I 1L1OB 2KECA 1SFOH 4B3ML 1CFMA 1M1KC 1QNUA 3C1EA 1IW7D 1VQ8A 4RGMA 2RDHA 4C3HG 4ID6A 2D62A 2YYZA 4IUVA 2JQOA 4IFDG 1D8LA 4Y52H 1A63A 2AWOA 4FP5D 2BCOA 1QCBD 4ME5A 5J22A 3T51B 4GN3B 1TWFB 1WTOA 1H9MA 4JBMA 3EIVA 1HRJA 1UAPA 1WTWA 1HZ9A 2DNEA 5JPNC 4Y7NB 2SNMA 3J80L 1PVOA 3NE5B 3QWNA 2E75C 3ZYYX 2F52A 1VQLA 4JI0Q 1DYQA 3J7AV 2CVRA 1B53A 3OMCA 4NPSA 1DONA 1K73C 2J0TD 2NZOA 5CV8A 1T9HA 1V8QA 2R7ZH 2E8GA 1PTOC 1PRTD 2FMMA 5KNDA 4JC0A 5JEAH 3I90A 2ALYB 2F0HA 1U4PA 1J6QA 2I5LX 3PSIA 1WD0A 4XT3B 1Y1WH 3RLNA 1WTQA 3FVQA 5D3DA 1QG7A 1SYGA 1I6VC 2NVXB 2TSSA 1U5KA 1TKWB 3KFUA 1BF4A 1ICWA 3P75A 2L11A 1EEFD 3FPUB 1EY7A 5HGTA 3ZJYC 5IYDH 5M3MG 4BY1H 4WJWA 3P20A 2GN5A 3I56A 1BUVT 3L9AX 1UNSA 4H13C 5HURA 1A3VA 1TWCH 2UUBQ 4F87A 2F0IA 2G9HD 1EY0A 3HOZB 4YY3Q 1CT1D 1B70B 2ZTDA 3BYTB 5EPJA 1GM5A 3S17H 4IUTA 3RR5A 3HOWB 1ZKOA 2EYOA 2GVBA 1MBYA 2KHJA 4CKEA 3AB9A 4KN4C 1EOVA 4DR5L 3UDXA 1KNEA 1EIFA 3LNNA 4GNXA 1KC8C 1Q82C 3GTGB 3U4ZA 4J15A 5ISRA 4WRDA 4YCVA 4KKSA 1PTOF 2VQFL 4DV7L 1W6KA 1YITA 1MSGA 4K6LA 5EPKA 5E4XA 4KMUC 5A2QL 1X9NA 3H3VC 4A3JG 1L0YB 1SR3A 5JJLA 1UWVA 4QB4A 1WTHA 2Z6KA 2KCMA 1EY4A 4C3HH 1DM0B 1HQMC 3KYHC 2KUMA 1SFOB 5C44G 2K50A 4IURA 5C0XI 4DAYA 1E2VA 5CV5A 3QOJA 1EYAA 1OXVA 3CCJA 3TZDA 4A3MB 1K8MA 2G5DA 2MO1A 4K6DA 2K7VA 4RGTA 1BNZA 3TN2A 1YHBA 3SXHA 5C4ZA 2VB2X 4H02A 4HIDA 1RCVD 3A8IE 5FOBB 1FVIA 1TWAH 4A3BH 2ZTCA 1D7QA 4EQOA 3I4MB 4OONA 2NVTB 3FRPB 1EY6A 1SJED 1JR0D 1SNPA 1V1QA 1ENFA 2RBMA 4X62Q 4C2MH 3CQZH 2RA4A 1WYDA 4DK3C 3C46A 1GHJA 2VUMG 3OOCA 2HT1A 4ZUJA 2AKWB 1V1PA 2K14A 4JCVE 4DV5Q 4JG2A 4A3EG 2EVBA 3D3RA 1X32A 1FR3A 4HR7B 2B2YA 2HQEA 3GO5A 3NQTA 4KTAA 4P71A 3HKZG 1CHPD 4OXPA 1Y8OB 5M3MH 2EYMA 2Z1CA 4YCUA 1LTAD 1MJEA 3K5LA 3NBIA 1LT5D 1CK1A 3WWVA 1K83H 3Q23A 3EN2A 4BBRG 3KF6B 2B3GA 2X6GA 1KNAA 4OWTB 3S16B 1OXSC 1TWCB 3G48A 3PF5A 1D5XC 4XYQA 3KDFA 3SE0A 4HJ8A 2GVAA 3VA7A 3S17B 3J81E 3U58A 4DFAA 1MSHA 2K5QA 1IW7C 4A3DG 4JOIC 3K7UC 3TP5A 5CV7A 1VF7A 1TU2B 4RCNA 2D9UA 5C3XA 1O7YA 4A3JH 1BXTA 1QVFA 5FJ8G 2QDLA 5IGBA 4OHJA 1AEXA 3HGBA 3K5NA 3Q6SA 2AQ2B 3SK4A 4PQXA 4JI7L 4O42A 4MN3A 1SRUA 5C44H 4AQYL 2UU9L 2QDBA 1N9WA 2EY5A 2VL6A 3WOEA 4HAEA 2KCTA 1B50A 1HPCA 1Y8NB 1PFMA 5DEHA 5GADC 2PI2E 3K5OA 4JV5Q 1B44D 4DK1A 2D0OA 4RMFA 1PRTC 3DLLA 2BDOA 1UUPA 4DN4M 3HKZE 4NKLA 4FO2A 4RGOS 5EJWA 2LY7A 1KTKA 2NVYH 1GUGA 2HIVA 1DOLA 2FMCA 1HNWQ 4OO1I 4TVAB 5E1FA 3HOVG 4LAAA 1HZBA 1SROA 2RDFA 3SK6A 2XNAC 4RWSC 3TDQA 2K5DA 2VUMH 3A55A 4DUZL 5E7NA 4ALPA 2F0GA 4A3EH 4RGNA 4YHHL 4C3JB 1STYA 3TP8A 1IYUA 1AP0A 4ZCKA 1SYFA 3PUVA 2C9OA 3M3YB 1S5CD 3U9SA 2D0PA 1S3OA 3KF8A 1SLJA 4K2LA 3K81C 1H95A 1C9OA 2RCFA 2ZXOA 4JI5Q 3BDLA 1R9TB 4ULLA 4BBRH 1EOTA 5LHY1 1X3FA 1WOCA 3S1NB 2LMCB 2CW0C 4HMJA 1SE2A 4JI4Q 4DV4L 1YBYA 1PRTF 1U4LA 4POFA 1PXUA 3TS2A 3GTKB 1IKLA 1SDFA 5IGCA 5JVH3 1BVSA 5EBDA 3U9OA 1GXDC 4P2CB 2A74C 4DNIA 2P5ZX 3V2TA 1XMOQ 3NELA 3GTOB 3GQBA 4A3DH 2E2JH 5NUCA 4G57A 3G6JB 2D2CC 5L37A 3BZKA 5AFWA 1KRTA 3T56B 1B9MA 1GD7A 2BH2A 1L0XB 2RSNA 1PH2A 1WI5A 2HQLA 5FJ8H 1TWGB 4L6TB 1LT4D 3J80E 2Y0SG 4RA8A 4R4OA 3VR4A 3NTHA 1PFNA 2Z4IA 4A3JB 4TQUS 1I4PA 1JQYD 1VQEA 1GHKA 2K4KA 3PO3B 1H9JA 1SSOA 2ZM6L 2E2IH 2PO4A 5C44B 4DR4L 5M5WB 1K3BC 4ZQ3A 2FJ2A 2O2LD 2H1EA 3IKJA 4RKLA 5KRUA 3ER0A 2ES2A 4DV0Q 3I4NG 1BBXC 4ZKCB 2OF1A 1VQOA 2RDGA 2E2HH 1N33Q 2BOSA 1PH4A 4BBSG 5E4WC 1RTOA 3MZ5A 2IX0A 2UXCQ 3HOVH 3S14H 1PHJA 1DZ1A 2A6HD 2AUKA 3A7LA 1K8GA 3K80C 1M8AA 1EEID 4DR7L 4DAMA 1B3QA 3RD4A 2KJXA 5IYBG 4U68A 3QB3A 4MTKA 3TEHB 1PV4A 5IWAQ 4LF4L 2KHSA 2OWOA 4CHTB 3CRKC 3M7NA 3GTJB 2HD3A 5C4HA 1LUZA 3HG9A 5I6WA 3RLFA 3CD6A 2VY3A 2AHOB 2KBNA 1HR0Q 2B63H 4XQNA 1WFQA 4HTHA 1M4VA 1PZKD 3QG1A 2Y0SE 3EROA 2BDNA 3OHXC 5BR8L 5A2QE 1JOOA 3TP6A 3QOLA 4L63B 5C3EG 3TRZA 3NEMA 4DR3L 3S1RB 2PMZE 2EYLA 4CDDC 2K28A 3D8GA 2B39A 1P8LA 1X56A 4ZRZA 2HDLA 2PW5A 4OELB 5CGKA 3ULPA 1YNJC 3CC7A 5LL6S 3BYYB 3DMUA 4QGUA 2F3WA 2A1AA 3L0OA 4LF6Q 2BH8A 3Q8DA 4HSPA 2L1BA 2F0UA 4KN7C 1GUSA 2I46A 1IBML 3QIAA 1SBBB 4N8X1 1NE3A 4KV6A 1SNQA 1G291 5IP7G 1G91A 5CV6A 3I4NH 1D1IA 3MXPA 4IPDA 4ZKBB 4BBSH 4HSVA 1HR0W 1JJ2A 5C4XG 1YNXA 4IJHA 4DV2Q 3RNUA 3ERQA 2V4DA 2MFIA 1J5EL 2O4XA 3S14B 5IYBH 4UHVA 3BZCA 1N34Q 3W5OA 3VR6A 5J39A 3HOZG 2OTLA 4OIKA 4YWLA 3H6MA 4AH6A 4UY8C 2EJGC 4FXGC 4HMIA 1G6PA 3PIOA 3DUZA 4IALA 2HHHQ 1GOZA 1N36L 1XPRA 3MFYA 1HA6A 3F2UA 1FYCA 5IGFA 1II3A 2A69D 2R93H 5CR3A 1SE3A 4WORA 4RCOA 2NB0A 2PQEA 3E5SA 3VR3A 2R7FA 5EBCA 3BS1A 1VQBA 1YEZA 1D2BA 5C3EH 1PH6A 4XDXA 5IOCA 1QOHA 3N52A 1SNMA 1GUOA 1PH8A 1HNZQ 4A4IA 3A7AB 4HJ5A 1I4GA 1JWUD 1DJRD 2QGQA 1BO0A 1BBWA 2RHSB 4EX5A 4X3KA 2JP1A 3NHHA 2WV6D 4B9WA 1TS3A 1TWFH 4A3MG 4JI0L 4FXDA 2V1CC 2WACA 4R4TA 2EYHA 1Z6HA 3SDZA 5GAGC 1K3RA 3PIP3 4GKKQ 1ML0D 5ELEA 4DV1Q 2AQ3B 2Z6BA 3AEVA 3K57A 3I4MG 1EWHA 1CKNA 2WAQB 1F2YA 1RKNA 2CHBD 3HOXG 4DAYB 2F0WA 1C48A 5IP7H 2MHVA 4DXFA 1ZYRD 1FJGQ 2A19A 5HGQA 3D0FA 5BN4A 5CBAE 1JOKA 1ONLA 2EQSA 2L15A 1QE6A 2MQHA 3U4VA 4IFDJ 3H0GG 4PG3A 4BS9A 3X3MA 5IYCG 4JI6Q 2UUBL 1H9SB 5FLXL 1PZJD 3J7A5 4KJNA 1MJCA 3S9WA 3CCRA 4YY3L 4DA2A 5FK9C 2XGTA 1CKMA 1QJOA 2HIXA 3A56A 3HOZH 4IOAA 1D5MC 1STBA 4X65Q 1V1PB 2IPKD 1I4HA 1NUCA 2XRQD 3NUCA 5I2YA 1EY9A 4LK1C 4LNQA 3GTGH 4H44C 2E5LQ 3MEHA 2AWNA 4JYAQ 3GTMH 3CCEA 1PYWD 3PUYA 2N3SA 3T53B 2WINB 2MUYA 5IT9c 1U4RA 4A3KB 3E3XA 3Q0AA 2B2TC 1WTVA 1H9RA 4RAUC 5KYLA 1MIUA 3NWSA 2UXBQ 2CWAA 3KLWA 3DM3A 3CMAA 5C3EB 3FMCA 2N8NA 4G4KA 3OTOQ 1QUQA 4A3MH 4IQZA 4XIGS 3OW7A 1YZ6A 4TSSA 4OWXB 4B9XA 2F4VQ 1KHIA 1KL9A 3KUPA 5IP9G 4KD4A 4X62L 1S5BD 2ASBA 3I4MH 2NVTH 5EAYA 1K9MC 1MGSA 5I6YA 3HOXH 1Q7YC 5ELOA 3A5ZB 4A75A 4A76A 1A8VA 1Q8IA 1NAPA 4DAVA 3CPWA 4DV5L 1YNND 5K36G 3PUZA 2CFMA 2SOBA 1GVPA 1JWSD 4DPGA 2K75A 3RZOB 4C3JG 1DGSA 1LT3D 1EZ6A 1X54A 5IYCH 3AMUA 3NQIA 4ME3A 4K8JA 4DF7A 4B3TQ 3MXNA 1HNXQ 1Z9FA 2R92G 5C4XB 1MI2A 3K0YA 2DUDA 4C3IB 1X6OA 3T1YQ 4P73A 3CRLC 4C1NK 1UE6A 2A69C 3S16H 3P1HA 3DM1A 5J1ZA 4NMZA 1RD9D 2CQOA 1LV9A 1TY0A 3H15A 1GUTA 1RHPA 2F0KA 3KF8B 4UP9A 1SE4A 1N8RC 1VF5C 4X64Q 4FF2A 1AH9A 5CBEE 1SNCA 4IUUA 4RFBA 4S3SA 4BA1I 2NVQH 1DOMA 1R4QB 2CW0D 3G4SA 3W3AA 1G2SA 3GTMB 1I6HB 2PQAA 4QMGA 2KCNA 5T1GA 3WOFA 2R6GA 1Q90A 2K5NA 3CMEA 3PO3G 4JV5L 1SNOA 1L1OC 4CJ1B 1ASYA 3UE0A 1AZPA 4IFDH 2LS01 1LTTD 1F77A 1RODA 1E2ZA 1I3QB 1ZYRC 2FFKB 5IP9H 2JA5G 3LWEA 1CUKA 1TS4A 4JI8Q 1KQSA 1HNWL 4HEDA 1JE5A 3VYUA 5I9PA 3H09A 3VA5A 1E2WA 2M9VA 3FKIG 3R2TA 1EWCA 2UXDQ 2LFNA 5GROA 2ENBA 2DGYA 2NN6G 5D65A 1YI2A 1VQJA 2CH4A 3HOXB 2NTSA 1CQFA 2K33A 2G9DA 2JA6G 1BBUA 4JI3Q 1EY8A 3R3OA 4C3JH 3GV6A 1VQHA 1A2TA 3QO2A 1KIXA 2A8VA 4JI5L 4ABNA 3M3YH 1JMCA 1TWHB 3NSWA 3ULLA 1Y1VB 1LTRD 3H0GB 1O7IA 4KY6A 2R92H 1EQQA 2I5HA 3PV0A 1X3PA 1R9TH 1EQRA 3IL8A 3T4AC 4JI4L 1SYBA 2XIWA 4APVA 3TMEA 4LF8Q 3KOJA 4LFBQ 3S1NH 1KDBA 1GUWA 3C3LA 4K0KQ 1FL0A 2VQEQ 3E9IA 1VQ5A 1JCKB 3AFQA 3GTKH 1ESFA 1X65A 1XMOL 2XN9C 4R9WA 5EKLA 4GKJQ 3ND8A 3GTOH 3K8AA 5ELBA 1XMQQ 4LF7Q 2C35B 3GP7A 2YTYA 3GV3A 2ICEC 1JB7A 4TKOB 4PZ8A 5DM73 1TWGH 1ILQA 1XXGA 3TP7A 2B2VC 4RKBA 3A8KE 2NVQB 3DEPA 2JJQA 3UI2A 4KHPQ 3EVQA 4R4QA 5KEEA 3BVZA 5GAEC 2ZJQA 3PO3H 4OX9Q 2NZ1D 3STBD 1L1OA 5COYA 2J4XA 4I65A 3J7ZC 3FEWX 5M5WH 1A3UA 4DV0L 1IBLQ 1EFWA 3ONAB 2WKDA 2L12A 4JVZA 4YWKA 2JYOA 1BKBA 1N33L 2JA5H 5EKKA 1I4RA 1YNJD 4JPBW 1YNNC 2UXCL 2AMCB 3FKIH 3PF4A 1PH1A 1NNXA 1JOQA 4GN4B 2N49A 2NN6H 5FLXE 2M00A 3CCLA 4NXMQ 3DXJC 4PZ7A 5IWAL 2LSSA 4DNTB 2CCZA 1JE4A 2JA6H 1SXTA 1S5DD 3J81c 1HZCA 2FHTA 2AQ1B 2LXKA 3C1FA 2RCNA 2IL8A 3KK7A 3K7AB 4OIJA 3GTJH 3OW2A 1HR0L 1EU3A 1PFBA 2EJMA 3OIPA 4H7BA 2IW3A 5DNFA 3PO2G 1O7ZA 2F0PA 1KXLA 3HKSA 5IT9L 2R92B 2QW7A 4DR6Q 4X6AH 3SGIA 1ICFB 4O0AA 1WJJA 1Y8PB
chains in the Genus database with same CATH topology
1SEBD 1Q3LA 3RZDB 4RHRA 3V96A 1STEA 3SHLA 5IODA 3OPOA 1BCPB 4K14A 4A3FB 2EZVA 2B2VA 3MXGA 5JJZA 1HXYD 2F0LA 4K5XA 3MAQA 1KABA 2EOTA 2VXWA 4R8NA 1AZQA 2XWBB 4J1MA 3E0JA 4OL7A 1CHQD 1ENCA 1Z7TA 2L55A 5I4DA 1B2TA 2EYJA 5C5MA 1NCVA 4JBWA 2FINB 2Q8RE 2EPBA 2J7ZA 2JA5B 1XTCD 4AYBB 3L7ZC 4KHVA 2JA7B 3FKIB 1LTSD 3NXWA 2OXPA 3Q22A 3MA2B 4Z9CB 5IIFA 5FO7B 4QUFA 4WFN3 3DHQA 3T16A 2KA7A 2JA6B 5ELCA 2PCFB 4JK1C 3KLSX 1BOSA 1SNDA 2Z4HA 4KKTA 4G7OC 4RHSA 1IHZA 1PDQA 2HCCA 5I9OA 2YU9B 3FPPA 2JXMB 2F0EA 1F2ZA 2JSOA 3T13A 1JORA 2BA1A 1B4OA 4ZK9B 1EYDA 4KJOA 4XXEA 1ENAA 2B2WC 2F0JA 1LTGD 2NYZD 3HS0C 4J8QA 1C4QA 2N88A 1HCZA 4A3GB 1BCPC 2AUJD 1ET9A 3P7JA 5KIXA 1F9QA 2F3VA 1EZ8A 1JWMD 4RH6A 5TSSA 5F2DA 4HCEA 2F0FA 2B2UC 3VYTA 3PIO3 4Q5VA 3NTIA 1W6JA 2NTTA 3IAYA 3EQLC 4KY5A 4O1NA 4C3IG 5CORA 2F0MA 2EY1A 2KVMA 4EQNA 5K5PA 1JC7A 3I72A 4QIWB 1ZEQX 3D31A 3S1MB 5EPLA 1BCPF 3I3CA 4DXGA 1EQTA 1HA5A 2K05A 1EY5A 5T1IA 4QCLA 1DXMA 2ZT9C 1TQOA 3PO2B 5C6AA 2DY8A 2F0DA 5KYIA 4IUNA 4IUPA 3WDNA 5M5YB 3K58A 4G7HC 1R4PB 3ITPA 4QUCA 2DY7A 1SAPA 3D6CA 4N9PA 3S15B 2KEEA 4UAIA 3GD7A 4L8JA 3AU7A 1TY2A 2A5HA 1WCMB 1HUMA 3SK8A 2MJ8A 3ND9A 2MP1A 5CV9A 2NWGA 3K5MA 4PMWA 1V1OA 5FO8B 1KLGD 2B2UA 2PYKA 2HDMA 4GZYC 2XWJB 2ICIA 2RKSA 2XSCA 1D5ZC 1EQVA 4MIUA 1ESRA 5M9OA 3NTKA 4XTCS 2EY6A 2SDFA 1SJHD 3HRZC 2XVSA 1PTOB 1JB3A 2KEDA 5D14A 4F7XA 2ID0A 3MFGA 4DNRB 3MVVA 2PZUA 4QF4A 1NR4A 3SEBA 4CJ2C 1LTBD 4KD3A 3KBXA 1T5XD 2JEAI 3HZXA 4I7ZC 4DK0A 3M7GA 5JAVA 1VDZA 2EYFA 3DEOA 3FDTA 2JA8B 2KOLA 2TMPA 2D5DA 2JEBI 2M2LA 3KBGA 4FXKC 5IGDA 4A3IB 1AFPA 4NP5A 1XX8A 5C0XJ 2K5WA 4ODGA 1G2TA 2MPMA 4FF1A 3DWPA 2R61A 1U9RA 1HTPA 1QWYA 4G7ZC 4FF4A 1SYCA 1WTRA 1ET6A 2BE5D 2KQ3A 5IGEA 3EFXD 3NBHA 1GJXA 1OXXK 1E0BA 2GA4B 2XRSD 1TT2A 3S2DB 3I91A 2E2DC 5C3WA 3NP8A 3G7LA 1IL8A 1U4MA 4NW2A 2ZXRA 4PNYA 4IUQA 1PLFA 4IFDI 1CZGA 1STNA 1O7LA 3OMGA 2OT2A 1F9RA 1TS2A 1CA6A 2B2YC 2VB3X 2QKIC 4YIJA 3M4OB 1G8ZD 1EYCA 5C0XG 1OXUA 1EU4A 3H91A 1TVXA 3BVMA 3RUZA 4A93B 2JE6I 2B2TA 1I4QA 1LACA 1IKMA 4CKBA 5CC4A 4EQPA 1EFID 5DM63 3MC0B 2EDGA 5KNBA 1T5EA 4BY7B 3X3NA 3BDCA 4Q0FA 4U673 3MTSA 1HQRD 4ZLTF 1RJTA 1LLRD 5EGTA 4X3SA 2WIIB 1KDAA 1D6EC 3OWEB 2O5JC 3BVGA 1SYEA 3J7AF 4EGVA 1CTMA 5KGUA 1CA5A 5K36H 2K1BA 2F0TA 3D4DA 1F9PA 1O78A 3BDOA 1PRTB 5BN3A 1WTXA 3E6ZX 3L3OC 2A73B 4LMQD 3Q24A 4F8MA 3NWTA 1Z47A 1XYIA 1DOKA 2C5CA 5C4JB 3BZDB 2EY2A 1BR9A 1H9SA 2A68D 4DU9A 5M5XB 1B1ZA 4B08A 5D3IB 1UEAB 4XT1B 2K32A 4BWGB 2N55A 3IFTA 1VMPA 3MWYW 2R7ZB 1A15A 1RTNA 1EIGA 2A6ED 3EJIA 3I4LA 4XQJA 1HHVA 2H4OA 1Y1WB 5C0XH 1CQVA 2NN6I 3KLSA 1STAA 5I2XA 2Q8IB 1SMYD 3K6OA 4BY1B 3VYSA 5EKIA 2SNSA 4KY7A 2PNRC 4CJ0B 2IX3A 4PMCA 2HCIA 3URYA 1XWEA 4OO1G 1AW7A 3J7YW 1BCPD 3I70A 3KLRA 3I73A 2BE5C 1HTLD 3R2IA 4M8AA 4EVOA 5KNCA 2I07B 4FYDA 2LKVA 3JAML 4C3HB 1IYVA 3HEJA 2F4IA 4KK7A 2E74C 4XYOA 1CZWA 3QJYA 5ELFA 2WB1B 4KHZA 5CMDA 3VYRA 1TWAB 4A3BB 3CU7A 1F2LA 3VR5A 4K5VA 4CKCA 1WTPA 3N6RA 3PMFA 5A35A 4C2MB 2NBFA 3CQZB 2CQAA 2WKCA 4C56C 3O13A 2EJFC 5M3FB 2B8GA 2F0VA 2F0QA 1STGA 2F0OA 3TZUA 5M3MB 4N9TA 1MD2D 3PUXA 1FD7D 4M1UB 2X6LA 1S5FD 4X3UA 1K83B 5CV4A 4OO1H 4C1NI 1TS5A 4HN7A 5ELDA 2L5TA 4PV1C 1F9SA 2OEOA 4IZ8A 1I4XA 1LT6D 1NR2A 2L0CA 1H9KA 3SR1A 4NDXA 1HFGA 3GTQB 4CBVA 3MHBA 2A68C 3HP3A 2BA0A 2NUCA 1F2MA 1ILPA 3DWQA 3OSOA 4ZYSA 2PW7A 4ILWA 4KI0A 1A3TA 4PMBA 5G3LD 2A6EC 2NVYB 2KCCA 4E6IA 1VCIA 2EYPA 2RSOA 1S5ED 3HOUB 1SMYC 1HUNA 3V05A 1FNVA 2VNUD 2VUMB 4KKUA 3D6WA 4A3EB 3S1QB 2Q8TA 1STHA 4XQQA 4UDUC 2RVLA 3HKZB 2DNCA 1ZXTA 3SK5A 1RDPD 2K01A 3M4YA 1Y69U 4HCSA 2IJ0A 5FO9B 1FGBD 3R93A 3BG3A 2F0SA 4BBRB 3D4WA 2R3ZA 2WP8J 3OWFA 5IGGA 4OGQC 1WD1A 4DAPA 3NK9A 2EE1A 4IN3A 3S2HB 1JICA 4DGZA 3I8ZA 4K2KA 3TBIB 2EXZA 2F03A 1LABA 1DCZA 4A3DB 2E2JB 2X69A 3SVMA 1PTOH 1AN8A 1GUNA 4FVMA 1QB5D 2F0NA 5CYUA 1HFNA 3RMHA 3A8JE 3LX0A 2Z8LA 3GTLB 1B3AA 2E2IB 3K59A 4ZAIA 1Q1BA 3W2DA 4R8IA 1SYDA 1BDOA 1A6XA 1EIHA 3MXUA 2QEJC 2E2HB 3PUWA 4V190 3DWAA 1PTOD 3R8BA 2IWHA 1LO5D 2QF7A 2QILA 4TRDA 5JVG3 3HOVB 1O80A 1KAAA 3TSSA 5JPMC 1Q1EA 4V0BA 1X3QA 1A2UA 1V43A 5C5LA 2B2WA 4LJZC 5JOBA 3C2PA 1J9OA 2K6AA 5DAUA 1Q12A 5JEAJ 2K03A 1C8CA 4F88A 1KLUD 3OIQA 1S4ZA 2B63B 2ZXPA 2L9HA 3HOYB 1EL0A 2PPBC 1VMCA 1NSNS 2F1MA 3JAME 3J81L 3A54A 3LWUA 4K5WA 3NPPA 1CI3M 1QILA 1KDCA 4X3TA 4ZUIA 3H94A 2PZTA 2PZWA 2RQXA 4CGYB 3VR2A 2E76C 2IT1A 2K04A 1K8OA 1TR5A 1OO9B 1LTID 1D1KA 2O5IC 2Y0SB 4FNFA 2MGSA 3IFDA 4J6HA 3D4RA 5LL6X 5IT9E 1RF2D 3EA6A 5FKAC 5EQ0A 2PMZB 2A6HC 1OXTA 4FF3A 2DN8A 1QNKA 3M85A 2SEBD 1CM9A 5JEAG 3I4NB 1G6ZA 4BBSB 1PZID 1TIID 5E3FA 2HUGA 4K8IA 4MHEA 3CKIB 2L4NA 1FNWA 1I50B 2IX1A 5G3LF 4H0LC 1WVLA 1FNUA 3CHBD 1J8IA 1BQQT 2QCPX 2R93B 2B8FA 1PMRA 5BN5A 1B9NA 1DD2A 3GTPB 4BA2I 2KECA 1CFMA 1QNUA 3C1EA 1IW7D 4RGMA 2RDHA 4C3HG 4ID6A 2D62A 2YYZA 4IUVA 4IFDG 2AWOA 4FP5D 2BCOA 1QCBD 4ME5A 5J22A 3T51B 1TWFB 1WTOA 1H9MA 1HRJA 1UAPA 1WTWA 2DNEA 5JPNC 4Y7NB 2SNMA 3J80L 3NE5B 3QWNA 2E75C 3ZYYX 1DYQA 3J7AV 2CVRA 1B53A 3OMCA 1DONA 2J0TD 5CV8A 1V8QA 1PTOC 1PRTD 2FMMA 5KNDA 5JEAH 3I90A 2F0HA 1U4PA 1WD0A 4XT3B 1WTQA 3FVQA 5D3DA 1SYGA 1QG7A 1I6VC 2NVXB 2TSSA 1TKWB 1BF4A 1ICWA 3P75A 2L11A 1EEFD 3FPUB 1EY7A 5HGTA 4WJWA 3P20A 1BUVT 3L9AX 1UNSA 4H13C 5HURA 1A3VA 4F87A 2F0IA 2G9HD 1EY0A 3HOZB 1CT1D 5EPJA 3BYTB 4IUTA 3HOWB 1ZKOA 2EYOA 1MBYA 4CKEA 3AB9A 4KN4C 1KNEA 3LNNA 3GTGB 5ISRA 4WRDA 4KKSA 1PTOF 1W6KA 1MSGA 4K6LA 5EPKA 5E4XA 4KMUC 5A2QL 3H3VC 1L0YB 4QB4A 1EY4A 1DM0B 1HQMC 2KUMA 1SFOB 4IURA 5C0XI 4DAYA 1E2VA 5CV5A 3QOJA 1EYAA 1OXVA 3TZDA 4A3MB 1K8MA 4K6DA 2K7VA 4RGTA 1BNZA 3TN2A 3SXHA 5C4ZA 2VB2X 1RCVD 3A8IE 5FOBB 4EQOA 3I4MB 2NVTB 3FRPB 1EY6A 1SJED 1JR0D 1SNPA 1ENFA 2RBMA 2RA4A 3C46A 1GHJA 3OOCA 4ZUJA 1V1PA 2EVBA 3D3RA 1X32A 1FR3A 4HR7B 2B2YA 2HQEA 3GO5A 3NQTA 4KTAA 1CHPD 1Y8OB 2EYMA 2Z1CA 1LTAD 3K5LA 3NBIA 1LT5D 1CK1A 3Q23A 2X6GA 1KNAA 3S16B 1OXSC 1TWCB 1D5XC 4XYQA 3SE0A 3VA7A 3S17B 3J81E 4DFAA 1MSHA 2K5QA 1IW7C 3TP5A 5CV7A 1VF7A 1TU2B 4RCNA 2D9UA 5C3XA 1O7YA 1BXTA 5IGBA 4OHJA 1AEXA 3HGBA 3K5NA 3SK4A 3Q6SA 2AQ2B 4PQXA 4O42A 4MN3A 2QDBA 2EY5A 3WOEA 4HAEA 1B50A 1HPCA 1Y8NB 1PFMA 5DEHA 3K5OA 1B44D 4DK1A 1PRTC 2BDOA 1UUPA 4DN4M 4NKLA 4FO2A 4RGOS 5EJWA 2LY7A 1KTKA 1GUGA 1DOLA 2FMCA 4OO1I 5E1FA 4LAAA 2RDFA 3SK6A 2XNAC 4RWSC 3TDQA 2K5DA 3A55A 2F0GA 4RGNA 4C3JB 1STYA 3TP8A 1IYUA 1AP0A 1SYFA 3PUVA 2C9OA 3M3YB 1S5CD 3U9SA 3KF8A 4K2LA 2ZXOA 3BDLA 1R9TB 4ULLA 1EOTA 5LHY1 3S1NB 2LMCB 2CW0C 4HMJA 1SE2A 1PRTF 1U4LA 1PXUA 3GTKB 1IKLA 1SDFA 5IGCA 5JVH3 5EBDA 3U9OA 1GXDC 4P2CB 2A74C 3V2TA 3GTOB 3GQBA 5NUCA 4G57A 3G6JB 2D2CC 5AFWA 3T56B 1B9MA 1L0XB 2RSNA 1TWGB 4L6TB 1LT4D 3J80E 4RA8A 3VR4A 3NTHA 1PFNA 2Z4IA 4A3JB 4TQUS 1I4PA 1JQYD 1GHKA 3PO3B 1H9JA 1SSOA 2PO4A 5C44B 5M5WB 4ZQ3A 2FJ2A 2O2LD 2H1EA 3IKJA 4RKLA 5KRUA 1BBXC 4ZKCB 2OF1A 2RDGA 2BOSA 5E4WC 1RTOA 3MZ5A 2IX0A 1DZ1A 2A6HD 2AUKA 3A7LA 1M8AA 1EEID 3RD4A 2KJXA 4U68A 3QB3A 2KHSA 4CHTB 3CRKC 3M7NA 3GTJB 5C4HA 3HG9A 5I6WA 3RLFA 4XQNA 4HTHA 1M4VA 1PZKD 3QG1A 3EROA 2BDNA 3OHXC 5A2QE 1JOOA 3TP6A 3QOLA 4L63B 3S1RB 2EYLA 2K28A 3D8GA 2B39A 4ZRZA 2HDLA 2PW5A 5CGKA 1YNJC 5LL6S 3BYYB 3DMUA 2F3WA 4HSPA 2L1BA 2F0UA 4KN7C 1GUSA 2I46A 3QIAA 1SBBB 4KV6A 1SNQA 1G291 1G91A 5CV6A 1D1IA 3MXPA 4ZKBB 4HSVA 3ERQA 2V4DA 2O4XA 3S14B 3VR6A 5J39A 4OIKA 3H6MA 2EJGC 4FXGC 4HMIA 3DUZA 4IALA 1GOZA 1HA6A 3MFYA 3F2UA 1FYCA 5IGFA 1II3A 2A69D 5CR3A 1SE3A 4WORA 4RCOA 2NB0A 2PQEA 3E5SA 3VR3A 5EBCA 3BS1A 1D2BA 4XDXA 5IOCA 1QOHA 3N52A 1SNMA 1GUOA 3A7AB 1I4GA 1JWUD 1DJRD 1BO0A 4X3KA 2JP1A 3NHHA 2WV6D 4B9WA 1TS3A 4FXDA 2WACA 2EYHA 1Z6HA 3SDZA 3PIP3 1ML0D 5ELEA 2AQ3B 3K57A 1EWHA 2WAQB 1F2YA 1RKNA 2CHBD 2F0WA 1C48A 2MHVA 4DXFA 1ZYRD 5BN4A 5CBAE 1JOKA 1ONLA 1QE6A 4IFDJ 4BS9A 3X3MA 1H9SB 5FLXL 1PZJD 4KJNA 3S9WA 4DA2A 5FK9C 1QJOA 3A56A 1D5MC 1STBA 1V1PB 2IPKD 1I4HA 1NUCA 2XRQD 3NUCA 5I2YA 1EY9A 4LK1C 4H44C 3MEHA 2AWNA 1PYWD 3PUYA 3T53B 2WINB 2MUYA 1U4RA 4A3KB 3Q0AA 2B2TC 1WTVA 1H9RA 4RAUC 5KYLA 3NWSA 5C3EB 3FMCA 4G4KA 4IQZA 4XIGS 3OW7A 4TSSA 4B9XA 3KUPA 4KD4A 1S5BD 1MGSA 5I6YA 1Q8IA 1NAPA 4DAVA 1YNND 5K36G 3PUZA 2SOBA 1JWSD 3RZOB 4C3JG 1LT3D 1EZ6A 3AMUA 3NQIA 4K8JA 4DF7A 3MXNA 5C4XB 1MI2A 3K0YA 4C3IB 3CRLC 4C1NK 2A69C 3P1HA 3DM1A 5J1ZA 4NMZA 1RD9D 1LV9A 1TY0A 1GUTA 1RHPA 2F0KA 1SE4A 1VF5C 4FF2A 5CBEE 1SNCA 4BA1I 4IUUA 4RFBA 4S3SA 1DOMA 1R4QB 2CW0D 3W3AA 1G2SA 3GTMB 1I6HB 4QMGA 2KCNA 5T1GA 3WOFA 2R6GA 1Q90A 1SNOA 4CJ1B 1AZPA 4IFDH 2LS01 1LTTD 1F77A 1RODA 1E2ZA 1I3QB 1ZYRC 2FFKB 3LWEA 1TS4A 4HEDA 3VYUA 5I9PA 3H09A 3VA5A 1E2WA 2M9VA 3R2TA 1EWCA 2LFNA 2ENBA 2NN6G 5D65A 3HOXB 2NTSA 1CQFA 2K33A 2G9DA 1EY8A 3R3OA 3GV6A 1A2TA 3QO2A 4ABNA 1TWHB 3NSWA 1Y1VB 1LTRD 3H0GB 4KY6A 3PV0A 1X3PA 3T4AC 3IL8A 1SYBA 2XIWA 3TMEA 1KDBA 1GUWA 3C3LA 1JCKB 1ESFA 2XN9C 4R9WA 5EKLA 3ND8A 5ELBA 3GP7A 3GV3A 2ICEC 4TKOB 5DM73 1ILQA 1XXGA 3TP7A 2B2VC 4RKBA 3A8KE 2NVQB 3DEPA 3UI2A 3EVQA 5KEEA 3BVZA 2NZ1D 5COYA 2J4XA 4I65A 3FEWX 1A3UA 3ONAB 2WKDA 2L12A 2JYOA 5EKKA 1I4RA 1YNJD 1YNNC 1JOQA 2NN6H 5FLXE 2M00A 3DXJC 4DNTB 1JE4A 1SXTA 1S5DD 2FHTA 2AQ1B 3C1FA 2IL8A 3KK7A 3K7AB 4OIJA 1EU3A 1PFBA 2EJMA 3OIPA 4H7BA 2IW3A 5DNFA 1O7ZA 2F0PA 5IT9L 2R92B 1Y8PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A3T A;  2F0U A;  4PMB A;  3HEJ A;  1SYB A;  2F0J A;  2EYO A;  3TME A;  3TP5 A;  1SYE A;  4KV6 A;  1JOK A;  5CV7 A;  4TRD A;  5KGU A;  4K8J A;  1KDB A;  1SNQ A;  4DF7 A;  5C3X A;  1KAA A;  3SK8 A;  1U9R A;  2F0T A;  3D4D A;  4E6I A;  5ISR A;  2EYP A;  4WRD A;  5CV9 A;  3SHL A;  1A2U A;  1SYC A;  5CV6 A;  5IOD A;  5IGB A;  1AEX A;  3MXP A;  5C5L A;  4F7X A;  3SK4 A;  2KQ3 A;  4KJN A;  5EKL A;  3P1H A;  4F8M A;  2PYK A;  4ZQ3 A;  5IGE A;  3S9W A;  5JOB A;  4K5V A;  5J1Z A;  2QDB A;  4RKL A;  5KIX A;  2F3V A;  4K14 A;  4NMZ A;  5KRU A;  2EY5 A;  1EZ8 A;  4QB4 A;  3PMF A;  5DAU A;  1TT2 A;  1EY4 A;  2F0L A;  4K5X A;  2OF1 A;  5F2D A;  2EY2 A;  5C3W A;  1STB A;  1KAB A;  2F0F A;  2F0K A;  2RKS A;  4DU9 A;  1EQV A;  4R8N A;  1NUC A;  1STH A;  3ERQ A;  4MIU A;  5DEH A;  4J1M A;  4OL7 A;  3NUC A;  3MZ5 A;  1ENC A;  2O4X A;  3SK5 A;  1EY9 A;  3NP8 A;  4RKB A;  3TP7 A;  5CV5 A;  3QOJ A;  1EYA A;  5M9O A;  4NKL A;  3C1E A;  1SNC A;  4S3S A;  5J39 A;  4PNY A;  2F0V A;  4ID6 A;  4K6D A;  2EY6 A;  3EVQ A;  5KEE A;  3SXH A;  5C4Z A;  4QMG A;  3MEH A;  2F0Q A;  2EYJ A;  3H6M A;  1STN A;  3EJI A;  2F0S A;  5C5M A;  1STG A;  2F0O A;  3D4W A;  3OMG A;  4KY5 A;  4HMI A;  4ME5 A;  3QB3 A;  3OWF A;  4N9T A;  1NSN S;  4IAL A;  5E1F A;  4I65 A;  5IGG A;  5J22 A;  4LAA A;  1A3U A;  4EQO A;  2KHS A;  2RDF A;  3SK6 A;  1EY6 A;  1SNP A;  4K5W A;  5IGF A;  1KDC A;  2SNM A;  2F0M A;  2EY1 A;  3NK9 A;  2RBM A;  1II3 A;  1SNO A;  5EKK A;  1STA A;  5CR3 A;  4ZUI A;  2PZT A;  2F0G A;  2PZW A;  5CV4 A;  5KYL A;  4KHV A;  4WOR A;  4YIJ A;  5C4H A;  4EQN A;  1STY A;  2PQE A;  3E5S A;  5K5P A;  4DGZ A;  3NXW A;  3OMC A;  3TP8 A;  5I6W A;  1EYC A;  4K2K A;  4ODG A;  1TR5 A;  2EXZ A;  2OXP A;  2SNS A;  1SYF A;  2PZU A;  3MVV A;  4QF4 A;  5IIF A;  1JOQ A;  4KY7 A;  5CV8 A;  4HTH A;  3RUZ A;  3DHQ A;  1SNM A;  3T16 A;  5IOC A;  4ZUJ A;  4PMC A;  4K2L A;  4KD3 A;  2M00 A;  3ERO A;  4J6H A;  3HZX A;  3BDL A;  1EY5 A;  2HQE A;  3NQT A;  4KTA A;  4B9X A;  5I9P A;  2OEO A;  4IZ8 A;  3VA5 A;  5CC4 A;  1JOO A;  3TP6 A;  4EQP A;  3QOL A;  2F0H A;  3NHH A;  4B9W A;  1TQO A;  2ENB A;  4KD4 A;  2EYM A;  4HMJ A;  5C6A A;  2F0N A;  2F0D A;  3C1F A;  1SYG A;  5KYI A;  1SND A;  2EYL A;  2WAC A;  4IUN A;  3SR1 A;  4NDX A;  5I6Y A;  5JAV A;  2EYF A;  2EYH A;  3LX0 A;  3P75 A;  5IGC A;  3D8G A;  5HGT A;  1EY7 A;  1EY8 A;  3R3O A;  4H7B A;  3U9O A;  1IHZ A;  4EVO A;  2PW5 A;  3BDC A;  1A2T A;  3ITP A;  3V2T A;  5HUR A;  3MHB A;  2F0P A;  5CGK A;  5I9O A;  1A3V A;  3D6C A;  2LKV A;  1SYD A;  3DMU A;  5NUC A;  2F0E A;  1F2Z A;  1F2Y A;  1RKN A;  2F3W A;  2NUC A;  2F0I A;  2SOB A;  4G57 A;  5E3F A;  3T13 A;  1EY0 A;  4N9P A;  2F0W A;  5EGT A;  1JOR A;  1F2M A;  4KY6 A;  5IGD A;  1EYD A;  4K8I A;  4KJO A;  4DFA A;  3OSO A;  4NP5 A;  1EZ6 A;  1ENA A;  2PW7 A;  1KDA A; 
#chains in the Genus database with same CATH topology
 1SEB D;  1PYB A;  4HIO A;  1Q3L A;  3RZD B;  4RHR A;  3S1R H;  3V96 A;  1STE A;  3SHL A;  5IOD A;  1PH5 A;  1IBK Q;  3KJO A;  3AFP A;  4B3R Q;  1OTC A;  4JOI A;  1V9P A;  3OPO A;  4LF6 L;  1BCP B;  1WCM G;  4K14 A;  4A3F B;  2EZV A;  2B2V A;  1HZA A;  3MXG A;  3UE1 A;  1MHW C;  1JT8 A;  5JJZ A;  1E1O A;  4IJL A;  1HXY D;  2F0L A;  4K5X A;  3MAQ A;  1KAB A;  4L5T A;  2EOT A;  2VXW A;  4R8N A;  1AZQ A;  2XWB B;  4J1M A;  3E0J A;  4OL7 A;  1CHQ D;  1ENC A;  1Z7T A;  2WAQ G;  2L55 A;  1A0I A;  1NBW A;  5I4D A;  1B2T A;  2EYJ A;  5C5M A;  1NCV A;  4JBW A;  2FIN B;  2Q2I A;  4DUY Q;  2Q8R E;  2EPB A;  2J7Z A;  2JA5 B;  4DV2 L;  3LGJ A;  1JJC B;  1IL2 A;  1XTC D;  4AYB B;  4YWM A;  3KJP A;  4BXX G;  4HJ9 A;  4GOP B;  3L7Z C;  4KHV A;  2JA7 B;  3FKI B;  1LTS D;  1N34 L;  3NXW A;  2OXP A;  3Q22 A;  1ASZ A;  3MA2 B;  4Z9C B;  5IIF A;  1EYG A;  5FO7 B;  4QUF A;  4WFN 3;  3DHQ A;  1KD1 C;  3T16 A;  2KA7 A;  1RL2 A;  2JA6 B;  2HHH L;  2VW9 A;  5ELC A;  4I7A A;  1VQM A;  2PCF B;  4JK1 C;  1HJP A;  3M9B A;  3KLS X;  1BOS A;  1YVC A;  3PO2 H;  2RF4 A;  1SND A;  2ZJR A;  2Z4H A;  4KKT A;  3J80 c;  4G7O C;  4RHS A;  1IHZ A;  1PDQ A;  2HCC A;  1HNZ L;  4A3K G;  5I9O A;  2YU9 B;  4AIM A;  1C0A A;  3FPP A;  2JXM B;  2F0E A;  1F2Z A;  2JSO A;  4X66 Q;  1YHA A;  1VQI A;  3T13 A;  2WAQ E;  3KF6 A;  2BA1 A;  1B4O A;  1JOR A;  4ZK9 B;  1EYD A;  4KJO A;  2DJF C;  2MO0 A;  4XXE A;  3S15 H;  1XJV A;  1ENA A;  2B2W C;  2K5V A;  5DLQ E;  2F0J A;  1CKO A;  3VDY A;  2JA8 G;  2NYZ D;  1LTG D;  2K5H A;  3STB C;  3HS0 C;  4GKK L;  4LF9 Q;  4DV1 L;  4J8Q A;  3CXC A;  1WCM H;  1SE8 A;  4NB3 A;  1A62 A;  1XTD A;  4JBK A;  1C4Q A;  2N88 A;  1HCZ A;  2JN4 A;  4A3G B;  2WFW A;  1BCP C;  2EXD A;  2AUJ D;  1ET9 A;  1TXY A;  3P7J A;  5KIX A;  1FJG L;  1VQK A;  1F9Q A;  2F3V A;  1EZ8 A;  1JWM D;  2QEX A;  4RH6 A;  5TSS A;  5AJ3 Q;  5F2D A;  4HCE A;  2F0F A;  2B2U C;  3A74 A;  4GLA C;  3VYT A;  3PIO 3;  4Q5V A;  3NTI A;  4UP7 A;  1W6J A;  4JI6 L;  2NTT A;  1VQC A;  3H3V I;  1N32 Q;  2RHQ B;  4BXX H;  3IAY A;  4MZ9 A;  3EQL C;  4KY5 A;  3QR8 A;  4R4C A;  1K0S A;  3AQQ A;  4O1N A;  5HY6 A;  4L5Q A;  4LF5 Q;  1X3G A;  4GOP C;  4X65 L;  4C3I G;  5COR A;  2F0M A;  2EY1 A;  4QY7 A;  2KVM A;  4EQN A;  5K5P A;  1JC7 A;  3I72 A;  4QIW B;  1ZEQ X;  3MEF A;  1VQP A;  1PYS B;  3D31 A;  3S1M B;  1NJI C;  5EPL A;  1BCP F;  2E5L L;  3I3C A;  4DXG A;  4GN5 A;  4JYA L;  1EQT A;  2VS1 A;  2KEN A;  1HA5 A;  2K05 A;  1EY5 A;  5T1I A;  2OCE A;  4QCL A;  1DXM A;  2ZT9 C;  1TQO A;  3PO2 B;  5C6A A;  4JI2 Q;  2DY8 A;  2F0D A;  1Y14 B;  5KYI A;  4A3K H;  4DR2 Q;  4A93 G;  4IUN A;  1PFS A;  2UXB L;  4DR1 Q;  4IUP A;  3WDN A;  2EIF A;  5M5Y B;  3K58 A;  4G7H C;  5FLM G;  3OTO L;  4LWC A;  4MTN A;  1R4P B;  4NXN Q;  3ITP A;  4QUC A;  3UDG A;  2JK8 A;  1PH3 A;  2I0Q A;  2DY7 A;  1SAP A;  2K52 A;  3D6C A;  4DV3 Q;  2F4V L;  3TQY A;  2JA8 H;  4N9P A;  3S15 B;  4GNX B;  2KEE A;  4BY7 G;  4UAI A;  3GD7 A;  1XNR Q;  4L8J A;  3AU7 A;  1TY2 A;  2A5H A;  1WCM B;  1JJG A;  1HUM A;  3SK8 A;  2MJ8 A;  3ND9 A;  3CF5 A;  2MP1 A;  5CV9 A;  2NWG A;  3K5M A;  1L0W A;  4PMW A;  1V1O A;  5FO8 B;  1IXR A;  1KLG D;  2B2U A;  2PYK A;  1VQ4 A;  3G6E A;  2HDM A;  1YHQ A;  4GZY C;  2XWJ B;  3RZO H;  2ICI A;  2RKS A;  2XSC A;  3S2D H;  1D5Z C;  1EQV A;  4MIU A;  4B3S Q;  4DK6 C;  4B3T L;  1HNX L;  1CSQ A;  1IYJ B;  1ESR A;  3T1Y L;  5M9O A;  1XNQ Q;  1Y1V G;  3NTK A;  4XTC S;  5C4X H;  3EBE A;  2EY6 A;  4C3I H;  1AE3 A;  2UUC Q;  2SDF A;  1SJH D;  2UUA Q;  3HRZ C;  2XVS A;  1PTO B;  1JB3 A;  3T1H Q;  3A0J A;  4P72 A;  2KED A;  3JAM c;  1E1T A;  5D14 A;  4F7X A;  2ID0 A;  3MFG A;  1UE5 A;  1NMF A;  4X64 L;  3G71 A;  4DNR B;  3M4O H;  3MVV A;  2PZU A;  4QF4 A;  1NR4 A;  1L2F A;  3CPF A;  3SEB A;  2PI2 A;  4CJ2 C;  1LTB D;  1E24 A;  1VQ9 A;  4KD3 A;  3KBX A;  1T5X D;  4A93 H;  2JEA I;  3HZX A;  4I7Z C;  1I6H H;  2I5M X;  3PIP A;  4DK0 A;  4IPG A;  4CDE C;  5FLM H;  1QVC A;  3M7G A;  2LXJ A;  1VDZ A;  3TRE A;  2EYF A;  5JAV A;  3KDF B;  2Q2H A;  3DEO A;  2IHF A;  3FDT A;  4JI8 L;  1I3Q H;  1EWI A;  2JA8 B;  2KOL A;  2TMP A;  4GNX C;  4IOC A;  1K28 A;  2D5D A;  4LFA Q;  2JEB I;  2UXD L;  2M2L A;  3KBG A;  4FXK C;  5IGD A;  4A3I B;  1AFP A;  5LMU Q;  4LFC Q;  1W3S A;  4NP5 A;  1XX8 A;  5C0X J;  2K5W A;  3CCM A;  4ODG A;  3F1Z A;  2Q2U A;  1G2T A;  4EQ5 A;  2MPM A;  4FF1 A;  3DWP A;  4JI3 L;  2R61 A;  2Z6K C;  1U9R A;  1HTP A;  1QWY A;  1E3P A;  4G7Z C;  2QA4 A;  4FF4 A;  1SYC A;  3TS0 A;  1WTR A;  3ERS X;  5J3B A;  1ET6 A;  2BE5 D;  2H5X A;  2KQ3 A;  5IGE A;  3EFX D;  3NBH A;  1GJX A;  1TWH H;  1OXX K;  4WJ4 A;  1E0B A;  2GA4 B;  2XRS D;  1Y1V H;  4KLK A;  5GQO A;  3RN5 A;  1TT2 A;  3H0G H;  3S2D B;  3I91 A;  5C4J H;  2E2D C;  2WB1 G;  5C3W A;  4LF8 L;  4LFB L;  1NMG A;  4LW1 A;  5M5X H;  4A3B G;  4K0K L;  2VQE L;  4UP8 A;  3NP8 A;  3G7L A;  1IL8 A;  1U4M A;  2R7D A;  4NW2 A;  1U0L A;  2ZXR A;  4PNY A;  4IUQ A;  2ATW A;  4GKJ L;  1PLF A;  4IFD I;  1CZG A;  1STN A;  1O7L A;  1XMQ L;  4LF7 L;  3OMG A;  1Q86 C;  1VQG A;  2ZJP A;  2OT2 A;  3ULJ A;  5M3F G;  1YJN A;  1F9R A;  1TS2 A;  1CA6 A;  2B2Y C;  2VB3 X;  1QZH A;  2IY5 B;  2QKI C;  4YIJ A;  3M4O B;  1G8Z D;  1K0R A;  4PZ6 A;  1EYC A;  5C0X G;  1OXU A;  4KHP L;  1EU4 A;  4DV6 Q;  4A3F G;  5LMN Q;  3H91 A;  1TVX A;  3BVM A;  3RUZ A;  4OX9 L;  4LUO A;  4A93 B;  3E9H A;  2JE6 I;  2XTI A;  2B2T A;  3S24 A;  1I4Q A;  1IBL L;  1LAC A;  2DJG C;  3CP0 A;  1IKM A;  4UPA A;  4CKB A;  5CC4 A;  4EQP A;  1P16 A;  4GLV B;  4R4I A;  3IRB A;  1E22 A;  2VZA A;  1EFI D;  5DM6 3;  3MC0 B;  5JJK A;  2EDG A;  5KNB A;  1T5E A;  4BY7 B;  3X3N A;  3BDC A;  4Q0F A;  2WB1 E;  4U67 3;  4NXM L;  3I7F A;  3MTS A;  1HQR D;  4AYB G;  4ZLT F;  4JI1 Q;  1LM0 A;  1LLR D;  1RJT A;  3JAM i;  5EGT A;  4X3S A;  2JA7 G;  2WII B;  1KDA A;  1D6E C;  3OWE B;  2O5J C;  2IHE A;  1VQN A;  3BVG A;  1I94 Q;  1SYE A;  3J7A F;  4EGV A;  1CTM A;  5KGU A;  1CA5 A;  4L5R C;  5K36 H;  2K1B A;  2F0T A;  3D4D A;  1F9P A;  1O78 A;  3BDO A;  1PRT B;  5BN3 A;  1WTX A;  4POG A;  3K7A H;  4B3M Q;  3E6Z X;  3L3O C;  2A73 B;  4LMQ D;  3Q24 A;  1MKH A;  3NWT A;  4F8M A;  4DR6 L;  2JA9 A;  1VQ6 A;  1Z47 A;  1XYI A;  1DOK A;  2C5C A;  5C4J B;  5LMN W;  3BZD B;  4DKA C;  1HH2 P;  2EY2 A;  1BR9 A;  1H9S A;  2A68 D;  4DU9 A;  1CSP A;  5M5X B;  1B1Z A;  4B08 A;  5D3I B;  1UEA B;  4JW0 A;  2K32 A;  4XT1 B;  4BWG B;  2N55 A;  3IFT A;  3HOU G;  1VMP A;  3MWY W;  1XPU A;  3RZD H;  2R7Z B;  1IBK L;  1A15 A;  1RTN A;  4HJ7 A;  1EIG A;  5M3F H;  4B3R L;  2A6E D;  3EJI A;  3I4L A;  4XQJ A;  4MNO A;  1HHV A;  2H4O A;  1Y1W B;  5C0X H;  1CQV A;  2YTX A;  4LUV A;  1K8A C;  2NN6 I;  4A3F H;  3KLS A;  3CCQ A;  1NTG A;  1STA A;  5I2X A;  2Q8I B;  1SMY D;  3K6O A;  4AYB E;  4A3G G;  4BY1 B;  3VYS A;  5EKI A;  2SNS A;  3RLO A;  4KY7 A;  2PNR C;  4CJ0 B;  2IX3 A;  4PMC A;  3ICE A;  3PCO B;  2HCI A;  2YV5 A;  3URY A;  4DUY L;  1XWE A;  4OO1 G;  1B8A A;  1AW7 A;  3F2B A;  3J7Y W;  1BCP D;  3I70 A;  3KLR A;  3UDF A;  3I73 A;  2BE5 C;  4GS3 A;  3F2D A;  4DR5 Q;  4CDF C;  1HTL D;  3R2I A;  4M8A A;  2JA7 H;  4HIM A;  2N78 A;  4EVO A;  4O2D A;  5KNC A;  4QL5 A;  2I07 B;  4FYD A;  1Q46 A;  3GTQ H;  2VQF Q;  2LKV A;  4DV7 Q;  2ZTE A;  2YTV A;  4P75 A;  3JAM L;  4C3H B;  1VQA A;  1GO3 E;  1PH9 A;  1IYV A;  3HEJ A;  3I55 A;  1B7Y B;  1Q8K A;  2F4I A;  4KK7 A;  2E74 C;  4XYO A;  1CZW A;  5IE8 A;  3QJY A;  5ELF A;  3CC4 A;  2WB1 B;  4KHZ A;  5CMD A;  3VYR A;  1TWA B;  1S40 A;  4A3B B;  4X66 L;  3CU7 A;  1F2L A;  3VR5 A;  4K5V A;  2YU9 H;  4CKC A;  1WTP A;  3HOU H;  3N6R A;  1G51 A;  3PMF A;  2NZH A;  5A35 A;  4C2M B;  2NBF A;  3CQZ B;  2CQA A;  2WKC A;  3M4P A;  4C56 C;  1VQD A;  4LF9 L;  3S1Q H;  4RG1 A;  3O13 A;  3OYY A;  3B6Y A;  2EJF C;  5M3F B;  2B8G A;  1M90 C;  1FGU A;  2CWP A;  2F0V A;  2F0Q A;  1STG A;  2F0O A;  3TZU A;  5FLX c;  5M3M B;  4L5S A;  4A3G H;  4N9T A;  2B63 G;  1MD2 D;  3PUX A;  5AJ3 L;  1FD7 D;  2Z0S A;  3W1G A;  4M1U B;  2X6L A;  3HOY G;  1S5F D;  4X3U A;  1K83 B;  5CV4 A;  1UEB A;  3UDI A;  3S2H H;  4OO1 H;  2CH4 W;  4C1N I;  1TS5 A;  3GDE A;  4HN7 A;  1Q81 C;  3PGZ A;  4OWW B;  1N32 L;  5ELD A;  2L5T A;  4QIW E;  4PV1 C;  4A3C G;  1F9S A;  2OEO A;  4IZ8 A;  3E0E A;  4LF5 L;  3F8T A;  3CW2 C;  1I4X A;  4CDC C;  1LT6 D;  1IZ6 A;  1NR2 A;  2MNA A;  2L0C A;  1H9K A;  1CKN B;  3SR1 A;  4NDX A;  1LYL A;  1QVG A;  1HFG A;  4IPH A;  1S72 A;  1C7Y A;  3GTL H;  3GTQ B;  4FDB A;  4CBV A;  3MHB A;  2A68 C;  3HP3 A;  3S1M H;  2BA0 A;  2NUC A;  4JI7 Q;  1F2M A;  1ILP A;  4AQY Q;  2UU9 Q;  3DWQ A;  3OSO A;  4ZYS A;  2PW7 A;  4ILW A;  4JI2 L;  4KI0 A;  1A3T A;  4PMB A;  4DR2 L;  5G3L D;  3CAM A;  4DR1 L;  3U50 C;  2A6E C;  2NVY B;  2KCC A;  1X3E A;  3CC2 A;  4E6I A;  1VCI A;  2EYP A;  4NXN L;  4A3L G;  5M5Y H;  4DV3 L;  3CCS A;  2RSO A;  1LTL A;  1S5E D;  3HOU B;  1XPO A;  1SMY C;  1HUN A;  3V05 A;  1FNV A;  2VNU D;  2VUM B;  4KKU A;  4P74 A;  4WJ3 M;  3D6W A;  4A3E B;  1XNR L;  3S1Q B;  2Q8T A;  4GLX A;  1STH A;  4XQQ A;  4UDU C;  4DUZ Q;  2RVL A;  3HKZ B;  2DNC A;  3W1B A;  1ZXT A;  3SK5 A;  4YHH Q;  1RDP D;  2K01 A;  3M4Y A;  1Y69 U;  1X55 A;  2IJ0 A;  4HCS A;  4IPC A;  4A3I G;  2R93 G;  4N8F A;  5FO9 B;  5JJI A;  2KHI A;  1FGB D;  3R93 A;  3HOY H;  3BG3 A;  2F0S A;  4BBR B;  1KAW A;  3D4W A;  2R3Z A;  2WP8 J;  3OWF A;  3J81 i;  5IGG A;  4OGQ C;  1WD1 A;  4DAP A;  3F2C A;  3CCV A;  1AE2 A;  4LUZ A;  3NK9 A;  4B3S L;  1QUQ B;  2EE1 A;  3BJU A;  4IN3 A;  4R1J A;  3S2H B;  4A3C H;  3J81 j;  4DV4 Q;  1XNQ L;  1JIC A;  4DGZ A;  3I8Z A;  4K2K A;  3TBI B;  2EXZ A;  2F03 A;  2FXQ A;  1LAB A;  1DCZ A;  4A3D B;  2E2J B;  2UUC L;  2UUA L;  2X69 A;  3SVM A;  2Z9H A;  3T1H L;  1PTO H;  1PH7 A;  1AN8 A;  1QZG A;  1GUN A;  1E7Z A;  4FVM A;  3BU2 A;  1QB5 D;  2F0N A;  5CYU A;  1HFN A;  3RMH A;  3A8J E;  3LX0 A;  3NBH B;  2Z8L A;  3GTL B;  1B3A A;  2E2I B;  3K59 A;  4ZAI A;  1Q1B A;  1YJW A;  3W2D A;  4R8I A;  1PA6 A;  1SYD A;  3I2Z A;  2ZM6 Q;  1BDO A;  2OQ0 A;  4DR4 Q;  1A6X A;  1EIH A;  3MXU A;  3MXN B;  2QEJ C;  2E2H B;  3PUW A;  4IO9 A;  4V19 0;  3DWA A;  4A3L H;  1PTO D;  3R8B A;  2IWH A;  1LO5 D;  2QF7 A;  2QIL A;  4TRD A;  5JVG 3;  1VQ7 A;  3HOV B;  1O80 A;  1KAA A;  3TSS A;  2OTJ A;  5JPM C;  1Q1E A;  4V0B A;  1X3Q A;  1A2U A;  1RIP A;  1I50 H;  2B29 A;  1YJ9 A;  1V43 A;  5C5L A;  2B2W A;  3HOW G;  4LJZ C;  4LFA L;  2CKZ B;  5JOB A;  3C2P A;  4DR7 Q;  4JBJ A;  1J9O A;  4LFC L;  5LMU L;  2K6A A;  5GAH C;  1UE7 A;  3AYH B;  5DAU A;  1Q12 A;  5JEA J;  4LF4 Q;  2K03 A;  4A3I H;  3H3V H;  1YIJ A;  1C8C A;  4F88 A;  1KLU D;  2PQA B;  3OIQ A;  1S4Z A;  2B63 B;  3FP9 A;  2PNH A;  4QJF A;  5ELN A;  3GTP H;  4HJA A;  2ZXP A;  2L9H A;  3HOY B;  1EL0 A;  2PPB C;  1VMC A;  1EUJ A;  1NSN S;  2F1M A;  3JAM E;  3J81 L;  3PQI A;  5BR8 Q;  3A54 A;  4OEM B;  4YCW A;  3LWU A;  1KRS A;  4K5W A;  3NPP A;  3NEN A;  1CI3 M;  1QIL A;  3J80 i;  1KDC A;  4X3T A;  4ZUI A;  3H94 A;  2PZT A;  1VQF A;  2PZW A;  4Y7N H;  4DR3 Q;  3FHW A;  5H1S E;  2RQX A;  1NY4 A;  3K0X A;  3VR2 A;  2E76 C;  4CGY B;  2IT1 A;  2K04 A;  1K8O A;  1TR5 A;  3M4Q A;  1OO9 B;  1LTI D;  1D1K A;  2F3I A;  2O5I C;  2Y0S B;  4FNF A;  2MGS A;  1EIY B;  4GOP A;  3I4O A;  3IFD A;  4J6H A;  1SN8 A;  1W2B A;  3D4R A;  5LL6 X;  5IT9 E;  1RF2 D;  3EA6 A;  5IY0 A;  5FKA C;  5EQ0 A;  2PMZ B;  2R7Z G;  2A6H C;  1OXT A;  4FF3 A;  2DN8 A;  1IBM Q;  1I5F A;  1QNK A;  3M85 A;  2SEB D;  1CM9 A;  2NVX H;  3HFZ B;  4HIK A;  5JEA G;  4DV6 L;  3I4N B;  2OQK A;  5LMN L;  1GKH A;  1UE1 A;  1Y1W G;  1VS0 A;  1G6Z A;  4BBS B;  1PZI D;  1TII D;  5E3F A;  5IYD G;  2HUG A;  4K8I A;  4BY1 G;  4MHE A;  3CKI B;  2L4N A;  2Q2T A;  3HOW H;  3JC6 6;  1J5E Q;  1FNW A;  1I50 B;  2IX1 A;  1SMX A;  5G3L F;  4BY7 H;  4QQB X;  4H0L C;  4JI1 L;  1WVL A;  1FNU A;  3CHB D;  3CCU A;  1J8I A;  1BQQ T;  2QCP X;  3L2P A;  3A5U A;  2R93 B;  1N36 Q;  1I94 L;  2B8F A;  1PMR A;  5BN5 A;  1B9N A;  1DD2 A;  3RN2 A;  3GTP B;  4BA2 I;  1L1O B;  2KEC A;  1SFO H;  4B3M L;  1CFM A;  1M1K C;  1QNU A;  3C1E A;  1IW7 D;  1VQ8 A;  4RGM A;  2RDH A;  4C3H G;  4ID6 A;  2D62 A;  2YYZ A;  4IUV A;  2JQO A;  4IFD G;  1D8L A;  4Y52 H;  1A63 A;  2AWO A;  4FP5 D;  2BCO A;  1QCB D;  4ME5 A;  5J22 A;  3T51 B;  4GN3 B;  1TWF B;  1WTO A;  1H9M A;  4JBM A;  3EIV A;  1HRJ A;  1UAP A;  1WTW A;  1HZ9 A;  2DNE A;  5JPN C;  4Y7N B;  2SNM A;  3J80 L;  1PVO A;  3NE5 B;  3QWN A;  2E75 C;  3ZYY X;  2F52 A;  1VQL A;  4JI0 Q;  1DYQ A;  3J7A V;  2CVR A;  1B53 A;  3OMC A;  4NPS A;  1DON A;  1K73 C;  2J0T D;  2NZO A;  5CV8 A;  1T9H A;  1V8Q A;  2R7Z H;  2E8G A;  1PTO C;  1PRT D;  2FMM A;  5KND A;  4JC0 A;  5JEA H;  3I90 A;  2ALY B;  2F0H A;  1U4P A;  1J6Q A;  2I5L X;  3PSI A;  1WD0 A;  4XT3 B;  1Y1W H;  3RLN A;  1WTQ A;  3FVQ A;  5D3D A;  1QG7 A;  1SYG A;  1I6V C;  2NVX B;  2TSS A;  1U5K A;  1TKW B;  3KFU A;  1BF4 A;  1ICW A;  3P75 A;  2L11 A;  1EEF D;  3FPU B;  1EY7 A;  5HGT A;  3ZJY C;  5IYD H;  5M3M G;  4BY1 H;  4WJW A;  3P20 A;  2GN5 A;  3I56 A;  1BUV T;  3L9A X;  1UNS A;  4H13 C;  5HUR A;  1A3V A;  1TWC H;  2UUB Q;  4F87 A;  2F0I A;  2G9H D;  1EY0 A;  3HOZ B;  4YY3 Q;  1CT1 D;  1B70 B;  2ZTD A;  3BYT B;  5EPJ A;  1GM5 A;  3S17 H;  4IUT A;  3RR5 A;  3HOW B;  1ZKO A;  2EYO A;  2GVB A;  1MBY A;  2KHJ A;  4CKE A;  3AB9 A;  4KN4 C;  1EOV A;  4DR5 L;  3UDX A;  1KNE A;  1EIF A;  3LNN A;  4GNX A;  1KC8 C;  1Q82 C;  3GTG B;  3U4Z A;  4J15 A;  5ISR A;  4WRD A;  4YCV A;  4KKS A;  1PTO F;  2VQF L;  4DV7 L;  1W6K A;  1YIT A;  1MSG A;  4K6L A;  5EPK A;  5E4X A;  4KMU C;  5A2Q L;  1X9N A;  3H3V C;  4A3J G;  1L0Y B;  1SR3 A;  5JJL A;  1UWV A;  4QB4 A;  1WTH A;  2Z6K A;  2KCM A;  1EY4 A;  4C3H H;  1DM0 B;  1HQM C;  3KYH C;  2KUM A;  1SFO B;  5C44 G;  2K50 A;  4IUR A;  5C0X I;  4DAY A;  1E2V A;  5CV5 A;  3QOJ A;  1EYA A;  1OXV A;  3CCJ A;  3TZD A;  4A3M B;  1K8M A;  2G5D A;  2MO1 A;  4K6D A;  2K7V A;  4RGT A;  1BNZ A;  3TN2 A;  1YHB A;  3SXH A;  5C4Z A;  2VB2 X;  4H02 A;  4HID A;  1RCV D;  3A8I E;  5FOB B;  1FVI A;  1TWA H;  4A3B H;  2ZTC A;  1D7Q A;  4EQO A;  3I4M B;  4OON A;  2NVT B;  3FRP B;  1EY6 A;  1SJE D;  1JR0 D;  1SNP A;  1V1Q A;  1ENF A;  2RBM A;  4X62 Q;  4C2M H;  3CQZ H;  2RA4 A;  1WYD A;  4DK3 C;  3C46 A;  1GHJ A;  2VUM G;  3OOC A;  2HT1 A;  4ZUJ A;  2AKW B;  1V1P A;  2K14 A;  4JCV E;  4DV5 Q;  4JG2 A;  4A3E G;  2EVB A;  3D3R A;  1X32 A;  1FR3 A;  4HR7 B;  2B2Y A;  2HQE A;  3GO5 A;  3NQT A;  4KTA A;  4P71 A;  3HKZ G;  1CHP D;  4OXP A;  1Y8O B;  5M3M H;  2EYM A;  2Z1C A;  4YCU A;  1LTA D;  1MJE A;  3K5L A;  3NBI A;  1LT5 D;  1CK1 A;  3WWV A;  1K83 H;  3Q23 A;  3EN2 A;  4BBR G;  3KF6 B;  2B3G A;  2X6G A;  1KNA A;  4OWT B;  3S16 B;  1OXS C;  1TWC B;  3G48 A;  3PF5 A;  1D5X C;  4XYQ A;  3KDF A;  3SE0 A;  4HJ8 A;  2GVA A;  3VA7 A;  3S17 B;  3J81 E;  3U58 A;  4DFA A;  1MSH A;  2K5Q A;  1IW7 C;  4A3D G;  4JOI C;  3K7U C;  3TP5 A;  5CV7 A;  1VF7 A;  1TU2 B;  4RCN A;  2D9U A;  5C3X A;  1O7Y A;  4A3J H;  1BXT A;  1QVF A;  5FJ8 G;  2QDL A;  5IGB A;  4OHJ A;  1AEX A;  3HGB A;  3K5N A;  3Q6S A;  2AQ2 B;  3SK4 A;  4PQX A;  4JI7 L;  4O42 A;  4MN3 A;  1SRU A;  5C44 H;  4AQY L;  2UU9 L;  2QDB A;  1N9W A;  2EY5 A;  2VL6 A;  3WOE A;  4HAE A;  2KCT A;  1B50 A;  1HPC A;  1Y8N B;  1PFM A;  5DEH A;  5GAD C;  2PI2 E;  3K5O A;  4JV5 Q;  1B44 D;  4DK1 A;  2D0O A;  4RMF A;  1PRT C;  3DLL A;  2BDO A;  1UUP A;  4DN4 M;  3HKZ E;  4NKL A;  4FO2 A;  4RGO S;  5EJW A;  2LY7 A;  1KTK A;  2NVY H;  1GUG A;  2HIV A;  1DOL A;  2FMC A;  1HNW Q;  4OO1 I;  4TVA B;  5E1F A;  3HOV G;  4LAA A;  1HZB A;  1SRO A;  2RDF A;  3SK6 A;  2XNA C;  4RWS C;  3TDQ A;  2K5D A;  2VUM H;  3A55 A;  4DUZ L;  5E7N A;  4ALP A;  2F0G A;  4A3E H;  4RGN A;  4YHH L;  4C3J B;  1STY A;  3TP8 A;  1IYU A;  1AP0 A;  4ZCK A;  1SYF A;  3PUV A;  2C9O A;  3M3Y B;  1S5C D;  3U9S A;  2D0P A;  1S3O A;  3KF8 A;  1SLJ A;  4K2L A;  3K81 C;  1H95 A;  1C9O A;  2RCF A;  2ZXO A;  4JI5 Q;  3BDL A;  1R9T B;  4ULL A;  4BBR H;  1EOT A;  5LHY 1;  1X3F A;  1WOC A;  3S1N B;  2LMC B;  2CW0 C;  4HMJ A;  1SE2 A;  4JI4 Q;  4DV4 L;  1YBY A;  1PRT F;  1U4L A;  4POF A;  1PXU A;  3TS2 A;  3GTK B;  1IKL A;  1SDF A;  5IGC A;  5JVH 3;  1BVS A;  5EBD A;  3U9O A;  1GXD C;  4P2C B;  2A74 C;  4DNI A;  2P5Z X;  3V2T A;  1XMO Q;  3NEL A;  3GTO B;  3GQB A;  4A3D H;  2E2J H;  5NUC A;  4G57 A;  3G6J B;  2D2C C;  5L37 A;  3BZK A;  5AFW A;  1KRT A;  3T56 B;  1B9M A;  1GD7 A;  2BH2 A;  1L0X B;  2RSN A;  1PH2 A;  1WI5 A;  2HQL A;  5FJ8 H;  1TWG B;  4L6T B;  1LT4 D;  3J80 E;  2Y0S G;  4RA8 A;  4R4O A;  3VR4 A;  3NTH A;  1PFN A;  2Z4I A;  4A3J B;  4TQU S;  1I4P A;  1JQY D;  1VQE A;  1GHK A;  2K4K A;  3PO3 B;  1H9J A;  1SSO A;  2ZM6 L;  2E2I H;  2PO4 A;  5C44 B;  4DR4 L;  5M5W B;  1K3B C;  4ZQ3 A;  2FJ2 A;  2O2L D;  2H1E A;  3IKJ A;  4RKL A;  5KRU A;  3ER0 A;  2ES2 A;  4DV0 Q;  3I4N G;  1BBX C;  4ZKC B;  2OF1 A;  1VQO A;  2RDG A;  2E2H H;  1N33 Q;  2BOS A;  1PH4 A;  4BBS G;  5E4W C;  1RTO A;  3MZ5 A;  2IX0 A;  2UXC Q;  3HOV H;  3S14 H;  1PHJ A;  1DZ1 A;  2A6H D;  2AUK A;  3A7L A;  1K8G A;  3K80 C;  1M8A A;  1EEI D;  4DR7 L;  4DAM A;  1B3Q A;  3RD4 A;  2KJX A;  5IYB G;  4U68 A;  3QB3 A;  4MTK A;  3TEH B;  1PV4 A;  5IWA Q;  4LF4 L;  2KHS A;  2OWO A;  4CHT B;  3CRK C;  3M7N A;  3GTJ B;  2HD3 A;  5C4H A;  1LUZ A;  3HG9 A;  5I6W A;  3RLF A;  3CD6 A;  2VY3 A;  2AHO B;  2KBN A;  1HR0 Q;  2B63 H;  4XQN A;  1WFQ A;  4HTH A;  1M4V A;  1PZK D;  3QG1 A;  2Y0S E;  3ERO A;  2BDN A;  3OHX C;  5BR8 L;  5A2Q E;  1JOO A;  3TP6 A;  3QOL A;  4L63 B;  5C3E G;  3TRZ A;  3NEM A;  4DR3 L;  3S1R B;  2PMZ E;  2EYL A;  4CDD C;  2K28 A;  3D8G A;  2B39 A;  1P8L A;  1X56 A;  4ZRZ A;  2HDL A;  2PW5 A;  4OEL B;  5CGK A;  3ULP A;  1YNJ C;  3CC7 A;  5LL6 S;  3BYY B;  3DMU A;  4QGU A;  2F3W A;  2A1A A;  3L0O A;  4LF6 Q;  2BH8 A;  3Q8D A;  4HSP A;  2L1B A;  2F0U A;  4KN7 C;  1GUS A;  2I46 A;  1IBM L;  3QIA A;  1SBB B;  4N8X 1;  1NE3 A;  4KV6 A;  1SNQ A;  1G29 1;  5IP7 G;  1G91 A;  5CV6 A;  3I4N H;  1D1I A;  3MXP A;  4IPD A;  4ZKB B;  4BBS H;  4HSV A;  1HR0 W;  1JJ2 A;  5C4X G;  1YNX A;  4IJH A;  4DV2 Q;  3RNU A;  3ERQ A;  2V4D A;  2MFI A;  1J5E L;  2O4X A;  3S14 B;  5IYB H;  4UHV A;  3BZC A;  1N34 Q;  3W5O A;  3VR6 A;  5J39 A;  3HOZ G;  2OTL A;  4OIK A;  4YWL A;  3H6M A;  4AH6 A;  4UY8 C;  2EJG C;  4FXG C;  4HMI A;  1G6P A;  3PIO A;  3DUZ A;  4IAL A;  2HHH Q;  1GOZ A;  1N36 L;  1XPR A;  3MFY A;  1HA6 A;  3F2U A;  1FYC A;  5IGF A;  1II3 A;  2A69 D;  2R93 H;  5CR3 A;  1SE3 A;  4WOR A;  4RCO A;  2NB0 A;  2PQE A;  3E5S A;  3VR3 A;  2R7F A;  5EBC A;  3BS1 A;  1VQB A;  1YEZ A;  1D2B A;  5C3E H;  1PH6 A;  4XDX A;  5IOC A;  1QOH A;  3N52 A;  1SNM A;  1GUO A;  1PH8 A;  1HNZ Q;  4A4I A;  3A7A B;  4HJ5 A;  1I4G A;  1JWU D;  1DJR D;  2QGQ A;  1BO0 A;  1BBW A;  2RHS B;  4EX5 A;  4X3K A;  2JP1 A;  3NHH A;  2WV6 D;  4B9W A;  1TS3 A;  1TWF H;  4A3M G;  4JI0 L;  4FXD A;  2V1C C;  2WAC A;  4R4T A;  2EYH A;  1Z6H A;  3SDZ A;  5GAG C;  1K3R A;  3PIP 3;  4GKK Q;  1ML0 D;  5ELE A;  4DV1 Q;  2AQ3 B;  2Z6B A;  3AEV A;  3K57 A;  3I4M G;  1EWH A;  1CKN A;  2WAQ B;  1F2Y A;  1RKN A;  2CHB D;  3HOX G;  4DAY B;  2F0W A;  1C48 A;  5IP7 H;  2MHV A;  4DXF A;  1ZYR D;  1FJG Q;  2A19 A;  5HGQ A;  3D0F A;  5BN4 A;  5CBA E;  1JOK A;  1ONL A;  2EQS A;  2L15 A;  1QE6 A;  2MQH A;  3U4V A;  4IFD J;  3H0G G;  4PG3 A;  4BS9 A;  3X3M A;  5IYC G;  4JI6 Q;  2UUB L;  1H9S B;  5FLX L;  1PZJ D;  3J7A 5;  4KJN A;  1MJC A;  3S9W A;  3CCR A;  4YY3 L;  4DA2 A;  5FK9 C;  2XGT A;  1CKM A;  1QJO A;  2HIX A;  3A56 A;  3HOZ H;  4IOA A;  1D5M C;  1STB A;  4X65 Q;  1V1P B;  2IPK D;  1I4H A;  1NUC A;  2XRQ D;  3NUC A;  5I2Y A;  1EY9 A;  4LK1 C;  4LNQ A;  3GTG H;  4H44 C;  2E5L Q;  3MEH A;  2AWN A;  4JYA Q;  3GTM H;  3CCE A;  1PYW D;  3PUY A;  2N3S A;  3T53 B;  2WIN B;  2MUY A;  5IT9 c;  1U4R A;  4A3K B;  3E3X A;  3Q0A A;  2B2T C;  1WTV A;  1H9R A;  4RAU C;  5KYL A;  1MIU A;  3NWS A;  2UXB Q;  2CWA A;  3KLW A;  3DM3 A;  3CMA A;  5C3E B;  3FMC A;  2N8N A;  4G4K A;  3OTO Q;  1QUQ A;  4A3M H;  4IQZ A;  4XIG S;  3OW7 A;  1YZ6 A;  4TSS A;  4OWX B;  4B9X A;  2F4V Q;  1KHI A;  1KL9 A;  3KUP A;  5IP9 G;  4KD4 A;  4X62 L;  1S5B D;  2ASB A;  3I4M H;  2NVT H;  5EAY A;  1K9M C;  1MGS A;  5I6Y A;  3HOX H;  1Q7Y C;  5ELO A;  3A5Z B;  4A75 A;  4A76 A;  1A8V A;  1Q8I A;  1NAP A;  4DAV A;  3CPW A;  4DV5 L;  1YNN D;  5K36 G;  3PUZ A;  2CFM A;  2SOB A;  1GVP A;  1JWS D;  4DPG A;  2K75 A;  3RZO B;  4C3J G;  1DGS A;  1LT3 D;  1EZ6 A;  1X54 A;  5IYC H;  3AMU A;  3NQI A;  4ME3 A;  4K8J A;  4DF7 A;  4B3T Q;  3MXN A;  1HNX Q;  1Z9F A;  2R92 G;  5C4X B;  1MI2 A;  3K0Y A;  2DUD A;  4C3I B;  1X6O A;  3T1Y Q;  4P73 A;  3CRL C;  4C1N K;  1UE6 A;  2A69 C;  3S16 H;  3P1H A;  3DM1 A;  5J1Z A;  4NMZ A;  1RD9 D;  2CQO A;  1LV9 A;  1TY0 A;  3H15 A;  1GUT A;  1RHP A;  2F0K A;  3KF8 B;  4UP9 A;  1SE4 A;  1N8R C;  1VF5 C;  4X64 Q;  4FF2 A;  1AH9 A;  5CBE E;  1SNC A;  4IUU A;  4RFB A;  4S3S A;  4BA1 I;  2NVQ H;  1DOM A;  1R4Q B;  2CW0 D;  3G4S A;  3W3A A;  1G2S A;  3GTM B;  1I6H B;  2PQA A;  4QMG A;  2KCN A;  5T1G A;  3WOF A;  2R6G A;  1Q90 A;  2K5N A;  3CME A;  3PO3 G;  4JV5 L;  1SNO A;  1L1O C;  4CJ1 B;  1ASY A;  3UE0 A;  1AZP A;  4IFD H;  2LS0 1;  1LTT D;  1F77 A;  1ROD A;  1E2Z A;  1I3Q B;  1ZYR C;  2FFK B;  5IP9 H;  2JA5 G;  3LWE A;  1CUK A;  1TS4 A;  4JI8 Q;  1KQS A;  1HNW L;  4HED A;  1JE5 A;  3VYU A;  5I9P A;  3H09 A;  3VA5 A;  1E2W A;  2M9V A;  3FKI G;  3R2T A;  1EWC A;  2UXD Q;  2LFN A;  5GRO A;  2ENB A;  2DGY A;  2NN6 G;  5D65 A;  1YI2 A;  1VQJ A;  2CH4 A;  3HOX B;  2NTS A;  1CQF A;  2K33 A;  2G9D A;  2JA6 G;  1BBU A;  4JI3 Q;  1EY8 A;  3R3O A;  4C3J H;  3GV6 A;  1VQH A;  1A2T A;  3QO2 A;  1KIX A;  2A8V A;  4JI5 L;  4ABN A;  3M3Y H;  1JMC A;  1TWH B;  3NSW A;  3ULL A;  1Y1V B;  1LTR D;  3H0G B;  1O7I A;  4KY6 A;  2R92 H;  1EQQ A;  2I5H A;  3PV0 A;  1X3P A;  1R9T H;  1EQR A;  3IL8 A;  3T4A C;  4JI4 L;  1SYB A;  2XIW A;  4APV A;  3TME A;  4LF8 Q;  3KOJ A;  4LFB Q;  3S1N H;  1KDB A;  1GUW A;  3C3L A;  4K0K Q;  1FL0 A;  2VQE Q;  3E9I A;  1VQ5 A;  1JCK B;  3AFQ A;  3GTK H;  1ESF A;  1X65 A;  1XMO L;  2XN9 C;  4R9W A;  5EKL A;  4GKJ Q;  3ND8 A;  3GTO H;  3K8A A;  5ELB A;  1XMQ Q;  4LF7 Q;  2C35 B;  3GP7 A;  2YTY A;  3GV3 A;  2ICE C;  1JB7 A;  4TKO B;  4PZ8 A;  5DM7 3;  1TWG H;  1ILQ A;  1XXG A;  3TP7 A;  2B2V C;  4RKB A;  3A8K E;  2NVQ B;  3DEP A;  2JJQ A;  3UI2 A;  4KHP Q;  3EVQ A;  4R4Q A;  5KEE A;  3BVZ A;  5GAE C;  2ZJQ A;  3PO3 H;  4OX9 Q;  2NZ1 D;  3STB D;  1L1O A;  5COY A;  2J4X A;  4I65 A;  3J7Z C;  3FEW X;  5M5W H;  1A3U A;  4DV0 L;  1IBL Q;  1EFW A;  3ONA B;  2WKD A;  2L12 A;  4JVZ A;  4YWK A;  2JYO A;  1BKB A;  1N33 L;  2JA5 H;  5EKK A;  1I4R A;  1YNJ D;  4JPB W;  1YNN C;  2UXC L;  2AMC B;  3FKI H;  3PF4 A;  1PH1 A;  1NNX A;  1JOQ A;  4GN4 B;  2N49 A;  2NN6 H;  5FLX E;  2M00 A;  3CCL A;  4NXM Q;  3DXJ C;  4PZ7 A;  5IWA L;  2LSS A;  4DNT B;  2CCZ A;  1JE4 A;  2JA6 H;  1SXT A;  1S5D D;  3J81 c;  1HZC A;  2FHT A;  2AQ1 B;  2LXK A;  3C1F A;  2RCN A;  2IL8 A;  3KK7 A;  3K7A B;  4OIJ A;  3GTJ H;  3OW2 A;  1HR0 L;  1EU3 A;  1PFB A;  2EJM A;  3OIP A;  4H7B A;  2IW3 A;  5DNF A;  3PO2 G;  1O7Z A;  2F0P A;  1KXL A;  3HKS A;  5IT9 L;  2R92 B;  2QW7 A;  4DR6 Q;  4X6A H;  3SGI A;  1ICF B;  4O0A A;  1WJJ A;  1Y8P B; 
#chains in the Genus database with same CATH homology
 1SEB D;  1Q3L A;  3RZD B;  4RHR A;  3V96 A;  1STE A;  3SHL A;  5IOD A;  3OPO A;  1BCP B;  4K14 A;  4A3F B;  2EZV A;  2B2V A;  3MXG A;  5JJZ A;  1HXY D;  2F0L A;  4K5X A;  3MAQ A;  1KAB A;  2EOT A;  2VXW A;  4R8N A;  1AZQ A;  2XWB B;  4J1M A;  3E0J A;  4OL7 A;  1CHQ D;  1ENC A;  1Z7T A;  2L55 A;  5I4D A;  1B2T A;  2EYJ A;  5C5M A;  1NCV A;  4JBW A;  2FIN B;  2Q8R E;  2EPB A;  2J7Z A;  2JA5 B;  1XTC D;  4AYB B;  3L7Z C;  4KHV A;  2JA7 B;  3FKI B;  1LTS D;  3NXW A;  2OXP A;  3Q22 A;  3MA2 B;  4Z9C B;  5IIF A;  5FO7 B;  4QUF A;  4WFN 3;  3DHQ A;  3T16 A;  2KA7 A;  2JA6 B;  5ELC A;  2PCF B;  4JK1 C;  3KLS X;  1BOS A;  1SND A;  2Z4H A;  4KKT A;  4G7O C;  4RHS A;  1IHZ A;  1PDQ A;  2HCC A;  5I9O A;  2YU9 B;  3FPP A;  2JXM B;  2F0E A;  1F2Z A;  2JSO A;  3T13 A;  1JOR A;  2BA1 A;  1B4O A;  4ZK9 B;  1EYD A;  4KJO A;  4XXE A;  1ENA A;  2B2W C;  2F0J A;  1LTG D;  2NYZ D;  3HS0 C;  4J8Q A;  1C4Q A;  2N88 A;  1HCZ A;  4A3G B;  1BCP C;  2AUJ D;  1ET9 A;  3P7J A;  5KIX A;  1F9Q A;  2F3V A;  1EZ8 A;  1JWM D;  4RH6 A;  5TSS A;  5F2D A;  4HCE A;  2F0F A;  2B2U C;  3VYT A;  3PIO 3;  4Q5V A;  3NTI A;  1W6J A;  2NTT A;  3IAY A;  3EQL C;  4KY5 A;  4O1N A;  4C3I G;  5COR A;  2F0M A;  2EY1 A;  2KVM A;  4EQN A;  5K5P A;  1JC7 A;  3I72 A;  4QIW B;  1ZEQ X;  3D31 A;  3S1M B;  5EPL A;  1BCP F;  3I3C A;  4DXG A;  1EQT A;  1HA5 A;  2K05 A;  1EY5 A;  5T1I A;  4QCL A;  1DXM A;  2ZT9 C;  1TQO A;  3PO2 B;  5C6A A;  2DY8 A;  2F0D A;  5KYI A;  4IUN A;  4IUP A;  3WDN A;  5M5Y B;  3K58 A;  4G7H C;  1R4P B;  3ITP A;  4QUC A;  2DY7 A;  1SAP A;  3D6C A;  4N9P A;  3S15 B;  2KEE A;  4UAI A;  3GD7 A;  4L8J A;  3AU7 A;  1TY2 A;  2A5H A;  1WCM B;  1HUM A;  3SK8 A;  2MJ8 A;  3ND9 A;  2MP1 A;  5CV9 A;  2NWG A;  3K5M A;  4PMW A;  1V1O A;  5FO8 B;  1KLG D;  2B2U A;  2PYK A;  2HDM A;  4GZY C;  2XWJ B;  2ICI A;  2RKS A;  2XSC A;  1D5Z C;  1EQV A;  4MIU A;  1ESR A;  5M9O A;  3NTK A;  4XTC S;  2EY6 A;  2SDF A;  1SJH D;  3HRZ C;  2XVS A;  1PTO B;  1JB3 A;  2KED A;  5D14 A;  4F7X A;  2ID0 A;  3MFG A;  4DNR B;  3MVV A;  2PZU A;  4QF4 A;  1NR4 A;  3SEB A;  4CJ2 C;  1LTB D;  4KD3 A;  3KBX A;  1T5X D;  2JEA I;  3HZX A;  4I7Z C;  4DK0 A;  3M7G A;  5JAV A;  1VDZ A;  2EYF A;  3DEO A;  3FDT A;  2JA8 B;  2KOL A;  2TMP A;  2D5D A;  2JEB I;  2M2L A;  3KBG A;  4FXK C;  5IGD A;  4A3I B;  1AFP A;  4NP5 A;  1XX8 A;  5C0X J;  2K5W A;  4ODG A;  1G2T A;  2MPM A;  4FF1 A;  3DWP A;  2R61 A;  1U9R A;  1HTP A;  1QWY A;  4G7Z C;  4FF4 A;  1SYC A;  1WTR A;  1ET6 A;  2BE5 D;  2KQ3 A;  5IGE A;  3EFX D;  3NBH A;  1GJX A;  1OXX K;  1E0B A;  2GA4 B;  2XRS D;  1TT2 A;  3S2D B;  3I91 A;  2E2D C;  5C3W A;  3NP8 A;  3G7L A;  1IL8 A;  1U4M A;  4NW2 A;  2ZXR A;  4PNY A;  4IUQ A;  1PLF A;  4IFD I;  1CZG A;  1STN A;  1O7L A;  3OMG A;  2OT2 A;  1F9R A;  1TS2 A;  1CA6 A;  2B2Y C;  2VB3 X;  2QKI C;  4YIJ A;  3M4O B;  1G8Z D;  1EYC A;  5C0X G;  1OXU A;  1EU4 A;  3H91 A;  1TVX A;  3BVM A;  3RUZ A;  4A93 B;  2JE6 I;  2B2T A;  1I4Q A;  1LAC A;  1IKM A;  4CKB A;  5CC4 A;  4EQP A;  1EFI D;  5DM6 3;  3MC0 B;  2EDG A;  5KNB A;  1T5E A;  4BY7 B;  3X3N A;  3BDC A;  4Q0F A;  4U67 3;  3MTS A;  1HQR D;  4ZLT F;  1RJT A;  1LLR D;  5EGT A;  4X3S A;  2WII B;  1KDA A;  1D6E C;  3OWE B;  2O5J C;  3BVG A;  1SYE A;  3J7A F;  4EGV A;  1CTM A;  5KGU A;  1CA5 A;  5K36 H;  2K1B A;  2F0T A;  3D4D A;  1F9P A;  1O78 A;  3BDO A;  1PRT B;  5BN3 A;  1WTX A;  3E6Z X;  3L3O C;  2A73 B;  4LMQ D;  3Q24 A;  4F8M A;  3NWT A;  1Z47 A;  1XYI A;  1DOK A;  2C5C A;  5C4J B;  3BZD B;  2EY2 A;  1BR9 A;  1H9S A;  2A68 D;  4DU9 A;  5M5X B;  1B1Z A;  4B08 A;  5D3I B;  1UEA B;  4XT1 B;  2K32 A;  4BWG B;  2N55 A;  3IFT A;  1VMP A;  3MWY W;  2R7Z B;  1A15 A;  1RTN A;  1EIG A;  2A6E D;  3EJI A;  3I4L A;  4XQJ A;  1HHV A;  2H4O A;  1Y1W B;  5C0X H;  1CQV A;  2NN6 I;  3KLS A;  1STA A;  5I2X A;  2Q8I B;  1SMY D;  3K6O A;  4BY1 B;  3VYS A;  5EKI A;  2SNS A;  4KY7 A;  2PNR C;  4CJ0 B;  2IX3 A;  4PMC A;  2HCI A;  3URY A;  1XWE A;  4OO1 G;  1AW7 A;  3J7Y W;  1BCP D;  3I70 A;  3KLR A;  3I73 A;  2BE5 C;  1HTL D;  3R2I A;  4M8A A;  4EVO A;  5KNC A;  2I07 B;  4FYD A;  2LKV A;  3JAM L;  4C3H B;  1IYV A;  3HEJ A;  2F4I A;  4KK7 A;  2E74 C;  4XYO A;  1CZW A;  3QJY A;  5ELF A;  2WB1 B;  4KHZ A;  5CMD A;  3VYR A;  1TWA B;  4A3B B;  3CU7 A;  1F2L A;  3VR5 A;  4K5V A;  4CKC A;  1WTP A;  3N6R A;  3PMF A;  5A35 A;  4C2M B;  2NBF A;  3CQZ B;  2CQA A;  2WKC A;  4C56 C;  3O13 A;  2EJF C;  5M3F B;  2B8G A;  2F0V A;  2F0Q A;  1STG A;  2F0O A;  3TZU A;  5M3M B;  4N9T A;  1MD2 D;  3PUX A;  1FD7 D;  4M1U B;  2X6L A;  1S5F D;  4X3U A;  1K83 B;  5CV4 A;  4OO1 H;  4C1N I;  1TS5 A;  4HN7 A;  5ELD A;  2L5T A;  4PV1 C;  1F9S A;  2OEO A;  4IZ8 A;  1I4X A;  1LT6 D;  1NR2 A;  2L0C A;  1H9K A;  3SR1 A;  4NDX A;  1HFG A;  3GTQ B;  4CBV A;  3MHB A;  2A68 C;  3HP3 A;  2BA0 A;  2NUC A;  1F2M A;  1ILP A;  3DWQ A;  3OSO A;  4ZYS A;  2PW7 A;  4ILW A;  4KI0 A;  1A3T A;  4PMB A;  5G3L D;  2A6E C;  2NVY B;  2KCC A;  4E6I A;  1VCI A;  2EYP A;  2RSO A;  1S5E D;  3HOU B;  1SMY C;  1HUN A;  3V05 A;  1FNV A;  2VNU D;  2VUM B;  4KKU A;  3D6W A;  4A3E B;  3S1Q B;  2Q8T A;  1STH A;  4XQQ A;  4UDU C;  2RVL A;  3HKZ B;  2DNC A;  1ZXT A;  3SK5 A;  1RDP D;  2K01 A;  3M4Y A;  1Y69 U;  4HCS A;  2IJ0 A;  5FO9 B;  1FGB D;  3R93 A;  3BG3 A;  2F0S A;  4BBR B;  3D4W A;  2R3Z A;  2WP8 J;  3OWF A;  5IGG A;  4OGQ C;  1WD1 A;  4DAP A;  3NK9 A;  2EE1 A;  4IN3 A;  3S2H B;  1JIC A;  4DGZ A;  3I8Z A;  4K2K A;  3TBI B;  2EXZ A;  2F03 A;  1LAB A;  1DCZ A;  4A3D B;  2E2J B;  2X69 A;  3SVM A;  1PTO H;  1AN8 A;  1GUN A;  4FVM A;  1QB5 D;  2F0N A;  5CYU A;  1HFN A;  3RMH A;  3A8J E;  3LX0 A;  2Z8L A;  3GTL B;  1B3A A;  2E2I B;  3K59 A;  4ZAI A;  1Q1B A;  3W2D A;  4R8I A;  1SYD A;  1BDO A;  1A6X A;  1EIH A;  3MXU A;  2QEJ C;  2E2H B;  3PUW A;  4V19 0;  3DWA A;  1PTO D;  3R8B A;  2IWH A;  1LO5 D;  2QF7 A;  2QIL A;  4TRD A;  5JVG 3;  3HOV B;  1O80 A;  1KAA A;  3TSS A;  5JPM C;  1Q1E A;  4V0B A;  1X3Q A;  1A2U A;  1V43 A;  5C5L A;  2B2W A;  4LJZ C;  5JOB A;  3C2P A;  1J9O A;  2K6A A;  5DAU A;  1Q12 A;  5JEA J;  2K03 A;  1C8C A;  4F88 A;  1KLU D;  3OIQ A;  1S4Z A;  2B63 B;  2ZXP A;  2L9H A;  3HOY B;  1EL0 A;  2PPB C;  1VMC A;  1NSN S;  2F1M A;  3JAM E;  3J81 L;  3A54 A;  3LWU A;  4K5W A;  3NPP A;  1CI3 M;  1QIL A;  1KDC A;  4X3T A;  4ZUI A;  3H94 A;  2PZT A;  2PZW A;  2RQX A;  4CGY B;  3VR2 A;  2E76 C;  2IT1 A;  2K04 A;  1K8O A;  1TR5 A;  1OO9 B;  1LTI D;  1D1K A;  2O5I C;  2Y0S B;  4FNF A;  2MGS A;  3IFD A;  4J6H A;  3D4R A;  5LL6 X;  5IT9 E;  1RF2 D;  3EA6 A;  5FKA C;  5EQ0 A;  2PMZ B;  2A6H C;  1OXT A;  4FF3 A;  2DN8 A;  1QNK A;  3M85 A;  2SEB D;  1CM9 A;  5JEA G;  3I4N B;  1G6Z A;  4BBS B;  1PZI D;  1TII D;  5E3F A;  2HUG A;  4K8I A;  4MHE A;  3CKI B;  2L4N A;  1FNW A;  1I50 B;  2IX1 A;  5G3L F;  4H0L C;  1WVL A;  1FNU A;  3CHB D;  1J8I A;  1BQQ T;  2QCP X;  2R93 B;  2B8F A;  1PMR A;  5BN5 A;  1B9N A;  1DD2 A;  3GTP B;  4BA2 I;  2KEC A;  1CFM A;  1QNU A;  3C1E A;  1IW7 D;  4RGM A;  2RDH A;  4C3H G;  4ID6 A;  2D62 A;  2YYZ A;  4IUV A;  4IFD G;  2AWO A;  4FP5 D;  2BCO A;  1QCB D;  4ME5 A;  5J22 A;  3T51 B;  1TWF B;  1WTO A;  1H9M A;  1HRJ A;  1UAP A;  1WTW A;  2DNE A;  5JPN C;  4Y7N B;  2SNM A;  3J80 L;  3NE5 B;  3QWN A;  2E75 C;  3ZYY X;  1DYQ A;  3J7A V;  2CVR A;  1B53 A;  3OMC A;  1DON A;  2J0T D;  5CV8 A;  1V8Q A;  1PTO C;  1PRT D;  2FMM A;  5KND A;  5JEA H;  3I90 A;  2F0H A;  1U4P A;  1WD0 A;  4XT3 B;  1WTQ A;  3FVQ A;  5D3D A;  1SYG A;  1QG7 A;  1I6V C;  2NVX B;  2TSS A;  1TKW B;  1BF4 A;  1ICW A;  3P75 A;  2L11 A;  1EEF D;  3FPU B;  1EY7 A;  5HGT A;  4WJW A;  3P20 A;  1BUV T;  3L9A X;  1UNS A;  4H13 C;  5HUR A;  1A3V A;  4F87 A;  2F0I A;  2G9H D;  1EY0 A;  3HOZ B;  1CT1 D;  5EPJ A;  3BYT B;  4IUT A;  3HOW B;  1ZKO A;  2EYO A;  1MBY A;  4CKE A;  3AB9 A;  4KN4 C;  1KNE A;  3LNN A;  3GTG B;  5ISR A;  4WRD A;  4KKS A;  1PTO F;  1W6K A;  1MSG A;  4K6L A;  5EPK A;  5E4X A;  4KMU C;  5A2Q L;  3H3V C;  1L0Y B;  4QB4 A;  1EY4 A;  1DM0 B;  1HQM C;  2KUM A;  1SFO B;  4IUR A;  5C0X I;  4DAY A;  1E2V A;  5CV5 A;  3QOJ A;  1EYA A;  1OXV A;  3TZD A;  4A3M B;  1K8M A;  4K6D A;  2K7V A;  4RGT A;  1BNZ A;  3TN2 A;  3SXH A;  5C4Z A;  2VB2 X;  1RCV D;  3A8I E;  5FOB B;  4EQO A;  3I4M B;  2NVT B;  3FRP B;  1EY6 A;  1SJE D;  1JR0 D;  1SNP A;  1ENF A;  2RBM A;  2RA4 A;  3C46 A;  1GHJ A;  3OOC A;  4ZUJ A;  1V1P A;  2EVB A;  3D3R A;  1X32 A;  1FR3 A;  4HR7 B;  2B2Y A;  2HQE A;  3GO5 A;  3NQT A;  4KTA A;  1CHP D;  1Y8O B;  2EYM A;  2Z1C A;  1LTA D;  3K5L A;  3NBI A;  1LT5 D;  1CK1 A;  3Q23 A;  2X6G A;  1KNA A;  3S16 B;  1OXS C;  1TWC B;  1D5X C;  4XYQ A;  3SE0 A;  3VA7 A;  3S17 B;  3J81 E;  4DFA A;  1MSH A;  2K5Q A;  1IW7 C;  3TP5 A;  5CV7 A;  1VF7 A;  1TU2 B;  4RCN A;  2D9U A;  5C3X A;  1O7Y A;  1BXT A;  5IGB A;  4OHJ A;  1AEX A;  3HGB A;  3K5N A;  3SK4 A;  3Q6S A;  2AQ2 B;  4PQX A;  4O42 A;  4MN3 A;  2QDB A;  2EY5 A;  3WOE A;  4HAE A;  1B50 A;  1HPC A;  1Y8N B;  1PFM A;  5DEH A;  3K5O A;  1B44 D;  4DK1 A;  1PRT C;  2BDO A;  1UUP A;  4DN4 M;  4NKL A;  4FO2 A;  4RGO S;  5EJW A;  2LY7 A;  1KTK A;  1GUG A;  1DOL A;  2FMC A;  4OO1 I;  5E1F A;  4LAA A;  2RDF A;  3SK6 A;  2XNA C;  4RWS C;  3TDQ A;  2K5D A;  3A55 A;  2F0G A;  4RGN A;  4C3J B;  1STY A;  3TP8 A;  1IYU A;  1AP0 A;  1SYF A;  3PUV A;  2C9O A;  3M3Y B;  1S5C D;  3U9S A;  3KF8 A;  4K2L A;  2ZXO A;  3BDL A;  1R9T B;  4ULL A;  1EOT A;  5LHY 1;  3S1N B;  2LMC B;  2CW0 C;  4HMJ A;  1SE2 A;  1PRT F;  1U4L A;  1PXU A;  3GTK B;  1IKL A;  1SDF A;  5IGC A;  5JVH 3;  5EBD A;  3U9O A;  1GXD C;  4P2C B;  2A74 C;  3V2T A;  3GTO B;  3GQB A;  5NUC A;  4G57 A;  3G6J B;  2D2C C;  5AFW A;  3T56 B;  1B9M A;  1L0X B;  2RSN A;  1TWG B;  4L6T B;  1LT4 D;  3J80 E;  4RA8 A;  3VR4 A;  3NTH A;  1PFN A;  2Z4I A;  4A3J B;  4TQU S;  1I4P A;  1JQY D;  1GHK A;  3PO3 B;  1H9J A;  1SSO A;  2PO4 A;  5C44 B;  5M5W B;  4ZQ3 A;  2FJ2 A;  2O2L D;  2H1E A;  3IKJ A;  4RKL A;  5KRU A;  1BBX C;  4ZKC B;  2OF1 A;  2RDG A;  2BOS A;  5E4W C;  1RTO A;  3MZ5 A;  2IX0 A;  1DZ1 A;  2A6H D;  2AUK A;  3A7L A;  1M8A A;  1EEI D;  3RD4 A;  2KJX A;  4U68 A;  3QB3 A;  2KHS A;  4CHT B;  3CRK C;  3M7N A;  3GTJ B;  5C4H A;  3HG9 A;  5I6W A;  3RLF A;  4XQN A;  4HTH A;  1M4V A;  1PZK D;  3QG1 A;  3ERO A;  2BDN A;  3OHX C;  5A2Q E;  1JOO A;  3TP6 A;  3QOL A;  4L63 B;  3S1R B;  2EYL A;  2K28 A;  3D8G A;  2B39 A;  4ZRZ A;  2HDL A;  2PW5 A;  5CGK A;  1YNJ C;  5LL6 S;  3BYY B;  3DMU A;  2F3W A;  4HSP A;  2L1B A;  2F0U A;  4KN7 C;  1GUS A;  2I46 A;  3QIA A;  1SBB B;  4KV6 A;  1SNQ A;  1G29 1;  1G91 A;  5CV6 A;  1D1I A;  3MXP A;  4ZKB B;  4HSV A;  3ERQ A;  2V4D A;  2O4X A;  3S14 B;  3VR6 A;  5J39 A;  4OIK A;  3H6M A;  2EJG C;  4FXG C;  4HMI A;  3DUZ A;  4IAL A;  1GOZ A;  1HA6 A;  3MFY A;  3F2U A;  1FYC A;  5IGF A;  1II3 A;  2A69 D;  5CR3 A;  1SE3 A;  4WOR A;  4RCO A;  2NB0 A;  2PQE A;  3E5S A;  3VR3 A;  5EBC A;  3BS1 A;  1D2B A;  4XDX A;  5IOC A;  1QOH A;  3N52 A;  1SNM A;  1GUO A;  3A7A B;  1I4G A;  1JWU D;  1DJR D;  1BO0 A;  4X3K A;  2JP1 A;  3NHH A;  2WV6 D;  4B9W A;  1TS3 A;  4FXD A;  2WAC A;  2EYH A;  1Z6H A;  3SDZ A;  3PIP 3;  1ML0 D;  5ELE A;  2AQ3 B;  3K57 A;  1EWH A;  2WAQ B;  1F2Y A;  1RKN A;  2CHB D;  2F0W A;  1C48 A;  2MHV A;  4DXF A;  1ZYR D;  5BN4 A;  5CBA E;  1JOK A;  1ONL A;  1QE6 A;  4IFD J;  4BS9 A;  3X3M A;  1H9S B;  5FLX L;  1PZJ D;  4KJN A;  3S9W A;  4DA2 A;  5FK9 C;  1QJO A;  3A56 A;  1D5M C;  1STB A;  1V1P B;  2IPK D;  1I4H A;  1NUC A;  2XRQ D;  3NUC A;  5I2Y A;  1EY9 A;  4LK1 C;  4H44 C;  3MEH A;  2AWN A;  1PYW D;  3PUY A;  3T53 B;  2WIN B;  2MUY A;  1U4R A;  4A3K B;  3Q0A A;  2B2T C;  1WTV A;  1H9R A;  4RAU C;  5KYL A;  3NWS A;  5C3E B;  3FMC A;  4G4K A;  4IQZ A;  4XIG S;  3OW7 A;  4TSS A;  4B9X A;  3KUP A;  4KD4 A;  1S5B D;  1MGS A;  5I6Y A;  1Q8I A;  1NAP A;  4DAV A;  1YNN D;  5K36 G;  3PUZ A;  2SOB A;  1JWS D;  3RZO B;  4C3J G;  1LT3 D;  1EZ6 A;  3AMU A;  3NQI A;  4K8J A;  4DF7 A;  3MXN A;  5C4X B;  1MI2 A;  3K0Y A;  4C3I B;  3CRL C;  4C1N K;  2A69 C;  3P1H A;  3DM1 A;  5J1Z A;  4NMZ A;  1RD9 D;  1LV9 A;  1TY0 A;  1GUT A;  1RHP A;  2F0K A;  1SE4 A;  1VF5 C;  4FF2 A;  5CBE E;  1SNC A;  4BA1 I;  4IUU A;  4RFB A;  4S3S A;  1DOM A;  1R4Q B;  2CW0 D;  3W3A A;  1G2S A;  3GTM B;  1I6H B;  4QMG A;  2KCN A;  5T1G A;  3WOF A;  2R6G A;  1Q90 A;  1SNO A;  4CJ1 B;  1AZP A;  4IFD H;  2LS0 1;  1LTT D;  1F77 A;  1ROD A;  1E2Z A;  1I3Q B;  1ZYR C;  2FFK B;  3LWE A;  1TS4 A;  4HED A;  3VYU A;  5I9P A;  3H09 A;  3VA5 A;  1E2W A;  2M9V A;  3R2T A;  1EWC A;  2LFN A;  2ENB A;  2NN6 G;  5D65 A;  3HOX B;  2NTS A;  1CQF A;  2K33 A;  2G9D A;  1EY8 A;  3R3O A;  3GV6 A;  1A2T A;  3QO2 A;  4ABN A;  1TWH B;  3NSW A;  1Y1V B;  1LTR D;  3H0G B;  4KY6 A;  3PV0 A;  1X3P A;  3T4A C;  3IL8 A;  1SYB A;  2XIW A;  3TME A;  1KDB A;  1GUW A;  3C3L A;  1JCK B;  1ESF A;  2XN9 C;  4R9W A;  5EKL A;  3ND8 A;  5ELB A;  3GP7 A;  3GV3 A;  2ICE C;  4TKO B;  5DM7 3;  1ILQ A;  1XXG A;  3TP7 A;  2B2V C;  4RKB A;  3A8K E;  2NVQ B;  3DEP A;  3UI2 A;  3EVQ A;  5KEE A;  3BVZ A;  2NZ1 D;  5COY A;  2J4X A;  4I65 A;  3FEW X;  1A3U A;  3ONA B;  2WKD A;  2L12 A;  2JYO A;  5EKK A;  1I4R A;  1YNJ D;  1YNN C;  1JOQ A;  2NN6 H;  5FLX E;  2M00 A;  3DXJ C;  4DNT B;  1JE4 A;  1SXT A;  1S5D D;  2FHT A;  2AQ1 B;  3C1F A;  2IL8 A;  3KK7 A;  3K7A B;  4OIJ A;  1EU3 A;  1PFB A;  2EJM A;  3OIP A;  4H7B A;  2IW3 A;  5DNF A;  1O7Z A;  2F0P A;  5IT9 L;  2R92 B;  1Y8P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...