3T16A

Crystal structure of staphylococcal nuclease variant nviaga/m98g at cryogenic temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
124
Chain Sequence
LHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIPYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKGVNEALVRQGLAKVAYVYKGNNTHEQHLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant NVIAGA/M98G at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 38
structure length 124
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t16A00
4ZQ3A 4WORA 5CV8A 5K5PA 5E1FA 2F0OA 4WRDA 3QOLA 5M9OA 3MXPA 5CR3A 5EKLA 1KABA 4K2LA 4K6DA 4KHVA 3TMEA 4F8MA 2HQEA 2F0PA 1EZ8A 4I65A 3ERQA 1KDCA 1EZ6A 3T13A 5J22A 4EQOA 3HEJA 2O4XA 3QOJA 4NMZA 4KJNA 1II3A 4K14A 2F0NA 2EYPA 3D6CA 5IGFA 3NK9A 3D4DA 3EROA 1SYEA 4NKLA 4RKBA 3P1HA 3SHLA 2RKSA 5IIFA 1U9RA 5C6AA 3D8GA 3DMUA 4DF7A 2F0WA 2OXPA 1SYCA 2KHSA 5IGDA 2PZTA 1JOKA 1RKNA 3QB3A 4N9TA 4PNYA 5CV7A 4MIUA 5C4HA 5ISRA 1EYAA 2EY1A 4KY6A 3VA5A 4DU9A 5KGUA 1JOQA 1AEXA 2F0EA 2OEOA 2PYKA 5DAUA 3TP6A 4OL7A 4G57A 4PMCA 4H7BA 5KEEA 5J39A 1STBA 2PW7A 3S9WA 3OSOA 1TQOA 1STYA 2RBMA 2NUCA 2PQEA 4NDXA 5NUCA 4DGZA 4EQNA 3SK4A 3C1EA 3TP5A 5IODA 1EQVA 3NUCA 1STHA 1EY7A 2PW5A 3ITPA 4J1MA 2EXZA 4KJOA 5IGCA 2F0VA 1A3UA 4HTHA 5C3WA 1JOOA 2KQ3A 4HMIA 2F0MA 2QDBA 5EGTA 3BDLA 5I6YA 3TP7A 5CV9A 3SR1A 2SNSA 4ID6A 1A3TA 2EY6A 2F0UA 5I9PA 2EYOA 2F0DA 5KYIA 3NHHA 3E5SA 4F7XA 5CC4A 4QF4A 4TRDA 2F0FA 3PMFA 1EYCA 4K5VA 4ZUIA 2ENBA 2F0GA 1SNDA 2F0LA 1F2YA 2F0TA 3P75A 1SYGA 1KDBA 5DEHA 4ZUJA 3R3OA 5IGBA 3EVQA 3LX0A 5CV6A 2LKVA 1SNQA 4RKLA 5KIXA 5C5LA 1EY9A 1STGA 2EY5A 1SYBA 1TT2A 4K2KA 3C1FA 3MEHA 3MVVA 1NSNS 2F0KA 4IUNA 1F2ZA 3NP8A 1SNCA 4J6HA 5J1ZA 3T16A 5KRUA 1STAA 4B9XA 5EKKA 2F0JA 4KD3A 1SYFA 1A2TA 1EYDA 3MHBA 3OWFA 1EY5A 4K8IA 4PMBA 2EYJA 3SXHA 4EQPA 5JAVA 4K5WA 4DFAA 1EY8A 1F2MA 3OMGA 2EYFA 2F3WA 1A2UA 1SNPA 5CV4A 4HMJA 4ME5A 4EVOA 3SK5A 3NXWA 4QMGA 4S3SA 1NUCA 2F0QA 3OMCA 3V2TA 5C3XA 2EYLA 3NQTA 2RDFA 5E3FA 2OF1A 3HZXA 5IOCA 5CV5A 2PZWA 1KDAA 2SNMA 5C5MA 3RUZA 1TR5A 2EYMA 2WACA 2F3VA 3H6MA 4KTAA 4QB4A 4E6IA 2SOBA 4R8NA 5I6WA 3TP8A 5I9OA 1SYDA 4KD4A 1A3VA 5IGGA 2EY2A 3EJIA 4B9WA 5JOBA 4KY5A 1SNMA 1EY4A 2F0SA 1EY6A 2M00A 4KY7A 3BDCA 4LAAA 5KYLA 1SNOA 4N9PA 4NP5A 1KAAA 1IHZA 3DHQA 3SK6A 4ODGA 2PZUA 3SK8A 5IGEA 1JORA 5C4ZA 4IALA 2F0IA 1ENCA 5CGKA 3U9OA 1ENAA 1EY0A 3MZ5A 4KV6A 2EYHA 4IZ8A 5F2DA 5HURA 1STNA 5HGTA 2F0HA 4YIJA 4K5XA 3D4WA 4K8JA
chains in the Genus database with same CATH superfamily
5J3BA 5CV8A 4DR2Q 1JWUD 2ICIA 2Q2IA 2OWOA 3HOXH 1EIYB 5ELOA 4F87A 1RF2D 2NBFA 3QIAA 2RCFA 2NN6H 3CP0A 3D6CA 4A3DH 2Z4IA 1U9RA 5C6AA 3HOZH 1X3PA 2Q8RE 2UU9Q 2E75C 4EGVA 2CW0D 2H4OA 5AJ3L 2R93G 1E2VA 1JOKA 3KLRA 2ATWA 3W1BA 2CWPA 3KJOA 4BY7H 1WYDA 3JAME 1Q7YC 1N36Q 3TZUA 4JBKA 1YHAA 4A3GG 4FDBA 3K7AB 5FKAC 4A4IA 1HR0Q 3I2ZA 1QVGA 4RGMA 5EJWA 3SR1A 2BH2A 2EY6A 2IY5B 2A6HD 5IT9c 2E2JH 2F0FA 1XNQL 4HSPA 3A8KE 1PHJA 3ICEA 2CH4W 1ILPA 5C3EG 4C3IB 4R4CA 2K14A 1SNQA 3HOXB 1V1PA 1S5BD 3U9SA 2IHEA 1PH3A 3H3VH 3I90A 4RA8A 4AIMA 3MFGA 3D3RA 3BVMA 3NELA 3KYHC 4TKOB 1RL2A 1JMCA 2JN4A 2J4XA 3PO3B 4KD3A 1X56A 5K36G 5JJIA 2LFNA 1GXDC 4L5QA 3GD7A 5C4XG 5IT9L 4EVOA 1VQKA 5AFWA 1WD1A 5CBEE 4B3ML 4H0LC 5CV5A 3AMUA 1PYBA 2WACA 4KTAA 1HA6A 3CC2A 2JA8B 4UAIA 2KHIA 4KY5A 2ICEC 1FVIA 4X3UA 2VQFL 3BDOA 3PIOA 2M00A 2K6AA 4JI8Q 3CCJA 1ASYA 4A93B 4NP5A 4A3BB 3GQBA 3L3OC 1U5KA 1B7YB 1NBWA 2Z9HA 1EU3A 2K03A 4IFDG 1Y1WG 1NR4A 5K5PA 3AU7A 4L5TA 2PO4A 2BDOA 3QOLA 4ULLA 1HJPA 4K2LA 5JEAJ 1NCVA 1W3SA 2MNAA 2O5IC 1PTOH 1EZ6A 1FNWA 2NN6G 1TWCB 1FNUA 4RH6A 2A69D 1F9QA 2DJFC 1JICA 5M3MG 2L12A 2ZXRA 4FYDA 4C3JH 2O2LD 1NJIC 1EL0A 4C3JB 5A35A 1BO0A 3U4ZA 4X66Q 4GNXC 3Q23A 3KBGA 2UUCL 2N78A 1GUGA 1IBKL 1STBA 4DAVA 1JJGA 3OSOA 4RHRA 5IYBG 2RBMA 1OO9B 1PH9A 3MXUA 4HIKA 1YNNC 1EY7A 3ITPA 2LXKA 1TWGH 4XQJA 5D3DA 3HOVB 1WCMB 1BKBA 2K50A 1TWFH 5EGTA 1SRUA 3FPUB 1Y8PB 2JXMB 1QB5D 2MPMA 3QG1A 4DV1L 2ZJQA 3NHHA 4DK0A 3PMFA 1Y1VH 3CMAA 3CQZH 1KHIA 1VQGA 2BA1A 2L11A 1L0YB 2NVXB 2AKWB 4BXXH 1KDBA 3F2DA 5M5WB 2PCFB 4GN4B 1HNZQ 2AMCB 3M7NA 2RQXA 1OTCA 4X3TA 3IKJA 3Q22A 2F03A 3S16B 4DV4L 4DAYA 1EUJA 5ELCA 3D31A 4DNTB 2K5WA 1CKNB 1PH5A 2R92H 1X55A 3PUVA 5T1GA 1JWMD 1XMOQ 4ZRZA 1VF5C 2R7ZB 4AQYL 3X3NA 2VQEQ 1F2MA 4A93G 1CSPA 5LMNW 1B70B 1N36L 3TN2A 5M5XB 1O80A 2BOSA 1O7YA 1ONLA 1VQBA 1YNND 4A3JH 2A68C 2E8GA 5FO7B 1HR0W 2EY2A 3EJIA 3CCLA 2YTXA 4QGUA 4LAAA 5FLXE 5C4XB 2ZXOA 1OXVA 2MHVA 4DR2L 3DHQA 5T1IA 1JORA 2NZOA 1S5FD 1VMCA 1G2TA 3MZ5A 4JK1C 2K1BA 3DM1A 4ZQ3A 4MTNA 3MXPA 1NMGA 1CKOA 4EX5A 2IX1A 2HQEA 2HHHQ 5LL6X 2N8NA 3HG9A 4BWGB 4KJNA 2IPKD 4DN4M 4R4IA 4GOPB 4V190 1DCZA 3DMUA 4X62L 4XIGS 2A5HA 3OTOQ 3D6WA 2ZTDA 4MIUA 5CV7A 5KGUA 5C3EB 1AEXA 4B3TQ 2DGYA 2JEBI 4KI0A 3HOWG 1GD7A 2EDGA 3H0GB 2QF7A 3MC0B 3O13A 3PUWA 2E2HH 1C0AA 1UE6A 1QILA 5D14A 4IOCA 4IUPA 4DGZA 1D5XC 1V9PA 3SK4A 1TWFB 1TS4A 3TP5A 4LNQA 2UXDL 1EQQA 1JJ2A 3PUYA 1UE5A 2RHQB 3TQYA 5JVG3 4JI5Q 2R92B 4A3JG 3JC66 4CKCA 5LMNL 1CI3M 3TP7A 4ID6A 5I9PA 2EYOA 1Q46A 1XPRA 2NVQB 1PH1A 1BCPF 2Z1CA 3CCVA 1S5DD 4TRDA 2J0TD 4RCOA 1EYCA 1LTTD 1YHBA 1S4ZA 1JCKB 1LTGD 2TMPA 1VQ8A 2E2HB 4WJWA 2XIWA 5M3MH 5IP7H 1CUKA 1B9MA 1VQ5A 3VYUA 3FMCA 4DR3L 5FO9B 1QG7A 3DM3A 1GOZA 1SN8A 4Q5VA 2ZXPA 3M9BA 2FFKB 3G71A 4YCWA 1SYBA 3M3YH 4LUVA 3CCQA 3HOZG 3MEFA 4J6HA 3HOVH 1AP0A 1PDQA 4IPGA 1DD2A 2NTSA 4BBRB 4C3HG 2CHBD 5CV4A 2JA7G 2UXDQ 1VQ4A 4S3SA 4X6AH 2F0QA 4UDUC 1LM0A 1UWVA 1HZCA 5IP9H 4ME3A 1N34Q 1X65A 1NMFA 2JK8A 2Y0SB 5IGGA 4CKBA 1EEID 4YY3L 5IYBH 1MHWC 1EY4A 5C4XH 2QCPX 1VQDA 4LK1C 3MXNB 1I5FA 4ALPA 3I7FA 1S5CD 4ODGA 3SK8A 2ZTCA 3HOWB 4IALA 5CGKA 3M4QA 3A7LA 3LNNA 3H3VC 3H94A 1PRTC 4A3FH 3VYTA 1I94L 2ALYB 4R4OA 4LF4L 2F0PA 4GS3A 3VDYA 1N33L 4FNFA 3W1GA 2JJQA 4A3BH 2UXBL 4IUQA 1G2SA 2YV5A 2UU9L 5IIFA 1Y1WH 2OXPA 2WAQE 4N9TA 5C4HA 1PMRA 3VA5A 1AE2A 1WOCA 1LABA 3G6EA 2IT1A 2I0QA 1FYCA 4H7BA 4C3IH 4JPBW 4IJHA 1E7ZA 1EWIA 2KJXA 3I55A 2N55A 3CCEA 5M3FB 2VUMH 1RDPD 4V0BA 5NUCA 5EAYA 3C1EA 2JSOA 4DR1Q 3KUPA 3G4SA 1YEZA 1XYIA 2B2UC 3NQIA 2PQAA 2F0MA 1QUQA 5C44G 3K59A 1J5EL 5EBDA 5FJ8H 1V8QA 3S1MH 3J7ZC 1BCPC 4C2MH 4DK6C 1CFMA 4A75A 4LF9Q 1BBUA 2AUJD 1IBKQ 2WKCA 1ZXTA 4OHJA 4JI4L 1GO3E 4ZK9B 5ELDA 3R2TA 3OWEB 1EOTA 2N3SA 3G48A 2I5LX 3CCUA 2BCOA 3UDIA 1STGA 4JC0A 3I4NB 2CH4A 3T51B 1NSNS 1HQRD 2RDGA 4JCVE 1B2TA 1B44D 3VR3A 3MXGA 1CA6A 4BXXG 3VA7A 1EYDA 2C5CA 4K5WA 2EYFA 2V1CC 4DV6Q 2GA4B 1BQQT 3V2TA 2DJGC 1AZPA 1DXMA 2DNEA 3VR6A 4DR7Q 2G5DA 1CHPD 1QNUA 1J5EQ 3FRPB 3URYA 3AQQA 3PUZA 1Q81C 1QOHA 3DWPA 4DV2Q 2QILA 5LMNQ 5GQOA 2D0OA 5FOBB 5FLMH 3PGZA 4LFAQ 5IGEA 2KEDA 4HN7A 4CDEC 2VB2X 2Z0SA 5IP9G 1STNA 3HS0C 3QR8A 4YIJA 1VQAA 5HGTA 2ES2A 1BUVT 2L0CA 3NBHA 2HCIA 3W2DA 3EQLC 4A3MH 1N8RC 1GVPA 1YBYA 2HUGA 1VQEA 2HDLA 1BBXC 1I3QH 2YTVA 1R9TH 3BZKA 3R8BA 1YJWA 4A3LG 3RD4A 1VQJA 3OIPA 4OWXB 4PMCA 1KLUD 3CCMA 4DV2L 2JA5H 1I4PA 2AQ2B 1HA5A 5C4JH 4FF4A 3I56A 1O7LA 4WFN3 2B2WC 3GTKH 4YY3Q 2PW5A 1LT5D 4DV5Q 3HOUH 3HKZG 1DM0B 1WTXA 3M4OB 1EWCA 4U673 1L0XB 1B9NA 1XMQL 3CXCA 4A3KB 1D5ZC 1QNKA 3OPOA 1TS3A 2CW0C 1LUZA 1BNZA 4ZUJA 4AYBG 1NAPA 3EVQA 2ZM6L 1TWAB 3EN2A 5KIXA 2RHSB 3A55A 1IW7C 1KXLA 2LMCB 4I7AA 5DM63 2GN5A 2K75A 1QZGA 2Z6KC 2UUBL 4IUTA 1SAPA 5COYA 1S40A 2MQHA 1Y8NB 2D2CC 3CQZB 4DV5L 1EY8A 3OMGA 1A2UA 3HOYG 5CORA 3MWYW 3M3YB 3OMCA 1SLJA 4GN5A 3A7AB 3FHWA 1IBLL 1WTVA 2B39A 2PI2E 2K04A 2N88A 1H9SA 1H9JA 1XMQQ 4A3GB 3RZOB 4B9WA 2UUAQ 1CKMA 2CCZA 4C2MB 4NB3A 5E4WC 3OW2A 4CHTB 4QJFA 2NVQH 1KAAA 1IHZA 2RDHA 4HSVA 1PLFA 2LY7A 5C4ZA 3RZOH 1OXXK 4OX9Q 4LWCA 1F2LA 2R93B 1AN8A 4F8MA 1LO5D 1ZKOA 1L0WA 4UP9A 5CYUA 5J22A 2JEAI 2F0NA 3P7JA 2J7ZA 3DWAA 3SHLA 2O5JC 4B08A 2RKSA 3FKIG 1BCPD 2YYZA 5CBAE 2R6GA 3RLFA 4JI8L 5IGDA 1RKNA 1JB7A 4FO2A 3I8ZA 2OEOA 2PYKA 5C0XG 4G57A 1YJ9A 2ZT9C 1LACA 2SDFA 3NBHB 1STYA 1VQIA 3J80L 1N33Q 4OIJA 1BBWA 1VQMA 3E6ZX 2WAQB 4UY8C 1PYWD 1JQYD 2XWBB 1I4GA 4A3CH 4A3FB 2MO0A 5KYIA 3F1ZA 1D5MC 2JA5G 1EQRA 1WI5A 4ZAIA 3HGBA 1Y1VB 3W3AA 1XX8A 1SNDA 3N6RA 4GOPC 5A2QL 2NN6I 1Q82C 2B2UA 1GUNA 4RKLA 2A19A 2EY5A 2WV6D 3GTMH 1X3EA 2KBNA 3RLOA 2XRSD 3M7GA 2B63B 4IPCA 2E2IH 2Q2UA 3J80c 1B50A 5KNBA 2OQ0A 2BDNA 4RGNA 3PSIA 3DEOA 4P71A 4QL5A 4RHSA 4GLAC 4DR4Q 5E4XA 4HMJA 1PYSB 1ZEQX 3KK7A 2R7FA 3K6OA 5E3FA 1LTID 3S14H 3I3CA 1SYDA 4PV1C 1VQ6A 1K0RA 1SR3A 1SNMA 4B3RL 2IJ0A 2G9HD 2CQAA 2MFIA 2MUYA 2PMZE 1ET6A 2NZ1D 4N9PA 5IWAL 3HOYH 1F9RA 1I6VC 2DY7A 3JAMi 1WD0A 3U9OA 1ENAA 5F2DA 2EYHA 5BR8Q 3GTGH 1SE2A 2JA6H 2MP1A 2XTIA 4LJZC 4FXGC 3PO2B 1ILQA 3S16H 4RMFA 2L9HA 3S17H 3CW2C 1VCIA 4JI1Q 3NK9A 1NY4A 3P1HA 4G4KA 1QVCA 4H44C 1P16A 3GP7A 4DR5Q 1HXYD 3QB3A 2E5LL 1F77A 3OIQA 4HEDA 3ND9A 4DNIA 4DU9A 3S15B 4DA2A 4R4QA 3TS0A 3PQIA 3FKIB 5G3LF 2F0EA 1TY2A 2E2DC 3J7AF 4JI2L 4KMUC 3K81C 1SMYD 1TQOA 5D65A 5HY6A 1RIPA 5IODA 1QZHA 1YJNA 3GTMB 3I4NG 3NE5B 3IL8A 2F0UA 3M4YA 1D2BA 2B2YC 3L9AX 2DNCA 4K5VA 2B2WA 2K05A 3I91A 4DR5L 4FF2A 4BY1H 1XPUA 1UUPA 3UE0A 2Z6KA 4QUFA 4BY1B 4ABNA 1TWCH 4A3MG 1T9HA 4JI1L 2K5HA 4GKKL 3NTHA 3RR5A 3S2DH 2C9OA 3PIO3 1R9TB 1JE5A 4QUCA 1BXTA 1C48A 1RODA 5CMDA 2QEXA 1KTKA 4K8IA 4BY7B 4IO9A 4BBRH 4JBMA 2B29A 1FGUA 4OGQC 1A62A 1JE4A 1UE1A 5C0XJ 1G291 1IXRA 1O78A 2QA4A 3H6MA 4DAYB 3TDQA 2VUMG 3GTQH 1Q1BA 5FLMG 3DUZA 3HOWH 2XNAC 4PG3A 4M8AA 1XNRQ 2HDMA 4L6TB 5LHY1 4A3KG 3A8IE 4KHZA 4HAEA 1WFQA 2F0IA 1ENCA 1LTAD 3LGJA 3GTGB 5HURA 3BJUA 3BYTB 4K5XA 3N52A 1KQSA 5GROA 2B2TA 1TXYA 2JA9A 4FVMA 2AUKA 5CR3A 3UDFA 4WJ4A 2K52A 3CRKC 3I4LA 3GTJH 4LFBQ 1EZ8A 4AH6A 4A3EH 5LMUQ 2K01A 1EIGA 2F4VL 4CJ0B 3S2DB 5JJLA 1KD1C 2Y0SG 3UDXA 2XVSA 3CHBD 5GAGC 1HRJA 2B8GA 4OX9L 1ZYRC 3BYYB 4NXMQ 4A3DB 1JOQA 1U4PA 1SFOB 1LLRD 3J80i 4XYQA 1XTCD 3ULLA 2RSNA 1WTHA 1CSQA 1PTOB 5IYDH 4XYOA 3KF8B 4HJAA 1I94Q 1TWHH 4NXNL 1GJXA 4DKAC 1XNQQ 3TZDA 2RCNA 1PRTD 2PNHA 1VQHA 4IN3A 1CZWA 4PZ6A 4DV4Q 1K73C 5IGCA 1HNWQ 1JOOA 4HMIA 2B2VC 3CAMA 1IKLA 2SNSA 4A3IB 4JYAQ 4TSSA 5LMUL 5GADC 3NSWA 4LW1A 4MZ9A 4DUZL 2QKIC 3DEPA 1K28A 2F0TA 1YHQA 3GV6A 1IKMA 3H0GH 1HUNA 2QDLA 1XJVA 2I5MX 1IL2A 2JA8H 2EIFA 2ID0A 3K0YA 4HJ7A 3A8JE 4OO1G 3MAQA 3NP8A 3S17B 3UI2A 3IAYA 2Q2TA 3A74A 3OWFA 3BS1A 2XRQD 2WB1E 4GLVB 5A2QE 1X3GA 4P2CB 3J81L 1YI2A 4DV7Q 1JB3A 2OF1A 3HZXA 1V43A 1TR5A 4X3KA 1B53A 2SOBA 4R8NA 4OONA 2M2LA 4KN7C 3ND8A 1MJEA 1A15A 2V4DA 3E0JA 1YITA 2F0SA 5BN3A 4POGA 5HGQA 5M5YB 4L63B 3PV0A 1MI2A 2F0HA 1I50B 5C44B 4EQPA 4OO1H 2R93H 2EZVA 1HPCA 1B4OA 4HIMA 2KVMA 3I4OA 2D5DA 3TBIB 3HKZB 3ERQA 1LTSD 1PVOA 4LF4Q 2AWOA 4YHHL 3HRZC 4B3RQ 1N32Q 1II3A 3Q0AA 1TWHB 1JC7A 1YNXA 1HFGA 4RKBA 1S5ED 3DXJC 4X64Q 4IFDH 1M4VA 4QIWB 1K8MA 2Q8TA 1ESRA 4PNYA 3V05A 3BZCA 1EYAA 2UXCL 3S14B 3HKSA 4LFBL 4KK7A 3NWSA 5DM73 2WINB 1K8OA 5J39A 3CF5A 1K3RA 4DV1Q 4MN3A 3I4MB 4LF5Q 3I4MH 1SE4A 3J7A5 4GLXA 1EQVA 4K6LA 3GTJB 1EIHA 1STHA 1LTLA 1A3UA 1IYUA 1X54A 3RMHA 2KHJA 1IZ6A 3CC7A 2JA6B 1SE3A 1TWGB 1AFPA 4KLKA 2B8FA 4LUZA 4GZYC 3OHXC 5K36H 3ONAB 5IYCH 1F2YA 1SYGA 2FINB 1FJGL 3HP3A 3T1YL 2RF4A 4P72A 1KC8C 1Q86C 2RA4A 2X69A 1S3OA 3G7LA 1RTOA 1PXUA 3PIPA 2UXCQ 2NWGA 4L8JA 2JA7B 3ULJA 1VQFA 1A2TA 3S2HB 2NVYH 1KIXA 3EBEA 2MGSA 1W6JA 4KKUA 1NUCA 4DV0Q 2EYLA 1WTRA 2EJFC 2BA0A 1HZAA 3OOCA 2EYMA 4E6IA 5EPJA 5I6WA 1ICFB 4RGTA 5I4DA 1I3QB 2GVAA 3S1QB 2FMMA 3RZDH 1C4QA 4NPSA 1A8VA 1QUQB 2UUBQ 5BR8L 4ZKBB 4A3JB 2R92G 1E2WA 4K8JA 4U68A 4X62Q 1LTRD 3CCRA 5M9OA 4CJ2C 2XGTA 1WTOA 1KABA 1PZKD 2FHTA 3CPWA 4UP7A 1KL9A 3T13A 3A0JA 4DXGA 3D4DA 4CJ1B 2B2TC 5DNFA 3T1HQ 2PZTA 5ELEA 5JPNC 4EQ5A 3TREA 2G9DA 1TS5A 1EIFA 2PQAB 1DGSA 2JYOA 4IUUA 2JE6I 3MFYA 2KENA 4RCNA 5IY0A 3PO3G 5JVH3 4C56C 2EXZA 4KJOA 4HTHA 3E0EA 1ESFA 1CZGA 5CV9A 2K5VA 1PFNA 1WTPA 2F0DA 2HD3A 3Q8DA 1AE3A 1I6HB 2VY3A 2LXJA 1E0BA 4BY7G 4C3HH 1ZYRD 2EVBA 1DONA 1PH6A 2B2VA 3J81E 4K0KQ 1XPOA 1TY0A 3U50C 2UUCQ 4IQZA 2Z6BA 2NVTB 1TVXA 3S1MB 2OT2A 2F0KA 2Z4HA 1F2ZA 4X65L 3H3VI 1N34L 3GTPH 3KLWA 2JP1A 5AJ3Q 1SXTA 3J7AV 2VZAA 5FLXc 2R7ZG 1D8LA 1SNPA 4OELB 3K58A 1HTLD 2WB1B 1LTBD 5FO8B 3OTOL 4RAUC 1SJHD 5M5XH 1Q90A 2A8VA 1B3QA 1GKHA 1WJJA 5JEAG 3FDTA 1E2ZA 1XNRL 4OIKA 2XWJB 4A93H 5IYDG 5H1SE 3AFPA 2F1MA 3W5OA 2IHFA 2XSCA 1A63A 3PO3H 2BH8A 4HIOA 4G7ZC 2K5QA 4H13C 3DLLA 1SDFA 5E1FA 2RVLA 2EPBA 4FXKC 3U58A 4XXEA 4RG1A 4JI5L 1CT1D 1KDCA 4EQOA 2HT1A 5TSSA 2HIXA 5IYCG 3GTPB 1K9MC 3H0GG 4QQBX 1Y14B 1VF7A 2JA6G 4O0AA 3K5LA 2ZTEA 1LT6D 1B3AA 5ELNA 3E3XA 1EFID 4A3EB 1YVCA 3KBXA 3ULPA 4JI6L 4GKKQ 4KKTA 3GTOB 3GTLH 4NDXA 4BBSH 3PUXA 3BVGA 4CDCC 1I4QA 3CMEA 2XN9C 3S2HH 1K3BC 2KA7A 2F0VA 1V1PB 5M5YH 3B6YA 3BZDB 5LL6S 3K5OA 5M5WH 5CC4A 4LFAL 3I4MG 4GNXA 2NZHA 4A3LH 1LT4D 1KLGD 1VQOA 2WFWA 4OXPA 2NVXH 1IYVA 3VR2A 4JI2Q 1MSGA 4OO1I 2JA8G 1HZ9A 2CQOA 2B63H 3RNUA 1E24A 4LF8L 4DK3C 1TT2A 2E76C 3OYYA 1NE3A 4YWMA 1K0SA 2Z8LA 5KRUA 4YCVA 4B9XA 2F3IA 2AQ3B 3K80C 3KDFB 1H9SB 1Y1VG 5ELFA 4JV5Q 1STEA 5I6YA 1L1OC 1TU2B 1U4LA 4XQNA 3MTSA 3NXWA 1QJOA 3T1YQ 1TIID 2RDFA 2VQFQ 1NNXA 1CM9A 1KDAA 1PTOF 3RUZA 2LSSA 2F3VA 3DWQA 2WAQG 2WIIB 4C3IG 3KJPA 1V1OA 4LF6L 3D0FA 3QWNA 5C4JB 2ZJRA 3SE0A 3CPFA 1GHJA 3QJYA 1NR2A 2KCCA 3GDEA 2PZUA 1T5XD 3Q6SA 4UPAA 2EXDA 1DOMA 4PZ7A 4NXNQ 4WRDA 5C0XH 2WKDA 5EQ0A 4KHVA 1WCMG 1OXUA 3HOVG 1L2FA 4CGYB 4MTKA 1MKHA 3FP9A 1DZ1A 2NVYB 4HCSA 2EYPA 4DUYL 1YNJC 1SYCA 2KHSA 3LWEA 3T53B 3F2BA 1A6XA 5ISRA 2NYZD 2EY1A 1HHVA 4LF6Q 4DUZQ 2KECA 1MJCA 2HHHL 4F88A 3G6JB 3KF8A 1DOLA 3L2PA 2H5XA 5FK9C 3BVZA 1HUMA 4A3IG 5IT9E 4J15A 1MSHA 2JA7H 4O2DA 4GNXB 4B3TL 5I2XA 3WOFA 4DV6L 2VW9A 3HOYB 2WB1G 1HTPA 4F7XA 1HZBA 1P8LA 4MNOA 2IWHA 3AYHB 4ZUIA 3PO2H 2EJMA 1G91A 4DV7L 2L15A 3M85A 1EYGA 4MHEA 1V1QA 1YZ6A 4A3BG 4A3DG 5JJKA 2PMZB 4POFA 3AFQA 5CV6A 2DN8A 1ML0D 1X32A 4UHVA 1TS2A 3A5ZB 3FEWX 3MEHA 2L55A 1MGSA 4LF7L 2ASBA 3S1RB 1IBLQ 3TS2A 2QEJC 1WCMH 4DR6L 1BDOA 2K32A 3SGIA 4PMBA 3GO5A 1AH9A 1MBYA 1VQNA 2VB3X 1AZQA 5JAVA 2KUMA 1Z6HA 2PI2A 4A3KH 3S1RH 4APVA 1KNEA 1VMPA 3K5NA 2I5HA 4CBVA 4FXDA 4XT3B 1SBBB 1MD2D 3NQTA 3J81j 2F4IA 1C8CA 4HCEA 4HJ5A 1T5EA 2PNRC 3U4VA 4XDXA 1G6ZA 1CTMA 1Q1EA 3I70A 4IUVA 3GTLB 1H95A 4KY7A 2AHOB 1G51A 3KDFA 3S1QH 4PMWA 2E5LQ 3D4RA 1MIUA 3D4WA 1I4XA 2NB0A 4EQNA 3LWUA 1U4MA 1H9RA 1CK1A 4XTCS 5IWAQ 3KLSA 1X3QA 2F0OA 4DK1A 1PH8A 2BE5D 1XXGA 4J8QA 2SEBD 3TMEA 1SROA 3JAMc 2FMCA 3ERSX 4I65A 1HH2P 1ET9A 4A3MB 3WOEA 4BY1G 1Z9FA 4YWKA 2R61A 5C0XI 4Y52H 1X3FA 3KLSX 3STBC 2F0WA 4M1UB 1LT3D 3CU7A 3MA2B 1DOKA 1EFWA 4DR7L 1CHQD 4ZYSA 1W6KA 5DAUA 3TP6A 1FJGQ 4OL7A 3TEHB 4L5RC 2KCMA 2QW7A 1Q8KA 2K4KA 4B3SQ 2NUCA 3AB9A 4DPGA 1D1KA 3SEBA 1K8AC 2K28A 1UEAB 2CVRA 2QDBA 3BDLA 4PQXA 1VQCA 3J81c 1K8GA 2L1BA 1IYJB 1Z7TA 1D1IA 5D3IB 4LF8Q 5FLXL 4JI6Q 3P75A 1JWSD 2CFMA 4DAPA 4FF3A 3LX0A 2LKVA 4ZLTF 1SSOA 3S1NB 3KF6B 1M8AA 2UXBQ 1ENFA 4O42A 1SJED 4JVZA 1VQ7A 4X65Q 2Q2HA 3BU2A 1BOSA 4GKJL 2IX0A 1QVFA 1M1KC 4BBSB 3GV3A 1I4RA 1STAA 4DAMA 5EKKA 2F0JA 1UE7A 3WDNA 3PO2G 1Q12A 3SXHA 2P5ZX 3CC4A 4JI7L 1GUSA 2F3WA 3HFZB 5GAEC 1PV4A 1VDZA 3F8TA 4KHPL 1F9SA 1U4RA 1BR9A 1NTGA 4IPDA 3MXNA 1WVLA 4ILWA 2JQOA 4A3GH 5JEAH 3HOUG 4N8X1 1WTWA 1PTOD 2A69C 3WWVA 1I50H 5C44H 1GUOA 1FR3A 1GUWA 1C7YA 4KKSA 2F4VQ 2AQ1B 1VQLA 3J80E 1EY6A 3K5MA 3T1HL 3BDCA 4LMQD 2KCTA 4JI0Q 3SK6A 3UE1A 1KRSA 4PZ8A 4X3SA 1K83B 2B3GA 4HIDA 4KV6A 4IZ8A 1PFMA 4IOAA 4P75A 4WORA 1TKWB 3GTKB 4L5SA 1C9OA 4BS9A 4K6DA 4LF7Q 1PTOC 4NMZA 3QOJA 4LFCQ 3TSSA 1FGBD 1SYEA 4NKLA 1B1ZA 1JR0D 1FD7D 1PRTB 5EBCA 2H1EA 4O1NA 3ZYYX 3GTQB 1VS0A 4TVAB 3HOUB 1EQTA 3Q24A 1EWHA 3STBD 2B2YA 5E7NA 4A3FG 1PRTF 4XT1B 1GM5A 2FJ2A 1N9WA 3A5UA 4A76A 2PW7A 3S9WA 2JA5B 1RTNA 4CKEA 3UDGA 1IBML 4N8FA 2PQEA 1PH7A 3EIVA 2D0PA 2DUDA 4UP8A 4BBSG 3PIP3 1UNSA 2NVTH 2EQSA 1QCBD 1J8IA 4XQQA 5I2YA 4QCLA 4RGOS 1O7ZA 4Y7NH 3NPPA 1HR0L 2R7DA 1PH4A 3T56B 3FPPA 2VQEL 3NTKA 4RFBA 1HNXL 1YNJD 4KN4C 1L1OA 1I6HH 4X66L 2A6HC 2RSOA 4JYAL 4LFCL 5DEHA 3VYRA 1BVSA 2KEEA 1QWYA 2E74C 3A54A 4H02A 3HOZB 2A74C 3VYSA 4WJ3M 4OWTB 4K2KA 1XWEA 2EJGC 1KRTA 2A6EC 1BCPB 4IFDJ 1K83H 4Q0FA 1SNCA 1RD9D 2K7VA 2M9VA 1GUTA 2GVBA 4IJLA 3R93A 4JV5L 2IL8A 3E9IA 1IBMQ 1HCZA 3PCOB 3KFUA 2K33A 1PZJD 2IX3A 5IP7G 4ME5A 1DJRD 3SK5A 4QY7A 4QMGA 4C1NK 3I4NH 4B3SL 5C3XA 4GKJQ 3NTIA 5IOCA 4JOIC 1U0LA 2IW3A 2PZWA 3NEMA 3F2CA 4QB4A 1SMYC 5I9OA 2X6LA 5JOBA 1M90C 2VL6A 1SNOA 1HNWL 2Q8IB 3I72A 4X64L 3K7UC 1HQMC 4OWWB 4HJ9A 1SFOH 2E2JB 2C35B 3CKIB 2A73B 2HQLA 4I7ZC 4YCUA 1QE6A 3NBIA 4RWSC 1FNVA 3X3MA 1ICWA 3H15A 4FP5D 3H91A 1I4HA 3GTOH 1BF4A 5BN4A 2OCEA 2OTJA 1R4PB 1LV9A 2O4XA 4OEMB 1L1OB 1SE8A 4K14A 1Y69U 4JW0A 1EOVA 3EROA 3QO2A 3VR4A 2A68D 3D8GA 4LUOA 2E2IB 3L7ZC 4DV3L 3A56A 5EKIA 1EU4A 4YHHQ 1N32L 4KY6A 4JI3Q 1W2BA 4AYBB 1WTQA 2PPBC 3S1NH 3IRBA 3T4AC 5JPMC 3C2PA 2MJ8A 1IW7D 2L4NA 3RLNA 5M3FH 2WP8J 3RN5A 1JJCB 2UUAL 5JJZA 3SVMA 2VUMB 4IFDI 1OXSC 4JI0L 3K57A 1KNAA 3E5SA 4QF4A 2L5TA 1GHKA 1G8ZD 3J7YW 1YIJA 1H9KA 2BE5C 2F0LA 2R7ZH 1SEBD 2K5DA 3R3OA 5IE8A 1CKNA 1EEFD 4CDDC 1OXTA 4P74A 3ZJYC 1FL0A 5C5LA 1EY9A 2VXWA 3VR5A 1HFNA 4K0KL 2Y0SE 3C1FA 3OW7A 4JBWA 1J9OA 3R2IA 4AYBE 5KNCA 1HNXQ 4JI3L 4DR6Q 1Y8OB 2F52A 4ZKCB 1JT8A 1SYFA 2HIVA 4A3EG 1UAPA 2TSSA 3MHBA 3SDZA 2EYJA 3IFDA 1X9NA 1SMXA 4DFAA 3RZDB 2FXQA 2D9UA 1PFSA 2YU9B 2ZM6Q 1CQFA 2R3ZA 4GOPA 1VQPA 4DXFA 5ELBA 2SNMA 5C5MA 1AW7A 1LYLA 3CCSA 2OTLA 4DR3Q 1UEBA 3TP8A 1PFBA 4KD4A 3H09A 4DV0L 1VQ9A 4IURA 4NXML 4B3MQ 3JAML 3K8AA 4DR4L 4C1NI 3E9HA 2D62A 1J6QA 5KYLA 1CQVA 4G7OC 4JI7Q 2CWAA 4KHPQ 1XTDA 1F9PA 5L37A 3I73A 3S15H 5EPLA 1RHPA 4C3JG 1Z47A 2ZJPA 3PF4A 5EKLA 4R8IA 5M3MB 4CDFC 1E3PA 2HCCA 1R4QB 3F2UA 4DR1L 3BG3A 3EFXD 3EA6A 3HEJA 2VNUD 3L0OA 3C3LA 5IGFA 1G6PA 1PA6A 5C3EH 3V96A 2I07B 3NENA 4DF7A 4YWLA 1Y1WB 2KCNA 5DLQE 4LF9L 4G7HC 5FJ8G 3J81i 5G3LD 1D6EC 1B8AA 5KEEA 2YU9H 1TWAH 3ER0A 3AEVA 1A0IA 1H9MA 2DY8A 4P73A 5EPKA 2YTYA 4R4TA 3S24A 3NUCA 4DV3Q 1D7QA 4HR7B 4J1MA 3KOJA 1IL8A 5C3WA 2KQ3A 4DUYQ 3M4OH 3TRZA 1A3TA 1RJTA 3P20A 4TQUS 1PH2A 4GN3B 5M3FG 4AQYQ 2ENBA 2F0GA 4JBJA 3M4PA 1RCVD 5IGBA 1Q8IA 5BN5A 3CD6A 2MO1A 4Y7NB 2AWNA 4BA1I 1PZID 2B63G 1KAWA 2EOTA 4BA2I 3MVVA 4IUNA 4Z9CB 5KNDA 4IPHA 1HNZL 3HOXG 5J1ZA 2EE1A 2KOLA 4R9WA 3T16A 4JOIA 2VS1A 3C46A 2I46A 1E1OA 2LS01 1EY5A 3PF5A 1ASZA 4ZCKA 4HJ8A 1X6OA 3FVQA 3CRLC 1XMOL 2N49A 2OQKA 4QIWE 4JG2A 4R1JA 3K0XA 3IFTA 4DNRB 4JI4Q 1E22A 2QGQA 4A3CG 2NTTA 3K7AH 4NW2A 1A3VA 1DYQA 3HKZE 3NWTA 1Q3LA 4LF5L 2X6GA 3RN2A 2A1AA 1CA5A 2A6ED 4C3HB 4BBRG 4FF1A 4A3IH 1O7IA 1E1TA 1S72A 3FKIH 1EY0A 3KF6A 2K5NA 5GAHC 2CKZB
chains in the Genus database with same CATH topology
5CV8A 1JWUD 2ICIA 4F87A 1RF2D 2NBFA 3QIAA 2NN6H 3D6CA 2Z4IA 1U9RA 5C6AA 1X3PA 2Q8RE 2E75C 4EGVA 2CW0D 2H4OA 1E2VA 1JOKA 3KLRA 3JAME 3TZUA 3K7AB 5FKAC 4RGMA 5EJWA 3SR1A 2EY6A 2A6HD 2F0FA 4HSPA 3A8KE 1ILPA 4C3IB 3HOXB 1SNQA 1V1PA 1S5BD 3U9SA 3I90A 4RA8A 3MFGA 3D3RA 3BVMA 4TKOB 2J4XA 3PO3B 4KD3A 5K36G 2LFNA 1GXDC 3GD7A 5IT9L 4EVOA 5AFWA 1WD1A 5CBEE 4H0LC 5CV5A 3AMUA 2WACA 4KTAA 1HA6A 2JA8B 4UAIA 4KY5A 4X3UA 2ICEC 3BDOA 2M00A 2K6AA 4A93B 4NP5A 4A3BB 3GQBA 3L3OC 1EU3A 2K03A 4IFDG 1NR4A 5K5PA 3AU7A 2PO4A 2BDOA 3QOLA 4ULLA 4K2LA 5JEAJ 1NCVA 2O5IC 1PTOH 1EZ6A 1FNWA 2NN6G 1TWCB 1FNUA 4RH6A 2A69D 1F9QA 1JICA 2L12A 2ZXRA 4FYDA 2O2LD 1EL0A 4C3JB 5A35A 1BO0A 3Q23A 3KBGA 1GUGA 1STBA 4DAVA 3OSOA 4RHRA 2RBMA 1OO9B 3MXUA 1YNNC 1EY7A 3ITPA 4XQJA 5D3DA 3HOVB 1WCMB 5EGTA 3FPUB 1Y8PB 2JXMB 1QB5D 2MPMA 3QG1A 3NHHA 4DK0A 3PMFA 2L11A 2BA1A 1L0YB 2NVXB 1KDBA 5M5WB 2PCFB 3M7NA 2RQXA 4X3TA 3IKJA 3Q22A 2F03A 3S16B 4DAYA 5ELCA 3D31A 4DNTB 2K5WA 3PUVA 5T1GA 1JWMD 4ZRZA 1VF5C 2R7ZB 3X3NA 1F2MA 3TN2A 5M5XB 1O80A 2BOSA 1O7YA 1ONLA 1YNND 2A68C 5FO7B 2EY2A 3EJIA 4LAAA 5FLXE 5C4XB 2ZXOA 1OXVA 2MHVA 3DHQA 5T1IA 1JORA 1S5FD 1VMCA 1G2TA 3MZ5A 4JK1C 2K1BA 3DM1A 4ZQ3A 3MXPA 2IX1A 2HQEA 5LL6X 3HG9A 4BWGB 4KJNA 2IPKD 4DN4M 4V190 1DCZA 3DMUA 4XIGS 2A5HA 3D6WA 5CV7A 4MIUA 5KGUA 5C3EB 1AEXA 2JEBI 4KI0A 2EDGA 3H0GB 2QF7A 3MC0B 3O13A 3PUWA 1QILA 5D14A 4IUPA 4DGZA 1D5XC 3SK4A 1TWFB 1TS4A 3TP5A 3PUYA 5JVG3 2R92B 4CKCA 1CI3M 3TP7A 4ID6A 5I9PA 2EYOA 2NVQB 1BCPF 2Z1CA 1S5DD 4TRDA 2J0TD 4RCOA 1EYCA 1LTTD 1S4ZA 1JCKB 1LTGD 2TMPA 2E2HB 4WJWA 2XIWA 1B9MA 3VYUA 3FMCA 5FO9B 1QG7A 1GOZA 4Q5VA 2ZXPA 2FFKB 1SYBA 4J6HA 1AP0A 1PDQA 1DD2A 2NTSA 4BBRB 4C3HG 2CHBD 5CV4A 4S3SA 2F0QA 4UDUC 2Y0SB 5IGGA 4CKBA 1EEID 1EY4A 2QCPX 4LK1C 1S5CD 4ODGA 3SK8A 3HOWB 4IALA 5CGKA 3A7LA 3LNNA 3H3VC 3H94A 1PRTC 3VYTA 2F0PA 4FNFA 4IUQA 1G2SA 5IIFA 2OXPA 4N9TA 5C4HA 1PMRA 3VA5A 1LABA 2IT1A 1FYCA 4H7BA 5M3FB 2KJXA 2N55A 1RDPD 4V0BA 5NUCA 3C1EA 2JSOA 3KUPA 1XYIA 2B2UC 3NQIA 3K59A 2F0MA 5EBDA 1V8QA 1BCPC 1CFMA 2AUJD 2WKCA 1ZXTA 4OHJA 4ZK9B 5ELDA 3R2TA 3OWEB 1EOTA 2BCOA 1STGA 3I4NB 3T51B 1NSNS 1HQRD 2RDGA 1B2TA 1B44D 3VR3A 3MXGA 1CA6A 3VA7A 1EYDA 2C5CA 4K5WA 2EYFA 2GA4B 1AZPA 1BQQT 3V2TA 1DXMA 2DNEA 3VR6A 1CHPD 1QNUA 3FRPB 3URYA 3PUZA 1QOHA 3DWPA 2QILA 5FOBB 5IGEA 2KEDA 4HN7A 2VB2X 1STNA 3HS0C 4YIJA 5HGTA 1BUVT 2L0CA 3NBHA 2HCIA 3W2DA 3EQLC 2HUGA 2HDLA 1BBXC 3R8BA 3RD4A 3OIPA 4PMCA 1KLUD 1I4PA 2AQ2B 1HA5A 4FF4A 1O7LA 4WFN3 2B2WC 2PW5A 1LT5D 1DM0B 1WTXA 3M4OB 1EWCA 4U673 1L0XB 1B9NA 4A3KB 1D5ZC 1QNKA 3OPOA 1TS3A 2CW0C 1BNZA 4ZUJA 1NAPA 3EVQA 1TWAB 5KIXA 3A55A 1IW7C 2LMCB 5DM63 4IUTA 1SAPA 5COYA 1Y8NB 2D2CC 3CQZB 1EY8A 3OMGA 1A2UA 5CORA 3MWYW 3M3YB 3OMCA 3A7AB 1WTVA 2B39A 2K04A 2N88A 1H9SA 1H9JA 4A3GB 3RZOB 4B9WA 4C2MB 5E4WC 4CHTB 1KAAA 1IHZA 2RDHA 4HSVA 1PLFA 2LY7A 5C4ZA 1OXXK 1F2LA 2R93B 1AN8A 4F8MA 1LO5D 1ZKOA 5CYUA 5J22A 2JEAI 2F0NA 3P7JA 2J7ZA 3DWAA 3SHLA 2O5JC 4B08A 2RKSA 1BCPD 2YYZA 5CBAE 2R6GA 3RLFA 5IGDA 1RKNA 4FO2A 3I8ZA 2OEOA 2PYKA 5C0XG 4G57A 2ZT9C 1LACA 2SDFA 1STYA 3J80L 4OIJA 2WAQB 3E6ZX 1PYWD 1JQYD 2XWBB 1I4GA 4A3FB 5KYIA 1D5MC 4ZAIA 3HGBA 1Y1VB 3W3AA 1XX8A 1SNDA 3N6RA 5A2QL 2NN6I 2B2UA 1GUNA 4RKLA 2EY5A 2WV6D 2XRSD 3M7GA 2B63B 1B50A 5KNBA 2BDNA 4RGNA 3DEOA 4RHSA 5E4XA 4HMJA 1ZEQX 3KK7A 3K6OA 5E3FA 1LTID 3I3CA 1SYDA 4PV1C 1SNMA 2IJ0A 2G9HD 2CQAA 2MUYA 1ET6A 2NZ1D 4N9PA 1F9RA 1I6VC 2DY7A 1WD0A 3U9OA 1ENAA 5F2DA 2EYHA 1SE2A 2MP1A 4LJZC 4FXGC 3PO2B 1ILQA 2L9HA 1VCIA 3NK9A 3P1HA 4G4KA 4H44C 3GP7A 1HXYD 3QB3A 1F77A 3OIQA 4HEDA 3ND9A 4DU9A 3S15B 4DA2A 3J7AF 5G3LF 3FKIB 2F0EA 1TY2A 2E2DC 4KMUC 1SMYD 1TQOA 5D65A 5IODA 3GTMB 3NE5B 3IL8A 2F0UA 3M4YA 1D2BA 2B2YC 3L9AX 2DNCA 4K5VA 2B2WA 2K05A 3I91A 4FF2A 1UUPA 4QUFA 4BY1B 4ABNA 3NTHA 2C9OA 3PIO3 1R9TB 4QUCA 1BXTA 1C48A 1RODA 5CMDA 1KTKA 4K8IA 4BY7B 4OGQC 1JE4A 5C0XJ 1G291 1O78A 3H6MA 3TDQA 1Q1BA 3DUZA 2XNAC 4M8AA 2HDMA 4L6TB 5LHY1 3A8IE 4KHZA 4HAEA 2F0IA 1ENCA 1LTAD 3GTGB 5HURA 3BYTB 4K5XA 3N52A 2B2TA 4FVMA 5CR3A 2AUKA 3CRKC 3I4LA 1EZ8A 2K01A 1EIGA 4CJ0B 3S2DB 2XVSA 3CHBD 1HRJA 2B8GA 1ZYRC 3BYYB 4A3DB 1JOQA 1U4PA 1SFOB 1LLRD 4XYQA 1XTCD 2RSNA 1PTOB 4XYOA 1GJXA 3TZDA 1PRTD 4IN3A 1CZWA 5IGCA 1JOOA 4HMIA 2B2VC 4A3IB 1IKLA 2SNSA 4TSSA 3NSWA 2QKIC 3DEPA 2F0TA 3GV6A 1IKMA 1HUNA 2ID0A 3K0YA 3A8JE 4OO1G 3MAQA 3NP8A 3S17B 3UI2A 3IAYA 3OWFA 3BS1A 2XRQD 5A2QE 4P2CB 3J81L 1JB3A 2OF1A 3HZXA 1V43A 1TR5A 4X3KA 1B53A 2SOBA 4R8NA 2M2LA 4KN7C 3ND8A 1A15A 2V4DA 3E0JA 2F0SA 5BN3A 5M5YB 4L63B 3PV0A 1MI2A 2F0HA 1I50B 5C44B 4EQPA 4OO1H 2EZVA 1HPCA 1B4OA 2KVMA 2D5DA 3TBIB 3HKZB 3ERQA 1LTSD 2AWOA 3HRZC 1II3A 3Q0AA 1TWHB 1JC7A 1HFGA 4RKBA 1S5ED 3DXJC 4IFDH 1M4VA 4QIWB 1K8MA 2Q8TA 1ESRA 4PNYA 3V05A 1EYAA 3S14B 4KK7A 3NWSA 5DM73 2WINB 1K8OA 5J39A 4MN3A 3I4MB 1SE4A 1EQVA 4K6LA 3GTJB 1EIHA 1STHA 1A3UA 1IYUA 3RMHA 2JA6B 1SE3A 1TWGB 1AFPA 2B8FA 4GZYC 3OHXC 5K36H 3ONAB 1F2YA 1SYGA 2FINB 3HP3A 2RA4A 2X69A 3G7LA 1RTOA 1PXUA 2NWGA 4L8JA 2JA7B 1A2TA 3S2HB 2MGSA 1W6JA 4KKUA 1NUCA 2EYLA 1WTRA 2EJFC 2BA0A 3OOCA 2EYMA 4E6IA 5EPJA 5I6WA 4RGTA 5I4DA 1I3QB 3S1QB 2FMMA 1C4QA 4ZKBB 4A3JB 1E2WA 4K8JA 4U68A 1LTRD 5M9OA 4CJ2C 1WTOA 1KABA 1PZKD 2FHTA 3T13A 4DXGA 3D4DA 4CJ1B 2B2TC 5DNFA 2PZTA 5ELEA 5JPNC 2G9DA 1TS5A 2JYOA 4IUUA 2JE6I 3MFYA 4RCNA 5JVH3 4C56C 2EXZA 4KJOA 4HTHA 1ESFA 1CZGA 5CV9A 1PFNA 1WTPA 2F0DA 1I6HB 1E0BA 1ZYRD 2EVBA 1DONA 2B2VA 3J81E 1TY0A 4IQZA 2NVTB 1TVXA 3S1MB 2OT2A 2F0KA 2Z4HA 1F2ZA 2JP1A 1SXTA 3J7AV 1SNPA 3K58A 1HTLD 2WB1B 1LTBD 5FO8B 4RAUC 1SJHD 1Q90A 5JEAG 3FDTA 1E2ZA 4OIKA 2XWJB 2F1MA 2XSCA 4G7ZC 2K5QA 4H13C 1SDFA 5E1FA 2RVLA 2EPBA 4FXKC 4XXEA 1CT1D 1KDCA 4EQOA 5TSSA 3GTPB 1VF7A 3K5LA 1LT6D 1B3AA 1EFID 4A3EB 3KBXA 4KKTA 3GTOB 4NDXA 3PUXA 3BVGA 1I4QA 2XN9C 2KA7A 2F0VA 1V1PB 3BZDB 5LL6S 3K5OA 5CC4A 1LT4D 1KLGD 1IYVA 3VR2A 1MSGA 4OO1I 1TT2A 2E76C 2Z8LA 5KRUA 4B9XA 2AQ3B 1H9SB 5ELFA 1STEA 5I6YA 1TU2B 1U4LA 4XQNA 3MTSA 3NXWA 1QJOA 1TIID 2RDFA 1CM9A 1KDAA 1PTOF 3RUZA 2F3VA 3DWQA 2WIIB 4C3IG 1V1OA 3QWNA 5C4JB 3SE0A 1GHJA 3QJYA 1NR2A 2KCCA 2PZUA 1T5XD 3Q6SA 1DOMA 4WRDA 5C0XH 2WKDA 5EQ0A 4KHVA 1OXUA 4CGYB 1DZ1A 2NVYB 4HCSA 2EYPA 1YNJC 1SYCA 2KHSA 3LWEA 3T53B 1A6XA 5ISRA 2NYZD 2EY1A 1HHVA 2KECA 4F88A 3G6JB 3KF8A 1DOLA 5FK9C 3BVZA 1HUMA 5IT9E 1MSHA 5I2XA 3WOFA 3HOYB 1HTPA 4F7XA 2IWHA 4ZUIA 2EJMA 1G91A 3M85A 4MHEA 2PMZB 5CV6A 2DN8A 1ML0D 1X32A 1TS2A 3FEWX 3MEHA 2L55A 1MGSA 3S1RB 2QEJC 1BDOA 2K32A 4PMBA 3GO5A 1MBYA 2VB3X 1AZQA 5JAVA 2KUMA 1Z6HA 1KNEA 1VMPA 3K5NA 4CBVA 4FXDA 4XT3B 1SBBB 1MD2D 3NQTA 2F4IA 1C8CA 4HCEA 1T5EA 2PNRC 4XDXA 1G6ZA 1CTMA 1Q1EA 3I70A 4IUVA 3GTLB 4KY7A 4PMWA 3D4RA 3D4WA 1I4XA 4EQNA 2NB0A 3LWUA 1H9RA 1U4MA 1CK1A 4XTCS 3KLSA 1X3QA 2F0OA 4DK1A 2BE5D 1XXGA 4J8QA 2SEBD 3TMEA 2FMCA 4I65A 1ET9A 4A3MB 3WOEA 2R61A 5C0XI 3KLSX 2F0WA 4M1UB 1LT3D 3CU7A 3MA2B 1DOKA 1CHQD 4ZYSA 1W6KA 5DAUA 3TP6A 4OL7A 2NUCA 3AB9A 1D1KA 3SEBA 2K28A 1UEAB 2CVRA 2QDBA 3BDLA 4PQXA 2L1BA 1Z7TA 1D1IA 5D3IB 5FLXL 3P75A 1JWSD 4DAPA 4FF3A 3LX0A 2LKVA 4ZLTF 1SSOA 3S1NB 1M8AA 1ENFA 4O42A 1SJED 1BOSA 2IX0A 4BBSB 3GV3A 1I4RA 1STAA 5EKKA 2F0JA 3WDNA 1Q12A 3SXHA 1GUSA 2F3WA 1VDZA 1F9SA 1U4RA 1BR9A 3MXNA 1WVLA 4ILWA 5JEAH 1WTWA 1PTOD 2A69C 1GUOA 1FR3A 1GUWA 4KKSA 2AQ1B 3J80E 1EY6A 3K5MA 3BDCA 4LMQD 3SK6A 4X3SA 1K83B 4KV6A 4IZ8A 1PFMA 4WORA 1TKWB 3GTKB 4BS9A 4K6DA 1PTOC 4NMZA 3QOJA 3TSSA 1FGBD 1SYEA 4NKLA 5EBCA 1B1ZA 1JR0D 1FD7D 1PRTB 2H1EA 4O1NA 3ZYYX 3GTQB 3HOUB 1EQTA 3Q24A 1EWHA 2B2YA 1PRTF 4XT1B 2FJ2A 2PW7A 3S9WA 2JA5B 1RTNA 4CKEA 2PQEA 3PIP3 1UNSA 1J8IA 1QCBD 4XQQA 5I2YA 4QCLA 4RGOS 1O7ZA 3NPPA 3T56B 3FPPA 3NTKA 4RFBA 1YNJD 4KN4C 2A6HC 2RSOA 5DEHA 3VYRA 2KEEA 1QWYA 2E74C 3A54A 3HOZB 2A74C 3VYSA 4K2KA 1XWEA 2EJGC 2A6EC 1BCPB 4IFDJ 4Q0FA 1SNCA 1RD9D 2K7VA 2M9VA 1GUTA 3R93A 2IL8A 1HCZA 2K33A 1PZJD 2IX3A 4ME5A 1DJRD 3SK5A 4QMGA 4C1NK 5C3XA 3NTIA 5IOCA 2PZWA 2IW3A 4QB4A 1SMYC 5I9OA 2X6LA 5JOBA 1SNOA 2Q8IB 3I72A 1HQMC 2E2JB 3CKIB 2A73B 4I7ZC 1QE6A 3NBIA 4RWSC 1FNVA 3X3MA 1ICWA 4FP5D 3H91A 1I4HA 1BF4A 5BN4A 1R4PB 1LV9A 2O4XA 4K14A 1Y69U 3EROA 3QO2A 3VR4A 2A68D 3D8GA 2E2IB 3L7ZC 3A56A 5EKIA 1EU4A 4KY6A 4AYBB 1WTQA 2PPBC 3C2PA 3T4AC 5JPMC 2MJ8A 1IW7D 2L4NA 2WP8J 5JJZA 3SVMA 2VUMB 4IFDI 1OXSC 3K57A 1KNAA 3E5SA 4QF4A 2L5TA 1GHKA 3J7YW 1G8ZD 1H9KA 2BE5C 2F0LA 1SEBD 2K5DA 3R3OA 1EEFD 1OXTA 5C5LA 1EY9A 2VXWA 3VR5A 1HFNA 3C1FA 3OW7A 4JBWA 1J9OA 3R2IA 5KNCA 1Y8OB 4ZKCB 1SYFA 1UAPA 2TSSA 3MHBA 3SDZA 2EYJA 3IFDA 4DFAA 3RZDB 2D9UA 2YU9B 1CQFA 2R3ZA 4DXFA 5ELBA 2SNMA 5C5MA 1AW7A 3TP8A 1PFBA 4KD4A 3H09A 4IURA 3JAML 4C1NI 2D62A 5KYLA 1CQVA 4G7OC 1F9PA 3I73A 5EPLA 1RHPA 4C3JG 1Z47A 5EKLA 4R8IA 5M3MB 2HCCA 1R4QB 3F2UA 3BG3A 3EFXD 3EA6A 3HEJA 2VNUD 3C3LA 5IGFA 3V96A 2I07B 4DF7A 1Y1WB 2KCNA 4G7HC 5G3LD 1D6EC 5KEEA 2DY8A 1H9MA 5EPKA 3NUCA 4HR7B 4J1MA 1IL8A 5C3WA 2KQ3A 1A3TA 1RJTA 3P20A 4TQUS 2ENBA 2F0GA 1RCVD 5IGBA 1Q8IA 5BN5A 4Y7NB 2AWNA 4BA1I 1PZID 2EOTA 4BA2I 3MVVA 4IUNA 4Z9CB 5KNDA 5J1ZA 2EE1A 2KOLA 4R9WA 3T16A 3C46A 2I46A 2LS01 1EY5A 3FVQA 3CRLC 3IFTA 4DNRB 2NTTA 4NW2A 1A3VA 1DYQA 3NWTA 1Q3LA 2X6GA 1CA5A 2A6ED 4C3HB 4FF1A 1EY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZQ3 A;  4WOR A;  5CV8 A;  5K5P A;  5E1F A;  2F0O A;  4WRD A;  3QOL A;  5M9O A;  3MXP A;  5CR3 A;  5EKL A;  1KAB A;  4K2L A;  4K6D A;  4KHV A;  3TME A;  4F8M A;  2HQE A;  2F0P A;  1EZ8 A;  4I65 A;  3ERQ A;  1KDC A;  1EZ6 A;  3T13 A;  5J22 A;  4EQO A;  3HEJ A;  2O4X A;  3QOJ A;  4NMZ A;  4KJN A;  1II3 A;  4K14 A;  2F0N A;  2EYP A;  3D6C A;  5IGF A;  3NK9 A;  3D4D A;  3ERO A;  1SYE A;  4NKL A;  4RKB A;  3P1H A;  3SHL A;  2RKS A;  5IIF A;  1U9R A;  5C6A A;  3D8G A;  3DMU A;  4DF7 A;  2F0W A;  2OXP A;  1SYC A;  2KHS A;  5IGD A;  2PZT A;  1JOK A;  1RKN A;  3QB3 A;  4N9T A;  4PNY A;  5CV7 A;  4MIU A;  5C4H A;  5ISR A;  1EYA A;  2EY1 A;  4KY6 A;  3VA5 A;  4DU9 A;  5KGU A;  1JOQ A;  1AEX A;  2F0E A;  2OEO A;  2PYK A;  5DAU A;  3TP6 A;  4OL7 A;  4G57 A;  4PMC A;  4H7B A;  5KEE A;  5J39 A;  1STB A;  2PW7 A;  3S9W A;  3OSO A;  1TQO A;  1STY A;  2RBM A;  2NUC A;  2PQE A;  4NDX A;  5NUC A;  4DGZ A;  4EQN A;  3SK4 A;  3C1E A;  3TP5 A;  5IOD A;  1EQV A;  3NUC A;  1STH A;  1EY7 A;  2PW5 A;  3ITP A;  4J1M A;  2EXZ A;  4KJO A;  5IGC A;  2F0V A;  1A3U A;  4HTH A;  5C3W A;  1JOO A;  2KQ3 A;  4HMI A;  2F0M A;  2QDB A;  5EGT A;  3BDL A;  5I6Y A;  3TP7 A;  5CV9 A;  3SR1 A;  2SNS A;  4ID6 A;  1A3T A;  2EY6 A;  2F0U A;  5I9P A;  2EYO A;  2F0D A;  5KYI A;  3NHH A;  3E5S A;  4F7X A;  5CC4 A;  4QF4 A;  4TRD A;  2F0F A;  3PMF A;  1EYC A;  4K5V A;  4ZUI A;  2ENB A;  2F0G A;  1SND A;  2F0L A;  1F2Y A;  2F0T A;  3P75 A;  1SYG A;  1KDB A;  5DEH A;  4ZUJ A;  3R3O A;  5IGB A;  3EVQ A;  3LX0 A;  5CV6 A;  2LKV A;  1SNQ A;  4RKL A;  5KIX A;  5C5L A;  1EY9 A;  1STG A;  2EY5 A;  1SYB A;  1TT2 A;  4K2K A;  3C1F A;  3MEH A;  3MVV A;  1NSN S;  2F0K A;  4IUN A;  1F2Z A;  3NP8 A;  1SNC A;  4J6H A;  5J1Z A;  3T16 A;  5KRU A;  1STA A;  4B9X A;  5EKK A;  2F0J A;  4KD3 A;  1SYF A;  1A2T A;  1EYD A;  3MHB A;  3OWF A;  1EY5 A;  4K8I A;  4PMB A;  2EYJ A;  3SXH A;  4EQP A;  5JAV A;  4K5W A;  4DFA A;  1EY8 A;  1F2M A;  3OMG A;  2EYF A;  2F3W A;  1A2U A;  1SNP A;  5CV4 A;  4HMJ A;  4ME5 A;  4EVO A;  3SK5 A;  3NXW A;  4QMG A;  4S3S A;  1NUC A;  2F0Q A;  3OMC A;  3V2T A;  5C3X A;  2EYL A;  3NQT A;  2RDF A;  5E3F A;  2OF1 A;  3HZX A;  5IOC A;  5CV5 A;  2PZW A;  1KDA A;  2SNM A;  5C5M A;  3RUZ A;  1TR5 A;  2EYM A;  2WAC A;  2F3V A;  3H6M A;  4KTA A;  4QB4 A;  4E6I A;  2SOB A;  4R8N A;  5I6W A;  3TP8 A;  5I9O A;  1SYD A;  4KD4 A;  1A3V A;  5IGG A;  2EY2 A;  3EJI A;  4B9W A;  5JOB A;  4KY5 A;  1SNM A;  1EY4 A;  2F0S A;  1EY6 A;  2M00 A;  4KY7 A;  3BDC A;  4LAA A;  5KYL A;  1SNO A;  4N9P A;  4NP5 A;  1KAA A;  1IHZ A;  3DHQ A;  3SK6 A;  4ODG A;  2PZU A;  3SK8 A;  5IGE A;  1JOR A;  5C4Z A;  4IAL A;  2F0I A;  1ENC A;  5CGK A;  3U9O A;  1ENA A;  1EY0 A;  3MZ5 A;  4KV6 A;  2EYH A;  4IZ8 A;  5F2D A;  5HUR A;  1STN A;  5HGT A;  2F0H A;  4YIJ A;  4K5X A;  3D4W A;  4K8J A; 
#chains in the Genus database with same CATH topology
 5J3B A;  5CV8 A;  4DR2 Q;  1JWU D;  2ICI A;  2Q2I A;  2OWO A;  3HOX H;  1EIY B;  5ELO A;  4F87 A;  1RF2 D;  2NBF A;  3QIA A;  2RCF A;  2NN6 H;  3CP0 A;  3D6C A;  4A3D H;  2Z4I A;  1U9R A;  5C6A A;  3HOZ H;  1X3P A;  2Q8R E;  2UU9 Q;  2E75 C;  4EGV A;  2CW0 D;  2H4O A;  5AJ3 L;  2R93 G;  1E2V A;  1JOK A;  3KLR A;  2ATW A;  3W1B A;  2CWP A;  3KJO A;  4BY7 H;  1WYD A;  3JAM E;  1Q7Y C;  1N36 Q;  3TZU A;  4JBK A;  1YHA A;  4A3G G;  4FDB A;  3K7A B;  5FKA C;  4A4I A;  1HR0 Q;  3I2Z A;  1QVG A;  4RGM A;  5EJW A;  3SR1 A;  2BH2 A;  2EY6 A;  2IY5 B;  2A6H D;  5IT9 c;  2E2J H;  2F0F A;  1XNQ L;  4HSP A;  3A8K E;  1PHJ A;  3ICE A;  2CH4 W;  1ILP A;  5C3E G;  4C3I B;  4R4C A;  2K14 A;  1SNQ A;  3HOX B;  1V1P A;  1S5B D;  3U9S A;  2IHE A;  1PH3 A;  3H3V H;  3I90 A;  4RA8 A;  4AIM A;  3MFG A;  3D3R A;  3BVM A;  3NEL A;  3KYH C;  4TKO B;  1RL2 A;  1JMC A;  2JN4 A;  2J4X A;  3PO3 B;  4KD3 A;  1X56 A;  5K36 G;  5JJI A;  2LFN A;  1GXD C;  4L5Q A;  3GD7 A;  5C4X G;  5IT9 L;  4EVO A;  1VQK A;  5AFW A;  1WD1 A;  5CBE E;  4B3M L;  4H0L C;  5CV5 A;  3AMU A;  1PYB A;  2WAC A;  4KTA A;  1HA6 A;  3CC2 A;  2JA8 B;  4UAI A;  2KHI A;  4KY5 A;  2ICE C;  1FVI A;  4X3U A;  2VQF L;  3BDO A;  3PIO A;  2M00 A;  2K6A A;  4JI8 Q;  3CCJ A;  1ASY A;  4A93 B;  4NP5 A;  4A3B B;  3GQB A;  3L3O C;  1U5K A;  1B7Y B;  1NBW A;  2Z9H A;  1EU3 A;  2K03 A;  4IFD G;  1Y1W G;  1NR4 A;  5K5P A;  3AU7 A;  4L5T A;  2PO4 A;  2BDO A;  3QOL A;  4ULL A;  1HJP A;  4K2L A;  5JEA J;  1NCV A;  1W3S A;  2MNA A;  2O5I C;  1PTO H;  1EZ6 A;  1FNW A;  2NN6 G;  1TWC B;  1FNU A;  4RH6 A;  2A69 D;  1F9Q A;  2DJF C;  1JIC A;  5M3M G;  2L12 A;  2ZXR A;  4FYD A;  4C3J H;  2O2L D;  1NJI C;  1EL0 A;  4C3J B;  5A35 A;  1BO0 A;  3U4Z A;  4X66 Q;  4GNX C;  3Q23 A;  3KBG A;  2UUC L;  2N78 A;  1GUG A;  1IBK L;  1STB A;  4DAV A;  1JJG A;  3OSO A;  4RHR A;  5IYB G;  2RBM A;  1OO9 B;  1PH9 A;  3MXU A;  4HIK A;  1YNN C;  1EY7 A;  3ITP A;  2LXK A;  1TWG H;  4XQJ A;  5D3D A;  3HOV B;  1WCM B;  1BKB A;  2K50 A;  1TWF H;  5EGT A;  1SRU A;  3FPU B;  1Y8P B;  2JXM B;  1QB5 D;  2MPM A;  3QG1 A;  4DV1 L;  2ZJQ A;  3NHH A;  4DK0 A;  3PMF A;  1Y1V H;  3CMA A;  3CQZ H;  1KHI A;  1VQG A;  2BA1 A;  2L11 A;  1L0Y B;  2NVX B;  2AKW B;  4BXX H;  1KDB A;  3F2D A;  5M5W B;  2PCF B;  4GN4 B;  1HNZ Q;  2AMC B;  3M7N A;  2RQX A;  1OTC A;  4X3T A;  3IKJ A;  3Q22 A;  2F03 A;  3S16 B;  4DV4 L;  4DAY A;  1EUJ A;  5ELC A;  3D31 A;  4DNT B;  2K5W A;  1CKN B;  1PH5 A;  2R92 H;  1X55 A;  3PUV A;  5T1G A;  1JWM D;  1XMO Q;  4ZRZ A;  1VF5 C;  2R7Z B;  4AQY L;  3X3N A;  2VQE Q;  1F2M A;  4A93 G;  1CSP A;  5LMN W;  1B70 B;  1N36 L;  3TN2 A;  5M5X B;  1O80 A;  2BOS A;  1O7Y A;  1ONL A;  1VQB A;  1YNN D;  4A3J H;  2A68 C;  2E8G A;  5FO7 B;  1HR0 W;  2EY2 A;  3EJI A;  3CCL A;  2YTX A;  4QGU A;  4LAA A;  5FLX E;  5C4X B;  2ZXO A;  1OXV A;  2MHV A;  4DR2 L;  3DHQ A;  5T1I A;  1JOR A;  2NZO A;  1S5F D;  1VMC A;  1G2T A;  3MZ5 A;  4JK1 C;  2K1B A;  3DM1 A;  4ZQ3 A;  4MTN A;  3MXP A;  1NMG A;  1CKO A;  4EX5 A;  2IX1 A;  2HQE A;  2HHH Q;  5LL6 X;  2N8N A;  3HG9 A;  4BWG B;  4KJN A;  2IPK D;  4DN4 M;  4R4I A;  4GOP B;  4V19 0;  1DCZ A;  3DMU A;  4X62 L;  4XIG S;  2A5H A;  3OTO Q;  3D6W A;  2ZTD A;  4MIU A;  5CV7 A;  5KGU A;  5C3E B;  1AEX A;  4B3T Q;  2DGY A;  2JEB I;  4KI0 A;  3HOW G;  1GD7 A;  2EDG A;  3H0G B;  2QF7 A;  3MC0 B;  3O13 A;  3PUW A;  2E2H H;  1C0A A;  1UE6 A;  1QIL A;  5D14 A;  4IOC A;  4IUP A;  4DGZ A;  1D5X C;  1V9P A;  3SK4 A;  1TWF B;  1TS4 A;  3TP5 A;  4LNQ A;  2UXD L;  1EQQ A;  1JJ2 A;  3PUY A;  1UE5 A;  2RHQ B;  3TQY A;  5JVG 3;  4JI5 Q;  2R92 B;  4A3J G;  3JC6 6;  4CKC A;  5LMN L;  1CI3 M;  3TP7 A;  4ID6 A;  5I9P A;  2EYO A;  1Q46 A;  1XPR A;  2NVQ B;  1PH1 A;  1BCP F;  2Z1C A;  3CCV A;  1S5D D;  4TRD A;  2J0T D;  4RCO A;  1EYC A;  1LTT D;  1YHB A;  1S4Z A;  1JCK B;  1LTG D;  2TMP A;  1VQ8 A;  2E2H B;  4WJW A;  2XIW A;  5M3M H;  5IP7 H;  1CUK A;  1B9M A;  1VQ5 A;  3VYU A;  3FMC A;  4DR3 L;  5FO9 B;  1QG7 A;  3DM3 A;  1GOZ A;  1SN8 A;  4Q5V A;  2ZXP A;  3M9B A;  2FFK B;  3G71 A;  4YCW A;  1SYB A;  3M3Y H;  4LUV A;  3CCQ A;  3HOZ G;  3MEF A;  4J6H A;  3HOV H;  1AP0 A;  1PDQ A;  4IPG A;  1DD2 A;  2NTS A;  4BBR B;  4C3H G;  2CHB D;  5CV4 A;  2JA7 G;  2UXD Q;  1VQ4 A;  4S3S A;  4X6A H;  2F0Q A;  4UDU C;  1LM0 A;  1UWV A;  1HZC A;  5IP9 H;  4ME3 A;  1N34 Q;  1X65 A;  1NMF A;  2JK8 A;  2Y0S B;  5IGG A;  4CKB A;  1EEI D;  4YY3 L;  5IYB H;  1MHW C;  1EY4 A;  5C4X H;  2QCP X;  1VQD A;  4LK1 C;  3MXN B;  1I5F A;  4ALP A;  3I7F A;  1S5C D;  4ODG A;  3SK8 A;  2ZTC A;  3HOW B;  4IAL A;  5CGK A;  3M4Q A;  3A7L A;  3LNN A;  3H3V C;  3H94 A;  1PRT C;  4A3F H;  3VYT A;  1I94 L;  2ALY B;  4R4O A;  4LF4 L;  2F0P A;  4GS3 A;  3VDY A;  1N33 L;  4FNF A;  3W1G A;  2JJQ A;  4A3B H;  2UXB L;  4IUQ A;  1G2S A;  2YV5 A;  2UU9 L;  5IIF A;  1Y1W H;  2OXP A;  2WAQ E;  4N9T A;  5C4H A;  1PMR A;  3VA5 A;  1AE2 A;  1WOC A;  1LAB A;  3G6E A;  2IT1 A;  2I0Q A;  1FYC A;  4H7B A;  4C3I H;  4JPB W;  4IJH A;  1E7Z A;  1EWI A;  2KJX A;  3I55 A;  2N55 A;  3CCE A;  5M3F B;  2VUM H;  1RDP D;  4V0B A;  5NUC A;  5EAY A;  3C1E A;  2JSO A;  4DR1 Q;  3KUP A;  3G4S A;  1YEZ A;  1XYI A;  2B2U C;  3NQI A;  2PQA A;  2F0M A;  1QUQ A;  5C44 G;  3K59 A;  1J5E L;  5EBD A;  5FJ8 H;  1V8Q A;  3S1M H;  3J7Z C;  1BCP C;  4C2M H;  4DK6 C;  1CFM A;  4A75 A;  4LF9 Q;  1BBU A;  2AUJ D;  1IBK Q;  2WKC A;  1ZXT A;  4OHJ A;  4JI4 L;  1GO3 E;  4ZK9 B;  5ELD A;  3R2T A;  3OWE B;  1EOT A;  2N3S A;  3G48 A;  2I5L X;  3CCU A;  2BCO A;  3UDI A;  1STG A;  4JC0 A;  3I4N B;  2CH4 A;  3T51 B;  1NSN S;  1HQR D;  2RDG A;  4JCV E;  1B2T A;  1B44 D;  3VR3 A;  3MXG A;  1CA6 A;  4BXX G;  3VA7 A;  1EYD A;  2C5C A;  4K5W A;  2EYF A;  2V1C C;  4DV6 Q;  2GA4 B;  1BQQ T;  3V2T A;  2DJG C;  1AZP A;  1DXM A;  2DNE A;  3VR6 A;  4DR7 Q;  2G5D A;  1CHP D;  1QNU A;  1J5E Q;  3FRP B;  3URY A;  3AQQ A;  3PUZ A;  1Q81 C;  1QOH A;  3DWP A;  4DV2 Q;  2QIL A;  5LMN Q;  5GQO A;  2D0O A;  5FOB B;  5FLM H;  3PGZ A;  4LFA Q;  5IGE A;  2KED A;  4HN7 A;  4CDE C;  2VB2 X;  2Z0S A;  5IP9 G;  1STN A;  3HS0 C;  3QR8 A;  4YIJ A;  1VQA A;  5HGT A;  2ES2 A;  1BUV T;  2L0C A;  3NBH A;  2HCI A;  3W2D A;  3EQL C;  4A3M H;  1N8R C;  1GVP A;  1YBY A;  2HUG A;  1VQE A;  2HDL A;  1BBX C;  1I3Q H;  2YTV A;  1R9T H;  3BZK A;  3R8B A;  1YJW A;  4A3L G;  3RD4 A;  1VQJ A;  3OIP A;  4OWX B;  4PMC A;  1KLU D;  3CCM A;  4DV2 L;  2JA5 H;  1I4P A;  2AQ2 B;  1HA5 A;  5C4J H;  4FF4 A;  3I56 A;  1O7L A;  4WFN 3;  2B2W C;  3GTK H;  4YY3 Q;  2PW5 A;  1LT5 D;  4DV5 Q;  3HOU H;  3HKZ G;  1DM0 B;  1WTX A;  3M4O B;  1EWC A;  4U67 3;  1L0X B;  1B9N A;  1XMQ L;  3CXC A;  4A3K B;  1D5Z C;  1QNK A;  3OPO A;  1TS3 A;  2CW0 C;  1LUZ A;  1BNZ A;  4ZUJ A;  4AYB G;  1NAP A;  3EVQ A;  2ZM6 L;  1TWA B;  3EN2 A;  5KIX A;  2RHS B;  3A55 A;  1IW7 C;  1KXL A;  2LMC B;  4I7A A;  5DM6 3;  2GN5 A;  2K75 A;  1QZG A;  2Z6K C;  2UUB L;  4IUT A;  1SAP A;  5COY A;  1S40 A;  2MQH A;  1Y8N B;  2D2C C;  3CQZ B;  4DV5 L;  1EY8 A;  3OMG A;  1A2U A;  3HOY G;  5COR A;  3MWY W;  3M3Y B;  3OMC A;  1SLJ A;  4GN5 A;  3A7A B;  3FHW A;  1IBL L;  1WTV A;  2B39 A;  2PI2 E;  2K04 A;  2N88 A;  1H9S A;  1H9J A;  1XMQ Q;  4A3G B;  3RZO B;  4B9W A;  2UUA Q;  1CKM A;  2CCZ A;  4C2M B;  4NB3 A;  5E4W C;  3OW2 A;  4CHT B;  4QJF A;  2NVQ H;  1KAA A;  1IHZ A;  2RDH A;  4HSV A;  1PLF A;  2LY7 A;  5C4Z A;  3RZO H;  1OXX K;  4OX9 Q;  4LWC A;  1F2L A;  2R93 B;  1AN8 A;  4F8M A;  1LO5 D;  1ZKO A;  1L0W A;  4UP9 A;  5CYU A;  5J22 A;  2JEA I;  2F0N A;  3P7J A;  2J7Z A;  3DWA A;  3SHL A;  2O5J C;  4B08 A;  2RKS A;  3FKI G;  1BCP D;  2YYZ A;  5CBA E;  2R6G A;  3RLF A;  4JI8 L;  5IGD A;  1RKN A;  1JB7 A;  4FO2 A;  3I8Z A;  2OEO A;  2PYK A;  5C0X G;  4G57 A;  1YJ9 A;  2ZT9 C;  1LAC A;  2SDF A;  3NBH B;  1STY A;  1VQI A;  3J80 L;  1N33 Q;  4OIJ A;  1BBW A;  1VQM A;  3E6Z X;  2WAQ B;  4UY8 C;  1PYW D;  1JQY D;  2XWB B;  1I4G A;  4A3C H;  4A3F B;  2MO0 A;  5KYI A;  3F1Z A;  1D5M C;  2JA5 G;  1EQR A;  1WI5 A;  4ZAI A;  3HGB A;  1Y1V B;  3W3A A;  1XX8 A;  1SND A;  3N6R A;  4GOP C;  5A2Q L;  2NN6 I;  1Q82 C;  2B2U A;  1GUN A;  4RKL A;  2A19 A;  2EY5 A;  2WV6 D;  3GTM H;  1X3E A;  2KBN A;  3RLO A;  2XRS D;  3M7G A;  2B63 B;  4IPC A;  2E2I H;  2Q2U A;  3J80 c;  1B50 A;  5KNB A;  2OQ0 A;  2BDN A;  4RGN A;  3PSI A;  3DEO A;  4P71 A;  4QL5 A;  4RHS A;  4GLA C;  4DR4 Q;  5E4X A;  4HMJ A;  1PYS B;  1ZEQ X;  3KK7 A;  2R7F A;  3K6O A;  5E3F A;  1LTI D;  3S14 H;  3I3C A;  1SYD A;  4PV1 C;  1VQ6 A;  1K0R A;  1SR3 A;  1SNM A;  4B3R L;  2IJ0 A;  2G9H D;  2CQA A;  2MFI A;  2MUY A;  2PMZ E;  1ET6 A;  2NZ1 D;  4N9P A;  5IWA L;  3HOY H;  1F9R A;  1I6V C;  2DY7 A;  3JAM i;  1WD0 A;  3U9O A;  1ENA A;  5F2D A;  2EYH A;  5BR8 Q;  3GTG H;  1SE2 A;  2JA6 H;  2MP1 A;  2XTI A;  4LJZ C;  4FXG C;  3PO2 B;  1ILQ A;  3S16 H;  4RMF A;  2L9H A;  3S17 H;  3CW2 C;  1VCI A;  4JI1 Q;  3NK9 A;  1NY4 A;  3P1H A;  4G4K A;  1QVC A;  4H44 C;  1P16 A;  3GP7 A;  4DR5 Q;  1HXY D;  3QB3 A;  2E5L L;  1F77 A;  3OIQ A;  4HED A;  3ND9 A;  4DNI A;  4DU9 A;  3S15 B;  4DA2 A;  4R4Q A;  3TS0 A;  3PQI A;  3FKI B;  5G3L F;  2F0E A;  1TY2 A;  2E2D C;  3J7A F;  4JI2 L;  4KMU C;  3K81 C;  1SMY D;  1TQO A;  5D65 A;  5HY6 A;  1RIP A;  5IOD A;  1QZH A;  1YJN A;  3GTM B;  3I4N G;  3NE5 B;  3IL8 A;  2F0U A;  3M4Y A;  1D2B A;  2B2Y C;  3L9A X;  2DNC A;  4K5V A;  2B2W A;  2K05 A;  3I91 A;  4DR5 L;  4FF2 A;  4BY1 H;  1XPU A;  1UUP A;  3UE0 A;  2Z6K A;  4QUF A;  4BY1 B;  4ABN A;  1TWC H;  4A3M G;  1T9H A;  4JI1 L;  2K5H A;  4GKK L;  3NTH A;  3RR5 A;  3S2D H;  2C9O A;  3PIO 3;  1R9T B;  1JE5 A;  4QUC A;  1BXT A;  1C48 A;  1ROD A;  5CMD A;  2QEX A;  1KTK A;  4K8I A;  4BY7 B;  4IO9 A;  4BBR H;  4JBM A;  2B29 A;  1FGU A;  4OGQ C;  1A62 A;  1JE4 A;  1UE1 A;  5C0X J;  1G29 1;  1IXR A;  1O78 A;  2QA4 A;  3H6M A;  4DAY B;  3TDQ A;  2VUM G;  3GTQ H;  1Q1B A;  5FLM G;  3DUZ A;  3HOW H;  2XNA C;  4PG3 A;  4M8A A;  1XNR Q;  2HDM A;  4L6T B;  5LHY 1;  4A3K G;  3A8I E;  4KHZ A;  4HAE A;  1WFQ A;  2F0I A;  1ENC A;  1LTA D;  3LGJ A;  3GTG B;  5HUR A;  3BJU A;  3BYT B;  4K5X A;  3N52 A;  1KQS A;  5GRO A;  2B2T A;  1TXY A;  2JA9 A;  4FVM A;  2AUK A;  5CR3 A;  3UDF A;  4WJ4 A;  2K52 A;  3CRK C;  3I4L A;  3GTJ H;  4LFB Q;  1EZ8 A;  4AH6 A;  4A3E H;  5LMU Q;  2K01 A;  1EIG A;  2F4V L;  4CJ0 B;  3S2D B;  5JJL A;  1KD1 C;  2Y0S G;  3UDX A;  2XVS A;  3CHB D;  5GAG C;  1HRJ A;  2B8G A;  4OX9 L;  1ZYR C;  3BYY B;  4NXM Q;  4A3D B;  1JOQ A;  1U4P A;  1SFO B;  1LLR D;  3J80 i;  4XYQ A;  1XTC D;  3ULL A;  2RSN A;  1WTH A;  1CSQ A;  1PTO B;  5IYD H;  4XYO A;  3KF8 B;  4HJA A;  1I94 Q;  1TWH H;  4NXN L;  1GJX A;  4DKA C;  1XNQ Q;  3TZD A;  2RCN A;  1PRT D;  2PNH A;  1VQH A;  4IN3 A;  1CZW A;  4PZ6 A;  4DV4 Q;  1K73 C;  5IGC A;  1HNW Q;  1JOO A;  4HMI A;  2B2V C;  3CAM A;  1IKL A;  2SNS A;  4A3I B;  4JYA Q;  4TSS A;  5LMU L;  5GAD C;  3NSW A;  4LW1 A;  4MZ9 A;  4DUZ L;  2QKI C;  3DEP A;  1K28 A;  2F0T A;  1YHQ A;  3GV6 A;  1IKM A;  3H0G H;  1HUN A;  2QDL A;  1XJV A;  2I5M X;  1IL2 A;  2JA8 H;  2EIF A;  2ID0 A;  3K0Y A;  4HJ7 A;  3A8J E;  4OO1 G;  3MAQ A;  3NP8 A;  3S17 B;  3UI2 A;  3IAY A;  2Q2T A;  3A74 A;  3OWF A;  3BS1 A;  2XRQ D;  2WB1 E;  4GLV B;  5A2Q E;  1X3G A;  4P2C B;  3J81 L;  1YI2 A;  4DV7 Q;  1JB3 A;  2OF1 A;  3HZX A;  1V43 A;  1TR5 A;  4X3K A;  1B53 A;  2SOB A;  4R8N A;  4OON A;  2M2L A;  4KN7 C;  3ND8 A;  1MJE A;  1A15 A;  2V4D A;  3E0J A;  1YIT A;  2F0S A;  5BN3 A;  4POG A;  5HGQ A;  5M5Y B;  4L63 B;  3PV0 A;  1MI2 A;  2F0H A;  1I50 B;  5C44 B;  4EQP A;  4OO1 H;  2R93 H;  2EZV A;  1HPC A;  1B4O A;  4HIM A;  2KVM A;  3I4O A;  2D5D A;  3TBI B;  3HKZ B;  3ERQ A;  1LTS D;  1PVO A;  4LF4 Q;  2AWO A;  4YHH L;  3HRZ C;  4B3R Q;  1N32 Q;  1II3 A;  3Q0A A;  1TWH B;  1JC7 A;  1YNX A;  1HFG A;  4RKB A;  1S5E D;  3DXJ C;  4X64 Q;  4IFD H;  1M4V A;  4QIW B;  1K8M A;  2Q8T A;  1ESR A;  4PNY A;  3V05 A;  3BZC A;  1EYA A;  2UXC L;  3S14 B;  3HKS A;  4LFB L;  4KK7 A;  3NWS A;  5DM7 3;  2WIN B;  1K8O A;  5J39 A;  3CF5 A;  1K3R A;  4DV1 Q;  4MN3 A;  3I4M B;  4LF5 Q;  3I4M H;  1SE4 A;  3J7A 5;  4GLX A;  1EQV A;  4K6L A;  3GTJ B;  1EIH A;  1STH A;  1LTL A;  1A3U A;  1IYU A;  1X54 A;  3RMH A;  2KHJ A;  1IZ6 A;  3CC7 A;  2JA6 B;  1SE3 A;  1TWG B;  1AFP A;  4KLK A;  2B8F A;  4LUZ A;  4GZY C;  3OHX C;  5K36 H;  3ONA B;  5IYC H;  1F2Y A;  1SYG A;  2FIN B;  1FJG L;  3HP3 A;  3T1Y L;  2RF4 A;  4P72 A;  1KC8 C;  1Q86 C;  2RA4 A;  2X69 A;  1S3O A;  3G7L A;  1RTO A;  1PXU A;  3PIP A;  2UXC Q;  2NWG A;  4L8J A;  2JA7 B;  3ULJ A;  1VQF A;  1A2T A;  3S2H B;  2NVY H;  1KIX A;  3EBE A;  2MGS A;  1W6J A;  4KKU A;  1NUC A;  4DV0 Q;  2EYL A;  1WTR A;  2EJF C;  2BA0 A;  1HZA A;  3OOC A;  2EYM A;  4E6I A;  5EPJ A;  5I6W A;  1ICF B;  4RGT A;  5I4D A;  1I3Q B;  2GVA A;  3S1Q B;  2FMM A;  3RZD H;  1C4Q A;  4NPS A;  1A8V A;  1QUQ B;  2UUB Q;  5BR8 L;  4ZKB B;  4A3J B;  2R92 G;  1E2W A;  4K8J A;  4U68 A;  4X62 Q;  1LTR D;  3CCR A;  5M9O A;  4CJ2 C;  2XGT A;  1WTO A;  1KAB A;  1PZK D;  2FHT A;  3CPW A;  4UP7 A;  1KL9 A;  3T13 A;  3A0J A;  4DXG A;  3D4D A;  4CJ1 B;  2B2T C;  5DNF A;  3T1H Q;  2PZT A;  5ELE A;  5JPN C;  4EQ5 A;  3TRE A;  2G9D A;  1TS5 A;  1EIF A;  2PQA B;  1DGS A;  2JYO A;  4IUU A;  2JE6 I;  3MFY A;  2KEN A;  4RCN A;  5IY0 A;  3PO3 G;  5JVH 3;  4C56 C;  2EXZ A;  4KJO A;  4HTH A;  3E0E A;  1ESF A;  1CZG A;  5CV9 A;  2K5V A;  1PFN A;  1WTP A;  2F0D A;  2HD3 A;  3Q8D A;  1AE3 A;  1I6H B;  2VY3 A;  2LXJ A;  1E0B A;  4BY7 G;  4C3H H;  1ZYR D;  2EVB A;  1DON A;  1PH6 A;  2B2V A;  3J81 E;  4K0K Q;  1XPO A;  1TY0 A;  3U50 C;  2UUC Q;  4IQZ A;  2Z6B A;  2NVT B;  1TVX A;  3S1M B;  2OT2 A;  2F0K A;  2Z4H A;  1F2Z A;  4X65 L;  3H3V I;  1N34 L;  3GTP H;  3KLW A;  2JP1 A;  5AJ3 Q;  1SXT A;  3J7A V;  2VZA A;  5FLX c;  2R7Z G;  1D8L A;  1SNP A;  4OEL B;  3K58 A;  1HTL D;  2WB1 B;  1LTB D;  5FO8 B;  3OTO L;  4RAU C;  1SJH D;  5M5X H;  1Q90 A;  2A8V A;  1B3Q A;  1GKH A;  1WJJ A;  5JEA G;  3FDT A;  1E2Z A;  1XNR L;  4OIK A;  2XWJ B;  4A93 H;  5IYD G;  5H1S E;  3AFP A;  2F1M A;  3W5O A;  2IHF A;  2XSC A;  1A63 A;  3PO3 H;  2BH8 A;  4HIO A;  4G7Z C;  2K5Q A;  4H13 C;  3DLL A;  1SDF A;  5E1F A;  2RVL A;  2EPB A;  4FXK C;  3U58 A;  4XXE A;  4RG1 A;  4JI5 L;  1CT1 D;  1KDC A;  4EQO A;  2HT1 A;  5TSS A;  2HIX A;  5IYC G;  3GTP B;  1K9M C;  3H0G G;  4QQB X;  1Y14 B;  1VF7 A;  2JA6 G;  4O0A A;  3K5L A;  2ZTE A;  1LT6 D;  1B3A A;  5ELN A;  3E3X A;  1EFI D;  4A3E B;  1YVC A;  3KBX A;  3ULP A;  4JI6 L;  4GKK Q;  4KKT A;  3GTO B;  3GTL H;  4NDX A;  4BBS H;  3PUX A;  3BVG A;  4CDC C;  1I4Q A;  3CME A;  2XN9 C;  3S2H H;  1K3B C;  2KA7 A;  2F0V A;  1V1P B;  5M5Y H;  3B6Y A;  3BZD B;  5LL6 S;  3K5O A;  5M5W H;  5CC4 A;  4LFA L;  3I4M G;  4GNX A;  2NZH A;  4A3L H;  1LT4 D;  1KLG D;  1VQO A;  2WFW A;  4OXP A;  2NVX H;  1IYV A;  3VR2 A;  4JI2 Q;  1MSG A;  4OO1 I;  2JA8 G;  1HZ9 A;  2CQO A;  2B63 H;  3RNU A;  1E24 A;  4LF8 L;  4DK3 C;  1TT2 A;  2E76 C;  3OYY A;  1NE3 A;  4YWM A;  1K0S A;  2Z8L A;  5KRU A;  4YCV A;  4B9X A;  2F3I A;  2AQ3 B;  3K80 C;  3KDF B;  1H9S B;  1Y1V G;  5ELF A;  4JV5 Q;  1STE A;  5I6Y A;  1L1O C;  1TU2 B;  1U4L A;  4XQN A;  3MTS A;  3NXW A;  1QJO A;  3T1Y Q;  1TII D;  2RDF A;  2VQF Q;  1NNX A;  1CM9 A;  1KDA A;  1PTO F;  3RUZ A;  2LSS A;  2F3V A;  3DWQ A;  2WAQ G;  2WII B;  4C3I G;  3KJP A;  1V1O A;  4LF6 L;  3D0F A;  3QWN A;  5C4J B;  2ZJR A;  3SE0 A;  3CPF A;  1GHJ A;  3QJY A;  1NR2 A;  2KCC A;  3GDE A;  2PZU A;  1T5X D;  3Q6S A;  4UPA A;  2EXD A;  1DOM A;  4PZ7 A;  4NXN Q;  4WRD A;  5C0X H;  2WKD A;  5EQ0 A;  4KHV A;  1WCM G;  1OXU A;  3HOV G;  1L2F A;  4CGY B;  4MTK A;  1MKH A;  3FP9 A;  1DZ1 A;  2NVY B;  4HCS A;  2EYP A;  4DUY L;  1YNJ C;  1SYC A;  2KHS A;  3LWE A;  3T53 B;  3F2B A;  1A6X A;  5ISR A;  2NYZ D;  2EY1 A;  1HHV A;  4LF6 Q;  4DUZ Q;  2KEC A;  1MJC A;  2HHH L;  4F88 A;  3G6J B;  3KF8 A;  1DOL A;  3L2P A;  2H5X A;  5FK9 C;  3BVZ A;  1HUM A;  4A3I G;  5IT9 E;  4J15 A;  1MSH A;  2JA7 H;  4O2D A;  4GNX B;  4B3T L;  5I2X A;  3WOF A;  4DV6 L;  2VW9 A;  3HOY B;  2WB1 G;  1HTP A;  4F7X A;  1HZB A;  1P8L A;  4MNO A;  2IWH A;  3AYH B;  4ZUI A;  3PO2 H;  2EJM A;  1G91 A;  4DV7 L;  2L15 A;  3M85 A;  1EYG A;  4MHE A;  1V1Q A;  1YZ6 A;  4A3B G;  4A3D G;  5JJK A;  2PMZ B;  4POF A;  3AFQ A;  5CV6 A;  2DN8 A;  1ML0 D;  1X32 A;  4UHV A;  1TS2 A;  3A5Z B;  3FEW X;  3MEH A;  2L55 A;  1MGS A;  4LF7 L;  2ASB A;  3S1R B;  1IBL Q;  3TS2 A;  2QEJ C;  1WCM H;  4DR6 L;  1BDO A;  2K32 A;  3SGI A;  4PMB A;  3GO5 A;  1AH9 A;  1MBY A;  1VQN A;  2VB3 X;  1AZQ A;  5JAV A;  2KUM A;  1Z6H A;  2PI2 A;  4A3K H;  3S1R H;  4APV A;  1KNE A;  1VMP A;  3K5N A;  2I5H A;  4CBV A;  4FXD A;  4XT3 B;  1SBB B;  1MD2 D;  3NQT A;  3J81 j;  2F4I A;  1C8C A;  4HCE A;  4HJ5 A;  1T5E A;  2PNR C;  3U4V A;  4XDX A;  1G6Z A;  1CTM A;  1Q1E A;  3I70 A;  4IUV A;  3GTL B;  1H95 A;  4KY7 A;  2AHO B;  1G51 A;  3KDF A;  3S1Q H;  4PMW A;  2E5L Q;  3D4R A;  1MIU A;  3D4W A;  1I4X A;  2NB0 A;  4EQN A;  3LWU A;  1U4M A;  1H9R A;  1CK1 A;  4XTC S;  5IWA Q;  3KLS A;  1X3Q A;  2F0O A;  4DK1 A;  1PH8 A;  2BE5 D;  1XXG A;  4J8Q A;  2SEB D;  3TME A;  1SRO A;  3JAM c;  2FMC A;  3ERS X;  4I65 A;  1HH2 P;  1ET9 A;  4A3M B;  3WOE A;  4BY1 G;  1Z9F A;  4YWK A;  2R61 A;  5C0X I;  4Y52 H;  1X3F A;  3KLS X;  3STB C;  2F0W A;  4M1U B;  1LT3 D;  3CU7 A;  3MA2 B;  1DOK A;  1EFW A;  4DR7 L;  1CHQ D;  4ZYS A;  1W6K A;  5DAU A;  3TP6 A;  1FJG Q;  4OL7 A;  3TEH B;  4L5R C;  2KCM A;  2QW7 A;  1Q8K A;  2K4K A;  4B3S Q;  2NUC A;  3AB9 A;  4DPG A;  1D1K A;  3SEB A;  1K8A C;  2K28 A;  1UEA B;  2CVR A;  2QDB A;  3BDL A;  4PQX A;  1VQC A;  3J81 c;  1K8G A;  2L1B A;  1IYJ B;  1Z7T A;  1D1I A;  5D3I B;  4LF8 Q;  5FLX L;  4JI6 Q;  3P75 A;  1JWS D;  2CFM A;  4DAP A;  4FF3 A;  3LX0 A;  2LKV A;  4ZLT F;  1SSO A;  3S1N B;  3KF6 B;  1M8A A;  2UXB Q;  1ENF A;  4O42 A;  1SJE D;  4JVZ A;  1VQ7 A;  4X65 Q;  2Q2H A;  3BU2 A;  1BOS A;  4GKJ L;  2IX0 A;  1QVF A;  1M1K C;  4BBS B;  3GV3 A;  1I4R A;  1STA A;  4DAM A;  5EKK A;  2F0J A;  1UE7 A;  3WDN A;  3PO2 G;  1Q12 A;  3SXH A;  2P5Z X;  3CC4 A;  4JI7 L;  1GUS A;  2F3W A;  3HFZ B;  5GAE C;  1PV4 A;  1VDZ A;  3F8T A;  4KHP L;  1F9S A;  1U4R A;  1BR9 A;  1NTG A;  4IPD A;  3MXN A;  1WVL A;  4ILW A;  2JQO A;  4A3G H;  5JEA H;  3HOU G;  4N8X 1;  1WTW A;  1PTO D;  2A69 C;  3WWV A;  1I50 H;  5C44 H;  1GUO A;  1FR3 A;  1GUW A;  1C7Y A;  4KKS A;  2F4V Q;  2AQ1 B;  1VQL A;  3J80 E;  1EY6 A;  3K5M A;  3T1H L;  3BDC A;  4LMQ D;  2KCT A;  4JI0 Q;  3SK6 A;  3UE1 A;  1KRS A;  4PZ8 A;  4X3S A;  1K83 B;  2B3G A;  4HID A;  4KV6 A;  4IZ8 A;  1PFM A;  4IOA A;  4P75 A;  4WOR A;  1TKW B;  3GTK B;  4L5S A;  1C9O A;  4BS9 A;  4K6D A;  4LF7 Q;  1PTO C;  4NMZ A;  3QOJ A;  4LFC Q;  3TSS A;  1FGB D;  1SYE A;  4NKL A;  1B1Z A;  1JR0 D;  1FD7 D;  1PRT B;  5EBC A;  2H1E A;  4O1N A;  3ZYY X;  3GTQ B;  1VS0 A;  4TVA B;  3HOU B;  1EQT A;  3Q24 A;  1EWH A;  3STB D;  2B2Y A;  5E7N A;  4A3F G;  1PRT F;  4XT1 B;  1GM5 A;  2FJ2 A;  1N9W A;  3A5U A;  4A76 A;  2PW7 A;  3S9W A;  2JA5 B;  1RTN A;  4CKE A;  3UDG A;  1IBM L;  4N8F A;  2PQE A;  1PH7 A;  3EIV A;  2D0P A;  2DUD A;  4UP8 A;  4BBS G;  3PIP 3;  1UNS A;  2NVT H;  2EQS A;  1QCB D;  1J8I A;  4XQQ A;  5I2Y A;  4QCL A;  4RGO S;  1O7Z A;  4Y7N H;  3NPP A;  1HR0 L;  2R7D A;  1PH4 A;  3T56 B;  3FPP A;  2VQE L;  3NTK A;  4RFB A;  1HNX L;  1YNJ D;  4KN4 C;  1L1O A;  1I6H H;  4X66 L;  2A6H C;  2RSO A;  4JYA L;  4LFC L;  5DEH A;  3VYR A;  1BVS A;  2KEE A;  1QWY A;  2E74 C;  3A54 A;  4H02 A;  3HOZ B;  2A74 C;  3VYS A;  4WJ3 M;  4OWT B;  4K2K A;  1XWE A;  2EJG C;  1KRT A;  2A6E C;  1BCP B;  4IFD J;  1K83 H;  4Q0F A;  1SNC A;  1RD9 D;  2K7V A;  2M9V A;  1GUT A;  2GVB A;  4IJL A;  3R93 A;  4JV5 L;  2IL8 A;  3E9I A;  1IBM Q;  1HCZ A;  3PCO B;  3KFU A;  2K33 A;  1PZJ D;  2IX3 A;  5IP7 G;  4ME5 A;  1DJR D;  3SK5 A;  4QY7 A;  4QMG A;  4C1N K;  3I4N H;  4B3S L;  5C3X A;  4GKJ Q;  3NTI A;  5IOC A;  4JOI C;  1U0L A;  2IW3 A;  2PZW A;  3NEM A;  3F2C A;  4QB4 A;  1SMY C;  5I9O A;  2X6L A;  5JOB A;  1M90 C;  2VL6 A;  1SNO A;  1HNW L;  2Q8I B;  3I72 A;  4X64 L;  3K7U C;  1HQM C;  4OWW B;  4HJ9 A;  1SFO H;  2E2J B;  2C35 B;  3CKI B;  2A73 B;  2HQL A;  4I7Z C;  4YCU A;  1QE6 A;  3NBI A;  4RWS C;  1FNV A;  3X3M A;  1ICW A;  3H15 A;  4FP5 D;  3H91 A;  1I4H A;  3GTO H;  1BF4 A;  5BN4 A;  2OCE A;  2OTJ A;  1R4P B;  1LV9 A;  2O4X A;  4OEM B;  1L1O B;  1SE8 A;  4K14 A;  1Y69 U;  4JW0 A;  1EOV A;  3ERO A;  3QO2 A;  3VR4 A;  2A68 D;  3D8G A;  4LUO A;  2E2I B;  3L7Z C;  4DV3 L;  3A56 A;  5EKI A;  1EU4 A;  4YHH Q;  1N32 L;  4KY6 A;  4JI3 Q;  1W2B A;  4AYB B;  1WTQ A;  2PPB C;  3S1N H;  3IRB A;  3T4A C;  5JPM C;  3C2P A;  2MJ8 A;  1IW7 D;  2L4N A;  3RLN A;  5M3F H;  2WP8 J;  3RN5 A;  1JJC B;  2UUA L;  5JJZ A;  3SVM A;  2VUM B;  4IFD I;  1OXS C;  4JI0 L;  3K57 A;  1KNA A;  3E5S A;  4QF4 A;  2L5T A;  1GHK A;  1G8Z D;  3J7Y W;  1YIJ A;  1H9K A;  2BE5 C;  2F0L A;  2R7Z H;  1SEB D;  2K5D A;  3R3O A;  5IE8 A;  1CKN A;  1EEF D;  4CDD C;  1OXT A;  4P74 A;  3ZJY C;  1FL0 A;  5C5L A;  1EY9 A;  2VXW A;  3VR5 A;  1HFN A;  4K0K L;  2Y0S E;  3C1F A;  3OW7 A;  4JBW A;  1J9O A;  3R2I A;  4AYB E;  5KNC A;  1HNX Q;  4JI3 L;  4DR6 Q;  1Y8O B;  2F52 A;  4ZKC B;  1JT8 A;  1SYF A;  2HIV A;  4A3E G;  1UAP A;  2TSS A;  3MHB A;  3SDZ A;  2EYJ A;  3IFD A;  1X9N A;  1SMX A;  4DFA A;  3RZD B;  2FXQ A;  2D9U A;  1PFS A;  2YU9 B;  2ZM6 Q;  1CQF A;  2R3Z A;  4GOP A;  1VQP A;  4DXF A;  5ELB A;  2SNM A;  5C5M A;  1AW7 A;  1LYL A;  3CCS A;  2OTL A;  4DR3 Q;  1UEB A;  3TP8 A;  1PFB A;  4KD4 A;  3H09 A;  4DV0 L;  1VQ9 A;  4IUR A;  4NXM L;  4B3M Q;  3JAM L;  3K8A A;  4DR4 L;  4C1N I;  3E9H A;  2D62 A;  1J6Q A;  5KYL A;  1CQV A;  4G7O C;  4JI7 Q;  2CWA A;  4KHP Q;  1XTD A;  1F9P A;  5L37 A;  3I73 A;  3S15 H;  5EPL A;  1RHP A;  4C3J G;  1Z47 A;  2ZJP A;  3PF4 A;  5EKL A;  4R8I A;  5M3M B;  4CDF C;  1E3P A;  2HCC A;  1R4Q B;  3F2U A;  4DR1 L;  3BG3 A;  3EFX D;  3EA6 A;  3HEJ A;  2VNU D;  3L0O A;  3C3L A;  5IGF A;  1G6P A;  1PA6 A;  5C3E H;  3V96 A;  2I07 B;  3NEN A;  4DF7 A;  4YWL A;  1Y1W B;  2KCN A;  5DLQ E;  4LF9 L;  4G7H C;  5FJ8 G;  3J81 i;  5G3L D;  1D6E C;  1B8A A;  5KEE A;  2YU9 H;  1TWA H;  3ER0 A;  3AEV A;  1A0I A;  1H9M A;  2DY8 A;  4P73 A;  5EPK A;  2YTY A;  4R4T A;  3S24 A;  3NUC A;  4DV3 Q;  1D7Q A;  4HR7 B;  4J1M A;  3KOJ A;  1IL8 A;  5C3W A;  2KQ3 A;  4DUY Q;  3M4O H;  3TRZ A;  1A3T A;  1RJT A;  3P20 A;  4TQU S;  1PH2 A;  4GN3 B;  5M3F G;  4AQY Q;  2ENB A;  2F0G A;  4JBJ A;  3M4P A;  1RCV D;  5IGB A;  1Q8I A;  5BN5 A;  3CD6 A;  2MO1 A;  4Y7N B;  2AWN A;  4BA1 I;  1PZI D;  2B63 G;  1KAW A;  2EOT A;  4BA2 I;  3MVV A;  4IUN A;  4Z9C B;  5KND A;  4IPH A;  1HNZ L;  3HOX G;  5J1Z A;  2EE1 A;  2KOL A;  4R9W A;  3T16 A;  4JOI A;  2VS1 A;  3C46 A;  2I46 A;  1E1O A;  2LS0 1;  1EY5 A;  3PF5 A;  1ASZ A;  4ZCK A;  4HJ8 A;  1X6O A;  3FVQ A;  3CRL C;  1XMO L;  2N49 A;  2OQK A;  4QIW E;  4JG2 A;  4R1J A;  3K0X A;  3IFT A;  4DNR B;  4JI4 Q;  1E22 A;  2QGQ A;  4A3C G;  2NTT A;  3K7A H;  4NW2 A;  1A3V A;  1DYQ A;  3HKZ E;  3NWT A;  1Q3L A;  4LF5 L;  2X6G A;  3RN2 A;  2A1A A;  1CA5 A;  2A6E D;  4C3H B;  4BBR G;  4FF1 A;  4A3I H;  1O7I A;  1E1T A;  1S72 A;  3FKI H;  1EY0 A;  3KF6 A;  2K5N A;  5GAH C;  2CKZ B; 
#chains in the Genus database with same CATH homology
 5CV8 A;  1JWU D;  2ICI A;  4F87 A;  1RF2 D;  2NBF A;  3QIA A;  2NN6 H;  3D6C A;  2Z4I A;  1U9R A;  5C6A A;  1X3P A;  2Q8R E;  2E75 C;  4EGV A;  2CW0 D;  2H4O A;  1E2V A;  1JOK A;  3KLR A;  3JAM E;  3TZU A;  3K7A B;  5FKA C;  4RGM A;  5EJW A;  3SR1 A;  2EY6 A;  2A6H D;  2F0F A;  4HSP A;  3A8K E;  1ILP A;  4C3I B;  3HOX B;  1SNQ A;  1V1P A;  1S5B D;  3U9S A;  3I90 A;  4RA8 A;  3MFG A;  3D3R A;  3BVM A;  4TKO B;  2J4X A;  3PO3 B;  4KD3 A;  5K36 G;  2LFN A;  1GXD C;  3GD7 A;  5IT9 L;  4EVO A;  5AFW A;  1WD1 A;  5CBE E;  4H0L C;  5CV5 A;  3AMU A;  2WAC A;  4KTA A;  1HA6 A;  2JA8 B;  4UAI A;  4KY5 A;  4X3U A;  2ICE C;  3BDO A;  2M00 A;  2K6A A;  4A93 B;  4NP5 A;  4A3B B;  3GQB A;  3L3O C;  1EU3 A;  2K03 A;  4IFD G;  1NR4 A;  5K5P A;  3AU7 A;  2PO4 A;  2BDO A;  3QOL A;  4ULL A;  4K2L A;  5JEA J;  1NCV A;  2O5I C;  1PTO H;  1EZ6 A;  1FNW A;  2NN6 G;  1TWC B;  1FNU A;  4RH6 A;  2A69 D;  1F9Q A;  1JIC A;  2L12 A;  2ZXR A;  4FYD A;  2O2L D;  1EL0 A;  4C3J B;  5A35 A;  1BO0 A;  3Q23 A;  3KBG A;  1GUG A;  1STB A;  4DAV A;  3OSO A;  4RHR A;  2RBM A;  1OO9 B;  3MXU A;  1YNN C;  1EY7 A;  3ITP A;  4XQJ A;  5D3D A;  3HOV B;  1WCM B;  5EGT A;  3FPU B;  1Y8P B;  2JXM B;  1QB5 D;  2MPM A;  3QG1 A;  3NHH A;  4DK0 A;  3PMF A;  2L11 A;  2BA1 A;  1L0Y B;  2NVX B;  1KDB A;  5M5W B;  2PCF B;  3M7N A;  2RQX A;  4X3T A;  3IKJ A;  3Q22 A;  2F03 A;  3S16 B;  4DAY A;  5ELC A;  3D31 A;  4DNT B;  2K5W A;  3PUV A;  5T1G A;  1JWM D;  4ZRZ A;  1VF5 C;  2R7Z B;  3X3N A;  1F2M A;  3TN2 A;  5M5X B;  1O80 A;  2BOS A;  1O7Y A;  1ONL A;  1YNN D;  2A68 C;  5FO7 B;  2EY2 A;  3EJI A;  4LAA A;  5FLX E;  5C4X B;  2ZXO A;  1OXV A;  2MHV A;  3DHQ A;  5T1I A;  1JOR A;  1S5F D;  1VMC A;  1G2T A;  3MZ5 A;  4JK1 C;  2K1B A;  3DM1 A;  4ZQ3 A;  3MXP A;  2IX1 A;  2HQE A;  5LL6 X;  3HG9 A;  4BWG B;  4KJN A;  2IPK D;  4DN4 M;  4V19 0;  1DCZ A;  3DMU A;  4XIG S;  2A5H A;  3D6W A;  5CV7 A;  4MIU A;  5KGU A;  5C3E B;  1AEX A;  2JEB I;  4KI0 A;  2EDG A;  3H0G B;  2QF7 A;  3MC0 B;  3O13 A;  3PUW A;  1QIL A;  5D14 A;  4IUP A;  4DGZ A;  1D5X C;  3SK4 A;  1TWF B;  1TS4 A;  3TP5 A;  3PUY A;  5JVG 3;  2R92 B;  4CKC A;  1CI3 M;  3TP7 A;  4ID6 A;  5I9P A;  2EYO A;  2NVQ B;  1BCP F;  2Z1C A;  1S5D D;  4TRD A;  2J0T D;  4RCO A;  1EYC A;  1LTT D;  1S4Z A;  1JCK B;  1LTG D;  2TMP A;  2E2H B;  4WJW A;  2XIW A;  1B9M A;  3VYU A;  3FMC A;  5FO9 B;  1QG7 A;  1GOZ A;  4Q5V A;  2ZXP A;  2FFK B;  1SYB A;  4J6H A;  1AP0 A;  1PDQ A;  1DD2 A;  2NTS A;  4BBR B;  4C3H G;  2CHB D;  5CV4 A;  4S3S A;  2F0Q A;  4UDU C;  2Y0S B;  5IGG A;  4CKB A;  1EEI D;  1EY4 A;  2QCP X;  4LK1 C;  1S5C D;  4ODG A;  3SK8 A;  3HOW B;  4IAL A;  5CGK A;  3A7L A;  3LNN A;  3H3V C;  3H94 A;  1PRT C;  3VYT A;  2F0P A;  4FNF A;  4IUQ A;  1G2S A;  5IIF A;  2OXP A;  4N9T A;  5C4H A;  1PMR A;  3VA5 A;  1LAB A;  2IT1 A;  1FYC A;  4H7B A;  5M3F B;  2KJX A;  2N55 A;  1RDP D;  4V0B A;  5NUC A;  3C1E A;  2JSO A;  3KUP A;  1XYI A;  2B2U C;  3NQI A;  3K59 A;  2F0M A;  5EBD A;  1V8Q A;  1BCP C;  1CFM A;  2AUJ D;  2WKC A;  1ZXT A;  4OHJ A;  4ZK9 B;  5ELD A;  3R2T A;  3OWE B;  1EOT A;  2BCO A;  1STG A;  3I4N B;  3T51 B;  1NSN S;  1HQR D;  2RDG A;  1B2T A;  1B44 D;  3VR3 A;  3MXG A;  1CA6 A;  3VA7 A;  1EYD A;  2C5C A;  4K5W A;  2EYF A;  2GA4 B;  1AZP A;  1BQQ T;  3V2T A;  1DXM A;  2DNE A;  3VR6 A;  1CHP D;  1QNU A;  3FRP B;  3URY A;  3PUZ A;  1QOH A;  3DWP A;  2QIL A;  5FOB B;  5IGE A;  2KED A;  4HN7 A;  2VB2 X;  1STN A;  3HS0 C;  4YIJ A;  5HGT A;  1BUV T;  2L0C A;  3NBH A;  2HCI A;  3W2D A;  3EQL C;  2HUG A;  2HDL A;  1BBX C;  3R8B A;  3RD4 A;  3OIP A;  4PMC A;  1KLU D;  1I4P A;  2AQ2 B;  1HA5 A;  4FF4 A;  1O7L A;  4WFN 3;  2B2W C;  2PW5 A;  1LT5 D;  1DM0 B;  1WTX A;  3M4O B;  1EWC A;  4U67 3;  1L0X B;  1B9N A;  4A3K B;  1D5Z C;  1QNK A;  3OPO A;  1TS3 A;  2CW0 C;  1BNZ A;  4ZUJ A;  1NAP A;  3EVQ A;  1TWA B;  5KIX A;  3A55 A;  1IW7 C;  2LMC B;  5DM6 3;  4IUT A;  1SAP A;  5COY A;  1Y8N B;  2D2C C;  3CQZ B;  1EY8 A;  3OMG A;  1A2U A;  5COR A;  3MWY W;  3M3Y B;  3OMC A;  3A7A B;  1WTV A;  2B39 A;  2K04 A;  2N88 A;  1H9S A;  1H9J A;  4A3G B;  3RZO B;  4B9W A;  4C2M B;  5E4W C;  4CHT B;  1KAA A;  1IHZ A;  2RDH A;  4HSV A;  1PLF A;  2LY7 A;  5C4Z A;  1OXX K;  1F2L A;  2R93 B;  1AN8 A;  4F8M A;  1LO5 D;  1ZKO A;  5CYU A;  5J22 A;  2JEA I;  2F0N A;  3P7J A;  2J7Z A;  3DWA A;  3SHL A;  2O5J C;  4B08 A;  2RKS A;  1BCP D;  2YYZ A;  5CBA E;  2R6G A;  3RLF A;  5IGD A;  1RKN A;  4FO2 A;  3I8Z A;  2OEO A;  2PYK A;  5C0X G;  4G57 A;  2ZT9 C;  1LAC A;  2SDF A;  1STY A;  3J80 L;  4OIJ A;  2WAQ B;  3E6Z X;  1PYW D;  1JQY D;  2XWB B;  1I4G A;  4A3F B;  5KYI A;  1D5M C;  4ZAI A;  3HGB A;  1Y1V B;  3W3A A;  1XX8 A;  1SND A;  3N6R A;  5A2Q L;  2NN6 I;  2B2U A;  1GUN A;  4RKL A;  2EY5 A;  2WV6 D;  2XRS D;  3M7G A;  2B63 B;  1B50 A;  5KNB A;  2BDN A;  4RGN A;  3DEO A;  4RHS A;  5E4X A;  4HMJ A;  1ZEQ X;  3KK7 A;  3K6O A;  5E3F A;  1LTI D;  3I3C A;  1SYD A;  4PV1 C;  1SNM A;  2IJ0 A;  2G9H D;  2CQA A;  2MUY A;  1ET6 A;  2NZ1 D;  4N9P A;  1F9R A;  1I6V C;  2DY7 A;  1WD0 A;  3U9O A;  1ENA A;  5F2D A;  2EYH A;  1SE2 A;  2MP1 A;  4LJZ C;  4FXG C;  3PO2 B;  1ILQ A;  2L9H A;  1VCI A;  3NK9 A;  3P1H A;  4G4K A;  4H44 C;  3GP7 A;  1HXY D;  3QB3 A;  1F77 A;  3OIQ A;  4HED A;  3ND9 A;  4DU9 A;  3S15 B;  4DA2 A;  3J7A F;  5G3L F;  3FKI B;  2F0E A;  1TY2 A;  2E2D C;  4KMU C;  1SMY D;  1TQO A;  5D65 A;  5IOD A;  3GTM B;  3NE5 B;  3IL8 A;  2F0U A;  3M4Y A;  1D2B A;  2B2Y C;  3L9A X;  2DNC A;  4K5V A;  2B2W A;  2K05 A;  3I91 A;  4FF2 A;  1UUP A;  4QUF A;  4BY1 B;  4ABN A;  3NTH A;  2C9O A;  3PIO 3;  1R9T B;  4QUC A;  1BXT A;  1C48 A;  1ROD A;  5CMD A;  1KTK A;  4K8I A;  4BY7 B;  4OGQ C;  1JE4 A;  5C0X J;  1G29 1;  1O78 A;  3H6M A;  3TDQ A;  1Q1B A;  3DUZ A;  2XNA C;  4M8A A;  2HDM A;  4L6T B;  5LHY 1;  3A8I E;  4KHZ A;  4HAE A;  2F0I A;  1ENC A;  1LTA D;  3GTG B;  5HUR A;  3BYT B;  4K5X A;  3N52 A;  2B2T A;  4FVM A;  5CR3 A;  2AUK A;  3CRK C;  3I4L A;  1EZ8 A;  2K01 A;  1EIG A;  4CJ0 B;  3S2D B;  2XVS A;  3CHB D;  1HRJ A;  2B8G A;  1ZYR C;  3BYY B;  4A3D B;  1JOQ A;  1U4P A;  1SFO B;  1LLR D;  4XYQ A;  1XTC D;  2RSN A;  1PTO B;  4XYO A;  1GJX A;  3TZD A;  1PRT D;  4IN3 A;  1CZW A;  5IGC A;  1JOO A;  4HMI A;  2B2V C;  4A3I B;  1IKL A;  2SNS A;  4TSS A;  3NSW A;  2QKI C;  3DEP A;  2F0T A;  3GV6 A;  1IKM A;  1HUN A;  2ID0 A;  3K0Y A;  3A8J E;  4OO1 G;  3MAQ A;  3NP8 A;  3S17 B;  3UI2 A;  3IAY A;  3OWF A;  3BS1 A;  2XRQ D;  5A2Q E;  4P2C B;  3J81 L;  1JB3 A;  2OF1 A;  3HZX A;  1V43 A;  1TR5 A;  4X3K A;  1B53 A;  2SOB A;  4R8N A;  2M2L A;  4KN7 C;  3ND8 A;  1A15 A;  2V4D A;  3E0J A;  2F0S A;  5BN3 A;  5M5Y B;  4L63 B;  3PV0 A;  1MI2 A;  2F0H A;  1I50 B;  5C44 B;  4EQP A;  4OO1 H;  2EZV A;  1HPC A;  1B4O A;  2KVM A;  2D5D A;  3TBI B;  3HKZ B;  3ERQ A;  1LTS D;  2AWO A;  3HRZ C;  1II3 A;  3Q0A A;  1TWH B;  1JC7 A;  1HFG A;  4RKB A;  1S5E D;  3DXJ C;  4IFD H;  1M4V A;  4QIW B;  1K8M A;  2Q8T A;  1ESR A;  4PNY A;  3V05 A;  1EYA A;  3S14 B;  4KK7 A;  3NWS A;  5DM7 3;  2WIN B;  1K8O A;  5J39 A;  4MN3 A;  3I4M B;  1SE4 A;  1EQV A;  4K6L A;  3GTJ B;  1EIH A;  1STH A;  1A3U A;  1IYU A;  3RMH A;  2JA6 B;  1SE3 A;  1TWG B;  1AFP A;  2B8F A;  4GZY C;  3OHX C;  5K36 H;  3ONA B;  1F2Y A;  1SYG A;  2FIN B;  3HP3 A;  2RA4 A;  2X69 A;  3G7L A;  1RTO A;  1PXU A;  2NWG A;  4L8J A;  2JA7 B;  1A2T A;  3S2H B;  2MGS A;  1W6J A;  4KKU A;  1NUC A;  2EYL A;  1WTR A;  2EJF C;  2BA0 A;  3OOC A;  2EYM A;  4E6I A;  5EPJ A;  5I6W A;  4RGT A;  5I4D A;  1I3Q B;  3S1Q B;  2FMM A;  1C4Q A;  4ZKB B;  4A3J B;  1E2W A;  4K8J A;  4U68 A;  1LTR D;  5M9O A;  4CJ2 C;  1WTO A;  1KAB A;  1PZK D;  2FHT A;  3T13 A;  4DXG A;  3D4D A;  4CJ1 B;  2B2T C;  5DNF A;  2PZT A;  5ELE A;  5JPN C;  2G9D A;  1TS5 A;  2JYO A;  4IUU A;  2JE6 I;  3MFY A;  4RCN A;  5JVH 3;  4C56 C;  2EXZ A;  4KJO A;  4HTH A;  1ESF A;  1CZG A;  5CV9 A;  1PFN A;  1WTP A;  2F0D A;  1I6H B;  1E0B A;  1ZYR D;  2EVB A;  1DON A;  2B2V A;  3J81 E;  1TY0 A;  4IQZ A;  2NVT B;  1TVX A;  3S1M B;  2OT2 A;  2F0K A;  2Z4H A;  1F2Z A;  2JP1 A;  1SXT A;  3J7A V;  1SNP A;  3K58 A;  1HTL D;  2WB1 B;  1LTB D;  5FO8 B;  4RAU C;  1SJH D;  1Q90 A;  5JEA G;  3FDT A;  1E2Z A;  4OIK A;  2XWJ B;  2F1M A;  2XSC A;  4G7Z C;  2K5Q A;  4H13 C;  1SDF A;  5E1F A;  2RVL A;  2EPB A;  4FXK C;  4XXE A;  1CT1 D;  1KDC A;  4EQO A;  5TSS A;  3GTP B;  1VF7 A;  3K5L A;  1LT6 D;  1B3A A;  1EFI D;  4A3E B;  3KBX A;  4KKT A;  3GTO B;  4NDX A;  3PUX A;  3BVG A;  1I4Q A;  2XN9 C;  2KA7 A;  2F0V A;  1V1P B;  3BZD B;  5LL6 S;  3K5O A;  5CC4 A;  1LT4 D;  1KLG D;  1IYV A;  3VR2 A;  1MSG A;  4OO1 I;  1TT2 A;  2E76 C;  2Z8L A;  5KRU A;  4B9X A;  2AQ3 B;  1H9S B;  5ELF A;  1STE A;  5I6Y A;  1TU2 B;  1U4L A;  4XQN A;  3MTS A;  3NXW A;  1QJO A;  1TII D;  2RDF A;  1CM9 A;  1KDA A;  1PTO F;  3RUZ A;  2F3V A;  3DWQ A;  2WII B;  4C3I G;  1V1O A;  3QWN A;  5C4J B;  3SE0 A;  1GHJ A;  3QJY A;  1NR2 A;  2KCC A;  2PZU A;  1T5X D;  3Q6S A;  1DOM A;  4WRD A;  5C0X H;  2WKD A;  5EQ0 A;  4KHV A;  1OXU A;  4CGY B;  1DZ1 A;  2NVY B;  4HCS A;  2EYP A;  1YNJ C;  1SYC A;  2KHS A;  3LWE A;  3T53 B;  1A6X A;  5ISR A;  2NYZ D;  2EY1 A;  1HHV A;  2KEC A;  4F88 A;  3G6J B;  3KF8 A;  1DOL A;  5FK9 C;  3BVZ A;  1HUM A;  5IT9 E;  1MSH A;  5I2X A;  3WOF A;  3HOY B;  1HTP A;  4F7X A;  2IWH A;  4ZUI A;  2EJM A;  1G91 A;  3M85 A;  4MHE A;  2PMZ B;  5CV6 A;  2DN8 A;  1ML0 D;  1X32 A;  1TS2 A;  3FEW X;  3MEH A;  2L55 A;  1MGS A;  3S1R B;  2QEJ C;  1BDO A;  2K32 A;  4PMB A;  3GO5 A;  1MBY A;  2VB3 X;  1AZQ A;  5JAV A;  2KUM A;  1Z6H A;  1KNE A;  1VMP A;  3K5N A;  4CBV A;  4FXD A;  4XT3 B;  1SBB B;  1MD2 D;  3NQT A;  2F4I A;  1C8C A;  4HCE A;  1T5E A;  2PNR C;  4XDX A;  1G6Z A;  1CTM A;  1Q1E A;  3I70 A;  4IUV A;  3GTL B;  4KY7 A;  4PMW A;  3D4R A;  3D4W A;  1I4X A;  4EQN A;  2NB0 A;  3LWU A;  1H9R A;  1U4M A;  1CK1 A;  4XTC S;  3KLS A;  1X3Q A;  2F0O A;  4DK1 A;  2BE5 D;  1XXG A;  4J8Q A;  2SEB D;  3TME A;  2FMC A;  4I65 A;  1ET9 A;  4A3M B;  3WOE A;  2R61 A;  5C0X I;  3KLS X;  2F0W A;  4M1U B;  1LT3 D;  3CU7 A;  3MA2 B;  1DOK A;  1CHQ D;  4ZYS A;  1W6K A;  5DAU A;  3TP6 A;  4OL7 A;  2NUC A;  3AB9 A;  1D1K A;  3SEB A;  2K28 A;  1UEA B;  2CVR A;  2QDB A;  3BDL A;  4PQX A;  2L1B A;  1Z7T A;  1D1I A;  5D3I B;  5FLX L;  3P75 A;  1JWS D;  4DAP A;  4FF3 A;  3LX0 A;  2LKV A;  4ZLT F;  1SSO A;  3S1N B;  1M8A A;  1ENF A;  4O42 A;  1SJE D;  1BOS A;  2IX0 A;  4BBS B;  3GV3 A;  1I4R A;  1STA A;  5EKK A;  2F0J A;  3WDN A;  1Q12 A;  3SXH A;  1GUS A;  2F3W A;  1VDZ A;  1F9S A;  1U4R A;  1BR9 A;  3MXN A;  1WVL A;  4ILW A;  5JEA H;  1WTW A;  1PTO D;  2A69 C;  1GUO A;  1FR3 A;  1GUW A;  4KKS A;  2AQ1 B;  3J80 E;  1EY6 A;  3K5M A;  3BDC A;  4LMQ D;  3SK6 A;  4X3S A;  1K83 B;  4KV6 A;  4IZ8 A;  1PFM A;  4WOR A;  1TKW B;  3GTK B;  4BS9 A;  4K6D A;  1PTO C;  4NMZ A;  3QOJ A;  3TSS A;  1FGB D;  1SYE A;  4NKL A;  5EBC A;  1B1Z A;  1JR0 D;  1FD7 D;  1PRT B;  2H1E A;  4O1N A;  3ZYY X;  3GTQ B;  3HOU B;  1EQT A;  3Q24 A;  1EWH A;  2B2Y A;  1PRT F;  4XT1 B;  2FJ2 A;  2PW7 A;  3S9W A;  2JA5 B;  1RTN A;  4CKE A;  2PQE A;  3PIP 3;  1UNS A;  1J8I A;  1QCB D;  4XQQ A;  5I2Y A;  4QCL A;  4RGO S;  1O7Z A;  3NPP A;  3T56 B;  3FPP A;  3NTK A;  4RFB A;  1YNJ D;  4KN4 C;  2A6H C;  2RSO A;  5DEH A;  3VYR A;  2KEE A;  1QWY A;  2E74 C;  3A54 A;  3HOZ B;  2A74 C;  3VYS A;  4K2K A;  1XWE A;  2EJG C;  2A6E C;  1BCP B;  4IFD J;  4Q0F A;  1SNC A;  1RD9 D;  2K7V A;  2M9V A;  1GUT A;  3R93 A;  2IL8 A;  1HCZ A;  2K33 A;  1PZJ D;  2IX3 A;  4ME5 A;  1DJR D;  3SK5 A;  4QMG A;  4C1N K;  5C3X A;  3NTI A;  5IOC A;  2PZW A;  2IW3 A;  4QB4 A;  1SMY C;  5I9O A;  2X6L A;  5JOB A;  1SNO A;  2Q8I B;  3I72 A;  1HQM C;  2E2J B;  3CKI B;  2A73 B;  4I7Z C;  1QE6 A;  3NBI A;  4RWS C;  1FNV A;  3X3M A;  1ICW A;  4FP5 D;  3H91 A;  1I4H A;  1BF4 A;  5BN4 A;  1R4P B;  1LV9 A;  2O4X A;  4K14 A;  1Y69 U;  3ERO A;  3QO2 A;  3VR4 A;  2A68 D;  3D8G A;  2E2I B;  3L7Z C;  3A56 A;  5EKI A;  1EU4 A;  4KY6 A;  4AYB B;  1WTQ A;  2PPB C;  3C2P A;  3T4A C;  5JPM C;  2MJ8 A;  1IW7 D;  2L4N A;  2WP8 J;  5JJZ A;  3SVM A;  2VUM B;  4IFD I;  1OXS C;  3K57 A;  1KNA A;  3E5S A;  4QF4 A;  2L5T A;  1GHK A;  3J7Y W;  1G8Z D;  1H9K A;  2BE5 C;  2F0L A;  1SEB D;  2K5D A;  3R3O A;  1EEF D;  1OXT A;  5C5L A;  1EY9 A;  2VXW A;  3VR5 A;  1HFN A;  3C1F A;  3OW7 A;  4JBW A;  1J9O A;  3R2I A;  5KNC A;  1Y8O B;  4ZKC B;  1SYF A;  1UAP A;  2TSS A;  3MHB A;  3SDZ A;  2EYJ A;  3IFD A;  4DFA A;  3RZD B;  2D9U A;  2YU9 B;  1CQF A;  2R3Z A;  4DXF A;  5ELB A;  2SNM A;  5C5M A;  1AW7 A;  3TP8 A;  1PFB A;  4KD4 A;  3H09 A;  4IUR A;  3JAM L;  4C1N I;  2D62 A;  5KYL A;  1CQV A;  4G7O C;  1F9P A;  3I73 A;  5EPL A;  1RHP A;  4C3J G;  1Z47 A;  5EKL A;  4R8I A;  5M3M B;  2HCC A;  1R4Q B;  3F2U A;  3BG3 A;  3EFX D;  3EA6 A;  3HEJ A;  2VNU D;  3C3L A;  5IGF A;  3V96 A;  2I07 B;  4DF7 A;  1Y1W B;  2KCN A;  4G7H C;  5G3L D;  1D6E C;  5KEE A;  2DY8 A;  1H9M A;  5EPK A;  3NUC A;  4HR7 B;  4J1M A;  1IL8 A;  5C3W A;  2KQ3 A;  1A3T A;  1RJT A;  3P20 A;  4TQU S;  2ENB A;  2F0G A;  1RCV D;  5IGB A;  1Q8I A;  5BN5 A;  4Y7N B;  2AWN A;  4BA1 I;  1PZI D;  2EOT A;  4BA2 I;  3MVV A;  4IUN A;  4Z9C B;  5KND A;  5J1Z A;  2EE1 A;  2KOL A;  4R9W A;  3T16 A;  3C46 A;  2I46 A;  2LS0 1;  1EY5 A;  3FVQ A;  3CRL C;  3IFT A;  4DNR B;  2NTT A;  4NW2 A;  1A3V A;  1DYQ A;  3NWT A;  1Q3L A;  2X6G A;  1CA5 A;  2A6E D;  4C3H B;  4FF1 A;  1EY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...