3T16A

Crystal structure of staphylococcal nuclease variant nviaga/m98g at cryogenic temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
124
Chain Sequence
LHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIPYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKGVNEALVRQGLAKVAYVYKGNNTHEQHLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant NVIAGA/M98G at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 124
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t16A00
4K8JA 3EJIA 3P1HA 1F2YA 4DU9A 3BDLA 5KEEA 5CC4A 4HTHA 4PNYA 1KDAA 2SNSA 2M00A 4QB4A 1ENCA 2PZTA 2EYMA 5IGBA 1STYA 2F0QA 5E3FA 5CV5A 3TP7A 1ENAA 3MEHA 1EZ8A 3OWFA 5IGGA 1SYGA 5J39A 2F0WA 4KD4A 3SK8A 3U9OA 5KGUA 3MZ5A 5EKLA 1A3UA 4K2LA 3S9WA 5KRUA 3OMCA 3NQTA 5JOBA 3MVVA 5C5LA 3SK6A 3P75A 2F0OA 1KDBA 1EY7A 1KAAA 1EY5A 4IUNA 2KQ3A 2F0IA 4EQOA 4H7BA 5E1FA 5F2DA 4HMJA 4DFAA 3SXHA 3QOLA 1TQOA 5I6YA 3BDCA 3QOJA 3D8GA 2PW5A 4KJNA 2EXZA 1STGA 5DEHA 1EY0A 3SR1A 1SNMA 1SNQA 1TR5A 1F2MA 5CV6A 3EROA 2EY5A 1EYAA 3NK9A 4KY5A 2NUCA 5C3XA 4R8NA 5C3WA 4K5XA 5IIFA 5CV8A 4KTAA 5DAUA 4K2KA 3TP8A 3VA5A 3ERQA 2RKSA 3D4DA 3TP5A 5K5PA 2F0FA 5KIXA 1EY4A 1JOKA 2F0DA 3MXPA 2F0TA 2QDBA 5C4ZA 5KYIA 5M9OA 3NXWA 4KHVA 4LAAA 5C6AA 4EQNA 4PMCA 3V2TA 1F2ZA 4DGZA 4EQPA 5C4HA 1EYDA 5CV4A 4QF4A 2HQEA 4F7XA 5HGTA 2F0VA 4B9WA 3QB3A 2EY1A 2SOBA 2OXPA 4NKLA 2EY2A 1A2TA 4HMIA 2RBMA 1STAA 1STHA 1STNA 2EYJA 4K5VA 4WORA 3HZXA 4N9TA 1IHZA 2PW7A 1JORA 4KY7A 3HEJA 5HURA 4ZUJA 1SNPA 3T13A 2EYLA 3TP6A 4J1MA 1EY8A 2F0MA 5IOCA 5KYLA 3EVQA 5J22A 4K8IA 4PMBA 4YIJA 2O4XA 4S3SA 1SYEA 3MHBA 1RKNA 1SYCA 5CV9A 2F0KA 4NMZA 2OF1A 4K5WA 2KHSA 5C5MA 2F0LA 3C1EA 4I65A 4K6DA 4TRDA 4DF7A 4F8MA 4ID6A 5CR3A 2F0EA 1SYFA 3DHQA 3E5SA 1EZ6A 5JAVA 1SNCA 3R3OA 3LX0A 5IGFA 1A3TA 1A3VA 4N9PA 2EYPA 4K14A 4ODGA 2F0NA 5CV7A 3H6MA 5EGTA 1TT2A 2F0UA 2F3VA 1NSNS 3PMFA 1SNOA 1II3A 1U9RA 1STBA 4J6HA 5J1ZA 2EY6A 4KJOA 3TMEA 1KDCA 5I9OA 5IGDA 4QMGA 1NUCA 2F0GA 2SNMA 3NP8A 3T16A 1EQVA 4IZ8A 5I9PA 5I6WA 4E6IA 3D4WA 2LKVA 4NDXA 1SYBA 5IGCA 2EYOA 2F3WA 2PQEA 2PZUA 3NHHA 4OL7A 3RUZA 4ZQ3A 3SK4A 4G57A 3SHLA 4B9XA 5CGKA 4NP5A 4ME5A 3SK5A 2F0JA 3C1FA 3ITPA 5NUCA 2F0HA 1KABA 4EVOA 1AEXA 4IALA 4RKLA 3OSOA 5IGEA 4KV6A 4KD3A 3NUCA 4ZUIA 5IODA 1EY6A 3DMUA 2PZWA 2OEOA 4KY6A 2RDFA 1A2UA 1JOOA 3D6CA 1SNDA 5EKKA 2EYFA 5ISRA 4WRDA 1EY9A 2F0PA 1EYCA 1JOQA 3OMGA 2F0SA 4MIUA 2PYKA 2WACA 4RKBA 2ENBA 1SYDA 2EYHA
chains in the Genus database with same CATH superfamily
4QY7A 4AYBB 1QVFA 1CZGA 1RF2D 2CH4W 5IGBA 3HOUH 4BBSH 3I4MB 3GTLB 3HOWB 3OWFA 4R4IA 1F9SA 4UDUC 3IFTA 1CUKA 3MVVA 4FP5D 3J80i 5E4WC 1EY7A 1QNKA 3LWUA 3CCUA 3A7AB 4JBJA 5I2YA 1EU4A 2WB1G 5IT9L 1EFWA 3TSSA 5DNFA 2QCPX 4MN3A 3OHXC 1B9NA 1CK1A 5C3XA 4G7ZC 1V1PB 1I94Q 1Y69U 1K0RA 2B3GA 2ZT9C 5C3EB 1GUWA 2BA1A 1I94L 1Y1VB 4P71A 3TP5A 5FLMG 1WTXA 3G48A 5C4ZA 1V1OA 4KHVA 4DGZA 1SEBD 1AN8A 1S5CD 2CFMA 1VQPA 4WORA 2L1BA 3K5NA 3A5ZB 3HEJA 4B3TQ 2KBNA 2WFWA 3I4LA 1K3RA 2R92H 1IXRA 2OF1A 4K5WA 1VQHA 2SEBD 2F0LA 4B08A 3C1EA 5CR3A 2F0EA 1D5MC 1GKHA 1X55A 2D9UA 2KCCA 3HOVB 3S9WA 2K5DA 1CKNA 3TMEA 3UE0A 5CORA 4A3EH 2ASBA 4QMGA 2VB2X 2HHHQ 1X56A 4IURA 4E6IA 4IPGA 4R9WA 4KN7C 1EYGA 2PQEA 1ONLA 4X6AH 2XWJB 3SK5A 3JAML 5ELNA 1KABA 3EN2A 1SJHD 4ZUIA 2DY8A 5M5XH 3BYTB 2RCFA 2PQAA 3RNUA 4IOCA 3GTQH 3P1HA 3UDXA 4DU9A 5JPMC 5CC4A 1D6EC 5IYBG 3D31A 1IL8A 3MEHA 1I5FA 1SYGA 5IY0A 4FXGC 5KGUA 3TBIB 4K2LA 2D5DA 3KDFB 1RODA 3T4AC 2GVBA 3CMAA 1QOHA 4R1JA 3K7AH 1NTGA 5HY6A 4EQOA 2KQ3A 4IUUA 5BN4A 1VQKA 4DXGA 1HR0Q 4DFAA 4YHHQ 4LUZA 4OIKA 1HR0L 5GQOA 1TWFH 2BOSA 4YHHL 3H3VH 1O80A 1JE4A 1LTSD 3FP9A 4M1UB 4LF5Q 1I4XA 4JBKA 4F88A 4LF5L 2MNAA 1XXGA 1JOKA 3TREA 3I7FA 3E0JA 5FLMH 2NVXH 4GLXA 3A8IE 1H9SB 1X9NA 3X3MA 1MJCA 3EQLC 1A15A 2N78A 4OELB 3NBIA 4FF1A 5HGQA 2R92B 3I73A 1DONA 1EY8A 3S16H 4IFDI 4B3RL 4YIJA 3ER0A 4NPSA 2VB3X 3MHBA 3SGIA 3KJOA 3S1NB 4ALPA 1CZWA 1DJRD 1SSOA 4HAEA 4OGQC 4ZCKA 4GOPA 2A69D 3LX0A 2EYPA 3FDTA 2ZM6Q 1PRTF 5I9OA 2FJ2A 4GN5A 3R93A 1M4VA 1NUCA 2ZM6L 1PH7A 2I0QA 4IUVA 1OXSC 4JYAQ 3C46A 2K6AA 2B8FA 4JYAL 1G2TA 3DM3A 2NYZD 4YWKA 2F52A 4Q5VA 3S15H 3WOEA 4RKLA 5IGEA 1VQFA 1QILA 2K32A 4Y7NB 4WRDA 4KHPQ 1EY9A 2AWOA 4C3IG 4KHPL 4BBRH 4A3JG 1A63A 1ASZA 1TXYA 5A35A 4GKKQ 4GLAC 2NTTA 1B9MA 5CV5A 2KJXA 4AQYQ 4GKKL 4IJHA 1ENAA 2A68D 5EBCA 2PNRC 3CCQA 3K5OA 4AQYL 1KC8C 1RDPD 4GNXA 5IYBH 1XX8A 3QO2A 2F0IA 1KLGD 4HEDA 4OX9Q 5F2DA 1TWFB 4U68A 3KYHC 4L5TA 1FNVA 2B2WC 4QUFA 3RLNA 2CQAA 1SRUA 3I4OA 3HG9A 3TS0A 1BCPD 4V0BA 3E9IA 4JC0A 1T5EA 4XQJA 1DOKA 1B70B 2BCOA 2E2IH 5C6AA 1IW7C 2UXBQ 1ILPA 3GP7A 2UXBL 3R2TA 1HFNA 1FL0A 4K5VA 1YITA 1HCZA 1IHZA 1JORA 4RCNA 1I4PA 2Q2UA 2F0MA 1KIXA 3C2PA 4UP8A 5FOBB 1X3PA 3CD6A 3HKZG 3O13A 3GTGH 3MEFA 1AW7A 1HTPA 5C5MA 1XPUA 4I65A 1C0AA 4JV5Q 1IL2A 1H9KA 2IHEA 3M85A 4JV5L 1XMQQ 2K52A 4YCUA 4J6HA 2HCCA 4FYDA 1XMQL 1B44D 1NNXA 4A3FG 3DWAA 2R7ZH 2SNMA 1CHQD 1PTOB 3CKIB 4IZ8A 3GTJH 4DUYQ 4NP5A 4X3TA 1W6JA 4A3DG 4DUYL 5NUCA 2YTXA 2HQLA 5CMDA 2N55A 3M7NA 1V9PA 1EIFA 1L1OC 3PF5A 1PFSA 3OW2A 3M4OB 3I4NG 2JEBI 4UPAA 1L1OA 5M3MG 2XWBB 1IKLA 3D6WA 2NZHA 4C3IH 5KNCA 4A3JH 2YYZA 3NTIA 3SK8A 3QWNA 1STEA 4DPGA 5KRUA 1S72A 1BO0A 4QIWB 3P75A 2ZTEA 1J5EQ 4C3HB 1WTRA 1J5EL 5IT9c 3JAME 3KUPA 1F9QA 3NTKA 1LUZA 1SNMA 3A56A 2Z4IA 4MNOA 2HIVA 4BY1B 2E2IB 2AQ3B 5CV8A 2MFIA 5DAUA 1S5BD 4WFN3 3KF6A 2M9VA 1TS5A 1HFGA 4EQPA 1EYDA 1TU2B 1PH4A 2RVLA 2RBMA 1STAA 3K6OA 4N8FA 1UE6A 4M8AA 1NR2A 2XSCA 2PW7A 1OXVA 4JI5Q 4HIMA 4J1MA 5IOCA 4PMBA 4HJ7A 4JI5L 3RLOA 3EBEA 3TEHB 3VR4A 4B3SQ 3I2ZA 3M9BA 3GO5A 1QZGA 4B3SL 3PUVA 2EJGC 1TWCH 1WFQA 2AQ2B 1AP0A 4RAUC 1U9RA 3PIOA 3GTJB 4C56C 2Z9HA 4DAPA 2IX0A 4Q0FA 2CW0C 1ENFA 3SK6A 1MIUA 5EQ0A 4J8QA 4LFAQ 2A68C 1EQQA 4R4QA 3CCJA 1KNAA 3S14H 4LFAL 1K9MC 1SN8A 2B2TC 2HDMA 3X3NA 4EVOA 4K0KQ 1JWUD 2A73B 4DV6L 3CXCA 4K0KL 3I56A 1ICWA 3NPPA 1E2WA 1HNZQ 4DR6Q 2XTIA 1LTTD 2D2CC 5M3FB 4LF4Q 1LLRD 3SVMA 4DR6L 3I4NH 3K5LA 2B2YC 1FGUA 4WJWA 3CF5A 4LF4L 1Y8PB 4LF9Q 1UE1A 1VMPA 5M3MH 2UUAQ 5M5WH 2AUKA 4L8JA 4LF9L 2F0QA 3K5MA 4GLVB 3ND8A 1TWHB 2IHFA 1VQIA 3MWYW 4P73A 5J39A 4IFDG 5EKLA 1A3UA 2G5DA 3OOCA 2KCTA 2R6GA 4RG1A 4JI1Q 2XN9C 4RMFA 1KAAA 1JQYD 4JI1L 2C35B 1BDOA 5JEAG 1FR3A 3BDCA 3SDZA 1S3OA 2EXZA 1TY0A 3HOUG 4BBSG 4XYOA 3G6JB 1Y8OB 1TS3A 1ZYRD 1LTBD 1VS0A 2PMZE 2RDGA 2YTVA 1UE5A 1EQRA 1QVCA 3HOZG 4JPBW 4CJ1B 4GN4B 2E2DC 4A3MB 4QF4A 5M5YH 4A3KH 1JWMD 2VL6A 2MHVA 4DV2Q 1B1ZA 5FLXL 1N33Q 4DV2L 2VZAA 2BE5D 1TKWB 2VQFQ 1N33L 4BY7B 3H0GH 1YNJD 1IZ6A 2VQFL 3S2DH 2Z4HA 4F87A 5GAHC 2WP8J 3LWEA 3OWEB 3S1QB 1OO9B 2O5JC 1VQCA 2AMCB 2JA8G 4HIKA 1VQGA 1TS2A 2XRQD 4F8MA 1SYFA 4DKAC 5IGFA 2AKWB 1I6VC 1FGBD 4PQXA 3DWQA 4JG2A 4R4OA 4GKJQ 5IGDA 1TT2A 3ZYYX 4GKJL 5KNBA 3QIAA 1SAPA 3V05A 3ERSX 5FO7B 3W1GA 3P7JA 4A3FB 2YU9H 1KD1C 2OTJA 3SHLA 1GO3E 1Q90A 2D0PA 1ET9A 1I4GA 1PRTB 1BR9A 4A3DB 2IL8A 1PYWD 2OEOA 2RDFA 3UE1A 1JOOA 3PUYA 1Q1EA 4O1NA 4A3EG 5EKKA 3MFGA 2HIXA 2Z1CA 1LTRD 3J7AF 3I4NB 2K5HA 4RKBA 2SDFA 4APVA 1BBUA 4J15A 5M3MB 4KKSA 4JBMA 5CYUA 3IKJA 1SMXA 2KCMA 4DR4Q 3BDLA 2CCZA 2SNSA 1XWEA 2ZXOA 4DR4L 1N9WA 1GXDC 1CQVA 2R61A 1QUQA 1JICA 2NVYH 1WD1A 1ICFB 1LABA 1PFNA 1PZJD 3KLSX 1E2ZA 1HR0W 3FKIB 1Q46A 4IFDH 3MC0B 4MHEA 1UE7A 2B2VA 3J7AV 4HJAA 4A3LG 4HN7A 3EFXD 4IN3A 4JI0Q 4X3SA 5JEAH 2X69A 1QJOA 1HXYD 1VQEA 1EYAA 2RA4A 4JI0L 1EEID 1A62A 2G9HD 3Q24A 3D4DA 1UEAB 3K58A 1JE5A 1B2TA 2TSSA 4X66Q 3U58A 5M5YB 5IE8A 1CM9A 4X66L 4CHTB 3HOZH 1JT8A 3STBD 2OXPA 4QL5A 2EY2A 2K5QA 3VDYA 2QA4A 1PDQA 4DV5Q 2EYLA 4DV5L 1SYEA 1X54A 2NVTH 2QEJC 1S5FD 3NQIA 2CQOA 4L5RC 3CPFA 5D14A 1Y1WB 3SEBA 1F9PA 2ZTCA 3RN5A 2WIIB 3M4YA 2JA8H 4G4KA 2F3VA 3PMFA 2KVMA 2WAQB 1BF4A 2O2LD 2YU9B 1KQSA 2JE6I 5I9PA 5I6WA 2I5HA 5ELOA 3WWVA 5IGCA 1PZID 5I6YA 5FK9C 3SK4A 4POGA 2G9DA 1YHAA 1DZ1A 3GTKB 4YY3Q 1E0BA 4ME5A 3T53B 3FEWX 2EJMA 5FJ8G 2K05A 2UU9Q 4YY3L 1LM0A 2UU9L 3J81j 3E0EA 1M1KC 4A3IH 3HOYB 4AYBE 2E2JH 3KLRA 1SNDA 1IW7D 2IJ0A 2EYFA 2JA6G 1G6ZA 1Q81C 1JOQA 4MIUA 1FD7D 1TVXA 2EIFA 3S1RB 4A3BG 3RZDB 2Y0SG 4DAYA 1ZYRC 2M00A 1YJNA 1D1KA 1EZ8A 3BZKA 2F0WA 3U9OA 4MZ9A 4P2CB 3DWPA 1DOMA 3L0OA 1DM0B 2QILA 4ZAIA 1SROA 4IUTA 5KNDA 3S24A 5E1FA 2IWHA 3UDIA 4BBRG 2XGTA 1TWAB 1NY4A 2A5HA 4CDCC 4KJNA 1STGA 4RH6A 3HP3A 3F2CA 2BE5C 3G4SA 3BYYB 4OWXB 1I4RA 4ZKCB 3HOUB 4BBSB 3VR2A 1JB3A 4A3LH 1YNJC 2NUCA 1K3BC 1L0XB 5C3WA 2K14A 4K5XA 4LWCA 4NB3A 3ERQA 3GDEA 2RKSA 2RQXA 3HOZB 3R8BA 1PYBA 2I46A 4AIMA 1H9MA 1WTWA 4CBVA 3ULLA 1XNQQ 1CA5A 3K0YA 3MXUA 2FHTA 3PIP3 1E24A 1XNQL 4QCLA 1D7QA 3PO2H 3CQZH 4DK1A 4FXDA 3HZXA 3LGJA 4KY7A 1JC7A 1QG7A 3GQBA 3J81i 3L3OC 1K8MA 3F2UA 5EAYA 4X65Q 3RR5A 2XNAC 1OTCA 4JI7Q 4X65L 5JAVA 1D5XC 3E5SA 2JA8B 2EQSA 2HD3A 5BN3A 4JI7L 1YBYA 5BN5A 1RIPA 3I72A 5T1GA 4LF8Q 4JI8L 3K8AA 5COYA 5J1ZA 4LF8L 1E7ZA 4KI0A 1PTOC 4DK6C 1QVGA 1Z6HA 4B3RQ 3D0FA 1JJCB 1PMRA 1G51A 2EYOA 3CC4A 4B9XA 3Q23A 4G7HC 1IBMQ 3AYHB 1HQMC 1NJIC 1WJJA 1YHQA 4IALA 1B8AA 1IBML 1NMFA 2X6GA 3MXGA 5FJ8H 3DMUA 5C0XJ 3S2HH 1HZAA 2B8GA 3Q0AA 3UDGA 1CA6A 2BH2A 2R7ZG 4QQBX 2PNHA 2RSNA 3N6RA 3VR6A 1XNRQ 1TY2A 4A3EB 5JOBA 1XNRL 4R8IA 2EYHA 4A3GH 1UUPA 1RJTA 2JA6H 4XT3B 5LL6S 3TQYA 4HTHA 2VUMG 4QB4A 2KEEA 2K75A 3J80c 5C0XI 3J7A5 4A3BH 1KNEA 1TIID 3CPWA 3MA2B 3OMCA 5A2QL 1CHPD 1JJGA 1KRSA 5M5XB 2CH4A 1KDBA 2EE1A 1MJEA 1GHKA 4HMJA 3STBC 2DNCA 1GUOA 2DJFC 4JI2Q 3QOJA 3GTQB 5C44G 4IPDA 3I3CA 4JI2L 2ALYB 3PQIA 5CBAE 3E3XA 3M4PA 2CW0D 1HNXQ 1B7YB 1X3QA 4UHVA 4RGMA 2MQHA 2DN8A 3K81C 4A4IA 1GUTA 1HNXL 4GZYC 2F0FA 3FMCA 3J81E 3UDFA 4PMWA 3NXWA 1KRTA 3K7AB 4LAAA 1K8AC 1BUVT 1CKNB 3VYTA 5CV4A 5LHY1 3QB3A 1KLUD 3CQZB 4HCEA 5FLXc 1RCVD 1SJED 3KF8A 2GA4B 4C3JG 4A75A 2JEAI 1EIGA 2WB1B 1I6HH 2ICIA 1PH8A 4C2MH 1VQ8A 5HURA 1PH2A 1PXUA 1I4QA 2B2WA 3H94A 5J22A 3EVQA 1RL2A 3BVZA 2JN4A 2O4XA 1SFOH 1BNZA 4L5SA 1HZBA 4NW2A 1L2FA 1HA5A 2PQAB 2NVXB 2NZ1D 2EOTA 3JAMi 4C1NK 2UUCQ 1SLJA 1BCPF 2YTYA 2GN5A 2UUCL 1HPCA 4RGNA 5CV7A 5K5PA 2LXJA 3VYRA 2VXWA 2KHJA 1NE3A 2Q2TA 5EPLA 4FF2A 1N32Q 4X62Q 3S16B 1N32L 4EGVA 1VQMA 4X62L 5CGKA 1RTOA 1U5KA 2Q8TA 1VQ5A 2H5XA 3KLSA 3T1YQ 1HA6A 5IT9E 4HJ8A 3PSIA 3T1YL 1HZCA 2KA7A 1ESFA 4KD3A 4JOIC 1SBBB 1H95A 1A2UA 3A8KE 4X3KA 1WCMH 2O5IC 4JOIA 2EVBA 3PGZA 1VQ6A 2WACA 4JK1C 1W3SA 3M3YH 3VR5A 3PO3G 2E74C 5IYDH 1EOVA 2E8GA 2NWGA 4RCOA 4H44C 5IYCH 2Y0SB 3CC2A 1E2VA 3GTPH 1XMOQ 4FF4A 3S15B 2VUMH 3PUZA 1XMOL 5C4XG 5G3LD 1PFBA 1D5ZC 1HRJA 3U9SA 1Q86C 4KMUC 3T51B 1J6QA 1K83H 1TQOA 4BBRB 2FMCA 1JMCA 4LJZC 4DAVA 1OXXK 1N8RC 3BZDB 2E2HH 4KY5A 5C44H 2ZJPA 4R4TA 1WVLA 1ZXTA 4GOPB 3AB9A 2QDBA 1X3GA 1T5XD 3CMEA 2A1AA 4B9WA 2C5CA 3NBHA 2IX3A 2K5VA 1QCBD 1ESRA 4C2MB 3G7LA 4XTCS 1IBKQ 3LNNA 1VF7A 5JPNC 2MP1A 2ZTDA 4ZUJA 3CRKC 4ZRZA 1IBKL 1SMYD 2F4IA 3BDOA 4C3JH 2ZJRA 3A7LA 2JA5G 1Z7TA 4A3KG 2NN6I 2EDGA 2D0OA 4ID6A 4MTNA 3L9AX 2JXMB 3Q22A 4L6TB 1FJGL 1U0LA 3FPUB 3F8TA 1YHBA 1SR3A 3K57A 4ODGA 4DAMA 3H6MA 4GS3A 1NSNS 3H0GG 2BDNA 4KJOA 1EWCA 3MXNA 3S1MH 3AFQA 4DV7Q 1DXMA 4IO9A 1EQVA 4IQZA 3HOWG 4P74A 1HZ9A 2OWOA 4DV7L 4H02A 1XYIA 4GNXB 4LFCQ 1F2LA 2F03A 3GTGB 1XPOA 5L37A 2B39A 4H13C 4LFCL 5GAEC 2ES2A 1PRTC 3ULJA 4RGOS 4IPHA 5D3DA 3GTOH 4LFBQ 2Z8LA 3OSOA 5JJZA 4LFBL 2V4DA 2VQEQ 2NVQH 3M3YB 1C9OA 1KHIA 5EJWA 2VQEL 2PYKA 4XT1B 3AMUA 2R7ZB 1SYDA 2Q2IA 4UAIA 3OYYA 1VQBA 3ND9A 4CGYB 1IYJB 4QIWE 2A19A 3GTMH 2PZTA 3UI2A 3A55A 4DR1Q 1TWGH 4QUCA 4V190 1D1IA 3PO3H 2VS1A 2E75C 4DR1L 2K5WA 4NXMQ 4DV6Q 4OXPA 1K83B 4NXML 2Z6BA 2B2TA 1Q8IA 2RSOA 5C4XH 4PG3A 3SXHA 2FMMA 3P20A 1A6XA 3KBXA 5ELBA 5C44B 4C3IB 3EROA 3H09A 4A3JB 2B2YA 3HKSA 3QG1A 2N88A 4KTAA 3FPPA 1XTCD 3J80L 3TP8A 4DK3C 2PI2E 3VA5A 2FFKB 2RCNA 3DUZA 3I90A 1EOTA 2L4NA 2OQ0A 3HOVG 5C4HA 1B50A 1E1OA 5EBDA 2K4KA 2L0CA 4CKBA 1LTID 2TMPA 4CJ0B 1UWVA 1JWSD 1W6KA 5A2QE 1WTVA 1O7LA 4C3JB 2LSSA 2LY7A 2WKDA 4DK0A 4ILWA 1MSGA 2L55A 3I8ZA 4P72A 1V1PA 3R2IA 4KKTA 1L1OB 2YV5A 1MGSA 3DLLA 2JA5H 2Z6KC 1EZ6A 3HFZB 5E7NA 1A3VA 4OHJA 4HJ9A 2F0UA 2KEDA 1VQLA 1II3A 2RF4A 1S40A 4BXXG 2ICEC 3T16A 1Z9FA 1LTAD 1R4QB 1GVPA 4NDXA 2LS01 2L9HA 4YWLA 1I3QH 3J7YW 1Y14B 3I4MH 3GTLH 3HOWH 3NBHB 3HKZB 1B3AA 1N36Q 4XXEA 1K28A 1OXTA 1R4PB 4KY6A 4XDXA 1PFMA 3CCVA 1DCZA 1Q3LA 1PH5A 1N36L 1HQRD 1TWCB 1VQDA 3VR3A 4HIDA 3RD4A 2L12A 5ISRA 1EYCA 3OMGA 3H15A 2IW3A 3NWTA 1EY0A 5LL6X 2V1CC 2BH8A 4JVZA 5GROA 4OIJA 3GTMB 3KF6B 5KEEA 4PNYA 2EYMA 3F1ZA 1STYA 1LTGD 2EPBA 5DM63 3F2BA 3S14B 4B3MQ 4A3IG 2A6EC 4ABNA 4ME3A 4DXFA 1K8OA 1AZPA 2JYOA 4B3ML 2B2UC 1IKMA 5C4XB 4DV1Q 1YNXA 1ZEQX 4IUNA 3V96A 2B2UA 1V1QA 4DV1L 2B29A 2I5LX 1YZ6A 1QZHA 3AU7A 5JJKA 5M5WB 1XTDA 1PTOD 3DEPA 4RGTA 5K36H 1I4HA 1SXTA 3CCMA 3HS0C 1PHJA 1SMYC 2ZXPA 2UUBL 4LUVA 2J4XA 2RDHA 1PTOF 1M90C 3A5UA 4EQNA 1E1TA 1F2ZA 4JCVE 1BBXC 2B63G 4I7AA 2HCIA 2EY1A 3KDFA 2AWNA 1PH6A 3HOVH 2EYJA 1TS4A 1MKHA 3I70A 4JI4Q 1NCVA 3CHBD 4JI4L 4BA1I 4K8IA 1RKNA 2Z0SA 1SYCA 5I2XA 1BXTA 5DLQE 2LMCB 3Q8DA 4NMZA 3S17H 2KHSA 4RHRA 2JA5B 2MPMA 1NMGA 2QDLA 4A3KB 4QJFA 1UAPA 2E76C 2FXQA 3PO2G 3GV6A 4N9PA 4K14A 1WOCA 2QKIC 4LNQA 5FO9B 3JC66 1X32A 2F0GA 3H0GB 1I3QB 5AFWA 1H9SA 5IP7G 3S2DB 3A8JE 2F3WA 2PZUA 1O7IA 4DN4M 5IP9G 1BCPB 3DEOA 2BA0A 2RHSB 4BXXH 4CDDC 2F0JA 4OONA 1BBWA 2A6HD 1FYCA 1J8IA 1IYVA 1Q82C 1CTMA 2L5TA 2MJ8A 1BVSA 2J7ZA 3E9HA 3OTOQ 3OIQA 4UP9A 3OTOL 1AFPA 3BJUA 4K8JA 3EJIA 1V8QA 3K0XA 3CCLA 1KDAA 3M7GA 1YJWA 3FRPB 1LT4D 1ET6A 2NB0A 4P75A 4BA2I 1VQ4A 5IGGA 3K80C 3TDQA 3BG3A 2BDOA 2QF7A 1VQNA 3NQTA 4FO2A 2F0OA 1UNSA 4LF6Q 1YNND 1G291 2K03A 1HTLD 2NN6G 1DOLA 4LF6L 4A3GG 2VY3A 2E5LQ 1VQAA 1AZQA 3AQQA 3NENA 2E5LL 1CFMA 3KK7A 3K59A 1VQJA 1EL0A 1HH2P 5LMNQ 3BZCA 4B3TL 2NVYB 2KHIA 5LMNL 3BU2A 2EJFC 2F3IA 4POFA 4OO1I 5H1SE 5KIXA 5GADC 3CRLC 3S1NH 4XQQA 1S5ED 1Q7YC 3H3VC 4A93G 1STHA 2B63H 2QGQA 1OXUA 1QNUA 2F4VQ 3RMHA 2HHHL 4PZ7A 4FNFA 4TKOB 1EFID 2F4VL 3CC7A 3ICEA 3S17B 1HUNA 2MO0A 1IYUA 5ELFA 4DR3Q 3I55A 3HRZC 2WAQE 4DR3L 4TRDA 4DF7A 1GOZA 1Q8KA 2KCNA 3DHQA 2DGYA 2K01A 4WJ3M 3J80E 4O2DA 3D3RA 4KK7A 2F0NA 4ZYSA 5EGTA 4Y7NH 1U4MA 4CDEC 3HOXG 2IX1A 3RZOH 1KDCA 1GUSA 1PZKD 3NP8A 1QUQB 1WTPA 4JBWA 2LKVA 4RWSC 5E4XA 4KLKA 2VW9A 2NVTB 4UP7A 4ZKBB 2HDLA 2JA7G 1VMCA 4PV1C 5IP7H 1GUGA 2F0HA 2JK8A 5C4JH 3OPOA 4C3HG 5IP9H 1VF5C 1O7YA 3NUCA 1S5DD 1YEZA 4JI8Q 1LTLA 2RHQB 2ENBA 4R4CA 2K28A 1KXLA 4BY1G 1JJ2A 1F2YA 3KBGA 3Q6SA 5CBEE 3GV3A 4RHSA 3AFPA 2K5NA 3TP7A 4ULLA 3RN2A 4KD4A 4ZK9B 2LXKA 5FLXE 3MZ5A 2XRSD 1D8LA 3PIPA 1F9RA 1WCMG 3ZJYC 4IFDJ 4A3IB 4CKEA 2I07B 3U4ZA 2E2JB 2UXDQ 1EY5A 2R7DA 4OWTB 4KKUA 5BR8Q 4MTKA 1U4LA 2UXDL 1KAWA 5BR8L 3NTHA 5JEAJ 5IYDG 2PW5A 3VA7A 4DV0Q 5IYCG 4YCWA 1SNQA 2NN6H 3A0JA 1L0WA 4DV0L 4IJLA 4DNTB 2XIWA 4A3CG 4IUPA 4R8NA 3OW7A 1CKMA 2R7FA 5EKIA 5IIFA 4GOPC 2WKCA 2OT2A 4HSPA 1P16A 1EY4A 1PRTD 2IT1A 2F0TA 5KYIA 3T1HQ 1AH9A 3T1HL 3AEVA 1AE2A 2L15A 5GAGC 5JVG3 5HGTA 1SE4A 2UXCQ 2LFNA 3HGBA 2GVAA 2R93G 2B63B 2UXCL 2P5ZX 4RA8A 1STNA 1CQFA 4Z9CB 4JI3Q 4TQUS 3WDNA 2KECA 3T13A 1PTOH 4RFBA 4JI3L 3TP6A 3ULPA 4A93H 3TN2A 1X6OA 4PZ8A 2H4OA 1FNWA 1AE3A 3IL8A 1EIYB 3QR8A 1NR4A 2DUDA 2A6HC 4K6DA 1QE6A 5M3FG 1EUJA 3IFDA 3M4OH 1PYSB 3RZOB 1PH9A 1SE2A 1ASYA 2A8VA 1GJXA 3TZUA 4DAYB 3PO2B 3G71A 4JI6Q 2EY6A 2PI2A 4FDBA 1N34Q 4DA2A 4JI6L 2OQKA 1K73C 1N34L 4OL7A 3HOXH 1WI5A 5EPJA 4GNXC 1EWIA 5C4JB 1JCKB 4TVAB 1VQ7A 3C1FA 3ITPA 4WJ4A 3PF4A 1G6PA 2JA7H 1B53A 1WTQA 2WINB 2F1MA 3MAQA 1Z47A 1YNNC 4C3HH 4YWMA 4OX9L 2F0SA 3NE5B 1K0SA 1GUNA 3B6YA 1A8VA 3BVGA 3CW2C 1GM5A 2ATWA 4C1NI 5E3FA 5AJ3Q 2VNUD 4BY1H 2OCEA 3BS1A 1G8ZD 5AJ3L 4A3MG 2MGSA 5LMUQ 3K7UC 1C7YA 3TS2A 5LMUL 1YJ9A 3S2HB 2KENA 4DR7Q 5JJLA 1YVCA 1EQTA 4DR7L 1E3PA 4H7BA 4O42A 1G2SA 2HT1A 2WV6D 3SE0A 4I7ZC 2FINB 2IY5B 3MFYA 3D8GA 3NSWA 4BY7G 4A3GB 2JA6B 1VCIA 1HJPA 3I91A 2ID0A 3BVMA 3SR1A 2K1BA 4DV4Q 4LK1C 1F2MA 4DV4L 1LO5D 1O7ZA 3URYA 4N8X1 4LF7Q 4A3BB 4FXKC 4K2KA 5ELEA 4LF7L 5JJIA 2F0DA 4A3CH 1E22A 5M9OA 1LT5D 1MD2D 2WB1E 5ELCA 1WYDA 4PMCA 4EX5A 2HQEA 4OEMB 3TRZA 1LT3D 4JW0A 2SOBA 3CP0A 4NKLA 3J81c 4HR7B 2JP1A 4K6LA 4HMIA 3WOFA 1LV9A 5G3LF 4A93B 1R9TH 2PCFB 2R93H 2NBFA 3EA6A 1SNPA 1H9JA 1SDFA 1JR0D 3GD7A 2K33A 4S3SA 2CWPA 2F0KA 1BKBA 1X65A 3H3VI 2A6ED 3NWSA 1PVOA 2PPBC 2Q2HA 3R3OA 1FNUA 4GN3B 4DR5Q 2D62A 3A74A 2JQOA 5M3FH 4DR5L 3L7ZC 2EZVA 1I6HB 3HOXB 4DNIA 1FVIA 1SYBA 1SFOB 4CKCA 5IWAQ 1GHJA 3RUZA 3PUWA 5IWAL 2Q8IB 2K50A 2DNEA 5EPKA 2QW7A 2JA7B 1TWHH 3FKIG 1I50H 4KV6A 4Y52H 1EY6A 1FJGQ 4OO1G 3U50C 1VQOA 3D6CA 2F0PA 2Y0SE 4XIGS 1U4RA 4FF3A 1MI2A 5DM73 1B4OA 4AYBG 1X3EA 2AUJD 4DR2Q 1PV4A 3I4MG 1CKOA 1PH1A 4DR2L 1ENCA 1PH3A 4TSSA 3PIO3 2K04A 1EEFD 1UEBA 2EXDA 2JJQA 2DY7A 1SE3A 1WCMB 2A69C 3KF8B 4A3MH 4H0LC 1DGSA 4DUZQ 1WTOA 1VQ9A 1LACA 3QOLA 4DUZL 5DEHA 1HHVA 1TR5A 3C3LA 5CV6A 1C48A 1EWHA 3FVQA 3GTPB 5C3EG 4BY7H 1YI2A 5FKAC 1Y1VG 2ZXRA 2VUMB 4X64Q 1YIJA 1ML0D 1Y1WG 3KFUA 3PUXA 4EQ5A 3D4RA 3S1QH 4X64L 1NAPA 4CJ2C 3F2DA 3IAYA 2PMZB 2WAQG 2MO1A 3L2PA 3CCEA 5K36G 1R9TB 3RLFA 3IRBA 2R93B 2CHBD 1BQQT 2I5MX 3W3AA 4XYQA 4U673 2QEXA 2E2HB 3NELA 5FO8B 1Y8NB 2AQ1B 4HCSA 1MSHA 2JA9A 2JSOA 4A3FH 3JAMc 4LMQD 4X3UA 1CSQA 3CCSA 5CV9A 3HOYG 1Q12A 2N8NA 3M4QA 2M2LA 1W2BA 1CI3M 3PV0A 1RTNA 2CWAA 4A3DH 3KLWA 4AH6A 4G7OC 2OTLA 3G6EA 2MUYA 3TZDA 1HNZL 2KUMA 2N3SA 4IPCA 1BOSA 3MTSA 1EU3A 1SNOA 1STBA 3W1BA 1L0YB 4L5QA 2UUAL 1BCPC 4G57A 4CDFC 1I50B 4IOAA 1U4PA 1PA6A 5C0XG 5IODA 1O78A 3T56B 1ILQA 1F77A 1D2BA 3CCRA 3FKIH 1HUMA 1T9HA 2XVSA 3J7ZC 1WTHA 2NTSA 2X6LA 2Z6KA 1A0IA 3S1MB 4OO1H 4DNRB 1KTKA 1QWYA 4BS9A 3OIPA 2H1EA 4KN4C 1V43A 4QGUA 1H9RA 1G91A 3GTOB 3A54A 4ZLTF 2CKZB 1KL9A 2HUGA 2ZJQA 5C5LA 3CAMA 3FHWA 1VDZA 4HJ5A 1K8GA 3N52A 2NVQB 3W5OA 1MBYA 4FVMA 4OWWB 2KOLA 4O0AA 4A76A 5D65A 5J3BA 2Q8RE 5LMNW 4XQNA 2EY5A 3NK9A 3DM1A 1TWGB 1DD2A 1XJVA 1P8LA 4HSVA 3PO3B 2J0TD 1C8CA 1CT1D 3MXPA 5C3EH 5D3IB 1Y1VH 1X3FA 3NEMA 3V2TA 5I4DA 3PCOB 4HIOA 4L63B 2C9OA 5TSSA 4F7XA 2F0VA 1NBWA 3MXNB 1Y1WH 3VYUA 2L11A 2IPKD 2DJGC 1Q1BA 1A2TA 3EIVA 2N49A 3W2DA 1S4ZA 4PZ6A 1M8AA 1XPRA 3QJYA 2R92G 4N9TA 2A74C 5KYLA 4LW1A 1ZKOA 5ELDA 2UUBQ 3KJPA 1SE8A 1LT6D 1HNWQ 3E6ZX 4KHZA 4DV3Q 3ONAB 1IBLQ 3GTKH 1CSPA 4BWGB 1HNWL 4DV3L 1IBLL 1C4QA 3DXJC 1PLFA 1SNCA 1J9OA 3HOYH 1A3TA 5T1IA 2K7VA 1GD7A 4YCVA 2CVRA 4IUQA 1LYLA 4UY8C 2AHOB 3J81L 1B3QA 1RHPA 3H91A 3HKZE 5JVH3 3D4WA 3S1RH 3NHHA 3RZDH 4NXNQ 4ZQ3A 1RD9D 1QB5D 4NXNL 1EIHA 3U4VA 3KOJA 1AEXA 4LUOA 2B2VC 2NZOA 2PO4A 3CU7A 2PZWA 1DYQA 1JB7A 5C0XH 1MHWC 1WD0A 3VYSA 1TWAH 2R3ZA
chains in the Genus database with same CATH topology
4AYBB 1CZGA 1RF2D 5IGBA 3I4MB 3GTLB 3HOWB 3OWFA 1F9SA 4UDUC 3IFTA 3MVVA 4FP5D 5E4WC 1EY7A 1QNKA 3LWUA 3A7AB 5I2YA 1EU4A 5IT9L 3TSSA 5DNFA 2QCPX 4MN3A 3OHXC 1B9NA 1CK1A 5C3XA 4G7ZC 1V1PB 1Y69U 2ZT9C 5C3EB 1GUWA 2BA1A 1Y1VB 3TP5A 1WTXA 5C4ZA 1V1OA 4KHVA 4DGZA 1SEBD 1AN8A 1S5CD 4WORA 2L1BA 3K5NA 3HEJA 3I4LA 2OF1A 4K5WA 2SEBD 2F0LA 4B08A 3C1EA 5CR3A 2F0EA 1D5MC 2D9UA 2KCCA 3HOVB 3S9WA 2K5DA 3TMEA 5CORA 4QMGA 2VB2X 4IURA 4E6IA 4R9WA 4KN7C 2PQEA 1ONLA 2XWJB 3SK5A 3JAML 1KABA 1SJHD 4ZUIA 2DY8A 3BYTB 3P1HA 4DU9A 5JPMC 5CC4A 1D6EC 3D31A 1IL8A 3MEHA 1SYGA 4FXGC 5KGUA 3TBIB 4K2LA 2D5DA 1RODA 3T4AC 1QOHA 4EQOA 2KQ3A 4IUUA 5BN4A 4DXGA 4DFAA 4OIKA 2BOSA 1O80A 1JE4A 1LTSD 4M1UB 1I4XA 4F88A 1XXGA 1JOKA 3E0JA 3A8IE 1H9SB 3X3MA 3EQLC 1A15A 3NBIA 4FF1A 2R92B 3I73A 1DONA 1EY8A 4IFDI 4YIJA 2VB3X 3MHBA 3S1NB 1CZWA 1DJRD 1SSOA 4HAEA 4OGQC 2A69D 3LX0A 2EYPA 3FDTA 1PRTF 5I9OA 2FJ2A 3R93A 1M4VA 1NUCA 4IUVA 1OXSC 3C46A 2K6AA 2B8FA 1G2TA 2NYZD 4Q5VA 3WOEA 4RKLA 5IGEA 1QILA 2K32A 4Y7NB 4WRDA 1EY9A 2AWOA 4C3IG 5A35A 2NTTA 1B9MA 5CV5A 2KJXA 1ENAA 2A68D 5EBCA 2PNRC 3K5OA 1RDPD 1XX8A 3QO2A 2F0IA 1KLGD 4HEDA 5F2DA 1TWFB 4U68A 1FNVA 2B2WC 4QUFA 2CQAA 3HG9A 1BCPD 4V0BA 1T5EA 4XQJA 1DOKA 2BCOA 5C6AA 1IW7C 1ILPA 3GP7A 3R2TA 1HFNA 4K5VA 1HCZA 1IHZA 1JORA 4RCNA 1I4PA 2F0MA 3C2PA 5FOBB 1X3PA 3O13A 1AW7A 1HTPA 5C5MA 4I65A 1H9KA 3M85A 4J6HA 2HCCA 4FYDA 1B44D 3DWAA 2SNMA 1CHQD 1PTOB 3CKIB 4IZ8A 4NP5A 4X3TA 1W6JA 5NUCA 5CMDA 2N55A 3M7NA 3M4OB 2JEBI 2XWBB 1IKLA 3D6WA 5KNCA 2YYZA 3NTIA 3SK8A 3QWNA 1STEA 5KRUA 1BO0A 4QIWB 3P75A 4C3HB 1WTRA 3JAME 3KUPA 1F9QA 3NTKA 1SNMA 3A56A 2Z4IA 4BY1B 2E2IB 2AQ3B 5CV8A 5DAUA 1S5BD 4WFN3 2M9VA 1TS5A 1HFGA 4EQPA 1EYDA 1TU2B 2RVLA 2RBMA 1STAA 3K6OA 4M8AA 1NR2A 2XSCA 2PW7A 1OXVA 4J1MA 5IOCA 4PMBA 3VR4A 3GO5A 3PUVA 2EJGC 2AQ2B 1AP0A 4RAUC 1U9RA 3GTJB 4C56C 4DAPA 2IX0A 4Q0FA 2CW0C 1ENFA 3SK6A 5EQ0A 4J8QA 2A68C 1KNAA 2B2TC 2HDMA 3X3NA 4EVOA 1JWUD 2A73B 1ICWA 3NPPA 1E2WA 1LTTD 2D2CC 5M3FB 1LLRD 3SVMA 3K5LA 4WJWA 2B2YC 1Y8PB 1VMPA 2AUKA 4L8JA 2F0QA 3K5MA 3ND8A 1TWHB 3MWYW 5J39A 4IFDG 5EKLA 1A3UA 3OOCA 2R6GA 2XN9C 1KAAA 1JQYD 1BDOA 5JEAG 1FR3A 3BDCA 3SDZA 2EXZA 1TY0A 4XYOA 3G6JB 1Y8OB 1TS3A 1ZYRD 1LTBD 2RDGA 4CJ1B 2E2DC 4A3MB 4QF4A 1JWMD 2MHVA 1B1ZA 5FLXL 2BE5D 1TKWB 4BY7B 1YNJD 2Z4HA 4F87A 2WP8J 3LWEA 3OWEB 3S1QB 1OO9B 2O5JC 1TS2A 2XRQD 4F8MA 1SYFA 5IGFA 1I6VC 1FGBD 4PQXA 3DWQA 5IGDA 1TT2A 3ZYYX 5KNBA 3QIAA 1SAPA 3V05A 5FO7B 4A3FB 3P7JA 3SHLA 1Q90A 1ET9A 1I4GA 1PRTB 1BR9A 4A3DB 2IL8A 1PYWD 2OEOA 2RDFA 1JOOA 3PUYA 1Q1EA 4O1NA 5EKKA 3MFGA 3J7AF 2Z1CA 1LTRD 3I4NB 4RKBA 2SDFA 5M3MB 4KKSA 5CYUA 3IKJA 3BDLA 2SNSA 1XWEA 2ZXOA 1GXDC 1CQVA 2R61A 1JICA 1WD1A 1LABA 1PFNA 1PZJD 3KLSX 1E2ZA 3FKIB 4IFDH 3MC0B 4MHEA 2B2VA 3J7AV 4HN7A 3EFXD 4IN3A 4X3SA 5JEAH 2X69A 1QJOA 1HXYD 2RA4A 1EYAA 1EEID 2G9HD 3Q24A 3D4DA 1UEAB 3K58A 1B2TA 2TSSA 5M5YB 1CM9A 4CHTB 2OXPA 2EY2A 2K5QA 1PDQA 2EYLA 1SYEA 2QEJC 1S5FD 3NQIA 5D14A 1Y1WB 3SEBA 1F9PA 2WIIB 3M4YA 4G4KA 2F3VA 3PMFA 2KVMA 2WAQB 1BF4A 2O2LD 2YU9B 2JE6I 5I9PA 5I6WA 5IGCA 1PZID 5I6YA 5FK9C 3SK4A 2G9DA 1DZ1A 3GTKB 1E0BA 4ME5A 3T53B 3FEWX 2EJMA 2K05A 3HOYB 3KLRA 1SNDA 1IW7D 2IJ0A 2EYFA 1G6ZA 1JOQA 4MIUA 1FD7D 1TVXA 3S1RB 3RZDB 4DAYA 1ZYRC 2M00A 1D1KA 1EZ8A 2F0WA 3U9OA 4P2CB 3DWPA 1DOMA 1DM0B 2QILA 4ZAIA 4IUTA 5KNDA 5E1FA 2IWHA 1TWAB 2A5HA 4KJNA 1STGA 4RH6A 3HP3A 2BE5C 3BYYB 1I4RA 4ZKCB 3HOUB 4BBSB 3VR2A 1JB3A 1YNJC 2NUCA 1L0XB 5C3WA 4K5XA 3ERQA 2RKSA 2RQXA 3HOZB 3R8BA 2I46A 1H9MA 1WTWA 4CBVA 1CA5A 3K0YA 3MXUA 2FHTA 3PIP3 4QCLA 4DK1A 4FXDA 3HZXA 4KY7A 1JC7A 1QG7A 3GQBA 3L3OC 1K8MA 3F2UA 2XNAC 5JAVA 1D5XC 3E5SA 2JA8B 5BN3A 5BN5A 3I72A 5T1GA 5COYA 5J1ZA 4KI0A 1PTOC 1Z6HA 1PMRA 2EYOA 4B9XA 3Q23A 4G7HC 1HQMC 4IALA 2X6GA 3MXGA 3DMUA 5C0XJ 3Q0AA 2B8GA 1CA6A 2RSNA 3N6RA 3VR6A 1TY2A 4A3EB 5JOBA 4R8IA 2EYHA 1UUPA 1RJTA 4XT3B 5LL6S 4HTHA 4QB4A 2KEEA 5C0XI 1KNEA 1TIID 3MA2B 3OMCA 5A2QL 1CHPD 5M5XB 1KDBA 2EE1A 1GHKA 4HMJA 2DNCA 1GUOA 3QOJA 3GTQB 3I3CA 5CBAE 2CW0D 1X3QA 4RGMA 2DN8A 1GUTA 4GZYC 2F0FA 3FMCA 3J81E 4PMWA 3NXWA 3K7AB 4LAAA 1BUVT 3VYTA 5CV4A 5LHY1 3QB3A 1KLUD 3CQZB 4HCEA 1RCVD 1SJED 3KF8A 2GA4B 4C3JG 2JEAI 1EIGA 2WB1B 2ICIA 5HURA 1PXUA 1I4QA 2B2WA 3H94A 5J22A 3EVQA 3BVZA 2O4XA 1BNZA 4NW2A 1HA5A 2NVXB 2NZ1D 2EOTA 4C1NK 1BCPF 1HPCA 4RGNA 5CV7A 5K5PA 3VYRA 2VXWA 5EPLA 4FF2A 3S16B 4EGVA 5CGKA 1RTOA 2Q8TA 3KLSA 1HA6A 5IT9E 2KA7A 1ESFA 4KD3A 1SBBB 1A2UA 3A8KE 4X3KA 2O5IC 2EVBA 2WACA 4JK1C 3VR5A 2E74C 2NWGA 4RCOA 4H44C 2Y0SB 1E2VA 4FF4A 3S15B 3PUZA 5G3LD 1PFBA 1D5ZC 1HRJA 3U9SA 4KMUC 3T51B 1TQOA 4BBRB 2FMCA 4LJZC 4DAVA 1OXXK 3BZDB 4KY5A 1WVLA 1ZXTA 3AB9A 2QDBA 1T5XD 4B9WA 2C5CA 3NBHA 2IX3A 1QCBD 1ESRA 4C2MB 3G7LA 4XTCS 3LNNA 1VF7A 5JPNC 2MP1A 4ZUJA 3CRKC 4ZRZA 1SMYD 2F4IA 3BDOA 3A7LA 1Z7TA 2NN6I 2EDGA 4ID6A 3L9AX 2JXMB 3Q22A 4L6TB 3FPUB 3K57A 4ODGA 3H6MA 1NSNS 2BDNA 4KJOA 1EWCA 3MXNA 1DXMA 1EQVA 4IQZA 1XYIA 1F2LA 2F03A 3GTGB 2B39A 4H13C 1PRTC 4RGOS 5D3DA 2Z8LA 3OSOA 5JJZA 2V4DA 3M3YB 5EJWA 2PYKA 4XT1B 3AMUA 2R7ZB 1SYDA 4UAIA 3ND9A 4CGYB 2PZTA 3UI2A 3A55A 4V190 4QUCA 1D1IA 2E75C 2K5WA 1K83B 2B2TA 1Q8IA 2RSOA 3SXHA 2FMMA 3P20A 1A6XA 3KBXA 5ELBA 5C44B 4C3IB 3EROA 3H09A 4A3JB 2B2YA 3QG1A 2N88A 4KTAA 3FPPA 1XTCD 3J80L 3TP8A 3VA5A 2FFKB 3DUZA 3I90A 1EOTA 2L4NA 1B50A 5C4HA 5EBDA 2L0CA 4CKBA 1LTID 2TMPA 4CJ0B 1JWSD 1W6KA 5A2QE 1WTVA 1O7LA 4C3JB 2LY7A 2WKDA 4DK0A 4ILWA 1MSGA 2L55A 3I8ZA 1V1PA 3R2IA 4KKTA 1MGSA 1EZ6A 1A3VA 4OHJA 2F0UA 2KEDA 1II3A 2ICEC 3T16A 1LTAD 1R4QB 4NDXA 2LS01 2L9HA 3J7YW 3HKZB 1B3AA 4XXEA 1R4PB 1OXTA 4KY6A 4XDXA 1PFMA 1DCZA 1Q3LA 1HQRD 1TWCB 3VR3A 3RD4A 2L12A 5ISRA 1EYCA 3OMGA 2IW3A 3NWTA 1EY0A 5LL6X 4OIJA 3GTMB 5KEEA 4PNYA 2EYMA 1STYA 1LTGD 2EPBA 5DM63 3S14B 2A6EC 4ABNA 4DXFA 1K8OA 1AZPA 2JYOA 2B2UC 1IKMA 5C4XB 1ZEQX 4IUNA 3V96A 2B2UA 3AU7A 5M5WB 3DEPA 1PTOD 4RGTA 5K36H 1I4HA 1SXTA 3HS0C 1SMYC 2ZXPA 2J4XA 2RDHA 1PTOF 4EQNA 1F2ZA 1BBXC 2HCIA 2EY1A 2AWNA 2EYJA 1TS4A 3I70A 1NCVA 3CHBD 4BA1I 4K8IA 1RKNA 1SYCA 5I2XA 1BXTA 2LMCB 4NMZA 2KHSA 4RHRA 2JA5B 2MPMA 4A3KB 1UAPA 2E76C 3GV6A 4N9PA 4K14A 2QKIC 5FO9B 1X32A 2F0GA 3H0GB 1I3QB 5AFWA 1H9SA 3S2DB 3A8JE 2F3WA 2PZUA 4DN4M 1BCPB 3DEOA 2BA0A 2F0JA 2A6HD 1FYCA 1J8IA 1IYVA 1CTMA 2L5TA 2MJ8A 2J7ZA 3OIQA 1AFPA 4K8JA 3EJIA 1V8QA 1KDAA 3M7GA 3FRPB 1LT4D 1ET6A 2NB0A 4BA2I 5IGGA 3TDQA 3BG3A 2BDOA 2QF7A 3NQTA 4FO2A 2F0OA 1UNSA 1YNND 1G291 2K03A 1HTLD 2NN6G 1DOLA 1AZQA 1CFMA 3KK7A 3K59A 1EL0A 2NVYB 2EJFC 4OO1I 5KIXA 3CRLC 4XQQA 1S5ED 3H3VC 1STHA 1OXUA 1QNUA 3RMHA 4TKOB 4FNFA 1EFID 3S17B 1HUNA 1IYUA 5ELFA 3HRZC 4TRDA 4DF7A 1GOZA 2KCNA 3DHQA 2K01A 3J80E 3D3RA 4KK7A 2F0NA 4ZYSA 5EGTA 1U4MA 2IX1A 1KDCA 1GUSA 1PZKD 3NP8A 1WTPA 4JBWA 2LKVA 4RWSC 5E4XA 2NVTB 4ZKBB 2HDLA 1VMCA 4PV1C 1GUGA 2F0HA 3OPOA 4C3HG 1VF5C 1O7YA 3NUCA 1S5DD 2ENBA 2K28A 1F2YA 3KBGA 3Q6SA 5CBEE 3GV3A 4RHSA 3TP7A 4ULLA 4KD4A 4ZK9B 5FLXE 3MZ5A 2XRSD 1F9RA 4IFDJ 4A3IB 4CKEA 2I07B 2E2JB 1EY5A 4KKUA 1U4LA 3NTHA 5JEAJ 2PW5A 3VA7A 1SNQA 2NN6H 4DNTB 2XIWA 4IUPA 4R8NA 3OW7A 5IIFA 5EKIA 2WKCA 2OT2A 4HSPA 1PRTD 1EY4A 2IT1A 2F0TA 5KYIA 5JVG3 5HGTA 1SE4A 2LFNA 3HGBA 2B63B 4RA8A 1STNA 1CQFA 4Z9CB 4TQUS 3WDNA 2KECA 3T13A 1PTOH 4RFBA 3TP6A 3TN2A 2H4OA 1FNWA 3IL8A 1NR4A 2A6HC 4K6DA 1QE6A 3IFDA 3RZOB 1SE2A 1GJXA 3TZUA 3PO2B 2EY6A 4DA2A 4OL7A 5EPJA 5C4JB 1JCKB 3C1FA 3ITPA 1B53A 1WTQA 2WINB 2F1MA 3MAQA 1Z47A 1YNNC 2F0SA 3NE5B 1GUNA 3BVGA 4C1NI 5E3FA 2VNUD 3BS1A 1G8ZD 2MGSA 3S2HB 1EQTA 4H7BA 4O42A 1G2SA 2WV6D 3SE0A 4I7ZC 2FINB 3MFYA 3D8GA 3NSWA 4A3GB 2JA6B 1VCIA 3I91A 2ID0A 3BVMA 3SR1A 2K1BA 4LK1C 1F2MA 1LO5D 1O7ZA 3URYA 4A3BB 4FXKC 4K2KA 5ELEA 2F0DA 5M9OA 1LT5D 1MD2D 5ELCA 4PMCA 2HQEA 1LT3D 2SOBA 4NKLA 4HR7B 2JP1A 4K6LA 4HMIA 3WOFA 1LV9A 5G3LF 4A93B 2PCFB 2NBFA 3EA6A 1SNPA 1H9JA 1SDFA 1JR0D 3GD7A 2K33A 4S3SA 2F0KA 2A6ED 3NWSA 2PPBC 3R3OA 1FNUA 2D62A 2EZVA 3L7ZC 1I6HB 3HOXB 1SYBA 1SFOB 4CKCA 1GHJA 3RUZA 3PUWA 2Q8IB 2DNEA 5EPKA 2JA7B 4KV6A 1EY6A 4OO1G 3D6CA 2F0PA 4XIGS 1U4RA 4FF3A 1MI2A 5DM73 1B4OA 2AUJD 1ENCA 4TSSA 3PIO3 2K04A 1EEFD 2DY7A 1SE3A 1WCMB 2A69C 4H0LC 1WTOA 1LACA 3QOLA 5DEHA 1HHVA 1TR5A 3C3LA 5CV6A 1C48A 1EWHA 3FVQA 3GTPB 5FKAC 2ZXRA 2VUMB 1ML0D 3PUXA 3D4RA 1NAPA 4CJ2C 3IAYA 2PMZB 5K36G 1R9TB 3RLFA 2R93B 2CHBD 1BQQT 3W3AA 4XYQA 4U673 2E2HB 5FO8B 1Y8NB 2AQ1B 4HCSA 1MSHA 2JSOA 4LMQD 4X3UA 5CV9A 1Q12A 2M2LA 1CI3M 3PV0A 1RTNA 4G7OC 2MUYA 3TZDA 2KUMA 1BOSA 3MTSA 1EU3A 1SNOA 1STBA 1L0YB 1BCPC 4G57A 1I50B 1U4PA 5C0XG 5IODA 1O78A 3T56B 1ILQA 1F77A 1D2BA 1HUMA 2XVSA 2NTSA 2X6LA 3S1MB 4OO1H 4DNRB 1KTKA 1QWYA 4BS9A 3OIPA 2H1EA 4KN4C 1V43A 1H9RA 1G91A 3GTOB 3A54A 4ZLTF 2HUGA 5C5LA 1VDZA 3N52A 2NVQB 1MBYA 4FVMA 2KOLA 5D65A 2Q8RE 4XQNA 2EY5A 3NK9A 3DM1A 1TWGB 1DD2A 4HSVA 3PO3B 2J0TD 1C8CA 1CT1D 3MXPA 5D3IB 3V2TA 5I4DA 4L63B 2C9OA 5TSSA 4F7XA 2F0VA 3VYUA 2L11A 2IPKD 1Q1BA 1A2TA 3W2DA 1S4ZA 1M8AA 3QJYA 4N9TA 2A74C 5KYLA 1ZKOA 5ELDA 1LT6D 3E6ZX 4KHZA 3ONAB 4BWGB 1C4QA 3DXJC 1PLFA 1SNCA 1J9OA 1A3TA 5T1IA 2K7VA 2CVRA 4IUQA 3J81L 1RHPA 3H91A 5JVH3 3D4WA 3NHHA 4ZQ3A 1RD9D 1QB5D 1EIHA 1AEXA 2B2VC 2PO4A 3CU7A 2PZWA 1DYQA 5C0XH 1WD0A 3VYSA 2R3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8J A;  3EJI A;  3P1H A;  1F2Y A;  4DU9 A;  3BDL A;  5KEE A;  5CC4 A;  4HTH A;  4PNY A;  1KDA A;  2SNS A;  2M00 A;  4QB4 A;  1ENC A;  2PZT A;  2EYM A;  5IGB A;  1STY A;  2F0Q A;  5E3F A;  5CV5 A;  3TP7 A;  1ENA A;  3MEH A;  1EZ8 A;  3OWF A;  5IGG A;  1SYG A;  5J39 A;  2F0W A;  4KD4 A;  3SK8 A;  3U9O A;  5KGU A;  3MZ5 A;  5EKL A;  1A3U A;  4K2L A;  3S9W A;  5KRU A;  3OMC A;  3NQT A;  5JOB A;  3MVV A;  5C5L A;  3SK6 A;  3P75 A;  2F0O A;  1KDB A;  1EY7 A;  1KAA A;  1EY5 A;  4IUN A;  2KQ3 A;  2F0I A;  4EQO A;  4H7B A;  5E1F A;  5F2D A;  4HMJ A;  4DFA A;  3SXH A;  3QOL A;  1TQO A;  5I6Y A;  3BDC A;  3QOJ A;  3D8G A;  2PW5 A;  4KJN A;  2EXZ A;  1STG A;  5DEH A;  1EY0 A;  3SR1 A;  1SNM A;  1SNQ A;  1TR5 A;  1F2M A;  5CV6 A;  3ERO A;  2EY5 A;  1EYA A;  3NK9 A;  4KY5 A;  2NUC A;  5C3X A;  4R8N A;  5C3W A;  4K5X A;  5IIF A;  5CV8 A;  4KTA A;  5DAU A;  4K2K A;  3TP8 A;  3VA5 A;  3ERQ A;  2RKS A;  3D4D A;  3TP5 A;  5K5P A;  2F0F A;  5KIX A;  1EY4 A;  1JOK A;  2F0D A;  3MXP A;  2F0T A;  2QDB A;  5C4Z A;  5KYI A;  5M9O A;  3NXW A;  4KHV A;  4LAA A;  5C6A A;  4EQN A;  4PMC A;  3V2T A;  1F2Z A;  4DGZ A;  4EQP A;  5C4H A;  1EYD A;  5CV4 A;  4QF4 A;  2HQE A;  4F7X A;  5HGT A;  2F0V A;  4B9W A;  3QB3 A;  2EY1 A;  2SOB A;  2OXP A;  4NKL A;  2EY2 A;  1A2T A;  4HMI A;  2RBM A;  1STA A;  1STH A;  1STN A;  2EYJ A;  4K5V A;  4WOR A;  3HZX A;  4N9T A;  1IHZ A;  2PW7 A;  1JOR A;  4KY7 A;  3HEJ A;  5HUR A;  4ZUJ A;  1SNP A;  3T13 A;  2EYL A;  3TP6 A;  4J1M A;  1EY8 A;  2F0M A;  5IOC A;  5KYL A;  3EVQ A;  5J22 A;  4K8I A;  4PMB A;  4YIJ A;  2O4X A;  4S3S A;  1SYE A;  3MHB A;  1RKN A;  1SYC A;  5CV9 A;  2F0K A;  4NMZ A;  2OF1 A;  4K5W A;  2KHS A;  5C5M A;  2F0L A;  3C1E A;  4I65 A;  4K6D A;  4TRD A;  4DF7 A;  4F8M A;  4ID6 A;  5CR3 A;  2F0E A;  1SYF A;  3DHQ A;  3E5S A;  1EZ6 A;  5JAV A;  1SNC A;  3R3O A;  3LX0 A;  5IGF A;  1A3T A;  1A3V A;  4N9P A;  2EYP A;  4K14 A;  4ODG A;  2F0N A;  5CV7 A;  3H6M A;  5EGT A;  1TT2 A;  2F0U A;  2F3V A;  1NSN S;  3PMF A;  1SNO A;  1II3 A;  1U9R A;  1STB A;  4J6H A;  5J1Z A;  2EY6 A;  4KJO A;  3TME A;  1KDC A;  5I9O A;  5IGD A;  4QMG A;  1NUC A;  2F0G A;  2SNM A;  3NP8 A;  3T16 A;  1EQV A;  4IZ8 A;  5I9P A;  5I6W A;  4E6I A;  3D4W A;  2LKV A;  4NDX A;  1SYB A;  5IGC A;  2EYO A;  2F3W A;  2PQE A;  2PZU A;  3NHH A;  4OL7 A;  3RUZ A;  4ZQ3 A;  3SK4 A;  4G57 A;  3SHL A;  4B9X A;  5CGK A;  4NP5 A;  4ME5 A;  3SK5 A;  2F0J A;  3C1F A;  3ITP A;  5NUC A;  2F0H A;  1KAB A;  4EVO A;  1AEX A;  4IAL A;  4RKL A;  3OSO A;  5IGE A;  4KV6 A;  4KD3 A;  3NUC A;  4ZUI A;  5IOD A;  1EY6 A;  3DMU A;  2PZW A;  2OEO A;  4KY6 A;  2RDF A;  1A2U A;  1JOO A;  3D6C A;  1SND A;  5EKK A;  2EYF A;  5ISR A;  4WRD A;  1EY9 A;  2F0P A;  1EYC A;  1JOQ A;  3OMG A;  2F0S A;  4MIU A;  2PYK A;  2WAC A;  4RKB A;  2ENB A;  1SYD A;  2EYH A; 
#chains in the Genus database with same CATH topology
 4QY7 A;  4AYB B;  1QVF A;  1CZG A;  1RF2 D;  2CH4 W;  5IGB A;  3HOU H;  4BBS H;  3I4M B;  3GTL B;  3HOW B;  3OWF A;  4R4I A;  1F9S A;  4UDU C;  3IFT A;  1CUK A;  3MVV A;  4FP5 D;  3J80 i;  5E4W C;  1EY7 A;  1QNK A;  3LWU A;  3CCU A;  3A7A B;  4JBJ A;  5I2Y A;  1EU4 A;  2WB1 G;  5IT9 L;  1EFW A;  3TSS A;  5DNF A;  2QCP X;  4MN3 A;  3OHX C;  1B9N A;  1CK1 A;  5C3X A;  4G7Z C;  1V1P B;  1I94 Q;  1Y69 U;  1K0R A;  2B3G A;  2ZT9 C;  5C3E B;  1GUW A;  2BA1 A;  1I94 L;  1Y1V B;  4P71 A;  3TP5 A;  5FLM G;  1WTX A;  3G48 A;  5C4Z A;  1V1O A;  4KHV A;  4DGZ A;  1SEB D;  1AN8 A;  1S5C D;  2CFM A;  1VQP A;  4WOR A;  2L1B A;  3K5N A;  3A5Z B;  3HEJ A;  4B3T Q;  2KBN A;  2WFW A;  3I4L A;  1K3R A;  2R92 H;  1IXR A;  2OF1 A;  4K5W A;  1VQH A;  2SEB D;  2F0L A;  4B08 A;  3C1E A;  5CR3 A;  2F0E A;  1D5M C;  1GKH A;  1X55 A;  2D9U A;  2KCC A;  3HOV B;  3S9W A;  2K5D A;  1CKN A;  3TME A;  3UE0 A;  5COR A;  4A3E H;  2ASB A;  4QMG A;  2VB2 X;  2HHH Q;  1X56 A;  4IUR A;  4E6I A;  4IPG A;  4R9W A;  4KN7 C;  1EYG A;  2PQE A;  1ONL A;  4X6A H;  2XWJ B;  3SK5 A;  3JAM L;  5ELN A;  1KAB A;  3EN2 A;  1SJH D;  4ZUI A;  2DY8 A;  5M5X H;  3BYT B;  2RCF A;  2PQA A;  3RNU A;  4IOC A;  3GTQ H;  3P1H A;  3UDX A;  4DU9 A;  5JPM C;  5CC4 A;  1D6E C;  5IYB G;  3D31 A;  1IL8 A;  3MEH A;  1I5F A;  1SYG A;  5IY0 A;  4FXG C;  5KGU A;  3TBI B;  4K2L A;  2D5D A;  3KDF B;  1ROD A;  3T4A C;  2GVB A;  3CMA A;  1QOH A;  4R1J A;  3K7A H;  1NTG A;  5HY6 A;  4EQO A;  2KQ3 A;  4IUU A;  5BN4 A;  1VQK A;  4DXG A;  1HR0 Q;  4DFA A;  4YHH Q;  4LUZ A;  4OIK A;  1HR0 L;  5GQO A;  1TWF H;  2BOS A;  4YHH L;  3H3V H;  1O80 A;  1JE4 A;  1LTS D;  3FP9 A;  4M1U B;  4LF5 Q;  1I4X A;  4JBK A;  4F88 A;  4LF5 L;  2MNA A;  1XXG A;  1JOK A;  3TRE A;  3I7F A;  3E0J A;  5FLM H;  2NVX H;  4GLX A;  3A8I E;  1H9S B;  1X9N A;  3X3M A;  1MJC A;  3EQL C;  1A15 A;  2N78 A;  4OEL B;  3NBI A;  4FF1 A;  5HGQ A;  2R92 B;  3I73 A;  1DON A;  1EY8 A;  3S16 H;  4IFD I;  4B3R L;  4YIJ A;  3ER0 A;  4NPS A;  2VB3 X;  3MHB A;  3SGI A;  3KJO A;  3S1N B;  4ALP A;  1CZW A;  1DJR D;  1SSO A;  4HAE A;  4OGQ C;  4ZCK A;  4GOP A;  2A69 D;  3LX0 A;  2EYP A;  3FDT A;  2ZM6 Q;  1PRT F;  5I9O A;  2FJ2 A;  4GN5 A;  3R93 A;  1M4V A;  1NUC A;  2ZM6 L;  1PH7 A;  2I0Q A;  4IUV A;  1OXS C;  4JYA Q;  3C46 A;  2K6A A;  2B8F A;  4JYA L;  1G2T A;  3DM3 A;  2NYZ D;  4YWK A;  2F52 A;  4Q5V A;  3S15 H;  3WOE A;  4RKL A;  5IGE A;  1VQF A;  1QIL A;  2K32 A;  4Y7N B;  4WRD A;  4KHP Q;  1EY9 A;  2AWO A;  4C3I G;  4KHP L;  4BBR H;  4A3J G;  1A63 A;  1ASZ A;  1TXY A;  5A35 A;  4GKK Q;  4GLA C;  2NTT A;  1B9M A;  5CV5 A;  2KJX A;  4AQY Q;  4GKK L;  4IJH A;  1ENA A;  2A68 D;  5EBC A;  2PNR C;  3CCQ A;  3K5O A;  4AQY L;  1KC8 C;  1RDP D;  4GNX A;  5IYB H;  1XX8 A;  3QO2 A;  2F0I A;  1KLG D;  4HED A;  4OX9 Q;  5F2D A;  1TWF B;  4U68 A;  3KYH C;  4L5T A;  1FNV A;  2B2W C;  4QUF A;  3RLN A;  2CQA A;  1SRU A;  3I4O A;  3HG9 A;  3TS0 A;  1BCP D;  4V0B A;  3E9I A;  4JC0 A;  1T5E A;  4XQJ A;  1DOK A;  1B70 B;  2BCO A;  2E2I H;  5C6A A;  1IW7 C;  2UXB Q;  1ILP A;  3GP7 A;  2UXB L;  3R2T A;  1HFN A;  1FL0 A;  4K5V A;  1YIT A;  1HCZ A;  1IHZ A;  1JOR A;  4RCN A;  1I4P A;  2Q2U A;  2F0M A;  1KIX A;  3C2P A;  4UP8 A;  5FOB B;  1X3P A;  3CD6 A;  3HKZ G;  3O13 A;  3GTG H;  3MEF A;  1AW7 A;  1HTP A;  5C5M A;  1XPU A;  4I65 A;  1C0A A;  4JV5 Q;  1IL2 A;  1H9K A;  2IHE A;  3M85 A;  4JV5 L;  1XMQ Q;  2K52 A;  4YCU A;  4J6H A;  2HCC A;  4FYD A;  1XMQ L;  1B44 D;  1NNX A;  4A3F G;  3DWA A;  2R7Z H;  2SNM A;  1CHQ D;  1PTO B;  3CKI B;  4IZ8 A;  3GTJ H;  4DUY Q;  4NP5 A;  4X3T A;  1W6J A;  4A3D G;  4DUY L;  5NUC A;  2YTX A;  2HQL A;  5CMD A;  2N55 A;  3M7N A;  1V9P A;  1EIF A;  1L1O C;  3PF5 A;  1PFS A;  3OW2 A;  3M4O B;  3I4N G;  2JEB I;  4UPA A;  1L1O A;  5M3M G;  2XWB B;  1IKL A;  3D6W A;  2NZH A;  4C3I H;  5KNC A;  4A3J H;  2YYZ A;  3NTI A;  3SK8 A;  3QWN A;  1STE A;  4DPG A;  5KRU A;  1S72 A;  1BO0 A;  4QIW B;  3P75 A;  2ZTE A;  1J5E Q;  4C3H B;  1WTR A;  1J5E L;  5IT9 c;  3JAM E;  3KUP A;  1F9Q A;  3NTK A;  1LUZ A;  1SNM A;  3A56 A;  2Z4I A;  4MNO A;  2HIV A;  4BY1 B;  2E2I B;  2AQ3 B;  5CV8 A;  2MFI A;  5DAU A;  1S5B D;  4WFN 3;  3KF6 A;  2M9V A;  1TS5 A;  1HFG A;  4EQP A;  1EYD A;  1TU2 B;  1PH4 A;  2RVL A;  2RBM A;  1STA A;  3K6O A;  4N8F A;  1UE6 A;  4M8A A;  1NR2 A;  2XSC A;  2PW7 A;  1OXV A;  4JI5 Q;  4HIM A;  4J1M A;  5IOC A;  4PMB A;  4HJ7 A;  4JI5 L;  3RLO A;  3EBE A;  3TEH B;  3VR4 A;  4B3S Q;  3I2Z A;  3M9B A;  3GO5 A;  1QZG A;  4B3S L;  3PUV A;  2EJG C;  1TWC H;  1WFQ A;  2AQ2 B;  1AP0 A;  4RAU C;  1U9R A;  3PIO A;  3GTJ B;  4C56 C;  2Z9H A;  4DAP A;  2IX0 A;  4Q0F A;  2CW0 C;  1ENF A;  3SK6 A;  1MIU A;  5EQ0 A;  4J8Q A;  4LFA Q;  2A68 C;  1EQQ A;  4R4Q A;  3CCJ A;  1KNA A;  3S14 H;  4LFA L;  1K9M C;  1SN8 A;  2B2T C;  2HDM A;  3X3N A;  4EVO A;  4K0K Q;  1JWU D;  2A73 B;  4DV6 L;  3CXC A;  4K0K L;  3I56 A;  1ICW A;  3NPP A;  1E2W A;  1HNZ Q;  4DR6 Q;  2XTI A;  1LTT D;  2D2C C;  5M3F B;  4LF4 Q;  1LLR D;  3SVM A;  4DR6 L;  3I4N H;  3K5L A;  2B2Y C;  1FGU A;  4WJW A;  3CF5 A;  4LF4 L;  1Y8P B;  4LF9 Q;  1UE1 A;  1VMP A;  5M3M H;  2UUA Q;  5M5W H;  2AUK A;  4L8J A;  4LF9 L;  2F0Q A;  3K5M A;  4GLV B;  3ND8 A;  1TWH B;  2IHF A;  1VQI A;  3MWY W;  4P73 A;  5J39 A;  4IFD G;  5EKL A;  1A3U A;  2G5D A;  3OOC A;  2KCT A;  2R6G A;  4RG1 A;  4JI1 Q;  2XN9 C;  4RMF A;  1KAA A;  1JQY D;  4JI1 L;  2C35 B;  1BDO A;  5JEA G;  1FR3 A;  3BDC A;  3SDZ A;  1S3O A;  2EXZ A;  1TY0 A;  3HOU G;  4BBS G;  4XYO A;  3G6J B;  1Y8O B;  1TS3 A;  1ZYR D;  1LTB D;  1VS0 A;  2PMZ E;  2RDG A;  2YTV A;  1UE5 A;  1EQR A;  1QVC A;  3HOZ G;  4JPB W;  4CJ1 B;  4GN4 B;  2E2D C;  4A3M B;  4QF4 A;  5M5Y H;  4A3K H;  1JWM D;  2VL6 A;  2MHV A;  4DV2 Q;  1B1Z A;  5FLX L;  1N33 Q;  4DV2 L;  2VZA A;  2BE5 D;  1TKW B;  2VQF Q;  1N33 L;  4BY7 B;  3H0G H;  1YNJ D;  1IZ6 A;  2VQF L;  3S2D H;  2Z4H A;  4F87 A;  5GAH C;  2WP8 J;  3LWE A;  3OWE B;  3S1Q B;  1OO9 B;  2O5J C;  1VQC A;  2AMC B;  2JA8 G;  4HIK A;  1VQG A;  1TS2 A;  2XRQ D;  4F8M A;  1SYF A;  4DKA C;  5IGF A;  2AKW B;  1I6V C;  1FGB D;  4PQX A;  3DWQ A;  4JG2 A;  4R4O A;  4GKJ Q;  5IGD A;  1TT2 A;  3ZYY X;  4GKJ L;  5KNB A;  3QIA A;  1SAP A;  3V05 A;  3ERS X;  5FO7 B;  3W1G A;  3P7J A;  4A3F B;  2YU9 H;  1KD1 C;  2OTJ A;  3SHL A;  1GO3 E;  1Q90 A;  2D0P A;  1ET9 A;  1I4G A;  1PRT B;  1BR9 A;  4A3D B;  2IL8 A;  1PYW D;  2OEO A;  2RDF A;  3UE1 A;  1JOO A;  3PUY A;  1Q1E A;  4O1N A;  4A3E G;  5EKK A;  3MFG A;  2HIX A;  2Z1C A;  1LTR D;  3J7A F;  3I4N B;  2K5H A;  4RKB A;  2SDF A;  4APV A;  1BBU A;  4J15 A;  5M3M B;  4KKS A;  4JBM A;  5CYU A;  3IKJ A;  1SMX A;  2KCM A;  4DR4 Q;  3BDL A;  2CCZ A;  2SNS A;  1XWE A;  2ZXO A;  4DR4 L;  1N9W A;  1GXD C;  1CQV A;  2R61 A;  1QUQ A;  1JIC A;  2NVY H;  1WD1 A;  1ICF B;  1LAB A;  1PFN A;  1PZJ D;  3KLS X;  1E2Z A;  1HR0 W;  3FKI B;  1Q46 A;  4IFD H;  3MC0 B;  4MHE A;  1UE7 A;  2B2V A;  3J7A V;  4HJA A;  4A3L G;  4HN7 A;  3EFX D;  4IN3 A;  4JI0 Q;  4X3S A;  5JEA H;  2X69 A;  1QJO A;  1HXY D;  1VQE A;  1EYA A;  2RA4 A;  4JI0 L;  1EEI D;  1A62 A;  2G9H D;  3Q24 A;  3D4D A;  1UEA B;  3K58 A;  1JE5 A;  1B2T A;  2TSS A;  4X66 Q;  3U58 A;  5M5Y B;  5IE8 A;  1CM9 A;  4X66 L;  4CHT B;  3HOZ H;  1JT8 A;  3STB D;  2OXP A;  4QL5 A;  2EY2 A;  2K5Q A;  3VDY A;  2QA4 A;  1PDQ A;  4DV5 Q;  2EYL A;  4DV5 L;  1SYE A;  1X54 A;  2NVT H;  2QEJ C;  1S5F D;  3NQI A;  2CQO A;  4L5R C;  3CPF A;  5D14 A;  1Y1W B;  3SEB A;  1F9P A;  2ZTC A;  3RN5 A;  2WII B;  3M4Y A;  2JA8 H;  4G4K A;  2F3V A;  3PMF A;  2KVM A;  2WAQ B;  1BF4 A;  2O2L D;  2YU9 B;  1KQS A;  2JE6 I;  5I9P A;  5I6W A;  2I5H A;  5ELO A;  3WWV A;  5IGC A;  1PZI D;  5I6Y A;  5FK9 C;  3SK4 A;  4POG A;  2G9D A;  1YHA A;  1DZ1 A;  3GTK B;  4YY3 Q;  1E0B A;  4ME5 A;  3T53 B;  3FEW X;  2EJM A;  5FJ8 G;  2K05 A;  2UU9 Q;  4YY3 L;  1LM0 A;  2UU9 L;  3J81 j;  3E0E A;  1M1K C;  4A3I H;  3HOY B;  4AYB E;  2E2J H;  3KLR A;  1SND A;  1IW7 D;  2IJ0 A;  2EYF A;  2JA6 G;  1G6Z A;  1Q81 C;  1JOQ A;  4MIU A;  1FD7 D;  1TVX A;  2EIF A;  3S1R B;  4A3B G;  3RZD B;  2Y0S G;  4DAY A;  1ZYR C;  2M00 A;  1YJN A;  1D1K A;  1EZ8 A;  3BZK A;  2F0W A;  3U9O A;  4MZ9 A;  4P2C B;  3DWP A;  1DOM A;  3L0O A;  1DM0 B;  2QIL A;  4ZAI A;  1SRO A;  4IUT A;  5KND A;  3S24 A;  5E1F A;  2IWH A;  3UDI A;  4BBR G;  2XGT A;  1TWA B;  1NY4 A;  2A5H A;  4CDC C;  4KJN A;  1STG A;  4RH6 A;  3HP3 A;  3F2C A;  2BE5 C;  3G4S A;  3BYY B;  4OWX B;  1I4R A;  4ZKC B;  3HOU B;  4BBS B;  3VR2 A;  1JB3 A;  4A3L H;  1YNJ C;  2NUC A;  1K3B C;  1L0X B;  5C3W A;  2K14 A;  4K5X A;  4LWC A;  4NB3 A;  3ERQ A;  3GDE A;  2RKS A;  2RQX A;  3HOZ B;  3R8B A;  1PYB A;  2I46 A;  4AIM A;  1H9M A;  1WTW A;  4CBV A;  3ULL A;  1XNQ Q;  1CA5 A;  3K0Y A;  3MXU A;  2FHT A;  3PIP 3;  1E24 A;  1XNQ L;  4QCL A;  1D7Q A;  3PO2 H;  3CQZ H;  4DK1 A;  4FXD A;  3HZX A;  3LGJ A;  4KY7 A;  1JC7 A;  1QG7 A;  3GQB A;  3J81 i;  3L3O C;  1K8M A;  3F2U A;  5EAY A;  4X65 Q;  3RR5 A;  2XNA C;  1OTC A;  4JI7 Q;  4X65 L;  5JAV A;  1D5X C;  3E5S A;  2JA8 B;  2EQS A;  2HD3 A;  5BN3 A;  4JI7 L;  1YBY A;  5BN5 A;  1RIP A;  3I72 A;  5T1G A;  4LF8 Q;  4JI8 L;  3K8A A;  5COY A;  5J1Z A;  4LF8 L;  1E7Z A;  4KI0 A;  1PTO C;  4DK6 C;  1QVG A;  1Z6H A;  4B3R Q;  3D0F A;  1JJC B;  1PMR A;  1G51 A;  2EYO A;  3CC4 A;  4B9X A;  3Q23 A;  4G7H C;  1IBM Q;  3AYH B;  1HQM C;  1NJI C;  1WJJ A;  1YHQ A;  4IAL A;  1B8A A;  1IBM L;  1NMF A;  2X6G A;  3MXG A;  5FJ8 H;  3DMU A;  5C0X J;  3S2H H;  1HZA A;  2B8G A;  3Q0A A;  3UDG A;  1CA6 A;  2BH2 A;  2R7Z G;  4QQB X;  2PNH A;  2RSN A;  3N6R A;  3VR6 A;  1XNR Q;  1TY2 A;  4A3E B;  5JOB A;  1XNR L;  4R8I A;  2EYH A;  4A3G H;  1UUP A;  1RJT A;  2JA6 H;  4XT3 B;  5LL6 S;  3TQY A;  4HTH A;  2VUM G;  4QB4 A;  2KEE A;  2K75 A;  3J80 c;  5C0X I;  3J7A 5;  4A3B H;  1KNE A;  1TII D;  3CPW A;  3MA2 B;  3OMC A;  5A2Q L;  1CHP D;  1JJG A;  1KRS A;  5M5X B;  2CH4 A;  1KDB A;  2EE1 A;  1MJE A;  1GHK A;  4HMJ A;  3STB C;  2DNC A;  1GUO A;  2DJF C;  4JI2 Q;  3QOJ A;  3GTQ B;  5C44 G;  4IPD A;  3I3C A;  4JI2 L;  2ALY B;  3PQI A;  5CBA E;  3E3X A;  3M4P A;  2CW0 D;  1HNX Q;  1B7Y B;  1X3Q A;  4UHV A;  4RGM A;  2MQH A;  2DN8 A;  3K81 C;  4A4I A;  1GUT A;  1HNX L;  4GZY C;  2F0F A;  3FMC A;  3J81 E;  3UDF A;  4PMW A;  3NXW A;  1KRT A;  3K7A B;  4LAA A;  1K8A C;  1BUV T;  1CKN B;  3VYT A;  5CV4 A;  5LHY 1;  3QB3 A;  1KLU D;  3CQZ B;  4HCE A;  5FLX c;  1RCV D;  1SJE D;  3KF8 A;  2GA4 B;  4C3J G;  4A75 A;  2JEA I;  1EIG A;  2WB1 B;  1I6H H;  2ICI A;  1PH8 A;  4C2M H;  1VQ8 A;  5HUR A;  1PH2 A;  1PXU A;  1I4Q A;  2B2W A;  3H94 A;  5J22 A;  3EVQ A;  1RL2 A;  3BVZ A;  2JN4 A;  2O4X A;  1SFO H;  1BNZ A;  4L5S A;  1HZB A;  4NW2 A;  1L2F A;  1HA5 A;  2PQA B;  2NVX B;  2NZ1 D;  2EOT A;  3JAM i;  4C1N K;  2UUC Q;  1SLJ A;  1BCP F;  2YTY A;  2GN5 A;  2UUC L;  1HPC A;  4RGN A;  5CV7 A;  5K5P A;  2LXJ A;  3VYR A;  2VXW A;  2KHJ A;  1NE3 A;  2Q2T A;  5EPL A;  4FF2 A;  1N32 Q;  4X62 Q;  3S16 B;  1N32 L;  4EGV A;  1VQM A;  4X62 L;  5CGK A;  1RTO A;  1U5K A;  2Q8T A;  1VQ5 A;  2H5X A;  3KLS A;  3T1Y Q;  1HA6 A;  5IT9 E;  4HJ8 A;  3PSI A;  3T1Y L;  1HZC A;  2KA7 A;  1ESF A;  4KD3 A;  4JOI C;  1SBB B;  1H95 A;  1A2U A;  3A8K E;  4X3K A;  1WCM H;  2O5I C;  4JOI A;  2EVB A;  3PGZ A;  1VQ6 A;  2WAC A;  4JK1 C;  1W3S A;  3M3Y H;  3VR5 A;  3PO3 G;  2E74 C;  5IYD H;  1EOV A;  2E8G A;  2NWG A;  4RCO A;  4H44 C;  5IYC H;  2Y0S B;  3CC2 A;  1E2V A;  3GTP H;  1XMO Q;  4FF4 A;  3S15 B;  2VUM H;  3PUZ A;  1XMO L;  5C4X G;  5G3L D;  1PFB A;  1D5Z C;  1HRJ A;  3U9S A;  1Q86 C;  4KMU C;  3T51 B;  1J6Q A;  1K83 H;  1TQO A;  4BBR B;  2FMC A;  1JMC A;  4LJZ C;  4DAV A;  1OXX K;  1N8R C;  3BZD B;  2E2H H;  4KY5 A;  5C44 H;  2ZJP A;  4R4T A;  1WVL A;  1ZXT A;  4GOP B;  3AB9 A;  2QDB A;  1X3G A;  1T5X D;  3CME A;  2A1A A;  4B9W A;  2C5C A;  3NBH A;  2IX3 A;  2K5V A;  1QCB D;  1ESR A;  4C2M B;  3G7L A;  4XTC S;  1IBK Q;  3LNN A;  1VF7 A;  5JPN C;  2MP1 A;  2ZTD A;  4ZUJ A;  3CRK C;  4ZRZ A;  1IBK L;  1SMY D;  2F4I A;  3BDO A;  4C3J H;  2ZJR A;  3A7L A;  2JA5 G;  1Z7T A;  4A3K G;  2NN6 I;  2EDG A;  2D0O A;  4ID6 A;  4MTN A;  3L9A X;  2JXM B;  3Q22 A;  4L6T B;  1FJG L;  1U0L A;  3FPU B;  3F8T A;  1YHB A;  1SR3 A;  3K57 A;  4ODG A;  4DAM A;  3H6M A;  4GS3 A;  1NSN S;  3H0G G;  2BDN A;  4KJO A;  1EWC A;  3MXN A;  3S1M H;  3AFQ A;  4DV7 Q;  1DXM A;  4IO9 A;  1EQV A;  4IQZ A;  3HOW G;  4P74 A;  1HZ9 A;  2OWO A;  4DV7 L;  4H02 A;  1XYI A;  4GNX B;  4LFC Q;  1F2L A;  2F03 A;  3GTG B;  1XPO A;  5L37 A;  2B39 A;  4H13 C;  4LFC L;  5GAE C;  2ES2 A;  1PRT C;  3ULJ A;  4RGO S;  4IPH A;  5D3D A;  3GTO H;  4LFB Q;  2Z8L A;  3OSO A;  5JJZ A;  4LFB L;  2V4D A;  2VQE Q;  2NVQ H;  3M3Y B;  1C9O A;  1KHI A;  5EJW A;  2VQE L;  2PYK A;  4XT1 B;  3AMU A;  2R7Z B;  1SYD A;  2Q2I A;  4UAI A;  3OYY A;  1VQB A;  3ND9 A;  4CGY B;  1IYJ B;  4QIW E;  2A19 A;  3GTM H;  2PZT A;  3UI2 A;  3A55 A;  4DR1 Q;  1TWG H;  4QUC A;  4V19 0;  1D1I A;  3PO3 H;  2VS1 A;  2E75 C;  4DR1 L;  2K5W A;  4NXM Q;  4DV6 Q;  4OXP A;  1K83 B;  4NXM L;  2Z6B A;  2B2T A;  1Q8I A;  2RSO A;  5C4X H;  4PG3 A;  3SXH A;  2FMM A;  3P20 A;  1A6X A;  3KBX A;  5ELB A;  5C44 B;  4C3I B;  3ERO A;  3H09 A;  4A3J B;  2B2Y A;  3HKS A;  3QG1 A;  2N88 A;  4KTA A;  3FPP A;  1XTC D;  3J80 L;  3TP8 A;  4DK3 C;  2PI2 E;  3VA5 A;  2FFK B;  2RCN A;  3DUZ A;  3I90 A;  1EOT A;  2L4N A;  2OQ0 A;  3HOV G;  5C4H A;  1B50 A;  1E1O A;  5EBD A;  2K4K A;  2L0C A;  4CKB A;  1LTI D;  2TMP A;  4CJ0 B;  1UWV A;  1JWS D;  1W6K A;  5A2Q E;  1WTV A;  1O7L A;  4C3J B;  2LSS A;  2LY7 A;  2WKD A;  4DK0 A;  4ILW A;  1MSG A;  2L55 A;  3I8Z A;  4P72 A;  1V1P A;  3R2I A;  4KKT A;  1L1O B;  2YV5 A;  1MGS A;  3DLL A;  2JA5 H;  2Z6K C;  1EZ6 A;  3HFZ B;  5E7N A;  1A3V A;  4OHJ A;  4HJ9 A;  2F0U A;  2KED A;  1VQL A;  1II3 A;  2RF4 A;  1S40 A;  4BXX G;  2ICE C;  3T16 A;  1Z9F A;  1LTA D;  1R4Q B;  1GVP A;  4NDX A;  2LS0 1;  2L9H A;  4YWL A;  1I3Q H;  3J7Y W;  1Y14 B;  3I4M H;  3GTL H;  3HOW H;  3NBH B;  3HKZ B;  1B3A A;  1N36 Q;  4XXE A;  1K28 A;  1OXT A;  1R4P B;  4KY6 A;  4XDX A;  1PFM A;  3CCV A;  1DCZ A;  1Q3L A;  1PH5 A;  1N36 L;  1HQR D;  1TWC B;  1VQD A;  3VR3 A;  4HID A;  3RD4 A;  2L12 A;  5ISR A;  1EYC A;  3OMG A;  3H15 A;  2IW3 A;  3NWT A;  1EY0 A;  5LL6 X;  2V1C C;  2BH8 A;  4JVZ A;  5GRO A;  4OIJ A;  3GTM B;  3KF6 B;  5KEE A;  4PNY A;  2EYM A;  3F1Z A;  1STY A;  1LTG D;  2EPB A;  5DM6 3;  3F2B A;  3S14 B;  4B3M Q;  4A3I G;  2A6E C;  4ABN A;  4ME3 A;  4DXF A;  1K8O A;  1AZP A;  2JYO A;  4B3M L;  2B2U C;  1IKM A;  5C4X B;  4DV1 Q;  1YNX A;  1ZEQ X;  4IUN A;  3V96 A;  2B2U A;  1V1Q A;  4DV1 L;  2B29 A;  2I5L X;  1YZ6 A;  1QZH A;  3AU7 A;  5JJK A;  5M5W B;  1XTD A;  1PTO D;  3DEP A;  4RGT A;  5K36 H;  1I4H A;  1SXT A;  3CCM A;  3HS0 C;  1PHJ A;  1SMY C;  2ZXP A;  2UUB L;  4LUV A;  2J4X A;  2RDH A;  1PTO F;  1M90 C;  3A5U A;  4EQN A;  1E1T A;  1F2Z A;  4JCV E;  1BBX C;  2B63 G;  4I7A A;  2HCI A;  2EY1 A;  3KDF A;  2AWN A;  1PH6 A;  3HOV H;  2EYJ A;  1TS4 A;  1MKH A;  3I70 A;  4JI4 Q;  1NCV A;  3CHB D;  4JI4 L;  4BA1 I;  4K8I A;  1RKN A;  2Z0S A;  1SYC A;  5I2X A;  1BXT A;  5DLQ E;  2LMC B;  3Q8D A;  4NMZ A;  3S17 H;  2KHS A;  4RHR A;  2JA5 B;  2MPM A;  1NMG A;  2QDL A;  4A3K B;  4QJF A;  1UAP A;  2E76 C;  2FXQ A;  3PO2 G;  3GV6 A;  4N9P A;  4K14 A;  1WOC A;  2QKI C;  4LNQ A;  5FO9 B;  3JC6 6;  1X32 A;  2F0G A;  3H0G B;  1I3Q B;  5AFW A;  1H9S A;  5IP7 G;  3S2D B;  3A8J E;  2F3W A;  2PZU A;  1O7I A;  4DN4 M;  5IP9 G;  1BCP B;  3DEO A;  2BA0 A;  2RHS B;  4BXX H;  4CDD C;  2F0J A;  4OON A;  1BBW A;  2A6H D;  1FYC A;  1J8I A;  1IYV A;  1Q82 C;  1CTM A;  2L5T A;  2MJ8 A;  1BVS A;  2J7Z A;  3E9H A;  3OTO Q;  3OIQ A;  4UP9 A;  3OTO L;  1AFP A;  3BJU A;  4K8J A;  3EJI A;  1V8Q A;  3K0X A;  3CCL A;  1KDA A;  3M7G A;  1YJW A;  3FRP B;  1LT4 D;  1ET6 A;  2NB0 A;  4P75 A;  4BA2 I;  1VQ4 A;  5IGG A;  3K80 C;  3TDQ A;  3BG3 A;  2BDO A;  2QF7 A;  1VQN A;  3NQT A;  4FO2 A;  2F0O A;  1UNS A;  4LF6 Q;  1YNN D;  1G29 1;  2K03 A;  1HTL D;  2NN6 G;  1DOL A;  4LF6 L;  4A3G G;  2VY3 A;  2E5L Q;  1VQA A;  1AZQ A;  3AQQ A;  3NEN A;  2E5L L;  1CFM A;  3KK7 A;  3K59 A;  1VQJ A;  1EL0 A;  1HH2 P;  5LMN Q;  3BZC A;  4B3T L;  2NVY B;  2KHI A;  5LMN L;  3BU2 A;  2EJF C;  2F3I A;  4POF A;  4OO1 I;  5H1S E;  5KIX A;  5GAD C;  3CRL C;  3S1N H;  4XQQ A;  1S5E D;  1Q7Y C;  3H3V C;  4A93 G;  1STH A;  2B63 H;  2QGQ A;  1OXU A;  1QNU A;  2F4V Q;  3RMH A;  2HHH L;  4PZ7 A;  4FNF A;  4TKO B;  1EFI D;  2F4V L;  3CC7 A;  3ICE A;  3S17 B;  1HUN A;  2MO0 A;  1IYU A;  5ELF A;  4DR3 Q;  3I55 A;  3HRZ C;  2WAQ E;  4DR3 L;  4TRD A;  4DF7 A;  1GOZ A;  1Q8K A;  2KCN A;  3DHQ A;  2DGY A;  2K01 A;  4WJ3 M;  3J80 E;  4O2D A;  3D3R A;  4KK7 A;  2F0N A;  4ZYS A;  5EGT A;  4Y7N H;  1U4M A;  4CDE C;  3HOX G;  2IX1 A;  3RZO H;  1KDC A;  1GUS A;  1PZK D;  3NP8 A;  1QUQ B;  1WTP A;  4JBW A;  2LKV A;  4RWS C;  5E4X A;  4KLK A;  2VW9 A;  2NVT B;  4UP7 A;  4ZKB B;  2HDL A;  2JA7 G;  1VMC A;  4PV1 C;  5IP7 H;  1GUG A;  2F0H A;  2JK8 A;  5C4J H;  3OPO A;  4C3H G;  5IP9 H;  1VF5 C;  1O7Y A;  3NUC A;  1S5D D;  1YEZ A;  4JI8 Q;  1LTL A;  2RHQ B;  2ENB A;  4R4C A;  2K28 A;  1KXL A;  4BY1 G;  1JJ2 A;  1F2Y A;  3KBG A;  3Q6S A;  5CBE E;  3GV3 A;  4RHS A;  3AFP A;  2K5N A;  3TP7 A;  4ULL A;  3RN2 A;  4KD4 A;  4ZK9 B;  2LXK A;  5FLX E;  3MZ5 A;  2XRS D;  1D8L A;  3PIP A;  1F9R A;  1WCM G;  3ZJY C;  4IFD J;  4A3I B;  4CKE A;  2I07 B;  3U4Z A;  2E2J B;  2UXD Q;  1EY5 A;  2R7D A;  4OWT B;  4KKU A;  5BR8 Q;  4MTK A;  1U4L A;  2UXD L;  1KAW A;  5BR8 L;  3NTH A;  5JEA J;  5IYD G;  2PW5 A;  3VA7 A;  4DV0 Q;  5IYC G;  4YCW A;  1SNQ A;  2NN6 H;  3A0J A;  1L0W A;  4DV0 L;  4IJL A;  4DNT B;  2XIW A;  4A3C G;  4IUP A;  4R8N A;  3OW7 A;  1CKM A;  2R7F A;  5EKI A;  5IIF A;  4GOP C;  2WKC A;  2OT2 A;  4HSP A;  1P16 A;  1EY4 A;  1PRT D;  2IT1 A;  2F0T A;  5KYI A;  3T1H Q;  1AH9 A;  3T1H L;  3AEV A;  1AE2 A;  2L15 A;  5GAG C;  5JVG 3;  5HGT A;  1SE4 A;  2UXC Q;  2LFN A;  3HGB A;  2GVA A;  2R93 G;  2B63 B;  2UXC L;  2P5Z X;  4RA8 A;  1STN A;  1CQF A;  4Z9C B;  4JI3 Q;  4TQU S;  3WDN A;  2KEC A;  3T13 A;  1PTO H;  4RFB A;  4JI3 L;  3TP6 A;  3ULP A;  4A93 H;  3TN2 A;  1X6O A;  4PZ8 A;  2H4O A;  1FNW A;  1AE3 A;  3IL8 A;  1EIY B;  3QR8 A;  1NR4 A;  2DUD A;  2A6H C;  4K6D A;  1QE6 A;  5M3F G;  1EUJ A;  3IFD A;  3M4O H;  1PYS B;  3RZO B;  1PH9 A;  1SE2 A;  1ASY A;  2A8V A;  1GJX A;  3TZU A;  4DAY B;  3PO2 B;  3G71 A;  4JI6 Q;  2EY6 A;  2PI2 A;  4FDB A;  1N34 Q;  4DA2 A;  4JI6 L;  2OQK A;  1K73 C;  1N34 L;  4OL7 A;  3HOX H;  1WI5 A;  5EPJ A;  4GNX C;  1EWI A;  5C4J B;  1JCK B;  4TVA B;  1VQ7 A;  3C1F A;  3ITP A;  4WJ4 A;  3PF4 A;  1G6P A;  2JA7 H;  1B53 A;  1WTQ A;  2WIN B;  2F1M A;  3MAQ A;  1Z47 A;  1YNN C;  4C3H H;  4YWM A;  4OX9 L;  2F0S A;  3NE5 B;  1K0S A;  1GUN A;  3B6Y A;  1A8V A;  3BVG A;  3CW2 C;  1GM5 A;  2ATW A;  4C1N I;  5E3F A;  5AJ3 Q;  2VNU D;  4BY1 H;  2OCE A;  3BS1 A;  1G8Z D;  5AJ3 L;  4A3M G;  2MGS A;  5LMU Q;  3K7U C;  1C7Y A;  3TS2 A;  5LMU L;  1YJ9 A;  3S2H B;  2KEN A;  4DR7 Q;  5JJL A;  1YVC A;  1EQT A;  4DR7 L;  1E3P A;  4H7B A;  4O42 A;  1G2S A;  2HT1 A;  2WV6 D;  3SE0 A;  4I7Z C;  2FIN B;  2IY5 B;  3MFY A;  3D8G A;  3NSW A;  4BY7 G;  4A3G B;  2JA6 B;  1VCI A;  1HJP A;  3I91 A;  2ID0 A;  3BVM A;  3SR1 A;  2K1B A;  4DV4 Q;  4LK1 C;  1F2M A;  4DV4 L;  1LO5 D;  1O7Z A;  3URY A;  4N8X 1;  4LF7 Q;  4A3B B;  4FXK C;  4K2K A;  5ELE A;  4LF7 L;  5JJI A;  2F0D A;  4A3C H;  1E22 A;  5M9O A;  1LT5 D;  1MD2 D;  2WB1 E;  5ELC A;  1WYD A;  4PMC A;  4EX5 A;  2HQE A;  4OEM B;  3TRZ A;  1LT3 D;  4JW0 A;  2SOB A;  3CP0 A;  4NKL A;  3J81 c;  4HR7 B;  2JP1 A;  4K6L A;  4HMI A;  3WOF A;  1LV9 A;  5G3L F;  4A93 B;  1R9T H;  2PCF B;  2R93 H;  2NBF A;  3EA6 A;  1SNP A;  1H9J A;  1SDF A;  1JR0 D;  3GD7 A;  2K33 A;  4S3S A;  2CWP A;  2F0K A;  1BKB A;  1X65 A;  3H3V I;  2A6E D;  3NWS A;  1PVO A;  2PPB C;  2Q2H A;  3R3O A;  1FNU A;  4GN3 B;  4DR5 Q;  2D62 A;  3A74 A;  2JQO A;  5M3F H;  4DR5 L;  3L7Z C;  2EZV A;  1I6H B;  3HOX B;  4DNI A;  1FVI A;  1SYB A;  1SFO B;  4CKC A;  5IWA Q;  1GHJ A;  3RUZ A;  3PUW A;  5IWA L;  2Q8I B;  2K50 A;  2DNE A;  5EPK A;  2QW7 A;  2JA7 B;  1TWH H;  3FKI G;  1I50 H;  4KV6 A;  4Y52 H;  1EY6 A;  1FJG Q;  4OO1 G;  3U50 C;  1VQO A;  3D6C A;  2F0P A;  2Y0S E;  4XIG S;  1U4R A;  4FF3 A;  1MI2 A;  5DM7 3;  1B4O A;  4AYB G;  1X3E A;  2AUJ D;  4DR2 Q;  1PV4 A;  3I4M G;  1CKO A;  1PH1 A;  4DR2 L;  1ENC A;  1PH3 A;  4TSS A;  3PIO 3;  2K04 A;  1EEF D;  1UEB A;  2EXD A;  2JJQ A;  2DY7 A;  1SE3 A;  1WCM B;  2A69 C;  3KF8 B;  4A3M H;  4H0L C;  1DGS A;  4DUZ Q;  1WTO A;  1VQ9 A;  1LAC A;  3QOL A;  4DUZ L;  5DEH A;  1HHV A;  1TR5 A;  3C3L A;  5CV6 A;  1C48 A;  1EWH A;  3FVQ A;  3GTP B;  5C3E G;  4BY7 H;  1YI2 A;  5FKA C;  1Y1V G;  2ZXR A;  2VUM B;  4X64 Q;  1YIJ A;  1ML0 D;  1Y1W G;  3KFU A;  3PUX A;  4EQ5 A;  3D4R A;  3S1Q H;  4X64 L;  1NAP A;  4CJ2 C;  3F2D A;  3IAY A;  2PMZ B;  2WAQ G;  2MO1 A;  3L2P A;  3CCE A;  5K36 G;  1R9T B;  3RLF A;  3IRB A;  2R93 B;  2CHB D;  1BQQ T;  2I5M X;  3W3A A;  4XYQ A;  4U67 3;  2QEX A;  2E2H B;  3NEL A;  5FO8 B;  1Y8N B;  2AQ1 B;  4HCS A;  1MSH A;  2JA9 A;  2JSO A;  4A3F H;  3JAM c;  4LMQ D;  4X3U A;  1CSQ A;  3CCS A;  5CV9 A;  3HOY G;  1Q12 A;  2N8N A;  3M4Q A;  2M2L A;  1W2B A;  1CI3 M;  3PV0 A;  1RTN A;  2CWA A;  4A3D H;  3KLW A;  4AH6 A;  4G7O C;  2OTL A;  3G6E A;  2MUY A;  3TZD A;  1HNZ L;  2KUM A;  2N3S A;  4IPC A;  1BOS A;  3MTS A;  1EU3 A;  1SNO A;  1STB A;  3W1B A;  1L0Y B;  4L5Q A;  2UUA L;  1BCP C;  4G57 A;  4CDF C;  1I50 B;  4IOA A;  1U4P A;  1PA6 A;  5C0X G;  5IOD A;  1O78 A;  3T56 B;  1ILQ A;  1F77 A;  1D2B A;  3CCR A;  3FKI H;  1HUM A;  1T9H A;  2XVS A;  3J7Z C;  1WTH A;  2NTS A;  2X6L A;  2Z6K A;  1A0I A;  3S1M B;  4OO1 H;  4DNR B;  1KTK A;  1QWY A;  4BS9 A;  3OIP A;  2H1E A;  4KN4 C;  1V43 A;  4QGU A;  1H9R A;  1G91 A;  3GTO B;  3A54 A;  4ZLT F;  2CKZ B;  1KL9 A;  2HUG A;  2ZJQ A;  5C5L A;  3CAM A;  3FHW A;  1VDZ A;  4HJ5 A;  1K8G A;  3N52 A;  2NVQ B;  3W5O A;  1MBY A;  4FVM A;  4OWW B;  2KOL A;  4O0A A;  4A76 A;  5D65 A;  5J3B A;  2Q8R E;  5LMN W;  4XQN A;  2EY5 A;  3NK9 A;  3DM1 A;  1TWG B;  1DD2 A;  1XJV A;  1P8L A;  4HSV A;  3PO3 B;  2J0T D;  1C8C A;  1CT1 D;  3MXP A;  5C3E H;  5D3I B;  1Y1V H;  1X3F A;  3NEM A;  3V2T A;  5I4D A;  3PCO B;  4HIO A;  4L63 B;  2C9O A;  5TSS A;  4F7X A;  2F0V A;  1NBW A;  3MXN B;  1Y1W H;  3VYU A;  2L11 A;  2IPK D;  2DJG C;  1Q1B A;  1A2T A;  3EIV A;  2N49 A;  3W2D A;  1S4Z A;  4PZ6 A;  1M8A A;  1XPR A;  3QJY A;  2R92 G;  4N9T A;  2A74 C;  5KYL A;  4LW1 A;  1ZKO A;  5ELD A;  2UUB Q;  3KJP A;  1SE8 A;  1LT6 D;  1HNW Q;  3E6Z X;  4KHZ A;  4DV3 Q;  3ONA B;  1IBL Q;  3GTK H;  1CSP A;  4BWG B;  1HNW L;  4DV3 L;  1IBL L;  1C4Q A;  3DXJ C;  1PLF A;  1SNC A;  1J9O A;  3HOY H;  1A3T A;  5T1I A;  2K7V A;  1GD7 A;  4YCV A;  2CVR A;  4IUQ A;  1LYL A;  4UY8 C;  2AHO B;  3J81 L;  1B3Q A;  1RHP A;  3H91 A;  3HKZ E;  5JVH 3;  3D4W A;  3S1R H;  3NHH A;  3RZD H;  4NXN Q;  4ZQ3 A;  1RD9 D;  1QB5 D;  4NXN L;  1EIH A;  3U4V A;  3KOJ A;  1AEX A;  4LUO A;  2B2V C;  2NZO A;  2PO4 A;  3CU7 A;  2PZW A;  1DYQ A;  1JB7 A;  5C0X H;  1MHW C;  1WD0 A;  3VYS A;  1TWA H;  2R3Z A; 
#chains in the Genus database with same CATH homology
 4AYB B;  1CZG A;  1RF2 D;  5IGB A;  3I4M B;  3GTL B;  3HOW B;  3OWF A;  1F9S A;  4UDU C;  3IFT A;  3MVV A;  4FP5 D;  5E4W C;  1EY7 A;  1QNK A;  3LWU A;  3A7A B;  5I2Y A;  1EU4 A;  5IT9 L;  3TSS A;  5DNF A;  2QCP X;  4MN3 A;  3OHX C;  1B9N A;  1CK1 A;  5C3X A;  4G7Z C;  1V1P B;  1Y69 U;  2ZT9 C;  5C3E B;  1GUW A;  2BA1 A;  1Y1V B;  3TP5 A;  1WTX A;  5C4Z A;  1V1O A;  4KHV A;  4DGZ A;  1SEB D;  1AN8 A;  1S5C D;  4WOR A;  2L1B A;  3K5N A;  3HEJ A;  3I4L A;  2OF1 A;  4K5W A;  2SEB D;  2F0L A;  4B08 A;  3C1E A;  5CR3 A;  2F0E A;  1D5M C;  2D9U A;  2KCC A;  3HOV B;  3S9W A;  2K5D A;  3TME A;  5COR A;  4QMG A;  2VB2 X;  4IUR A;  4E6I A;  4R9W A;  4KN7 C;  2PQE A;  1ONL A;  2XWJ B;  3SK5 A;  3JAM L;  1KAB A;  1SJH D;  4ZUI A;  2DY8 A;  3BYT B;  3P1H A;  4DU9 A;  5JPM C;  5CC4 A;  1D6E C;  3D31 A;  1IL8 A;  3MEH A;  1SYG A;  4FXG C;  5KGU A;  3TBI B;  4K2L A;  2D5D A;  1ROD A;  3T4A C;  1QOH A;  4EQO A;  2KQ3 A;  4IUU A;  5BN4 A;  4DXG A;  4DFA A;  4OIK A;  2BOS A;  1O80 A;  1JE4 A;  1LTS D;  4M1U B;  1I4X A;  4F88 A;  1XXG A;  1JOK A;  3E0J A;  3A8I E;  1H9S B;  3X3M A;  3EQL C;  1A15 A;  3NBI A;  4FF1 A;  2R92 B;  3I73 A;  1DON A;  1EY8 A;  4IFD I;  4YIJ A;  2VB3 X;  3MHB A;  3S1N B;  1CZW A;  1DJR D;  1SSO A;  4HAE A;  4OGQ C;  2A69 D;  3LX0 A;  2EYP A;  3FDT A;  1PRT F;  5I9O A;  2FJ2 A;  3R93 A;  1M4V A;  1NUC A;  4IUV A;  1OXS C;  3C46 A;  2K6A A;  2B8F A;  1G2T A;  2NYZ D;  4Q5V A;  3WOE A;  4RKL A;  5IGE A;  1QIL A;  2K32 A;  4Y7N B;  4WRD A;  1EY9 A;  2AWO A;  4C3I G;  5A35 A;  2NTT A;  1B9M A;  5CV5 A;  2KJX A;  1ENA A;  2A68 D;  5EBC A;  2PNR C;  3K5O A;  1RDP D;  1XX8 A;  3QO2 A;  2F0I A;  1KLG D;  4HED A;  5F2D A;  1TWF B;  4U68 A;  1FNV A;  2B2W C;  4QUF A;  2CQA A;  3HG9 A;  1BCP D;  4V0B A;  1T5E A;  4XQJ A;  1DOK A;  2BCO A;  5C6A A;  1IW7 C;  1ILP A;  3GP7 A;  3R2T A;  1HFN A;  4K5V A;  1HCZ A;  1IHZ A;  1JOR A;  4RCN A;  1I4P A;  2F0M A;  3C2P A;  5FOB B;  1X3P A;  3O13 A;  1AW7 A;  1HTP A;  5C5M A;  4I65 A;  1H9K A;  3M85 A;  4J6H A;  2HCC A;  4FYD A;  1B44 D;  3DWA A;  2SNM A;  1CHQ D;  1PTO B;  3CKI B;  4IZ8 A;  4NP5 A;  4X3T A;  1W6J A;  5NUC A;  5CMD A;  2N55 A;  3M7N A;  3M4O B;  2JEB I;  2XWB B;  1IKL A;  3D6W A;  5KNC A;  2YYZ A;  3NTI A;  3SK8 A;  3QWN A;  1STE A;  5KRU A;  1BO0 A;  4QIW B;  3P75 A;  4C3H B;  1WTR A;  3JAM E;  3KUP A;  1F9Q A;  3NTK A;  1SNM A;  3A56 A;  2Z4I A;  4BY1 B;  2E2I B;  2AQ3 B;  5CV8 A;  5DAU A;  1S5B D;  4WFN 3;  2M9V A;  1TS5 A;  1HFG A;  4EQP A;  1EYD A;  1TU2 B;  2RVL A;  2RBM A;  1STA A;  3K6O A;  4M8A A;  1NR2 A;  2XSC A;  2PW7 A;  1OXV A;  4J1M A;  5IOC A;  4PMB A;  3VR4 A;  3GO5 A;  3PUV A;  2EJG C;  2AQ2 B;  1AP0 A;  4RAU C;  1U9R A;  3GTJ B;  4C56 C;  4DAP A;  2IX0 A;  4Q0F A;  2CW0 C;  1ENF A;  3SK6 A;  5EQ0 A;  4J8Q A;  2A68 C;  1KNA A;  2B2T C;  2HDM A;  3X3N A;  4EVO A;  1JWU D;  2A73 B;  1ICW A;  3NPP A;  1E2W A;  1LTT D;  2D2C C;  5M3F B;  1LLR D;  3SVM A;  3K5L A;  4WJW A;  2B2Y C;  1Y8P B;  1VMP A;  2AUK A;  4L8J A;  2F0Q A;  3K5M A;  3ND8 A;  1TWH B;  3MWY W;  5J39 A;  4IFD G;  5EKL A;  1A3U A;  3OOC A;  2R6G A;  2XN9 C;  1KAA A;  1JQY D;  1BDO A;  5JEA G;  1FR3 A;  3BDC A;  3SDZ A;  2EXZ A;  1TY0 A;  4XYO A;  3G6J B;  1Y8O B;  1TS3 A;  1ZYR D;  1LTB D;  2RDG A;  4CJ1 B;  2E2D C;  4A3M B;  4QF4 A;  1JWM D;  2MHV A;  1B1Z A;  5FLX L;  2BE5 D;  1TKW B;  4BY7 B;  1YNJ D;  2Z4H A;  4F87 A;  2WP8 J;  3LWE A;  3OWE B;  3S1Q B;  1OO9 B;  2O5J C;  1TS2 A;  2XRQ D;  4F8M A;  1SYF A;  5IGF A;  1I6V C;  1FGB D;  4PQX A;  3DWQ A;  5IGD A;  1TT2 A;  3ZYY X;  5KNB A;  3QIA A;  1SAP A;  3V05 A;  5FO7 B;  4A3F B;  3P7J A;  3SHL A;  1Q90 A;  1ET9 A;  1I4G A;  1PRT B;  1BR9 A;  4A3D B;  2IL8 A;  1PYW D;  2OEO A;  2RDF A;  1JOO A;  3PUY A;  1Q1E A;  4O1N A;  5EKK A;  3MFG A;  3J7A F;  2Z1C A;  1LTR D;  3I4N B;  4RKB A;  2SDF A;  5M3M B;  4KKS A;  5CYU A;  3IKJ A;  3BDL A;  2SNS A;  1XWE A;  2ZXO A;  1GXD C;  1CQV A;  2R61 A;  1JIC A;  1WD1 A;  1LAB A;  1PFN A;  1PZJ D;  3KLS X;  1E2Z A;  3FKI B;  4IFD H;  3MC0 B;  4MHE A;  2B2V A;  3J7A V;  4HN7 A;  3EFX D;  4IN3 A;  4X3S A;  5JEA H;  2X69 A;  1QJO A;  1HXY D;  2RA4 A;  1EYA A;  1EEI D;  2G9H D;  3Q24 A;  3D4D A;  1UEA B;  3K58 A;  1B2T A;  2TSS A;  5M5Y B;  1CM9 A;  4CHT B;  2OXP A;  2EY2 A;  2K5Q A;  1PDQ A;  2EYL A;  1SYE A;  2QEJ C;  1S5F D;  3NQI A;  5D14 A;  1Y1W B;  3SEB A;  1F9P A;  2WII B;  3M4Y A;  4G4K A;  2F3V A;  3PMF A;  2KVM A;  2WAQ B;  1BF4 A;  2O2L D;  2YU9 B;  2JE6 I;  5I9P A;  5I6W A;  5IGC A;  1PZI D;  5I6Y A;  5FK9 C;  3SK4 A;  2G9D A;  1DZ1 A;  3GTK B;  1E0B A;  4ME5 A;  3T53 B;  3FEW X;  2EJM A;  2K05 A;  3HOY B;  3KLR A;  1SND A;  1IW7 D;  2IJ0 A;  2EYF A;  1G6Z A;  1JOQ A;  4MIU A;  1FD7 D;  1TVX A;  3S1R B;  3RZD B;  4DAY A;  1ZYR C;  2M00 A;  1D1K A;  1EZ8 A;  2F0W A;  3U9O A;  4P2C B;  3DWP A;  1DOM A;  1DM0 B;  2QIL A;  4ZAI A;  4IUT A;  5KND A;  5E1F A;  2IWH A;  1TWA B;  2A5H A;  4KJN A;  1STG A;  4RH6 A;  3HP3 A;  2BE5 C;  3BYY B;  1I4R A;  4ZKC B;  3HOU B;  4BBS B;  3VR2 A;  1JB3 A;  1YNJ C;  2NUC A;  1L0X B;  5C3W A;  4K5X A;  3ERQ A;  2RKS A;  2RQX A;  3HOZ B;  3R8B A;  2I46 A;  1H9M A;  1WTW A;  4CBV A;  1CA5 A;  3K0Y A;  3MXU A;  2FHT A;  3PIP 3;  4QCL A;  4DK1 A;  4FXD A;  3HZX A;  4KY7 A;  1JC7 A;  1QG7 A;  3GQB A;  3L3O C;  1K8M A;  3F2U A;  2XNA C;  5JAV A;  1D5X C;  3E5S A;  2JA8 B;  5BN3 A;  5BN5 A;  3I72 A;  5T1G A;  5COY A;  5J1Z A;  4KI0 A;  1PTO C;  1Z6H A;  1PMR A;  2EYO A;  4B9X A;  3Q23 A;  4G7H C;  1HQM C;  4IAL A;  2X6G A;  3MXG A;  3DMU A;  5C0X J;  3Q0A A;  2B8G A;  1CA6 A;  2RSN A;  3N6R A;  3VR6 A;  1TY2 A;  4A3E B;  5JOB A;  4R8I A;  2EYH A;  1UUP A;  1RJT A;  4XT3 B;  5LL6 S;  4HTH A;  4QB4 A;  2KEE A;  5C0X I;  1KNE A;  1TII D;  3MA2 B;  3OMC A;  5A2Q L;  1CHP D;  5M5X B;  1KDB A;  2EE1 A;  1GHK A;  4HMJ A;  2DNC A;  1GUO A;  3QOJ A;  3GTQ B;  3I3C A;  5CBA E;  2CW0 D;  1X3Q A;  4RGM A;  2DN8 A;  1GUT A;  4GZY C;  2F0F A;  3FMC A;  3J81 E;  4PMW A;  3NXW A;  3K7A B;  4LAA A;  1BUV T;  3VYT A;  5CV4 A;  5LHY 1;  3QB3 A;  1KLU D;  3CQZ B;  4HCE A;  1RCV D;  1SJE D;  3KF8 A;  2GA4 B;  4C3J G;  2JEA I;  1EIG A;  2WB1 B;  2ICI A;  5HUR A;  1PXU A;  1I4Q A;  2B2W A;  3H94 A;  5J22 A;  3EVQ A;  3BVZ A;  2O4X A;  1BNZ A;  4NW2 A;  1HA5 A;  2NVX B;  2NZ1 D;  2EOT A;  4C1N K;  1BCP F;  1HPC A;  4RGN A;  5CV7 A;  5K5P A;  3VYR A;  2VXW A;  5EPL A;  4FF2 A;  3S16 B;  4EGV A;  5CGK A;  1RTO A;  2Q8T A;  3KLS A;  1HA6 A;  5IT9 E;  2KA7 A;  1ESF A;  4KD3 A;  1SBB B;  1A2U A;  3A8K E;  4X3K A;  2O5I C;  2EVB A;  2WAC A;  4JK1 C;  3VR5 A;  2E74 C;  2NWG A;  4RCO A;  4H44 C;  2Y0S B;  1E2V A;  4FF4 A;  3S15 B;  3PUZ A;  5G3L D;  1PFB A;  1D5Z C;  1HRJ A;  3U9S A;  4KMU C;  3T51 B;  1TQO A;  4BBR B;  2FMC A;  4LJZ C;  4DAV A;  1OXX K;  3BZD B;  4KY5 A;  1WVL A;  1ZXT A;  3AB9 A;  2QDB A;  1T5X D;  4B9W A;  2C5C A;  3NBH A;  2IX3 A;  1QCB D;  1ESR A;  4C2M B;  3G7L A;  4XTC S;  3LNN A;  1VF7 A;  5JPN C;  2MP1 A;  4ZUJ A;  3CRK C;  4ZRZ A;  1SMY D;  2F4I A;  3BDO A;  3A7L A;  1Z7T A;  2NN6 I;  2EDG A;  4ID6 A;  3L9A X;  2JXM B;  3Q22 A;  4L6T B;  3FPU B;  3K57 A;  4ODG A;  3H6M A;  1NSN S;  2BDN A;  4KJO A;  1EWC A;  3MXN A;  1DXM A;  1EQV A;  4IQZ A;  1XYI A;  1F2L A;  2F03 A;  3GTG B;  2B39 A;  4H13 C;  1PRT C;  4RGO S;  5D3D A;  2Z8L A;  3OSO A;  5JJZ A;  2V4D A;  3M3Y B;  5EJW A;  2PYK A;  4XT1 B;  3AMU A;  2R7Z B;  1SYD A;  4UAI A;  3ND9 A;  4CGY B;  2PZT A;  3UI2 A;  3A55 A;  4V19 0;  4QUC A;  1D1I A;  2E75 C;  2K5W A;  1K83 B;  2B2T A;  1Q8I A;  2RSO A;  3SXH A;  2FMM A;  3P20 A;  1A6X A;  3KBX A;  5ELB A;  5C44 B;  4C3I B;  3ERO A;  3H09 A;  4A3J B;  2B2Y A;  3QG1 A;  2N88 A;  4KTA A;  3FPP A;  1XTC D;  3J80 L;  3TP8 A;  3VA5 A;  2FFK B;  3DUZ A;  3I90 A;  1EOT A;  2L4N A;  1B50 A;  5C4H A;  5EBD A;  2L0C A;  4CKB A;  1LTI D;  2TMP A;  4CJ0 B;  1JWS D;  1W6K A;  5A2Q E;  1WTV A;  1O7L A;  4C3J B;  2LY7 A;  2WKD A;  4DK0 A;  4ILW A;  1MSG A;  2L55 A;  3I8Z A;  1V1P A;  3R2I A;  4KKT A;  1MGS A;  1EZ6 A;  1A3V A;  4OHJ A;  2F0U A;  2KED A;  1II3 A;  2ICE C;  3T16 A;  1LTA D;  1R4Q B;  4NDX A;  2LS0 1;  2L9H A;  3J7Y W;  3HKZ B;  1B3A A;  4XXE A;  1R4P B;  1OXT A;  4KY6 A;  4XDX A;  1PFM A;  1DCZ A;  1Q3L A;  1HQR D;  1TWC B;  3VR3 A;  3RD4 A;  2L12 A;  5ISR A;  1EYC A;  3OMG A;  2IW3 A;  3NWT A;  1EY0 A;  5LL6 X;  4OIJ A;  3GTM B;  5KEE A;  4PNY A;  2EYM A;  1STY A;  1LTG D;  2EPB A;  5DM6 3;  3S14 B;  2A6E C;  4ABN A;  4DXF A;  1K8O A;  1AZP A;  2JYO A;  2B2U C;  1IKM A;  5C4X B;  1ZEQ X;  4IUN A;  3V96 A;  2B2U A;  3AU7 A;  5M5W B;  3DEP A;  1PTO D;  4RGT A;  5K36 H;  1I4H A;  1SXT A;  3HS0 C;  1SMY C;  2ZXP A;  2J4X A;  2RDH A;  1PTO F;  4EQN A;  1F2Z A;  1BBX C;  2HCI A;  2EY1 A;  2AWN A;  2EYJ A;  1TS4 A;  3I70 A;  1NCV A;  3CHB D;  4BA1 I;  4K8I A;  1RKN A;  1SYC A;  5I2X A;  1BXT A;  2LMC B;  4NMZ A;  2KHS A;  4RHR A;  2JA5 B;  2MPM A;  4A3K B;  1UAP A;  2E76 C;  3GV6 A;  4N9P A;  4K14 A;  2QKI C;  5FO9 B;  1X32 A;  2F0G A;  3H0G B;  1I3Q B;  5AFW A;  1H9S A;  3S2D B;  3A8J E;  2F3W A;  2PZU A;  4DN4 M;  1BCP B;  3DEO A;  2BA0 A;  2F0J A;  2A6H D;  1FYC A;  1J8I A;  1IYV A;  1CTM A;  2L5T A;  2MJ8 A;  2J7Z A;  3OIQ A;  1AFP A;  4K8J A;  3EJI A;  1V8Q A;  1KDA A;  3M7G A;  3FRP B;  1LT4 D;  1ET6 A;  2NB0 A;  4BA2 I;  5IGG A;  3TDQ A;  3BG3 A;  2BDO A;  2QF7 A;  3NQT A;  4FO2 A;  2F0O A;  1UNS A;  1YNN D;  1G29 1;  2K03 A;  1HTL D;  2NN6 G;  1DOL A;  1AZQ A;  1CFM A;  3KK7 A;  3K59 A;  1EL0 A;  2NVY B;  2EJF C;  4OO1 I;  5KIX A;  3CRL C;  4XQQ A;  1S5E D;  3H3V C;  1STH A;  1OXU A;  1QNU A;  3RMH A;  4TKO B;  4FNF A;  1EFI D;  3S17 B;  1HUN A;  1IYU A;  5ELF A;  3HRZ C;  4TRD A;  4DF7 A;  1GOZ A;  2KCN A;  3DHQ A;  2K01 A;  3J80 E;  3D3R A;  4KK7 A;  2F0N A;  4ZYS A;  5EGT A;  1U4M A;  2IX1 A;  1KDC A;  1GUS A;  1PZK D;  3NP8 A;  1WTP A;  4JBW A;  2LKV A;  4RWS C;  5E4X A;  2NVT B;  4ZKB B;  2HDL A;  1VMC A;  4PV1 C;  1GUG A;  2F0H A;  3OPO A;  4C3H G;  1VF5 C;  1O7Y A;  3NUC A;  1S5D D;  2ENB A;  2K28 A;  1F2Y A;  3KBG A;  3Q6S A;  5CBE E;  3GV3 A;  4RHS A;  3TP7 A;  4ULL A;  4KD4 A;  4ZK9 B;  5FLX E;  3MZ5 A;  2XRS D;  1F9R A;  4IFD J;  4A3I B;  4CKE A;  2I07 B;  2E2J B;  1EY5 A;  4KKU A;  1U4L A;  3NTH A;  5JEA J;  2PW5 A;  3VA7 A;  1SNQ A;  2NN6 H;  4DNT B;  2XIW A;  4IUP A;  4R8N A;  3OW7 A;  5IIF A;  5EKI A;  2WKC A;  2OT2 A;  4HSP A;  1PRT D;  1EY4 A;  2IT1 A;  2F0T A;  5KYI A;  5JVG 3;  5HGT A;  1SE4 A;  2LFN A;  3HGB A;  2B63 B;  4RA8 A;  1STN A;  1CQF A;  4Z9C B;  4TQU S;  3WDN A;  2KEC A;  3T13 A;  1PTO H;  4RFB A;  3TP6 A;  3TN2 A;  2H4O A;  1FNW A;  3IL8 A;  1NR4 A;  2A6H C;  4K6D A;  1QE6 A;  3IFD A;  3RZO B;  1SE2 A;  1GJX A;  3TZU A;  3PO2 B;  2EY6 A;  4DA2 A;  4OL7 A;  5EPJ A;  5C4J B;  1JCK B;  3C1F A;  3ITP A;  1B53 A;  1WTQ A;  2WIN B;  2F1M A;  3MAQ A;  1Z47 A;  1YNN C;  2F0S A;  3NE5 B;  1GUN A;  3BVG A;  4C1N I;  5E3F A;  2VNU D;  3BS1 A;  1G8Z D;  2MGS A;  3S2H B;  1EQT A;  4H7B A;  4O42 A;  1G2S A;  2WV6 D;  3SE0 A;  4I7Z C;  2FIN B;  3MFY A;  3D8G A;  3NSW A;  4A3G B;  2JA6 B;  1VCI A;  3I91 A;  2ID0 A;  3BVM A;  3SR1 A;  2K1B A;  4LK1 C;  1F2M A;  1LO5 D;  1O7Z A;  3URY A;  4A3B B;  4FXK C;  4K2K A;  5ELE A;  2F0D A;  5M9O A;  1LT5 D;  1MD2 D;  5ELC A;  4PMC A;  2HQE A;  1LT3 D;  2SOB A;  4NKL A;  4HR7 B;  2JP1 A;  4K6L A;  4HMI A;  3WOF A;  1LV9 A;  5G3L F;  4A93 B;  2PCF B;  2NBF A;  3EA6 A;  1SNP A;  1H9J A;  1SDF A;  1JR0 D;  3GD7 A;  2K33 A;  4S3S A;  2F0K A;  2A6E D;  3NWS A;  2PPB C;  3R3O A;  1FNU A;  2D62 A;  2EZV A;  3L7Z C;  1I6H B;  3HOX B;  1SYB A;  1SFO B;  4CKC A;  1GHJ A;  3RUZ A;  3PUW A;  2Q8I B;  2DNE A;  5EPK A;  2JA7 B;  4KV6 A;  1EY6 A;  4OO1 G;  3D6C A;  2F0P A;  4XIG S;  1U4R A;  4FF3 A;  1MI2 A;  5DM7 3;  1B4O A;  2AUJ D;  1ENC A;  4TSS A;  3PIO 3;  2K04 A;  1EEF D;  2DY7 A;  1SE3 A;  1WCM B;  2A69 C;  4H0L C;  1WTO A;  1LAC A;  3QOL A;  5DEH A;  1HHV A;  1TR5 A;  3C3L A;  5CV6 A;  1C48 A;  1EWH A;  3FVQ A;  3GTP B;  5FKA C;  2ZXR A;  2VUM B;  1ML0 D;  3PUX A;  3D4R A;  1NAP A;  4CJ2 C;  3IAY A;  2PMZ B;  5K36 G;  1R9T B;  3RLF A;  2R93 B;  2CHB D;  1BQQ T;  3W3A A;  4XYQ A;  4U67 3;  2E2H B;  5FO8 B;  1Y8N B;  2AQ1 B;  4HCS A;  1MSH A;  2JSO A;  4LMQ D;  4X3U A;  5CV9 A;  1Q12 A;  2M2L A;  1CI3 M;  3PV0 A;  1RTN A;  4G7O C;  2MUY A;  3TZD A;  2KUM A;  1BOS A;  3MTS A;  1EU3 A;  1SNO A;  1STB A;  1L0Y B;  1BCP C;  4G57 A;  1I50 B;  1U4P A;  5C0X G;  5IOD A;  1O78 A;  3T56 B;  1ILQ A;  1F77 A;  1D2B A;  1HUM A;  2XVS A;  2NTS A;  2X6L A;  3S1M B;  4OO1 H;  4DNR B;  1KTK A;  1QWY A;  4BS9 A;  3OIP A;  2H1E A;  4KN4 C;  1V43 A;  1H9R A;  1G91 A;  3GTO B;  3A54 A;  4ZLT F;  2HUG A;  5C5L A;  1VDZ A;  3N52 A;  2NVQ B;  1MBY A;  4FVM A;  2KOL A;  5D65 A;  2Q8R E;  4XQN A;  2EY5 A;  3NK9 A;  3DM1 A;  1TWG B;  1DD2 A;  4HSV A;  3PO3 B;  2J0T D;  1C8C A;  1CT1 D;  3MXP A;  5D3I B;  3V2T A;  5I4D A;  4L63 B;  2C9O A;  5TSS A;  4F7X A;  2F0V A;  3VYU A;  2L11 A;  2IPK D;  1Q1B A;  1A2T A;  3W2D A;  1S4Z A;  1M8A A;  3QJY A;  4N9T A;  2A74 C;  5KYL A;  1ZKO A;  5ELD A;  1LT6 D;  3E6Z X;  4KHZ A;  3ONA B;  4BWG B;  1C4Q A;  3DXJ C;  1PLF A;  1SNC A;  1J9O A;  1A3T A;  5T1I A;  2K7V A;  2CVR A;  4IUQ A;  3J81 L;  1RHP A;  3H91 A;  5JVH 3;  3D4W A;  3NHH A;  4ZQ3 A;  1RD9 D;  1QB5 D;  1EIH A;  1AEX A;  2B2V C;  2PO4 A;  3CU7 A;  2PZW A;  1DYQ A;  5C0X H;  1WD0 A;  3VYS A;  2R3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...