3T16A

Crystal structure of staphylococcal nuclease variant nviaga/m98g at cryogenic temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
124
Chain Sequence
b'LHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIPYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKGVNEALVRQGLAKVAYVYKGNNTHEQHLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant NVIAGA/M98G at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 124
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t16A00
3HZXA 1TR5A 4IZ8A 2PZUA 1EY6A 1SNMA 3EJIA 4LAAA 4RKLA 1EZ6A 4K2KA 1NSNS 2WACA 4F7XA 5KIXA 5E3FA 3TP7A 4QB4A 2OF1A 3NHHA 4NMZA 1SYCA 3TP5A 2EY5A 1STAA 5C5LA 4E6IA 3ITPA 2EXZA 5I9PA 4PMCA 5J39A 5EGTA 2EY6A 3MEHA 1KAAA 1F2MA 4PMBA 4EQOA 5CV8A 1EYAA 4ID6A 4DU9A 5IGGA 3P75A 3OWFA 5DEHA 3E5SA 1A3TA 2F0FA 4QF4A 5C4HA 2F0JA 1EY5A 1JOQA 4KV6A 2EYMA 3DHQA 3ERQA 5CR3A 5KYIA 3S9WA 1STYA 3OSOA 4K14A 1TT2A 5IGBA 2F0PA 2EYLA 1SNPA 4G57A 4K6DA 2KQ3A 3R3OA 3SK5A 2PW7A 2EYHA 5C4ZA 3EROA 3P1HA 4EQPA 5IGDA 5C6AA 1SYGA 1STNA 5EKLA 5HURA 1EY7A 2PZTA 4N9PA 2EYJA 2F0QA 4EVOA 1SYBA 2PQEA 3EVQA 4KJNA 4ZUIA 3QB3A 3NK9A 4ME5A 5F2DA 5C5MA 1F2ZA 2PZWA 5C3XA 2NUCA 4J6HA 4IUNA 3D8GA 4KJOA 2M00A 4KY5A 4KY7A 4PNYA 1EY9A 2RKSA 1II3A 1EY8A 1KABA 1SNQA 3H6MA 3OMGA 1U9RA 3NUCA 1NUCA 5EKKA 1F2YA 2RDFA 1STHA 2EYPA 2F0TA 3HEJA 1A2TA 1A2UA 1EZ8A 1STBA 4K8IA 5CV6A 2EYOA 4I65A 4KD4A 4WRDA 3NP8A 3RUZA 3T16A 5IGEA 3D6CA 5J1ZA 4S3SA 2O4XA 1AEXA 2F0GA 1EY0A 2PW5A 3MHBA 3QOLA 1KDAA 3C1FA 3NXWA 1EYDA 2OXPA 2EYFA 3PMFA 4K5XA 5CV9A 4B9XA 4K8JA 5JOBA 1RKNA 5I6WA 3SK8A 2RBMA 1SYFA 2EY2A 3V2TA 4DF7A 2F3WA 2PYKA 2F0KA 3MVVA 4DFAA 5KGUA 4OL7A 3DMUA 2F0IA 4K5WA 4R8NA 3NQTA 2QDBA 3MZ5A 5KEEA 2SNSA 5E1FA 3SHLA 5KRUA 4QMGA 1ENAA 1A3UA 2F0SA 2KHSA 4NKLA 2F0WA 4KHVA 4ZQ3A 2ENBA 4WORA 3LX0A 3SR1A 5KYLA 2F0NA 3C1EA 4H7BA 4EQNA 2HQEA 5M9OA 3SK6A 4F8MA 4K2LA 5CV5A 5NUCA 1A3VA 4IALA 4MIUA 2SOBA 3QOJA 4HMIA 5K5PA 1EY4A 5I6YA 3D4DA 3VA5A 1KDBA 5IODA 1JORA 5ISRA 3TP6A 1SNCA 1SNOA 5JAVA 1EYCA 1EQVA 1JOKA 1TQOA 1SNDA 2F0HA 2OEOA 4NDXA 4YIJA 4HMJA 2F0OA 3BDLA 4HTHA 3SXHA 3U9OA 4J1MA 3TP8A 4B9WA 5IGFA 2F0DA 5J22A 5IOCA 2F0LA 3D4WA 3OMCA 5CV4A 5DAUA 4ZUJA 4KY6A 3SK4A 1ENCA 4DGZA 4RKBA 2F0MA 1KDCA 4K5VA 4KTAA 5HGTA 2F0UA 4KD3A 4NP5A 4ODGA 2LKVA 5IGCA 1SYDA 4TRDA 2SNMA 2EY1A 3T13A 3TMEA 1SYEA 1IHZA 1STGA 2F0EA 2F3VA 5CV7A 5I9OA 4N9TA 5CGKA 5CC4A 1JOOA 3MXPA 5C3WA 5IIFA 2F0VA 3BDCA
chains in the Genus database with same CATH superfamily
3R8BA 5KNDA 1DXMA 2BDOA 3K5OA 2UUBQ 3HG9A 4NW2A 1MIUA 2LSSA 1RTNA 3TP5A 4DR7L 3I91A 2VB3X 2FINB 1CKMA 2L1BA 2A1AA 2I0QA 5FLXE 3WDNA 2UUAL 5GAEC 1D5ZC 2JEBI 3M4PA 5AFWA 1IKMA 1RTOA 5C4ZA 4JVZA 1LTGD 3ND9A 3EBEA 3T1YQ 4FDBA 4MTNA 5ELCA 4DV6Q 3J7A5 3K5NA 1K3RA 2IT1A 1TWGH 4RAUC 1RL2A 5AJ3Q 3N52A 4EVOA 1GUNA 4AYBB 1PH9A 3KK7A 4ME5A 4B3SQ 1U4RA 1FD7D 4JI4Q 4JI3Q 4KY5A 4JI8L 3IFDA 5IY0A 1XPOA 1TWCH 3R2TA 4PNYA 3H6MA 3HOYG 2E76C 1X3QA 1MJEA 1STBA 1Y1WH 4H0LC 3T16A 3HOZB 3GTMH 1RODA 4S3SA 5D3DA 3G7LA 1IKLA 1H9KA 1VDZA 2QGQA 2VL6A 1HUNA 1FNVA 5FLXc 5C0XI 1IBKL 4POGA 1JWUD 1G291 4IUQA 4DNRB 1A3UA 3S14H 3RD4A 4WJ4A 3K7AH 1YNJD 1HH2P 1TY0A 4RA8A 2K1BA 1MJCA 5E4XA 3KJPA 2F4IA 2JXMB 1XMOL 2UXCL 2FJ2A 1NMFA 5I6YA 1JORA 4M8AA 1GD7A 1HTLD 1SNCA 2WB1E 3S1QH 2RCFA 4YIJA 4A93H 1E2ZA 1WCMG 1TWFH 4R4TA 4N8X1 3HFZB 4A3FB 2B2YA 4HJ9A 1VQPA 2EJGC 1QOHA 2CWPA 4ZRZA 4DR3L 4JV5L 2N78A 5IP7G 3J81E 3K5LA 4XXEA 3H94A 3BS1A 1QVCA 1W2BA 4BBRH 4YHHL 1IZ6A 1XMQL 1X9NA 1E0BA 3PIP3 3OW7A 3EJIA 4DAPA 2WIIB 1N32L 1XX8A 1VQJA 1VQ4A 4E6IA 5C5LA 4LF9Q 3ITPA 4BWGB 4OWWB 1WTHA 4DR5L 4JOIC 1BVSA 4AQYL 5IYDH 4X64Q 3D3RA 1JR0D 3OWFA 4MN3A 1A8VA 4QF4A 1JOQA 4KV6A 3BZCA 3SK5A 1ENFA 1I4HA 5HGQA 4XT3B 2E8GA 3F1ZA 4FVMA 2KEEA 2A8VA 1IYJB 5BR8L 3HOWB 2RF4A 1M8AA 2RVLA 3MWYW 2JA8B 4C3JB 1W3SA 1XYIA 4NXML 5FLMH 2B63G 2VQEL 1VQGA 3AFPA 1XWEA 3J81c 3N6RA 3AQQA 1KABA 1NUCA 5IYBH 1LTTD 1QJOA 5A2QE 2IY5B 1EFID 1SFOB 1AP0A 2X6LA 2R93B 2QEJC 3ZJYC 1TXYA 3PO3G 3RZOH 4L6TB 4X66L 1EYDA 2VUMH 1E22A 3X3NA 4MZ9A 3SK8A 1K28A 4X3UA 2K5VA 1U4PA 4CHTB 3HOZH 4QMGA 3CC7A 1OXUA 3NTKA 3P20A 4DV1L 1PLFA 1IBLQ 4ZQ3A 5LMNL 2VY3A 3PIO3 2R6GA 2ALYB 3OW2A 4OWXB 2A6HC 2VNUD 1YIJA 4IN3A 2I5LX 2DNEA 1M1KC 4DV2L 1SNOA 4CGYB 1Q1EA 1EQVA 4OONA 4C3IB 2YYZA 2BDNA 5IYCG 5M3FB 2F0DA 1PTOD 5IWAL 2K05A 5JEAJ 4BY1G 1PH2A 4KTAA 1B8AA 4LF5L 1I6HB 1IHZA 5IP9G 1FVIA 4A3BG 5C3WA 2NN6G 2BA1A 2FXQA 2N8NA 2O2LD 1VQNA 3DEPA 4QB4A 1EIHA 2HIXA 1GUGA 4A3FH 2E2IH 2XNAC 1C4QA 2F1MA 4JBJA 4O0AA 1HNWL 2NVYB 1SEBD 3FKIG 1OXSC 2FFKB 5M5YB 1CSQA 3A7LA 1KQSA 5IE8A 3DHQA 5TSSA 4K14A 4RGNA 2EYLA 2R7FA 4LUVA 1R4PB 2J4XA 2RQXA 4HR7B 4JBMA 5EKLA 1K8GA 1T5EA 1S5CD 4IJLA 4A3GG 5FO7B 2B2UC 2YTVA 1VMPA 3HOXH 1S3OA 1VQHA 3RNUA 1HR0L 2PNHA 3GTJB 3D8GA 3A5UA 4DR2L 2WKCA 3TREA 1WVLA 1EY9A 1N33Q 2ZTCA 3QG1A 2BA0A 3IFTA 3H15A 4R9WA 2EPBA 3HOWH 4O42A 2A68C 3QIAA 3U4ZA 4C3JH 2PMZB 3G6EA 3AYHB 4IPGA 4A3MB 4Q5VA 4YWMA 2EYFA 2I5MX 4GLXA 4JI2L 2ICIA 2KBNA 2O5JC 3ULLA 2JSOA 4GNXA 4CKBA 1L1OA 1D8LA 1YHBA 1W6KA 5KRUA 1SFOH 2NVTB 4B3TL 1LT4D 1ESRA 3T4AC 2Y0SB 3ER0A 2R93H 4O1NA 4A3LG 3DWQA 4JBWA 3DEOA 4V0BA 3CPWA 4L5TA 4IALA 4IUUA 3D4DA 4KI0A 4Y7NB 1HXYD 1J5EL 1D2BA 2CH4A 2OQ0A 3CXCA 4RCOA 4X62Q 3TP8A 4JG2A 1C48A 2CCZA 1GUOA 4FNFA 4KD3A 5C4XH 3T13A 4N9TA 2D62A 1DOLA 2PZUA 4DR1Q 3OTOQ 1RF2D 1FGBD 1NY4A 3PIPA 4K2KA 2F52A 3A8JE 2JJQA 5JEAH 3E0JA 5M3FH 1I5FA 2EZVA 1HNXL 1IBML 4RMFA 1BUVT 5C44G 1SJED 2EXZA 2WV6D 5M5WB 1IW7C 2GA4B 3S2DB 1I6HH 3CCSA 1L2FA 4X6AH 1TS4A 1Z7TA 4BBSB 4EQOA 3QJYA 2ZTEA 1A3TA 4OEMB 3CD6A 3S1NH 3S9WA 3KLSA 2KHIA 4J15A 2EJFC 3E9HA 1CHPD 4JI0L 2NVYH 1EFWA 2H4OA 4LF6L 5M5YH 2EYJA 4X3TA 4JI8Q 5JJZA 1VQMA 1UE5A 3CP0A 5F2DA 1Q3LA 1B9MA 4J6HA 4YCVA 1N34L 3O13A 2QW7A 1EWIA 4HSPA 5JJIA 4LNQA 3Q22A 1BCPD 3ONAB 5G3LD 2MP1A 3U58A 3M4OB 5EBDA 3PO2B 5IGEA 3NP8A 3LGJA 4DV5Q 1NTGA 2E5LL 5CV9A 2UXBL 2WB1B 4DNIA 3MXNA 2CH4W 2F0KA 5BN3A 5KEEA 1O7ZA 5E7NA 1T9HA 2JE6I 3DM1A 1VQEA 3K6OA 5EQ0A 1WYDA 2X69A 4WORA 3PIOA 4A3MH 3EA6A 1I94L 5D3IB 4OELB 2XGTA 5ELNA 1ET6A 1KXLA 2A6HD 1XTDA 4TVAB 1QE6A 2G9DA 3ERSX 1XNRQ 2B2TC 5EAYA 2IWHA 1STEA 1EYCA 2NVTH 3SVMA 4X3KA 3U9OA 1CHQD 1CTMA 5IOCA 5C0XJ 5DAUA 2EE1A 4JI1Q 4DR6L 2KHJA 1KDCA 1RDPD 4K5VA 1OXTA 2AUKA 2QDLA 4XQJA 1SYEA 2B29A 1YEZA 2F3VA 2Q2TA 5FJ8G 4Y7NH 2QCPX 1F9SA 1ONLA 4BA2I 3H0GG 1KD1C 2PI2A 4HJ7A 1ZXTA 4A3JG 1SR3A 4HIKA 3K0XA 1EL0A 4UP8A 1MKHA 5EGTA 4GLVB 4U68A 1BQQT 2OWOA 1H9RA 4C3HH 1S72A 4DAVA 2KUMA 1G51A 4O2DA 4OO1G 1PZID 2OTLA 1M4VA 4JCVE 1EU3A 1VQFA 4EQPA 1OO9B 1SYGA 5M5WH 1EU4A 3OHXC 3S2DH 1UE6A 2R92G 4M1UB 4N9PA 1ZYRC 4BBSH 3R93A 5G3LF 1S4ZA 4KJNA 3RLFA 1YI2A 3QB3A 1SE3A 1YZ6A 4A3IG 3MXUA 1S5ED 5IT9L 1RHPA 4IURA 4KJOA 4L8JA 3S1MB 2JEAI 3W5OA 1A0IA 2K14A 2MO0A 1VF5C 2R61A 1SROA 3OIQA 4K0KQ 2JA9A 2EYOA 2JA6G 4DV4Q 1YVCA 1BDOA 2O4XA 4PQXA 2A68D 2DJFC 3C1FA 3CCQA 1PHJA 1DONA 5EPJA 5JOBA 4IFDI 4DV0L 1I4GA 3NQIA 4ZKBB 4OL7A 2OTJA 2ZJRA 1KL9A 4LF7L 3M4OH 5E1FA 3PO2H 2JK8A 2Q2HA 1TWAB 1LTID 4KHVA 1JWSD 2E2HB 4GKKL 4DV2Q 1Q82C 2R7ZG 5CV5A 5ELBA 1PRTC 1A3VA 4MIUA 3NEMA 1ILPA 5C3EG 4HJAA 2FHTA 1K9MC 2IPKD 3HOYB 1LACA 1Y14B 2OEOA 1G6PA 2IHFA 4HMJA 2F0OA 4A3KG 5M3MG 3J81j 3D4WA 1F9PA 3A0JA 2VW9A 4R4QA 4KHPQ 3V05A 1DD2A 3GTGB 1BOSA 3SGIA 2IHEA 1TR5A 2JYOA 1EZ6A 5C0XH 2WACA 3VYSA 3TBIB 2NVQH 1VQAA 2EY5A 4I7ZC 2UXDQ 5E4WC 1MSHA 3Q0AA 4LF8Q 1PTOC 4LMQD 4QGUA 2MQHA 3S1RH 5DEHA 3I4NG 1XNQL 1DCZA 3H3VC 2K5DA 3H91A 2EYMA 4ZKCB 3ERQA 3AFQA 3S17B 1ZKOA 2CVRA 1GKHA 2EYHA 2K33A 3I70A 1OTCA 5C6AA 5D65A 1I4PA 5FO8B 1BBUA 1EY7A 3NTHA 1WTRA 3BG3A 3T1HQ 4EQ5A 2RSNA 4V190 2VQFQ 5FK9C 4ZCKA 1CQVA 4KY7A 1YITA 3PUVA 3CQZB 2RKSA 1PH6A 4OX9Q 4LFBL 3NUCA 2ZXRA 3RUZA 4JI7Q 2BH2A 5LHY1 4I65A 2AQ3B 4QL5A 2JA5B 4IUPA 3J80c 2OXPA 1N36L 3CCUA 1SAPA 3CCVA 5GAGC 3S1MH 1SYFA 2EY2A 4CDEC 1G6ZA 2WAQG 3MVVA 2KCCA 2MPMA 3A55A 5J3BA 4KN4C 1Y1WG 4DA2A 2K52A 3KF8B 1EIYB 4BY7H 2C35B 1B3QA 5LL6X 3F2UA 1QUQB 2B63B 2E2DC 1VF7A 3C1EA 4UPAA 2E74C 4LUZA 1SE8A 3VA5A 3FVQA 1GJXA 3K81C 1E1OA 5GADC 1TQOA 1D7QA 1TWAH 1QZGA 3SXHA 2Z0SA 3JAMi 1P16A 2CW0C 2LS01 4KLKA 5CV4A 2E2HH 4KY6A 2N49A 4IPHA 1Y69U 1B2TA 3GTOB 4DV3Q 3C46A 1K8OA 4C2MB 4FXDA 1JJCB 3HZXA 4JI5L 3TN2A 1GHJA 2KECA 4A76A 4A93G 3NHHA 2BE5D 3J7AF 3NWTA 4X65L 3PUWA 2R7DA 2LFNA 5I9PA 1K83B 1FNWA 1MD2D 1XXGA 1HJPA 3GTGH 2B2VA 4TKOB 1B9NA 5I2XA 4BBRG 1SE2A 3K59A 4DUYQ 4GLAC 1QZHA 1SMXA 1SNPA 2B2YC 1HCZA 2RCNA 4UAIA 2Q2IA 5BN5A 3IKJA 1Q7YC 1I3QB 4RWSC 4XTCS 1TIID 4BY1B 2K5WA 2XRSD 1ASZA 5IYDG 2KVMA 1ZYRD 2ES2A 4LF4Q 3V96A 4A3BB 1MI2A 1E3PA 2NB0A 2C9OA 3S17H 4GKJL 3T56B 5CMDA 1SNQA 4L5SA 1A2UA 1HNZQ 4XDXA 4ZYSA 4NXNQ 1E7ZA 1RCVD 5FLMG 1Q12A 2F0GA 3GO5A 5EPKA 2JA7B 2RDHA 3K58A 3MHBA 3WWVA 2J7ZA 3HOUB 1UEBA 1YJWA 2XTIA 4K8JA 4A75A 4DFAA 3G48A 5FOBB 5IYBG 2K5HA 4FXKC 1TVXA 4K5WA 2ZT9C 1CKNB 2KOLA 3K80C 2IX0A 1BCPC 3A74A 1HZBA 2MJ8A 4A3DB 3UDFA 4LFAQ 2JA5H 1L0XB 3BU2A 5T1GA 3SR1A 2VUMG 2Z6BA 3E9IA 5M9OA 1AN8A 1BNZA 2D2CC 5DM73 3MA2B 2UU9L 1PTOB 1EY4A 1PRTD 3W2DA 3HOZG 4LUOA 4YY3Q 1E2VA 1SNDA 2F0HA 1NCVA 4HCSA 1UEAB 4L5RC 1X3PA 5IGFA 4GOPB 4JI6L 3OMCA 1PH7A 4HCEA 4EX5A 1G91A 4NP5A 3NTIA 3AB9A 1WD0A 2D0PA 2I07B 2F0EA 5CGKA 1EQTA 3P75A 4JK1C 3KDFB 4IQZA 4MNOA 5EKIA 1LABA 3ICEA 4F7XA 5LMUL 4UY8C 1Y8NB 4FF2A 2PPBC 1C9OA 3EN2A 3MEHA 3P7JA 3CC2A 3M4QA 4R4CA 4C2MH 5C4HA 1VQ5A 3Q8DA 4WJWA 2NZ1D 3GQBA 1STYA 4XYQA 1V8QA 3OWEB 4HSVA 4DUZL 4A3FG 4PV1C 1CSPA 4DR4Q 1AFPA 1I50B 3OOCA 1NR2A 1K83H 4ALPA 1PVOA 1JB3A 2F0QA 3B6YA 2ZM6L 1Q81C 3I4MB 3BVZA 2Z8LA 3NK9A 1GOZA 1TKWB 1PV4A 2L5TA 5JPNC 4B3ML 4A3EB 1BF4A 2XN9C 4LFCQ 5CBAE 3OMGA 5CORA 1I3QH 2SEBD 4R4OA 2F0TA 3CKIB 1MBYA 5C44B 1E1TA 3BYYB 1DOMA 1H9SB 1PMRA 2L55A 3J7ZC 1AEXA 3HOXG 1EY0A 2F4VL 1CM9A 3PMFA 4DV7L 4UHVA 4L5QA 2OT2A 4XIGS 1K8AC 2D0OA 3FRPB 2E2JB 2JN4A 3GTQB 1SJHD 3HKSA 3QWNA 3HOWG 1WTOA 1JCKB 2XVSA 1PRTF 4C3JG 1K3BC 2JA7H 4H13C 2YTYA 4FP5D 3FHWA 1CZGA 2K4KA 3LX0A 1UAPA 5KYLA 2IX1A 4P72A 2HHHQ 3HOUH 5NUCA 2JA8H 3PUXA 2Q2UA 4P74A 1WTWA 1EYGA 3BVGA 1SRUA 3VR6A 1P8LA 1LTRD 1RJTA 4G7OC 2Z4HA 5DNFA 1JJGA 2TMPA 4CJ1B 4XQNA 1FJGQ 2R93G 4A3DH 4KKSA 3K7UC 4G7HC 5HGTA 4CJ0B 1VQLA 4RKBA 4IFDJ 2CW0D 1VQ8A 4ODGA 4GNXC 1L1OC 2PNRC 1NMGA 5CV7A 1HZAA 1QVFA 1X3FA 4YWKA 1CQFA 4OHJA 2CQOA 3JC66 1PTOF 1NSNS 2M2LA 5JPMC 5E3FA 3TP7A 3HKZG 1A6XA 3T1YL 1STAA 3PV0A 4DV6L 4MTKA 2D9UA 2UUCQ 1I4RA 5C4XG 5AJ3L 1CZWA 1A62A 5EPLA 3NSWA 4B3SL 3WOEA 3KLWA 5CR3A 2IL8A 4JI4L 2F0PA 4JI3L 2HCIA 5JEAG 1R4QB 5M3FG 1ICFB 1H95A 4P75A 2ICEC 1PH3A 1EUJA 1HZ9A 3S15B 4DR7Q 2TSSA 5L37A 2P5ZX 2QILA 2IX3A 4C3IH 1U0LA 2OQKA 4JPBW 3G4SA 1B50A 3JAML 5GQOA 1BCPB 4ZUIA 1BR9A 2UUAQ 3CC4A 1A63A 4QCLA 1DM0B 1PH4A 1YNND 3H0GB 1NBWA 4CKEA 4Q0FA 2RDGA 3W3AA 2RDFA 2EYPA 1TY2A 1DOKA 2WINB 1HFNA 1M90C 1SSOA 2CFMA 4IOAA 3UE0A 1Z47A 1TS3A 4GZYC 3I4MH 4F88A 2E75C 2F3IA 3GTLB 1RD9D 3KLRA 4GN5A 2J0TD 4A3EH 1X55A 2WFWA 2NZHA 3MAQA 4BXXH 3K0YA 3SHLA 3STBC 1YJ9A 1PH5A 5I2YA 5JVG3 3VA7A 2K5NA 2XWBB 4I7AA 3CCLA 1Q90A 1ET9A 1QVGA 1IBKQ 4HMIA 1KDBA 2MNAA 2E2JH 3GTQH 3GTJH 1JOKA 5K36H 1VQOA 2DNCA 4LK1C 5C4JB 3BDLA 4B9WA 1C7YA 2JA6B 4LF9L 4A3MG 3M7NA 3SK4A 3M4YA 2DGYA 1XMOQ 1B3AA 2OCEA 2F03A 4JI5Q 2UXCQ 1IL8A 4X64L 2GVBA 1F9RA 3BDCA 4GS3A 1XJVA 1TWHB 2Y0SG 3KUPA 1GVPA 4IFDH 5KIXA 4R8IA 1L0WA 1B44D 2N55A 4RHRA 4B3RL 4DR3Q 4JV5Q 2GVAA 3BZKA 4EGVA 1F2MA 4PMBA 1JJ2A 1WOCA 1UNSA 2WKDA 2F0JA 3HOVB 3EFXD 3F2DA 4YHHQ 1XMQQ 5IT9E 2B2WA 5IGBA 4YCWA 1D1IA 1LT6D 4A3CH 1Z6HA 4PMWA 3I55A 1N32Q 3RLOA 1LM0A 3CW2C 4DR5Q 1ESFA 2BE5C 1S5BD 4C3HG 1Y8PB 2K28A 3NELA 4AQYQ 1CUKA 2N88A 2ID0A 1NJIC 3BJUA 1X3GA 4H44C 1CA5A 3KF8A 4NPSA 4MHEA 4U673 1U9RA 2LXKA 3WOFA 4IOCA 1QUQA 4L63B 1Y1VB 2A69C 4BBSG 4QIWE 5BR8Q 3GD7A 3TDQA 1IBLL 2RA4A 4NXMQ 2L11A 1V1PB 2VQEQ 2EVBA 4P73A 5KNCA 3UDGA 2PO4A 3TS0A 4HAEA 2LY7A 3G71A 1BCPF 3DLLA 2ZTDA 3VYTA 3NBHB 2AWNA 1HUMA 3UE1A 1CFMA 3D0FA 3A8IE 3PGZA 3I8ZA 2CHBD 3J81i 3TZUA 3GTLH 3HKZE 1QCBD 1EQRA 4X66Q 3CHBD 5BN4A 1ZEQX 4F8MA 5A35A 3QOJA 3BDOA 1EIFA 1O7YA 3PO2G 3E0EA 1S40A 1HZCA 2M9VA 2NYZD 4LW1A 3NE5B 1TWGB 2KCTA 2HCCA 4DV1Q 4KN7C 5COYA 5LMNQ 4QY7A 1B53A 2WB1G 3TZDA 1LT3D 1STGA 1F9QA 1KIXA 1TWCB 2HIVA 4C1NK 3GDEA 1KNAA 4BS9A 1HTPA 1Y1WB 1PFMA 5C4JH 1I4QA 1CKOA 1F2LA 2Z6KA 3GV6A 1S5DD 2K32A 3KYHC 5IWAQ 1IYVA 4LF5Q 1EOTA 4DK6C 4LWCA 1EYAA 1XPUA 2A6EC 4JW0A 2YTXA 5CYUA 5C0XG 1TWHH 1BO0A 4BA1I 4FF4A 3R3OA 1PZKD 3C2PA 5JVH3 3K7AB 1N33L 2EXDA 3EROA 3HP3A 1AZPA 1VQIA 3D4RA 4XYOA 2L0CA 1HNWQ 2BH8A 4YCUA 2ASBA 2PQEA 5GROA 3A56A 3HOVH 3RLNA 1LTSD 4CDFC 3S1QB 1N9WA 4IUNA 1CKNA 1F77A 4QUFA 1KAWA 4A93B 5H1SE 1PFNA 1JQYD 1L0YB 2K03A 2NBFA 1F2YA 4RCNA 5CV6A 2MUYA 3F8TA 2AHOB 4UDUC 5I4DA 4GN3B 1WCMB 1JMCA 1KDAA 2FMCA 5ELOA 4BBRB 2SDFA 4FO2A 1HR0Q 1XPRA 3I90A 3OYYA 3W1GA 4DR2Q 1D5XC 2K7VA 2F3WA 4J8QA 1J6QA 3VR2A 2F0IA 2XSCA 2PQAB 3NQTA 3OPOA 4GOPA 1O7LA 3L3OC 1Y1VH 1VS0A 2AMCB 4NKLA 3Q6SA 4CJ2C 3STBD 4X62L 2HQLA 3MXGA 3Q24A 3UDXA 1VMCA 3KDFA 1GUSA 3KOJA 4JI2Q 3VYRA 3F2CA 3CMEA 1HA5A 2VB2X 1N8RC 1Z9FA 1B4OA 4DR1L 3OTOL 3KJOA 4BY7G 2L12A 2EDGA 4B3TQ 2DN8A 2NTSA 1D5MC 4DKAC 3HS0C 4J1MA 1EQQA 1ENCA 4DGZA 1X65A 1PZJD 2AKWB 3CPFA 1D1KA 5IGCA 1SYDA 4TRDA 4DAYB 4JC0A 4C1NI 4XT1B 2K01A 2VXWA 1HQRD 3PUZA 1WI5A 1J5EQ 1HPCA 4HIDA 3J80L 1K8MA 1X56A 3TQYA 1G8ZD 4HJ5A 3RZOB 2PCFB 4TQUS 1VQKA 1SDFA 4ILWA 5J39A 2VUMB 5JJKA 3I56A 1KAAA 2KEDA 3RMHA 4DU9A 2MFIA 1HHVA 1EY5A 5KYIA 3PO3B 3I2ZA 2ZXPA 1SE4A 3OSOA 1FL0A 1LTAD 2RHQB 3M85A 1JC7A 1H9SA 1HNXQ 1IBMQ 4POFA 5IGDA 2O5IC 3HOYH 1JICA 5HURA 1TS5A 3E6ZX 1SYBA 4IUVA 4DV5L 1V9PA 5FLXL 4LJZC 3LWEA 4QJFA 2NVXB 4ABNA 4APVA 5C3XA 2XWJB 4AIMA 2JP1A 1C0AA 4ME3A 1O80A 4FYDA 3EIVA 2B2VC 3HEJA 4K8IA 4JI0Q 4RHSA 2CKZB 3BYTB 5J1ZA 4LF6Q 4KMUC 4UP7A 1XTCD 1DZ1A 2A69D 2VS1A 3T53B 1YJNA 1RKNA 3IAYA 1PFBA 4DF7A 3V2TA 1N34Q 1WJJA 2G5DA 3FPPA 1XNRL 2E2IB 1BBXC 1YNNC 2X6GA 1W6JA 2MHVA 1SBBB 1ENAA 3UDIA 1PYBA 1WCMH 1J9OA 1PRTB 1QG7A 2ENBA 3VR5A 3MFYA 4JI1L 2E5LQ 5FO9B 1YBYA 2K50A 2NZOA 3U9SA 4K2LA 3FKIB 3K5MA 2UXBQ 5IP7H 1Q8KA 2SOBA 4CKCA 5K5PA 4JOIA 3PF5A 4DK0A 3NWSA 1GO3E 5JAVA 2EQSA 2HT1A 1SMYC 2KJXA 2YU9B 2YV5A 3CQZH 2JA5G 1CA6A 3BVMA 3GTPB 3HOXB 1I94Q 4AYBG 2CWAA 1T5XD 3TMEA 2EY1A 1KHIA 4A3GB 1JOOA 2IW3A 4FXGC 1LTLA 1SNMA 3X3MA 3K57A 2I46A 4B3RQ 3PSIA 3KF6B 1WD1A 4NMZA 1WTPA 1VQ7A 4DR6Q 4JYAL 1IYUA 3J81L 5ELEA 1PYWD 1PYSB 3E5SA 2KA7A 3AU7A 3I73A 2B63H 2A5HA 1H9MA 2A6ED 1TT2A 4G57A 2KQ3A 4QIWB 3P1HA 1KLGD 1STNA 4K0KL 5DM63 1MSGA 1HRJA 4DV4L 3HRZC 3PF4A 2BCOA 3PO3H 2QEXA 1WTVA 2NUCA 3GTOH 1K0RA 1EWCA 2RSOA 1II3A 1UUPA 3QO2A 1LTBD 3C3LA 2RHSB 3HKZB 1EZ8A 2K04A 3RZDB 4WRDA 1TU2B 3AMUA 5C4XB 3I4LA 4A4IA 2WAQE 1K0SA 2QA4A 4WFN3 4GN4B 2NVXH 4R4IA 3M3YB 1AE3A 4DN4M 4DK1A 3CCEA 1O7IA 1UE7A 3H09A 1KC8C 3IRBA 2CQAA 2PYKA 1O78A 3KFUA 1TS2A 3I4OA 5A2QL 2QDBA 4K6LA 2KHSA 5IYCH 2LMCB 2JQOA 3ZYYX 1VQ6A 4DPGA 1CK1A 4ULLA 4CDCC 1NE3A 3S1NB 2F0NA 4HIMA 5EJWA 1EWHA 4H7BA 4BY1H 4KHPL 1PH1A 2VZAA 1AH9A 4DV0Q 3A5ZB 5IP9H 2B8GA 3RN2A 4A3BH 4B08A 4HEDA 5FKAC 2K5QA 2NN6H 3SDZA 1QNUA 4LF7Q 4DAMA 1X3EA 4DXGA 5J22A 4DXFA 2JA7G 1FYCA 4GKKQ 1PDQA 3S16B 3HOUG 2UXDL 4LF8L 3AEVA 2NWGA 2JA8G 1E2WA 3FKIH 1LV9A 3LNNA 3FEWX 3DUZA 4RGOS 5IIFA 4IZ8A 1NNXA 2N3SA 2B2UA 5HY6A 1FR3A 1UWVA 3CCJA 2YU9H 4A3DG 3KBXA 3GTPH 4PMCA 2UUBL 1MGSA 3I72A 4OGQC 1V1QA 3GP7A 3JAME 2HUGA 1AZQA 4A3GH 1SN8A 3T1HL 1ICWA 2VQFL 1JT8A 3M7GA 3URYA 2PW7A 1JE4A 1PTOH 4OX9L 2WP8J 3NPPA 1V1PA 4JI7L 3IL8A 3H3VH 4OXPA 3D6WA 3S2HB 2QF7A 3L2PA 2AQ2B 5ELDA 3CCRA 1Q46A 3NBHA 1XNQQ 3FDTA 3D31A 3CU7A 3HGBA 1F2ZA 3PUYA 3VYUA 2ZXOA 4K5XA 1EY8A 5I6WA 3CF5A 4QUCA 2C5CA 2DY7A 4PZ8A 4C3IG 4RH6A 2A74C 1G2TA 3QR8A 1DGSA 1U4MA 5M5XB 4IO9A 2PW5A 3NXWA 4KHZA 2PI2E 3JAMc 1R9TB 4A3LH 4AYBE 2RBMA 1EOVA 2EJMA 1KLUD 3DMUA 2NN6I 4LFBQ 2IJ0A 3MZ5A 3TRZA 3RZDH 3I4MG 1VQ9A 4IUTA 1B70B 4A3JB 4C3HB 1WFQA 1IXRA 1V1OA 1I50H 3RR5A 4UP9A 2ATWA 2DUDA 1LT5D 3M3YH 4EQNA 1N36Q 4DK3C 4A3EG 5LL6S 1SLJA 4JBKA 4WJ3M 2AQ1B 5LMNW 4DV3L 3MC0B 1EIGA 4BXXG 1DYQA 1MHWC 3GTKB 2HDMA 1B7YB 2ZJPA 3MTSA 4HTHA 3J80i 3OIPA 3TSSA 1SMYD 1ML0D 3SE0A 2ZJQA 2F0MA 5C44H 1PA6A 2AWOA 2F0UA 2K6AA 3M9BA 4QQBX 3CMAA 3TS2A 2R92B 5CBEE 3FPUB 1LLRD 2K75A 1U4LA 4DUYL 5K36G 4DNTB 4A3IB 3T51B 4YWLA 4IPDA 5DLQE 3U50C 1NAPA 4AH6A 4HIOA 2MO1A 1Q1BA 4G7ZC 3S16H 2Q8TA 3H3VI 4X3SA 3ND8A 4TSSA 5KNBA 1B1ZA 2EY6A 2XIWA 1D6EC 1YHQA 4ID6A 1ASYA 3S24A 5IGGA 2F0FA 2R3ZA 1U5KA 3FMCA 4LF4L 3A54A 2V4DA 4RFBA 1OXVA 4IFDG 1YNXA 1C8CA 1LYLA 2EIFA 1KRTA 4X65Q 1HNZL 1PH8A 4CDDC 1Q86C 1X54A 4NXNL 3SEBA 1LO5D 3J7AV 1V43A 4ZAIA 2AUJD 4OIKA 2A19A 2EOTA 2PQAA 2PZWA 3NENA 4RG1A 1K73C 4A3CG 2M00A 2R7ZB 1EEID 1GXDC 1HR0W 3KBGA 5C3EB 1STHA 1A2TA 3S2HH 4OWTB 2FMMA 3D6CA 1VCIA 2B2TA 5EBCA 1I6VC 4A3KB 4LFAL 5M3MB 2B2WC 3UI2A 2A73B 1YHAA 3CRKC 3E3XA 1GM5A 3VR3A 2V1CC 3MFGA 4GKJQ 5KGUA 2NVQB 1HFGA 3F2BA 3FP9A 4R8NA 1JE5A 4KKUA 4PZ7A 2DJGC 4YY3L 2SNSA 1YNJC 2F0SA 3MEFA 4DAYA 1HA6A 5M5XH 3S1RB 3S15H 1GUWA 3CRLC 5T1IA 1R9TH 1DJRD 3LWUA 1PFSA 1BBWA 1A15A 2B3GA 3Q23A 1S5FD 5IODA 3I4NB 5FJ8H 3ULJA 4OIJA 3GV3A 3H0GH 4F87A 4GNXB 1L1OB 5IT9c 4A3JH 2KENA 2Q8RE 3RN5A 1GHKA 2Z4IA 3J7YW 1G2SA 1WTXA 1AW7A 2SNMA 3CAMA 5I9OA 2UU9Q 3MXPA 2F0VA 3L7ZC 3GTKH 1EY6A 4JYAQ 1KNEA 1X32A 1JWMD 4LAAA 4RKLA 4OO1H 3A7AB 1IL2A 1WTQA 3PCOB 2OF1A 4DR4L 3I7FA 1SYCA 3W1BA 3K8AA 4JI6Q 1HQMC 4RGTA 1FNUA 4H02A 3VR4A 2R92H 4FF1A 4CBVA 5CV8A 4NB3A 1QILA 1AE2A 1Q8IA 4HJ8A 3NBIA 2D5DA 2L9HA 4PZ6A 1H9JA 4A3IH 2DY8A 3A8KE 1BKBA 4K6DA 1CT1D 4BY7B 4LFCL 1VQDA 1Y8OB 5LMUQ 4G4KA 2WAQB 3CCMA 4IPCA 2HD3A 4P2CB 3GTMB 2PZTA 3BZDB 2Z9HA 1E24A 2XRQD 5D14A 1QWYA 3L9AX 1RIPA 2JA6H 3EVQA 5JJLA 1QNKA 3DM3A 2H1EA 3U4VA 4KKTA 5C5MA 1OXXK 2Z6KC 2LXJA 4HN7A 4P71A 3DXJC 4XQQA 4C56C 3DWPA 4DUZQ 2Z1CA 2BOSA 5EKKA 1CI3M 5ISRA 4R1JA 2I5HA 3KLSX 4KD4A 4RGMA 3S14B 1KTKA 2G9HD 2ZM6Q 3HOVG 3QOLA 3ULPA 2HHHL 4B9XA 1FGUA 3TEHB 2R7ZH 4B3MQ 1UE1A 3L0OA 4Y52H 5C3EH 1I4XA 5ELFA 1FJGL 1TWFB 2L15A 2F0WA 4A3KH 1EEFD 5M3MH 4FF3A 2L4NA 3EQLC 4Z9CB 2B39A 4ZK9B 1SXTA 2F4VQ 2KCNA 4PG3A 2HQEA 3SK6A 1BXTA 1GUTA 1QB5D 4IJHA 4ZLTF 4DV7Q 1LUZA 2PMZE 3KF6A 1KRSA 3G6JB 2KCMA 2NTTA 3TP6A 1JB7A 1Y1VG 1VQCA 3MXNB 4NDXA 4OO1I 2Q8IB 2B8FA 4KK7A 1VQBA 1NR4A 3R2IA 1IW7D 5GAHC 4N8FA 3J80E 2HDLA 2F0LA 3I3CA 4ZUJA 2UUCL 2MGSA 1X6OA 3VDYA 2QKIC 3DWAA 2GN5A 2LKVA 2Y0SE 1J8IA 1ILQA 4GOPC 3PQIA 2H5XA 1PXUA 5CC4A 3I4NH
chains in the Genus database with same CATH topology
3R8BA 5KNDA 1DXMA 2BDOA 3K5OA 3HG9A 4NW2A 1RTNA 3TP5A 3I91A 2VB3X 2FINB 2L1BA 5FLXE 3WDNA 1D5ZC 2JEBI 1IKMA 5AFWA 1RTOA 5C4ZA 1LTGD 3ND9A 5ELCA 3K5NA 2IT1A 4RAUC 3N52A 4EVOA 1GUNA 4AYBB 3KK7A 4ME5A 1U4RA 1FD7D 4KY5A 3IFDA 3R2TA 4PNYA 3H6MA 2E76C 1X3QA 1STBA 3HOZB 4H0LC 3T16A 1RODA 4S3SA 5D3DA 3G7LA 1IKLA 1H9KA 1VDZA 1HUNA 1FNVA 5C0XI 1JWUD 1G291 4IUQA 4DNRB 1A3UA 3RD4A 1YNJD 1TY0A 4RA8A 2K1BA 5E4XA 2F4IA 2JXMB 2FJ2A 5I6YA 1JORA 4M8AA 1SNCA 1HTLD 4YIJA 1E2ZA 4A3FB 2B2YA 2EJGC 1QOHA 4ZRZA 3J81E 3K5LA 4XXEA 3H94A 3BS1A 1E0BA 3PIP3 3OW7A 3EJIA 4DAPA 2WIIB 1XX8A 4E6IA 5C5LA 3ITPA 4BWGB 3D3RA 1JR0D 3OWFA 4MN3A 4QF4A 1JOQA 4KV6A 3SK5A 1ENFA 1I4HA 4XT3B 4FVMA 2KEEA 3HOWB 1M8AA 2RVLA 3MWYW 2JA8B 4C3JB 1XYIA 1XWEA 3N6RA 1KABA 1NUCA 1LTTD 1QJOA 5A2QE 1EFID 1SFOB 1AP0A 2X6LA 2R93B 2QEJC 4L6TB 1EYDA 3X3NA 3SK8A 4X3UA 1U4PA 4CHTB 4QMGA 1OXUA 3NTKA 3P20A 1PLFA 4ZQ3A 3PIO3 2R6GA 2A6HC 2VNUD 4IN3A 2DNEA 1SNOA 4CGYB 1Q1EA 1EQVA 4C3IB 2YYZA 2BDNA 5M3FB 2F0DA 1PTOD 2K05A 5JEAJ 4KTAA 1I6HB 1IHZA 5C3WA 2NN6G 2BA1A 2O2LD 3DEPA 4QB4A 1EIHA 1GUGA 2XNAC 1C4QA 2F1MA 2NVYB 1SEBD 1OXSC 2FFKB 5M5YB 3A7LA 3DHQA 5TSSA 4K14A 4RGNA 2EYLA 1R4PB 2J4XA 2RQXA 4HR7B 5EKLA 1T5EA 1S5CD 5FO7B 2B2UC 1VMPA 3GTJB 3D8GA 2WKCA 1WVLA 1EY9A 3QG1A 2BA0A 3IFTA 4R9WA 2EPBA 4O42A 2A68C 3QIAA 2PMZB 4A3MB 4Q5VA 2EYFA 2ICIA 2O5JC 2JSOA 4CKBA 1W6KA 5KRUA 2NVTB 1LT4D 1ESRA 3T4AC 2Y0SB 4O1NA 3DWQA 4JBWA 3DEOA 4V0BA 4IALA 4IUUA 3D4DA 4KI0A 4Y7NB 1HXYD 1D2BA 4RCOA 3TP8A 1C48A 1GUOA 4FNFA 4KD3A 3T13A 4N9TA 2D62A 1DOLA 2PZUA 1RF2D 1FGBD 4K2KA 3A8JE 5JEAH 3E0JA 2EZVA 1BUVT 1SJED 2EXZA 2WV6D 5M5WB 1IW7C 2GA4B 3S2DB 1TS4A 1Z7TA 4BBSB 4EQOA 3QJYA 1A3TA 3S9WA 3KLSA 2EJFC 1CHPD 2H4OA 2EYJA 4X3TA 5JJZA 5F2DA 1Q3LA 1B9MA 4J6HA 3O13A 4HSPA 3Q22A 1BCPD 3ONAB 5G3LD 2MP1A 3M4OB 5EBDA 3PO2B 5IGEA 3NP8A 5CV9A 2WB1B 3MXNA 2F0KA 5BN3A 5KEEA 1O7ZA 2JE6I 3DM1A 5EQ0A 3K6OA 4WORA 2X69A 3EA6A 5D3IB 1ET6A 2A6HD 1QE6A 2G9DA 2B2TC 2IWHA 1STEA 1EYCA 3SVMA 4X3KA 3U9OA 1CHQD 1CTMA 5IOCA 5C0XJ 5DAUA 2EE1A 1KDCA 1RDPD 4K5VA 1OXTA 2AUKA 4XQJA 1SYEA 2F3VA 2QCPX 1F9SA 1ONLA 4BA2I 1ZXTA 1EL0A 5EGTA 4U68A 1BQQT 1H9RA 4DAVA 2KUMA 4OO1G 1PZID 1M4VA 1EU3A 4EQPA 1OO9B 1SYGA 1EU4A 3OHXC 4M1UB 4N9PA 1ZYRC 3R93A 5G3LF 1S4ZA 4KJNA 3RLFA 3QB3A 1SE3A 3MXUA 1S5ED 5IT9L 1RHPA 4IURA 4KJOA 4L8JA 3S1MB 2JEAI 1VF5C 2R61A 3OIQA 2EYOA 1BDOA 2O4XA 4PQXA 2A68D 3C1FA 1DONA 5EPJA 5JOBA 4IFDI 1I4GA 3NQIA 4ZKBB 4OL7A 5E1FA 1TWAB 1LTID 4KHVA 1JWSD 2E2HB 5CV5A 5ELBA 1PRTC 1A3VA 4MIUA 1ILPA 2FHTA 2IPKD 3HOYB 1LACA 2OEOA 4HMJA 2F0OA 3D4WA 1F9PA 3V05A 1DD2A 3GTGB 1BOSA 1TR5A 2JYOA 1EZ6A 5C0XH 2WACA 3VYSA 3TBIB 2EY5A 4I7ZC 5E4WC 1MSHA 3Q0AA 1PTOC 4LMQD 5DEHA 1DCZA 3H3VC 2K5DA 3H91A 2EYMA 4ZKCB 3ERQA 3S17B 1ZKOA 2CVRA 2EYHA 2K33A 3I70A 5C6AA 5D65A 1I4PA 5FO8B 1EY7A 3NTHA 1WTRA 3BG3A 2RSNA 4V190 5FK9C 1CQVA 4KY7A 3PUVA 3CQZB 2RKSA 3NUCA 2ZXRA 3RUZA 5LHY1 4I65A 2AQ3B 2JA5B 4IUPA 2OXPA 1SAPA 1SYFA 2EY2A 1G6ZA 3MVVA 2KCCA 2MPMA 3A55A 4KN4C 4DA2A 5LL6X 3F2UA 2B63B 2E2DC 1VF7A 3C1EA 2E74C 3VA5A 3FVQA 1GJXA 1TQOA 3SXHA 2CW0C 2LS01 5CV4A 4KY6A 1Y69U 1B2TA 3GTOB 3C46A 1K8OA 4C2MB 4FXDA 3HZXA 3TN2A 1GHJA 2KECA 3NHHA 2BE5D 3J7AF 3NWTA 3PUWA 5I9PA 2LFNA 1K83B 1FNWA 1MD2D 1XXGA 2B2VA 4TKOB 1B9NA 5I2XA 1SE2A 3K59A 1SNPA 2B2YC 1HCZA 4UAIA 5BN5A 3IKJA 1I3QB 4RWSC 4XTCS 1TIID 4BY1B 2K5WA 2XRSD 2KVMA 1ZYRD 3V96A 4A3BB 1MI2A 2NB0A 2C9OA 3T56B 5CMDA 1SNQA 1A2UA 4XDXA 4ZYSA 1RCVD 1Q12A 2F0GA 3GO5A 5EPKA 2JA7B 2RDHA 3K58A 3MHBA 2J7ZA 3HOUB 4K8JA 4DFAA 5FOBB 4FXKC 1TVXA 4K5WA 2ZT9C 2KOLA 2IX0A 1BCPC 2MJ8A 4A3DB 1L0XB 5T1GA 3SR1A 5M9OA 1AN8A 1BNZA 2D2CC 5DM73 3MA2B 1PTOB 1EY4A 1PRTD 3W2DA 1E2VA 1SNDA 2F0HA 1NCVA 4HCSA 1UEAB 1X3PA 5IGFA 3OMCA 4HCEA 1G91A 4NP5A 3NTIA 3AB9A 1WD0A 2I07B 2F0EA 5CGKA 1EQTA 3P75A 4JK1C 4IQZA 5EKIA 1LABA 4F7XA 1Y8NB 4FF2A 2PPBC 3MEHA 3P7JA 5C4HA 4WJWA 2NZ1D 3GQBA 4XYQA 1STYA 1V8QA 3OWEB 4HSVA 4PV1C 1AFPA 1I50B 3OOCA 1NR2A 1JB3A 2F0QA 3I4MB 3BVZA 2Z8LA 3NK9A 1GOZA 1TKWB 2L5TA 5JPNC 4A3EB 1BF4A 2XN9C 5CBAE 3OMGA 5CORA 2SEBD 2F0TA 3CKIB 1MBYA 5C44B 3BYYB 1DOMA 1H9SB 1PMRA 2L55A 1AEXA 1EY0A 1CM9A 3PMFA 2OT2A 4XIGS 3FRPB 2E2JB 3GTQB 1SJHD 3QWNA 1WTOA 1JCKB 2XVSA 1PRTF 4C3JG 4H13C 3LX0A 4FP5D 1CZGA 5KYLA 2IX1A 1UAPA 5NUCA 3PUXA 1WTWA 3BVGA 3VR6A 1LTRD 1RJTA 4G7OC 2Z4HA 5DNFA 2TMPA 4CJ1B 4XQNA 4KKSA 4G7HC 5HGTA 4CJ0B 4IFDJ 4RKBA 2CW0D 4ODGA 2PNRC 5CV7A 1CQFA 4OHJA 1PTOF 1NSNS 2M2LA 5JPMC 5E3FA 3TP7A 1A6XA 1STAA 3PV0A 2D9UA 1I4RA 1CZWA 5EPLA 3NSWA 3WOEA 5CR3A 2IL8A 2F0PA 2HCIA 5JEAG 1R4QB 2ICEC 3S15B 2TSSA 2QILA 2IX3A 1B50A 3JAML 1BCPB 4ZUIA 1BR9A 4QCLA 1DM0B 1YNND 3H0GB 4CKEA 4Q0FA 2RDGA 3W3AA 2RDFA 2EYPA 1TY2A 1DOKA 2WINB 1HFNA 1SSOA 1Z47A 1TS3A 4GZYC 4F88A 2E75C 3GTLB 1RD9D 3KLRA 2J0TD 3MAQA 3K0YA 3SHLA 5I2YA 5JVG3 3VA7A 2XWBB 1Q90A 1ET9A 4HMIA 1KDBA 1JOKA 5K36H 2DNCA 4LK1C 5C4JB 3BDLA 4B9WA 2JA6B 3M7NA 3SK4A 3M4YA 1B3AA 2F03A 1IL8A 1F9RA 3BDCA 1TWHB 3KUPA 4IFDH 5KIXA 4R8IA 1B44D 2N55A 4RHRA 4EGVA 1F2MA 4PMBA 2WKDA 1UNSA 2F0JA 3HOVB 3EFXD 5IT9E 2B2WA 5IGBA 1D1IA 1LT6D 1Z6HA 4PMWA 1ESFA 2BE5C 1S5BD 4C3HG 1Y8PB 2K28A 2N88A 2ID0A 4H44C 1CA5A 3KF8A 4MHEA 4U673 1U9RA 3WOFA 4L63B 1Y1VB 2A69C 3GD7A 3TDQA 2RA4A 2L11A 1V1PB 2EVBA 5KNCA 2PO4A 4HAEA 2LY7A 1BCPF 3VYTA 2AWNA 1HUMA 1CFMA 3A8IE 3I8ZA 2CHBD 3TZUA 1QCBD 3CHBD 5BN4A 1ZEQX 4F8MA 5A35A 3QOJA 3BDOA 1O7YA 2M9VA 2NYZD 3NE5B 1TWGB 2HCCA 4KN7C 5COYA 1B53A 3TZDA 1LT3D 1STGA 1F9QA 1TWCB 4C1NK 1KNAA 4BS9A 1HTPA 1Y1WB 1PFMA 1I4QA 1F2LA 3GV6A 1S5DD 2K32A 1IYVA 1EOTA 1EYAA 2A6EC 5CYUA 5C0XG 1BO0A 4BA1I 4FF4A 3R3OA 1PZKD 3C2PA 5JVH3 3K7AB 3EROA 3HP3A 1AZPA 3D4RA 4XYOA 2L0CA 2PQEA 3A56A 1LTSD 3S1QB 4IUNA 1F77A 4QUFA 4A93B 1PFNA 1JQYD 1L0YB 2K03A 2NBFA 1F2YA 4RCNA 5CV6A 2MUYA 4UDUC 5I4DA 1WCMB 1KDAA 2FMCA 4BBRB 2SDFA 4FO2A 3I90A 1D5XC 2K7VA 2F3WA 4J8QA 3VR2A 2F0IA 2XSCA 3NQTA 3OPOA 1O7LA 3L3OC 4NKLA 3Q6SA 4CJ2C 3MXGA 3Q24A 1VMCA 1GUSA 3VYRA 1HA5A 2VB2X 1B4OA 2L12A 2EDGA 2DN8A 2NTSA 1D5MC 3HS0C 4J1MA 1ENCA 4DGZA 1PZJD 1D1KA 5IGCA 1SYDA 4TRDA 4C1NI 4XT1B 2K01A 2VXWA 1HQRD 3PUZA 1HPCA 3J80L 1K8MA 1G8ZD 3RZOB 2PCFB 4TQUS 1SDFA 4ILWA 5J39A 2VUMB 1KAAA 2KEDA 3RMHA 4DU9A 1HHVA 1EY5A 5KYIA 3PO3B 2ZXPA 1SE4A 3OSOA 1LTAD 3M85A 1JC7A 1H9SA 5IGDA 2O5IC 1JICA 5HURA 1TS5A 3E6ZX 1SYBA 4IUVA 5FLXL 4LJZC 3LWEA 2NVXB 4ABNA 5C3XA 2XWJB 2JP1A 1O80A 4FYDA 2B2VC 3HEJA 4K8IA 4RHSA 3BYTB 5J1ZA 4KMUC 1XTCD 1DZ1A 2A69D 3T53B 1RKNA 3IAYA 1PFBA 4DF7A 3V2TA 3FPPA 2E2IB 1BBXC 1YNNC 2X6GA 1W6JA 2MHVA 1SBBB 1ENAA 3VR5A 1J9OA 1PRTB 1QG7A 2ENBA 3MFYA 5FO9B 3U9SA 4K2LA 3FKIB 3K5MA 2SOBA 4CKCA 5K5PA 4DK0A 3NWSA 5JAVA 1SMYC 2KJXA 2YU9B 1CA6A 3BVMA 3GTPB 3HOXB 1T5XD 3TMEA 2EY1A 4A3GB 1JOOA 2IW3A 4FXGC 1SNMA 3X3MA 3K57A 2I46A 1WD1A 4NMZA 1WTPA 1IYUA 3J81L 5ELEA 1PYWD 3E5SA 2KA7A 3AU7A 3I73A 2A5HA 1H9MA 2A6ED 1TT2A 4G57A 2KQ3A 4QIWB 3P1HA 1KLGD 1STNA 5DM63 1MSGA 1HRJA 3HRZC 2BCOA 1WTVA 2NUCA 1EWCA 2RSOA 1II3A 1UUPA 3QO2A 1LTBD 3C3LA 3HKZB 1EZ8A 2K04A 3RZDB 4WRDA 1TU2B 3AMUA 5C4XB 3I4LA 4WFN3 3M3YB 4DN4M 4DK1A 3H09A 2CQAA 2PYKA 1O78A 1TS2A 5A2QL 2QDBA 4K6LA 2KHSA 2LMCB 3ZYYX 1CK1A 4ULLA 3S1NB 2F0NA 5EJWA 1EWHA 4H7BA 2B8GA 4B08A 4HEDA 5FKAC 2K5QA 2NN6H 3SDZA 1QNUA 4DXGA 5J22A 4DXFA 1FYCA 1PDQA 3S16B 2NWGA 1E2WA 1LV9A 3LNNA 3FEWX 3DUZA 4RGOS 5IIFA 4IZ8A 2B2UA 1FR3A 3KBXA 4PMCA 1MGSA 3I72A 4OGQC 3GP7A 3JAME 2HUGA 1AZQA 1ICWA 3M7GA 3URYA 2PW7A 1JE4A 1PTOH 2WP8J 3NPPA 1V1PA 3IL8A 3D6WA 3S2HB 2QF7A 2AQ2B 5ELDA 3NBHA 3FDTA 3D31A 3CU7A 3HGBA 1F2ZA 3PUYA 3VYUA 2ZXOA 4K5XA 1EY8A 5I6WA 4QUCA 2C5CA 2DY7A 4C3IG 4RH6A 2A74C 1G2TA 1U4MA 5M5XB 2PW5A 3NXWA 4KHZA 1R9TB 2RBMA 2EJMA 1KLUD 3DMUA 2NN6I 2IJ0A 3MZ5A 4IUTA 4A3JB 4C3HB 1V1OA 1LT5D 4EQNA 5LL6S 2AQ1B 3MC0B 1EIGA 1DYQA 3GTKB 2HDMA 3MTSA 4HTHA 3OIPA 3TSSA 1SMYD 1ML0D 3SE0A 2F0MA 2AWOA 2F0UA 2K6AA 2R92B 5CBEE 3FPUB 1LLRD 1U4LA 5K36G 4DNTB 4A3IB 3T51B 1NAPA 1Q1BA 4G7ZC 2Q8TA 4X3SA 3ND8A 4TSSA 5KNBA 1B1ZA 2EY6A 2XIWA 1D6EC 4ID6A 5IGGA 2F0FA 2R3ZA 3FMCA 3A54A 2V4DA 4RFBA 1OXVA 4IFDG 1C8CA 3SEBA 1LO5D 3J7AV 1V43A 4ZAIA 2AUJD 4OIKA 2EOTA 2PZWA 2M00A 2R7ZB 1EEID 1GXDC 3KBGA 5C3EB 1STHA 1A2TA 2FMMA 3D6CA 1VCIA 2B2TA 5EBCA 1I6VC 4A3KB 5M3MB 2B2WC 3UI2A 2A73B 3CRKC 3VR3A 3MFGA 5KGUA 2NVQB 1HFGA 4R8NA 4KKUA 2SNSA 1YNJC 2F0SA 4DAYA 1HA6A 3S1RB 1GUWA 3CRLC 5T1IA 1DJRD 3LWUA 1A15A 3Q23A 1S5FD 5IODA 3I4NB 4OIJA 3GV3A 4F87A 2Q8RE 1GHKA 2Z4IA 3J7YW 1G2SA 1WTXA 1AW7A 2SNMA 5I9OA 3MXPA 2F0VA 3L7ZC 1EY6A 1KNEA 1X32A 1JWMD 4LAAA 4RKLA 4OO1H 3A7AB 1WTQA 2OF1A 1SYCA 1HQMC 4RGTA 1FNUA 3VR4A 4FF1A 4CBVA 5CV8A 1QILA 1Q8IA 3NBIA 2D5DA 2L9HA 1H9JA 2DY8A 3A8KE 4K6DA 1CT1D 4BY7B 1Y8OB 4G4KA 2WAQB 4P2CB 3GTMB 2PZTA 3BZDB 2XRQD 5D14A 1QWYA 3L9AX 3EVQA 1QNKA 2H1EA 4KKTA 5C5MA 1OXXK 4HN7A 3DXJC 4XQQA 4C56C 3DWPA 2Z1CA 2BOSA 5EKKA 1CI3M 5ISRA 3KLSX 4KD4A 4RGMA 3S14B 1KTKA 2G9HD 3QOLA 4B9XA 1I4XA 5ELFA 1TWFB 2F0WA 1EEFD 4FF3A 2L4NA 3EQLC 4Z9CB 2B39A 4ZK9B 1SXTA 2KCNA 2HQEA 3SK6A 1BXTA 1GUTA 1QB5D 4ZLTF 3G6JB 2NTTA 3TP6A 4NDXA 4OO1I 2Q8IB 2B8FA 4KK7A 1NR4A 3R2IA 1IW7D 3J80E 2HDLA 2F0LA 3I3CA 4ZUJA 2MGSA 2QKIC 3DWAA 2LKVA 1J8IA 1ILQA 1PXUA 5CC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HZX A;  1TR5 A;  4IZ8 A;  2PZU A;  1EY6 A;  1SNM A;  3EJI A;  4LAA A;  4RKL A;  1EZ6 A;  4K2K A;  1NSN S;  2WAC A;  4F7X A;  5KIX A;  5E3F A;  3TP7 A;  4QB4 A;  2OF1 A;  3NHH A;  4NMZ A;  1SYC A;  3TP5 A;  2EY5 A;  1STA A;  5C5L A;  4E6I A;  3ITP A;  2EXZ A;  5I9P A;  4PMC A;  5J39 A;  5EGT A;  2EY6 A;  3MEH A;  1KAA A;  1F2M A;  4PMB A;  4EQO A;  5CV8 A;  1EYA A;  4ID6 A;  4DU9 A;  5IGG A;  3P75 A;  3OWF A;  5DEH A;  3E5S A;  1A3T A;  2F0F A;  4QF4 A;  5C4H A;  2F0J A;  1EY5 A;  1JOQ A;  4KV6 A;  2EYM A;  3DHQ A;  3ERQ A;  5CR3 A;  5KYI A;  3S9W A;  1STY A;  3OSO A;  4K14 A;  1TT2 A;  5IGB A;  2F0P A;  2EYL A;  1SNP A;  4G57 A;  4K6D A;  2KQ3 A;  3R3O A;  3SK5 A;  2PW7 A;  2EYH A;  5C4Z A;  3ERO A;  3P1H A;  4EQP A;  5IGD A;  5C6A A;  1SYG A;  1STN A;  5EKL A;  5HUR A;  1EY7 A;  2PZT A;  4N9P A;  2EYJ A;  2F0Q A;  4EVO A;  1SYB A;  2PQE A;  3EVQ A;  4KJN A;  4ZUI A;  3QB3 A;  3NK9 A;  4ME5 A;  5F2D A;  5C5M A;  1F2Z A;  2PZW A;  5C3X A;  2NUC A;  4J6H A;  4IUN A;  3D8G A;  4KJO A;  2M00 A;  4KY5 A;  4KY7 A;  4PNY A;  1EY9 A;  2RKS A;  1II3 A;  1EY8 A;  1KAB A;  1SNQ A;  3H6M A;  3OMG A;  1U9R A;  3NUC A;  1NUC A;  5EKK A;  1F2Y A;  2RDF A;  1STH A;  2EYP A;  2F0T A;  3HEJ A;  1A2T A;  1A2U A;  1EZ8 A;  1STB A;  4K8I A;  5CV6 A;  2EYO A;  4I65 A;  4KD4 A;  4WRD A;  3NP8 A;  3RUZ A;  3T16 A;  5IGE A;  3D6C A;  5J1Z A;  4S3S A;  2O4X A;  1AEX A;  2F0G A;  1EY0 A;  2PW5 A;  3MHB A;  3QOL A;  1KDA A;  3C1F A;  3NXW A;  1EYD A;  2OXP A;  2EYF A;  3PMF A;  4K5X A;  5CV9 A;  4B9X A;  4K8J A;  5JOB A;  1RKN A;  5I6W A;  3SK8 A;  2RBM A;  1SYF A;  2EY2 A;  3V2T A;  4DF7 A;  2F3W A;  2PYK A;  2F0K A;  3MVV A;  4DFA A;  5KGU A;  4OL7 A;  3DMU A;  2F0I A;  4K5W A;  4R8N A;  3NQT A;  2QDB A;  3MZ5 A;  5KEE A;  2SNS A;  5E1F A;  3SHL A;  5KRU A;  4QMG A;  1ENA A;  1A3U A;  2F0S A;  2KHS A;  4NKL A;  2F0W A;  4KHV A;  4ZQ3 A;  2ENB A;  4WOR A;  3LX0 A;  3SR1 A;  5KYL A;  2F0N A;  3C1E A;  4H7B A;  4EQN A;  2HQE A;  5M9O A;  3SK6 A;  4F8M A;  4K2L A;  5CV5 A;  5NUC A;  1A3V A;  4IAL A;  4MIU A;  2SOB A;  3QOJ A;  4HMI A;  5K5P A;  1EY4 A;  5I6Y A;  3D4D A;  3VA5 A;  1KDB A;  5IOD A;  1JOR A;  5ISR A;  3TP6 A;  1SNC A;  1SNO A;  5JAV A;  1EYC A;  1EQV A;  1JOK A;  1TQO A;  1SND A;  2F0H A;  2OEO A;  4NDX A;  4YIJ A;  4HMJ A;  2F0O A;  3BDL A;  4HTH A;  3SXH A;  3U9O A;  4J1M A;  3TP8 A;  4B9W A;  5IGF A;  2F0D A;  5J22 A;  5IOC A;  2F0L A;  3D4W A;  3OMC A;  5CV4 A;  5DAU A;  4ZUJ A;  4KY6 A;  3SK4 A;  1ENC A;  4DGZ A;  4RKB A;  2F0M A;  1KDC A;  4K5V A;  4KTA A;  5HGT A;  2F0U A;  4KD3 A;  4NP5 A;  4ODG A;  2LKV A;  5IGC A;  1SYD A;  4TRD A;  2SNM A;  2EY1 A;  3T13 A;  3TME A;  1SYE A;  1IHZ A;  1STG A;  2F0E A;  2F3V A;  5CV7 A;  5I9O A;  4N9T A;  5CGK A;  5CC4 A;  1JOO A;  3MXP A;  5C3W A;  5IIF A;  2F0V A;  3BDC A; 
#chains in the Genus database with same CATH topology
 3R8B A;  5KND A;  1DXM A;  2BDO A;  3K5O A;  2UUB Q;  3HG9 A;  4NW2 A;  1MIU A;  2LSS A;  1RTN A;  3TP5 A;  4DR7 L;  3I91 A;  2VB3 X;  2FIN B;  1CKM A;  2L1B A;  2A1A A;  2I0Q A;  5FLX E;  3WDN A;  2UUA L;  5GAE C;  1D5Z C;  2JEB I;  3M4P A;  5AFW A;  1IKM A;  1RTO A;  5C4Z A;  4JVZ A;  1LTG D;  3ND9 A;  3EBE A;  3T1Y Q;  4FDB A;  4MTN A;  5ELC A;  4DV6 Q;  3J7A 5;  3K5N A;  1K3R A;  2IT1 A;  1TWG H;  4RAU C;  1RL2 A;  5AJ3 Q;  3N52 A;  4EVO A;  1GUN A;  4AYB B;  1PH9 A;  3KK7 A;  4ME5 A;  4B3S Q;  1U4R A;  1FD7 D;  4JI4 Q;  4JI3 Q;  4KY5 A;  4JI8 L;  3IFD A;  5IY0 A;  1XPO A;  1TWC H;  3R2T A;  4PNY A;  3H6M A;  3HOY G;  2E76 C;  1X3Q A;  1MJE A;  1STB A;  1Y1W H;  4H0L C;  3T16 A;  3HOZ B;  3GTM H;  1ROD A;  4S3S A;  5D3D A;  3G7L A;  1IKL A;  1H9K A;  1VDZ A;  2QGQ A;  2VL6 A;  1HUN A;  1FNV A;  5FLX c;  5C0X I;  1IBK L;  4POG A;  1JWU D;  1G29 1;  4IUQ A;  4DNR B;  1A3U A;  3S14 H;  3RD4 A;  4WJ4 A;  3K7A H;  1YNJ D;  1HH2 P;  1TY0 A;  4RA8 A;  2K1B A;  1MJC A;  5E4X A;  3KJP A;  2F4I A;  2JXM B;  1XMO L;  2UXC L;  2FJ2 A;  1NMF A;  5I6Y A;  1JOR A;  4M8A A;  1GD7 A;  1HTL D;  1SNC A;  2WB1 E;  3S1Q H;  2RCF A;  4YIJ A;  4A93 H;  1E2Z A;  1WCM G;  1TWF H;  4R4T A;  4N8X 1;  3HFZ B;  4A3F B;  2B2Y A;  4HJ9 A;  1VQP A;  2EJG C;  1QOH A;  2CWP A;  4ZRZ A;  4DR3 L;  4JV5 L;  2N78 A;  5IP7 G;  3J81 E;  3K5L A;  4XXE A;  3H94 A;  3BS1 A;  1QVC A;  1W2B A;  4BBR H;  4YHH L;  1IZ6 A;  1XMQ L;  1X9N A;  1E0B A;  3PIP 3;  3OW7 A;  3EJI A;  4DAP A;  2WII B;  1N32 L;  1XX8 A;  1VQJ A;  1VQ4 A;  4E6I A;  5C5L A;  4LF9 Q;  3ITP A;  4BWG B;  4OWW B;  1WTH A;  4DR5 L;  4JOI C;  1BVS A;  4AQY L;  5IYD H;  4X64 Q;  3D3R A;  1JR0 D;  3OWF A;  4MN3 A;  1A8V A;  4QF4 A;  1JOQ A;  4KV6 A;  3BZC A;  3SK5 A;  1ENF A;  1I4H A;  5HGQ A;  4XT3 B;  2E8G A;  3F1Z A;  4FVM A;  2KEE A;  2A8V A;  1IYJ B;  5BR8 L;  3HOW B;  2RF4 A;  1M8A A;  2RVL A;  3MWY W;  2JA8 B;  4C3J B;  1W3S A;  1XYI A;  4NXM L;  5FLM H;  2B63 G;  2VQE L;  1VQG A;  3AFP A;  1XWE A;  3J81 c;  3N6R A;  3AQQ A;  1KAB A;  1NUC A;  5IYB H;  1LTT D;  1QJO A;  5A2Q E;  2IY5 B;  1EFI D;  1SFO B;  1AP0 A;  2X6L A;  2R93 B;  2QEJ C;  3ZJY C;  1TXY A;  3PO3 G;  3RZO H;  4L6T B;  4X66 L;  1EYD A;  2VUM H;  1E22 A;  3X3N A;  4MZ9 A;  3SK8 A;  1K28 A;  4X3U A;  2K5V A;  1U4P A;  4CHT B;  3HOZ H;  4QMG A;  3CC7 A;  1OXU A;  3NTK A;  3P20 A;  4DV1 L;  1PLF A;  1IBL Q;  4ZQ3 A;  5LMN L;  2VY3 A;  3PIO 3;  2R6G A;  2ALY B;  3OW2 A;  4OWX B;  2A6H C;  2VNU D;  1YIJ A;  4IN3 A;  2I5L X;  2DNE A;  1M1K C;  4DV2 L;  1SNO A;  4CGY B;  1Q1E A;  1EQV A;  4OON A;  4C3I B;  2YYZ A;  2BDN A;  5IYC G;  5M3F B;  2F0D A;  1PTO D;  5IWA L;  2K05 A;  5JEA J;  4BY1 G;  1PH2 A;  4KTA A;  1B8A A;  4LF5 L;  1I6H B;  1IHZ A;  5IP9 G;  1FVI A;  4A3B G;  5C3W A;  2NN6 G;  2BA1 A;  2FXQ A;  2N8N A;  2O2L D;  1VQN A;  3DEP A;  4QB4 A;  1EIH A;  2HIX A;  1GUG A;  4A3F H;  2E2I H;  2XNA C;  1C4Q A;  2F1M A;  4JBJ A;  4O0A A;  1HNW L;  2NVY B;  1SEB D;  3FKI G;  1OXS C;  2FFK B;  5M5Y B;  1CSQ A;  3A7L A;  1KQS A;  5IE8 A;  3DHQ A;  5TSS A;  4K14 A;  4RGN A;  2EYL A;  2R7F A;  4LUV A;  1R4P B;  2J4X A;  2RQX A;  4HR7 B;  4JBM A;  5EKL A;  1K8G A;  1T5E A;  1S5C D;  4IJL A;  4A3G G;  5FO7 B;  2B2U C;  2YTV A;  1VMP A;  3HOX H;  1S3O A;  1VQH A;  3RNU A;  1HR0 L;  2PNH A;  3GTJ B;  3D8G A;  3A5U A;  4DR2 L;  2WKC A;  3TRE A;  1WVL A;  1EY9 A;  1N33 Q;  2ZTC A;  3QG1 A;  2BA0 A;  3IFT A;  3H15 A;  4R9W A;  2EPB A;  3HOW H;  4O42 A;  2A68 C;  3QIA A;  3U4Z A;  4C3J H;  2PMZ B;  3G6E A;  3AYH B;  4IPG A;  4A3M B;  4Q5V A;  4YWM A;  2EYF A;  2I5M X;  4GLX A;  4JI2 L;  2ICI A;  2KBN A;  2O5J C;  3ULL A;  2JSO A;  4GNX A;  4CKB A;  1L1O A;  1D8L A;  1YHB A;  1W6K A;  5KRU A;  1SFO H;  2NVT B;  4B3T L;  1LT4 D;  1ESR A;  3T4A C;  2Y0S B;  3ER0 A;  2R93 H;  4O1N A;  4A3L G;  3DWQ A;  4JBW A;  3DEO A;  4V0B A;  3CPW A;  4L5T A;  4IAL A;  4IUU A;  3D4D A;  4KI0 A;  4Y7N B;  1HXY D;  1J5E L;  1D2B A;  2CH4 A;  2OQ0 A;  3CXC A;  4RCO A;  4X62 Q;  3TP8 A;  4JG2 A;  1C48 A;  2CCZ A;  1GUO A;  4FNF A;  4KD3 A;  5C4X H;  3T13 A;  4N9T A;  2D62 A;  1DOL A;  2PZU A;  4DR1 Q;  3OTO Q;  1RF2 D;  1FGB D;  1NY4 A;  3PIP A;  4K2K A;  2F52 A;  3A8J E;  2JJQ A;  5JEA H;  3E0J A;  5M3F H;  1I5F A;  2EZV A;  1HNX L;  1IBM L;  4RMF A;  1BUV T;  5C44 G;  1SJE D;  2EXZ A;  2WV6 D;  5M5W B;  1IW7 C;  2GA4 B;  3S2D B;  1I6H H;  3CCS A;  1L2F A;  4X6A H;  1TS4 A;  1Z7T A;  4BBS B;  4EQO A;  3QJY A;  2ZTE A;  1A3T A;  4OEM B;  3CD6 A;  3S1N H;  3S9W A;  3KLS A;  2KHI A;  4J15 A;  2EJF C;  3E9H A;  1CHP D;  4JI0 L;  2NVY H;  1EFW A;  2H4O A;  4LF6 L;  5M5Y H;  2EYJ A;  4X3T A;  4JI8 Q;  5JJZ A;  1VQM A;  1UE5 A;  3CP0 A;  5F2D A;  1Q3L A;  1B9M A;  4J6H A;  4YCV A;  1N34 L;  3O13 A;  2QW7 A;  1EWI A;  4HSP A;  5JJI A;  4LNQ A;  3Q22 A;  1BCP D;  3ONA B;  5G3L D;  2MP1 A;  3U58 A;  3M4O B;  5EBD A;  3PO2 B;  5IGE A;  3NP8 A;  3LGJ A;  4DV5 Q;  1NTG A;  2E5L L;  5CV9 A;  2UXB L;  2WB1 B;  4DNI A;  3MXN A;  2CH4 W;  2F0K A;  5BN3 A;  5KEE A;  1O7Z A;  5E7N A;  1T9H A;  2JE6 I;  3DM1 A;  1VQE A;  3K6O A;  5EQ0 A;  1WYD A;  2X69 A;  4WOR A;  3PIO A;  4A3M H;  3EA6 A;  1I94 L;  5D3I B;  4OEL B;  2XGT A;  5ELN A;  1ET6 A;  1KXL A;  2A6H D;  1XTD A;  4TVA B;  1QE6 A;  2G9D A;  3ERS X;  1XNR Q;  2B2T C;  5EAY A;  2IWH A;  1STE A;  1EYC A;  2NVT H;  3SVM A;  4X3K A;  3U9O A;  1CHQ D;  1CTM A;  5IOC A;  5C0X J;  5DAU A;  2EE1 A;  4JI1 Q;  4DR6 L;  2KHJ A;  1KDC A;  1RDP D;  4K5V A;  1OXT A;  2AUK A;  2QDL A;  4XQJ A;  1SYE A;  2B29 A;  1YEZ A;  2F3V A;  2Q2T A;  5FJ8 G;  4Y7N H;  2QCP X;  1F9S A;  1ONL A;  4BA2 I;  3H0G G;  1KD1 C;  2PI2 A;  4HJ7 A;  1ZXT A;  4A3J G;  1SR3 A;  4HIK A;  3K0X A;  1EL0 A;  4UP8 A;  1MKH A;  5EGT A;  4GLV B;  4U68 A;  1BQQ T;  2OWO A;  1H9R A;  4C3H H;  1S72 A;  4DAV A;  2KUM A;  1G51 A;  4O2D A;  4OO1 G;  1PZI D;  2OTL A;  1M4V A;  4JCV E;  1EU3 A;  1VQF A;  4EQP A;  1OO9 B;  1SYG A;  5M5W H;  1EU4 A;  3OHX C;  3S2D H;  1UE6 A;  2R92 G;  4M1U B;  4N9P A;  1ZYR C;  4BBS H;  3R93 A;  5G3L F;  1S4Z A;  4KJN A;  3RLF A;  1YI2 A;  3QB3 A;  1SE3 A;  1YZ6 A;  4A3I G;  3MXU A;  1S5E D;  5IT9 L;  1RHP A;  4IUR A;  4KJO A;  4L8J A;  3S1M B;  2JEA I;  3W5O A;  1A0I A;  2K14 A;  2MO0 A;  1VF5 C;  2R61 A;  1SRO A;  3OIQ A;  4K0K Q;  2JA9 A;  2EYO A;  2JA6 G;  4DV4 Q;  1YVC A;  1BDO A;  2O4X A;  4PQX A;  2A68 D;  2DJF C;  3C1F A;  3CCQ A;  1PHJ A;  1DON A;  5EPJ A;  5JOB A;  4IFD I;  4DV0 L;  1I4G A;  3NQI A;  4ZKB B;  4OL7 A;  2OTJ A;  2ZJR A;  1KL9 A;  4LF7 L;  3M4O H;  5E1F A;  3PO2 H;  2JK8 A;  2Q2H A;  1TWA B;  1LTI D;  4KHV A;  1JWS D;  2E2H B;  4GKK L;  4DV2 Q;  1Q82 C;  2R7Z G;  5CV5 A;  5ELB A;  1PRT C;  1A3V A;  4MIU A;  3NEM A;  1ILP A;  5C3E G;  4HJA A;  2FHT A;  1K9M C;  2IPK D;  3HOY B;  1LAC A;  1Y14 B;  2OEO A;  1G6P A;  2IHF A;  4HMJ A;  2F0O A;  4A3K G;  5M3M G;  3J81 j;  3D4W A;  1F9P A;  3A0J A;  2VW9 A;  4R4Q A;  4KHP Q;  3V05 A;  1DD2 A;  3GTG B;  1BOS A;  3SGI A;  2IHE A;  1TR5 A;  2JYO A;  1EZ6 A;  5C0X H;  2WAC A;  3VYS A;  3TBI B;  2NVQ H;  1VQA A;  2EY5 A;  4I7Z C;  2UXD Q;  5E4W C;  1MSH A;  3Q0A A;  4LF8 Q;  1PTO C;  4LMQ D;  4QGU A;  2MQH A;  3S1R H;  5DEH A;  3I4N G;  1XNQ L;  1DCZ A;  3H3V C;  2K5D A;  3H91 A;  2EYM A;  4ZKC B;  3ERQ A;  3AFQ A;  3S17 B;  1ZKO A;  2CVR A;  1GKH A;  2EYH A;  2K33 A;  3I70 A;  1OTC A;  5C6A A;  5D65 A;  1I4P A;  5FO8 B;  1BBU A;  1EY7 A;  3NTH A;  1WTR A;  3BG3 A;  3T1H Q;  4EQ5 A;  2RSN A;  4V19 0;  2VQF Q;  5FK9 C;  4ZCK A;  1CQV A;  4KY7 A;  1YIT A;  3PUV A;  3CQZ B;  2RKS A;  1PH6 A;  4OX9 Q;  4LFB L;  3NUC A;  2ZXR A;  3RUZ A;  4JI7 Q;  2BH2 A;  5LHY 1;  4I65 A;  2AQ3 B;  4QL5 A;  2JA5 B;  4IUP A;  3J80 c;  2OXP A;  1N36 L;  3CCU A;  1SAP A;  3CCV A;  5GAG C;  3S1M H;  1SYF A;  2EY2 A;  4CDE C;  1G6Z A;  2WAQ G;  3MVV A;  2KCC A;  2MPM A;  3A55 A;  5J3B A;  4KN4 C;  1Y1W G;  4DA2 A;  2K52 A;  3KF8 B;  1EIY B;  4BY7 H;  2C35 B;  1B3Q A;  5LL6 X;  3F2U A;  1QUQ B;  2B63 B;  2E2D C;  1VF7 A;  3C1E A;  4UPA A;  2E74 C;  4LUZ A;  1SE8 A;  3VA5 A;  3FVQ A;  1GJX A;  3K81 C;  1E1O A;  5GAD C;  1TQO A;  1D7Q A;  1TWA H;  1QZG A;  3SXH A;  2Z0S A;  3JAM i;  1P16 A;  2CW0 C;  2LS0 1;  4KLK A;  5CV4 A;  2E2H H;  4KY6 A;  2N49 A;  4IPH A;  1Y69 U;  1B2T A;  3GTO B;  4DV3 Q;  3C46 A;  1K8O A;  4C2M B;  4FXD A;  1JJC B;  3HZX A;  4JI5 L;  3TN2 A;  1GHJ A;  2KEC A;  4A76 A;  4A93 G;  3NHH A;  2BE5 D;  3J7A F;  3NWT A;  4X65 L;  3PUW A;  2R7D A;  2LFN A;  5I9P A;  1K83 B;  1FNW A;  1MD2 D;  1XXG A;  1HJP A;  3GTG H;  2B2V A;  4TKO B;  1B9N A;  5I2X A;  4BBR G;  1SE2 A;  3K59 A;  4DUY Q;  4GLA C;  1QZH A;  1SMX A;  1SNP A;  2B2Y C;  1HCZ A;  2RCN A;  4UAI A;  2Q2I A;  5BN5 A;  3IKJ A;  1Q7Y C;  1I3Q B;  4RWS C;  4XTC S;  1TII D;  4BY1 B;  2K5W A;  2XRS D;  1ASZ A;  5IYD G;  2KVM A;  1ZYR D;  2ES2 A;  4LF4 Q;  3V96 A;  4A3B B;  1MI2 A;  1E3P A;  2NB0 A;  2C9O A;  3S17 H;  4GKJ L;  3T56 B;  5CMD A;  1SNQ A;  4L5S A;  1A2U A;  1HNZ Q;  4XDX A;  4ZYS A;  4NXN Q;  1E7Z A;  1RCV D;  5FLM G;  1Q12 A;  2F0G A;  3GO5 A;  5EPK A;  2JA7 B;  2RDH A;  3K58 A;  3MHB A;  3WWV A;  2J7Z A;  3HOU B;  1UEB A;  1YJW A;  2XTI A;  4K8J A;  4A75 A;  4DFA A;  3G48 A;  5FOB B;  5IYB G;  2K5H A;  4FXK C;  1TVX A;  4K5W A;  2ZT9 C;  1CKN B;  2KOL A;  3K80 C;  2IX0 A;  1BCP C;  3A74 A;  1HZB A;  2MJ8 A;  4A3D B;  3UDF A;  4LFA Q;  2JA5 H;  1L0X B;  3BU2 A;  5T1G A;  3SR1 A;  2VUM G;  2Z6B A;  3E9I A;  5M9O A;  1AN8 A;  1BNZ A;  2D2C C;  5DM7 3;  3MA2 B;  2UU9 L;  1PTO B;  1EY4 A;  1PRT D;  3W2D A;  3HOZ G;  4LUO A;  4YY3 Q;  1E2V A;  1SND A;  2F0H A;  1NCV A;  4HCS A;  1UEA B;  4L5R C;  1X3P A;  5IGF A;  4GOP B;  4JI6 L;  3OMC A;  1PH7 A;  4HCE A;  4EX5 A;  1G91 A;  4NP5 A;  3NTI A;  3AB9 A;  1WD0 A;  2D0P A;  2I07 B;  2F0E A;  5CGK A;  1EQT A;  3P75 A;  4JK1 C;  3KDF B;  4IQZ A;  4MNO A;  5EKI A;  1LAB A;  3ICE A;  4F7X A;  5LMU L;  4UY8 C;  1Y8N B;  4FF2 A;  2PPB C;  1C9O A;  3EN2 A;  3MEH A;  3P7J A;  3CC2 A;  3M4Q A;  4R4C A;  4C2M H;  5C4H A;  1VQ5 A;  3Q8D A;  4WJW A;  2NZ1 D;  3GQB A;  1STY A;  4XYQ A;  1V8Q A;  3OWE B;  4HSV A;  4DUZ L;  4A3F G;  4PV1 C;  1CSP A;  4DR4 Q;  1AFP A;  1I50 B;  3OOC A;  1NR2 A;  1K83 H;  4ALP A;  1PVO A;  1JB3 A;  2F0Q A;  3B6Y A;  2ZM6 L;  1Q81 C;  3I4M B;  3BVZ A;  2Z8L A;  3NK9 A;  1GOZ A;  1TKW B;  1PV4 A;  2L5T A;  5JPN C;  4B3M L;  4A3E B;  1BF4 A;  2XN9 C;  4LFC Q;  5CBA E;  3OMG A;  5COR A;  1I3Q H;  2SEB D;  4R4O A;  2F0T A;  3CKI B;  1MBY A;  5C44 B;  1E1T A;  3BYY B;  1DOM A;  1H9S B;  1PMR A;  2L55 A;  3J7Z C;  1AEX A;  3HOX G;  1EY0 A;  2F4V L;  1CM9 A;  3PMF A;  4DV7 L;  4UHV A;  4L5Q A;  2OT2 A;  4XIG S;  1K8A C;  2D0O A;  3FRP B;  2E2J B;  2JN4 A;  3GTQ B;  1SJH D;  3HKS A;  3QWN A;  3HOW G;  1WTO A;  1JCK B;  2XVS A;  1PRT F;  4C3J G;  1K3B C;  2JA7 H;  4H13 C;  2YTY A;  4FP5 D;  3FHW A;  1CZG A;  2K4K A;  3LX0 A;  1UAP A;  5KYL A;  2IX1 A;  4P72 A;  2HHH Q;  3HOU H;  5NUC A;  2JA8 H;  3PUX A;  2Q2U A;  4P74 A;  1WTW A;  1EYG A;  3BVG A;  1SRU A;  3VR6 A;  1P8L A;  1LTR D;  1RJT A;  4G7O C;  2Z4H A;  5DNF A;  1JJG A;  2TMP A;  4CJ1 B;  4XQN A;  1FJG Q;  2R93 G;  4A3D H;  4KKS A;  3K7U C;  4G7H C;  5HGT A;  4CJ0 B;  1VQL A;  4RKB A;  4IFD J;  2CW0 D;  1VQ8 A;  4ODG A;  4GNX C;  1L1O C;  2PNR C;  1NMG A;  5CV7 A;  1HZA A;  1QVF A;  1X3F A;  4YWK A;  1CQF A;  4OHJ A;  2CQO A;  3JC6 6;  1PTO F;  1NSN S;  2M2L A;  5JPM C;  5E3F A;  3TP7 A;  3HKZ G;  1A6X A;  3T1Y L;  1STA A;  3PV0 A;  4DV6 L;  4MTK A;  2D9U A;  2UUC Q;  1I4R A;  5C4X G;  5AJ3 L;  1CZW A;  1A62 A;  5EPL A;  3NSW A;  4B3S L;  3WOE A;  3KLW A;  5CR3 A;  2IL8 A;  4JI4 L;  2F0P A;  4JI3 L;  2HCI A;  5JEA G;  1R4Q B;  5M3F G;  1ICF B;  1H95 A;  4P75 A;  2ICE C;  1PH3 A;  1EUJ A;  1HZ9 A;  3S15 B;  4DR7 Q;  2TSS A;  5L37 A;  2P5Z X;  2QIL A;  2IX3 A;  4C3I H;  1U0L A;  2OQK A;  4JPB W;  3G4S A;  1B50 A;  3JAM L;  5GQO A;  1BCP B;  4ZUI A;  1BR9 A;  2UUA Q;  3CC4 A;  1A63 A;  4QCL A;  1DM0 B;  1PH4 A;  1YNN D;  3H0G B;  1NBW A;  4CKE A;  4Q0F A;  2RDG A;  3W3A A;  2RDF A;  2EYP A;  1TY2 A;  1DOK A;  2WIN B;  1HFN A;  1M90 C;  1SSO A;  2CFM A;  4IOA A;  3UE0 A;  1Z47 A;  1TS3 A;  4GZY C;  3I4M H;  4F88 A;  2E75 C;  2F3I A;  3GTL B;  1RD9 D;  3KLR A;  4GN5 A;  2J0T D;  4A3E H;  1X55 A;  2WFW A;  2NZH A;  3MAQ A;  4BXX H;  3K0Y A;  3SHL A;  3STB C;  1YJ9 A;  1PH5 A;  5I2Y A;  5JVG 3;  3VA7 A;  2K5N A;  2XWB B;  4I7A A;  3CCL A;  1Q90 A;  1ET9 A;  1QVG A;  1IBK Q;  4HMI A;  1KDB A;  2MNA A;  2E2J H;  3GTQ H;  3GTJ H;  1JOK A;  5K36 H;  1VQO A;  2DNC A;  4LK1 C;  5C4J B;  3BDL A;  4B9W A;  1C7Y A;  2JA6 B;  4LF9 L;  4A3M G;  3M7N A;  3SK4 A;  3M4Y A;  2DGY A;  1XMO Q;  1B3A A;  2OCE A;  2F03 A;  4JI5 Q;  2UXC Q;  1IL8 A;  4X64 L;  2GVB A;  1F9R A;  3BDC A;  4GS3 A;  1XJV A;  1TWH B;  2Y0S G;  3KUP A;  1GVP A;  4IFD H;  5KIX A;  4R8I A;  1L0W A;  1B44 D;  2N55 A;  4RHR A;  4B3R L;  4DR3 Q;  4JV5 Q;  2GVA A;  3BZK A;  4EGV A;  1F2M A;  4PMB A;  1JJ2 A;  1WOC A;  1UNS A;  2WKD A;  2F0J A;  3HOV B;  3EFX D;  3F2D A;  4YHH Q;  1XMQ Q;  5IT9 E;  2B2W A;  5IGB A;  4YCW A;  1D1I A;  1LT6 D;  4A3C H;  1Z6H A;  4PMW A;  3I55 A;  1N32 Q;  3RLO A;  1LM0 A;  3CW2 C;  4DR5 Q;  1ESF A;  2BE5 C;  1S5B D;  4C3H G;  1Y8P B;  2K28 A;  3NEL A;  4AQY Q;  1CUK A;  2N88 A;  2ID0 A;  1NJI C;  3BJU A;  1X3G A;  4H44 C;  1CA5 A;  3KF8 A;  4NPS A;  4MHE A;  4U67 3;  1U9R A;  2LXK A;  3WOF A;  4IOC A;  1QUQ A;  4L63 B;  1Y1V B;  2A69 C;  4BBS G;  4QIW E;  5BR8 Q;  3GD7 A;  3TDQ A;  1IBL L;  2RA4 A;  4NXM Q;  2L11 A;  1V1P B;  2VQE Q;  2EVB A;  4P73 A;  5KNC A;  3UDG A;  2PO4 A;  3TS0 A;  4HAE A;  2LY7 A;  3G71 A;  1BCP F;  3DLL A;  2ZTD A;  3VYT A;  3NBH B;  2AWN A;  1HUM A;  3UE1 A;  1CFM A;  3D0F A;  3A8I E;  3PGZ A;  3I8Z A;  2CHB D;  3J81 i;  3TZU A;  3GTL H;  3HKZ E;  1QCB D;  1EQR A;  4X66 Q;  3CHB D;  5BN4 A;  1ZEQ X;  4F8M A;  5A35 A;  3QOJ A;  3BDO A;  1EIF A;  1O7Y A;  3PO2 G;  3E0E A;  1S40 A;  1HZC A;  2M9V A;  2NYZ D;  4LW1 A;  3NE5 B;  1TWG B;  2KCT A;  2HCC A;  4DV1 Q;  4KN7 C;  5COY A;  5LMN Q;  4QY7 A;  1B53 A;  2WB1 G;  3TZD A;  1LT3 D;  1STG A;  1F9Q A;  1KIX A;  1TWC B;  2HIV A;  4C1N K;  3GDE A;  1KNA A;  4BS9 A;  1HTP A;  1Y1W B;  1PFM A;  5C4J H;  1I4Q A;  1CKO A;  1F2L A;  2Z6K A;  3GV6 A;  1S5D D;  2K32 A;  3KYH C;  5IWA Q;  1IYV A;  4LF5 Q;  1EOT A;  4DK6 C;  4LWC A;  1EYA A;  1XPU A;  2A6E C;  4JW0 A;  2YTX A;  5CYU A;  5C0X G;  1TWH H;  1BO0 A;  4BA1 I;  4FF4 A;  3R3O A;  1PZK D;  3C2P A;  5JVH 3;  3K7A B;  1N33 L;  2EXD A;  3ERO A;  3HP3 A;  1AZP A;  1VQI A;  3D4R A;  4XYO A;  2L0C A;  1HNW Q;  2BH8 A;  4YCU A;  2ASB A;  2PQE A;  5GRO A;  3A56 A;  3HOV H;  3RLN A;  1LTS D;  4CDF C;  3S1Q B;  1N9W A;  4IUN A;  1CKN A;  1F77 A;  4QUF A;  1KAW A;  4A93 B;  5H1S E;  1PFN A;  1JQY D;  1L0Y B;  2K03 A;  2NBF A;  1F2Y A;  4RCN A;  5CV6 A;  2MUY A;  3F8T A;  2AHO B;  4UDU C;  5I4D A;  4GN3 B;  1WCM B;  1JMC A;  1KDA A;  2FMC A;  5ELO A;  4BBR B;  2SDF A;  4FO2 A;  1HR0 Q;  1XPR A;  3I90 A;  3OYY A;  3W1G A;  4DR2 Q;  1D5X C;  2K7V A;  2F3W A;  4J8Q A;  1J6Q A;  3VR2 A;  2F0I A;  2XSC A;  2PQA B;  3NQT A;  3OPO A;  4GOP A;  1O7L A;  3L3O C;  1Y1V H;  1VS0 A;  2AMC B;  4NKL A;  3Q6S A;  4CJ2 C;  3STB D;  4X62 L;  2HQL A;  3MXG A;  3Q24 A;  3UDX A;  1VMC A;  3KDF A;  1GUS A;  3KOJ A;  4JI2 Q;  3VYR A;  3F2C A;  3CME A;  1HA5 A;  2VB2 X;  1N8R C;  1Z9F A;  1B4O A;  4DR1 L;  3OTO L;  3KJO A;  4BY7 G;  2L12 A;  2EDG A;  4B3T Q;  2DN8 A;  2NTS A;  1D5M C;  4DKA C;  3HS0 C;  4J1M A;  1EQQ A;  1ENC A;  4DGZ A;  1X65 A;  1PZJ D;  2AKW B;  3CPF A;  1D1K A;  5IGC A;  1SYD A;  4TRD A;  4DAY B;  4JC0 A;  4C1N I;  4XT1 B;  2K01 A;  2VXW A;  1HQR D;  3PUZ A;  1WI5 A;  1J5E Q;  1HPC A;  4HID A;  3J80 L;  1K8M A;  1X56 A;  3TQY A;  1G8Z D;  4HJ5 A;  3RZO B;  2PCF B;  4TQU S;  1VQK A;  1SDF A;  4ILW A;  5J39 A;  2VUM B;  5JJK A;  3I56 A;  1KAA A;  2KED A;  3RMH A;  4DU9 A;  2MFI A;  1HHV A;  1EY5 A;  5KYI A;  3PO3 B;  3I2Z A;  2ZXP A;  1SE4 A;  3OSO A;  1FL0 A;  1LTA D;  2RHQ B;  3M85 A;  1JC7 A;  1H9S A;  1HNX Q;  1IBM Q;  4POF A;  5IGD A;  2O5I C;  3HOY H;  1JIC A;  5HUR A;  1TS5 A;  3E6Z X;  1SYB A;  4IUV A;  4DV5 L;  1V9P A;  5FLX L;  4LJZ C;  3LWE A;  4QJF A;  2NVX B;  4ABN A;  4APV A;  5C3X A;  2XWJ B;  4AIM A;  2JP1 A;  1C0A A;  4ME3 A;  1O80 A;  4FYD A;  3EIV A;  2B2V C;  3HEJ A;  4K8I A;  4JI0 Q;  4RHS A;  2CKZ B;  3BYT B;  5J1Z A;  4LF6 Q;  4KMU C;  4UP7 A;  1XTC D;  1DZ1 A;  2A69 D;  2VS1 A;  3T53 B;  1YJN A;  1RKN A;  3IAY A;  1PFB A;  4DF7 A;  3V2T A;  1N34 Q;  1WJJ A;  2G5D A;  3FPP A;  1XNR L;  2E2I B;  1BBX C;  1YNN C;  2X6G A;  1W6J A;  2MHV A;  1SBB B;  1ENA A;  3UDI A;  1PYB A;  1WCM H;  1J9O A;  1PRT B;  1QG7 A;  2ENB A;  3VR5 A;  3MFY A;  4JI1 L;  2E5L Q;  5FO9 B;  1YBY A;  2K50 A;  2NZO A;  3U9S A;  4K2L A;  3FKI B;  3K5M A;  2UXB Q;  5IP7 H;  1Q8K A;  2SOB A;  4CKC A;  5K5P A;  4JOI A;  3PF5 A;  4DK0 A;  3NWS A;  1GO3 E;  5JAV A;  2EQS A;  2HT1 A;  1SMY C;  2KJX A;  2YU9 B;  2YV5 A;  3CQZ H;  2JA5 G;  1CA6 A;  3BVM A;  3GTP B;  3HOX B;  1I94 Q;  4AYB G;  2CWA A;  1T5X D;  3TME A;  2EY1 A;  1KHI A;  4A3G B;  1JOO A;  2IW3 A;  4FXG C;  1LTL A;  1SNM A;  3X3M A;  3K57 A;  2I46 A;  4B3R Q;  3PSI A;  3KF6 B;  1WD1 A;  4NMZ A;  1WTP A;  1VQ7 A;  4DR6 Q;  4JYA L;  1IYU A;  3J81 L;  5ELE A;  1PYW D;  1PYS B;  3E5S A;  2KA7 A;  3AU7 A;  3I73 A;  2B63 H;  2A5H A;  1H9M A;  2A6E D;  1TT2 A;  4G57 A;  2KQ3 A;  4QIW B;  3P1H A;  1KLG D;  1STN A;  4K0K L;  5DM6 3;  1MSG A;  1HRJ A;  4DV4 L;  3HRZ C;  3PF4 A;  2BCO A;  3PO3 H;  2QEX A;  1WTV A;  2NUC A;  3GTO H;  1K0R A;  1EWC A;  2RSO A;  1II3 A;  1UUP A;  3QO2 A;  1LTB D;  3C3L A;  2RHS B;  3HKZ B;  1EZ8 A;  2K04 A;  3RZD B;  4WRD A;  1TU2 B;  3AMU A;  5C4X B;  3I4L A;  4A4I A;  2WAQ E;  1K0S A;  2QA4 A;  4WFN 3;  4GN4 B;  2NVX H;  4R4I A;  3M3Y B;  1AE3 A;  4DN4 M;  4DK1 A;  3CCE A;  1O7I A;  1UE7 A;  3H09 A;  1KC8 C;  3IRB A;  2CQA A;  2PYK A;  1O78 A;  3KFU A;  1TS2 A;  3I4O A;  5A2Q L;  2QDB A;  4K6L A;  2KHS A;  5IYC H;  2LMC B;  2JQO A;  3ZYY X;  1VQ6 A;  4DPG A;  1CK1 A;  4ULL A;  4CDC C;  1NE3 A;  3S1N B;  2F0N A;  4HIM A;  5EJW A;  1EWH A;  4H7B A;  4BY1 H;  4KHP L;  1PH1 A;  2VZA A;  1AH9 A;  4DV0 Q;  3A5Z B;  5IP9 H;  2B8G A;  3RN2 A;  4A3B H;  4B08 A;  4HED A;  5FKA C;  2K5Q A;  2NN6 H;  3SDZ A;  1QNU A;  4LF7 Q;  4DAM A;  1X3E A;  4DXG A;  5J22 A;  4DXF A;  2JA7 G;  1FYC A;  4GKK Q;  1PDQ A;  3S16 B;  3HOU G;  2UXD L;  4LF8 L;  3AEV A;  2NWG A;  2JA8 G;  1E2W A;  3FKI H;  1LV9 A;  3LNN A;  3FEW X;  3DUZ A;  4RGO S;  5IIF A;  4IZ8 A;  1NNX A;  2N3S A;  2B2U A;  5HY6 A;  1FR3 A;  1UWV A;  3CCJ A;  2YU9 H;  4A3D G;  3KBX A;  3GTP H;  4PMC A;  2UUB L;  1MGS A;  3I72 A;  4OGQ C;  1V1Q A;  3GP7 A;  3JAM E;  2HUG A;  1AZQ A;  4A3G H;  1SN8 A;  3T1H L;  1ICW A;  2VQF L;  1JT8 A;  3M7G A;  3URY A;  2PW7 A;  1JE4 A;  1PTO H;  4OX9 L;  2WP8 J;  3NPP A;  1V1P A;  4JI7 L;  3IL8 A;  3H3V H;  4OXP A;  3D6W A;  3S2H B;  2QF7 A;  3L2P A;  2AQ2 B;  5ELD A;  3CCR A;  1Q46 A;  3NBH A;  1XNQ Q;  3FDT A;  3D31 A;  3CU7 A;  3HGB A;  1F2Z A;  3PUY A;  3VYU A;  2ZXO A;  4K5X A;  1EY8 A;  5I6W A;  3CF5 A;  4QUC A;  2C5C A;  2DY7 A;  4PZ8 A;  4C3I G;  4RH6 A;  2A74 C;  1G2T A;  3QR8 A;  1DGS A;  1U4M A;  5M5X B;  4IO9 A;  2PW5 A;  3NXW A;  4KHZ A;  2PI2 E;  3JAM c;  1R9T B;  4A3L H;  4AYB E;  2RBM A;  1EOV A;  2EJM A;  1KLU D;  3DMU A;  2NN6 I;  4LFB Q;  2IJ0 A;  3MZ5 A;  3TRZ A;  3RZD H;  3I4M G;  1VQ9 A;  4IUT A;  1B70 B;  4A3J B;  4C3H B;  1WFQ A;  1IXR A;  1V1O A;  1I50 H;  3RR5 A;  4UP9 A;  2ATW A;  2DUD A;  1LT5 D;  3M3Y H;  4EQN A;  1N36 Q;  4DK3 C;  4A3E G;  5LL6 S;  1SLJ A;  4JBK A;  4WJ3 M;  2AQ1 B;  5LMN W;  4DV3 L;  3MC0 B;  1EIG A;  4BXX G;  1DYQ A;  1MHW C;  3GTK B;  2HDM A;  1B7Y B;  2ZJP A;  3MTS A;  4HTH A;  3J80 i;  3OIP A;  3TSS A;  1SMY D;  1ML0 D;  3SE0 A;  2ZJQ A;  2F0M A;  5C44 H;  1PA6 A;  2AWO A;  2F0U A;  2K6A A;  3M9B A;  4QQB X;  3CMA A;  3TS2 A;  2R92 B;  5CBE E;  3FPU B;  1LLR D;  2K75 A;  1U4L A;  4DUY L;  5K36 G;  4DNT B;  4A3I B;  3T51 B;  4YWL A;  4IPD A;  5DLQ E;  3U50 C;  1NAP A;  4AH6 A;  4HIO A;  2MO1 A;  1Q1B A;  4G7Z C;  3S16 H;  2Q8T A;  3H3V I;  4X3S A;  3ND8 A;  4TSS A;  5KNB A;  1B1Z A;  2EY6 A;  2XIW A;  1D6E C;  1YHQ A;  4ID6 A;  1ASY A;  3S24 A;  5IGG A;  2F0F A;  2R3Z A;  1U5K A;  3FMC A;  4LF4 L;  3A54 A;  2V4D A;  4RFB A;  1OXV A;  4IFD G;  1YNX A;  1C8C A;  1LYL A;  2EIF A;  1KRT A;  4X65 Q;  1HNZ L;  1PH8 A;  4CDD C;  1Q86 C;  1X54 A;  4NXN L;  3SEB A;  1LO5 D;  3J7A V;  1V43 A;  4ZAI A;  2AUJ D;  4OIK A;  2A19 A;  2EOT A;  2PQA A;  2PZW A;  3NEN A;  4RG1 A;  1K73 C;  4A3C G;  2M00 A;  2R7Z B;  1EEI D;  1GXD C;  1HR0 W;  3KBG A;  5C3E B;  1STH A;  1A2T A;  3S2H H;  4OWT B;  2FMM A;  3D6C A;  1VCI A;  2B2T A;  5EBC A;  1I6V C;  4A3K B;  4LFA L;  5M3M B;  2B2W C;  3UI2 A;  2A73 B;  1YHA A;  3CRK C;  3E3X A;  1GM5 A;  3VR3 A;  2V1C C;  3MFG A;  4GKJ Q;  5KGU A;  2NVQ B;  1HFG A;  3F2B A;  3FP9 A;  4R8N A;  1JE5 A;  4KKU A;  4PZ7 A;  2DJG C;  4YY3 L;  2SNS A;  1YNJ C;  2F0S A;  3MEF A;  4DAY A;  1HA6 A;  5M5X H;  3S1R B;  3S15 H;  1GUW A;  3CRL C;  5T1I A;  1R9T H;  1DJR D;  3LWU A;  1PFS A;  1BBW A;  1A15 A;  2B3G A;  3Q23 A;  1S5F D;  5IOD A;  3I4N B;  5FJ8 H;  3ULJ A;  4OIJ A;  3GV3 A;  3H0G H;  4F87 A;  4GNX B;  1L1O B;  5IT9 c;  4A3J H;  2KEN A;  2Q8R E;  3RN5 A;  1GHK A;  2Z4I A;  3J7Y W;  1G2S A;  1WTX A;  1AW7 A;  2SNM A;  3CAM A;  5I9O A;  2UU9 Q;  3MXP A;  2F0V A;  3L7Z C;  3GTK H;  1EY6 A;  4JYA Q;  1KNE A;  1X32 A;  1JWM D;  4LAA A;  4RKL A;  4OO1 H;  3A7A B;  1IL2 A;  1WTQ A;  3PCO B;  2OF1 A;  4DR4 L;  3I7F A;  1SYC A;  3W1B A;  3K8A A;  4JI6 Q;  1HQM C;  4RGT A;  1FNU A;  4H02 A;  3VR4 A;  2R92 H;  4FF1 A;  4CBV A;  5CV8 A;  4NB3 A;  1QIL A;  1AE2 A;  1Q8I A;  4HJ8 A;  3NBI A;  2D5D A;  2L9H A;  4PZ6 A;  1H9J A;  4A3I H;  2DY8 A;  3A8K E;  1BKB A;  4K6D A;  1CT1 D;  4BY7 B;  4LFC L;  1VQD A;  1Y8O B;  5LMU Q;  4G4K A;  2WAQ B;  3CCM A;  4IPC A;  2HD3 A;  4P2C B;  3GTM B;  2PZT A;  3BZD B;  2Z9H A;  1E24 A;  2XRQ D;  5D14 A;  1QWY A;  3L9A X;  1RIP A;  2JA6 H;  3EVQ A;  5JJL A;  1QNK A;  3DM3 A;  2H1E A;  3U4V A;  4KKT A;  5C5M A;  1OXX K;  2Z6K C;  2LXJ A;  4HN7 A;  4P71 A;  3DXJ C;  4XQQ A;  4C56 C;  3DWP A;  4DUZ Q;  2Z1C A;  2BOS A;  5EKK A;  1CI3 M;  5ISR A;  4R1J A;  2I5H A;  3KLS X;  4KD4 A;  4RGM A;  3S14 B;  1KTK A;  2G9H D;  2ZM6 Q;  3HOV G;  3QOL A;  3ULP A;  2HHH L;  4B9X A;  1FGU A;  3TEH B;  2R7Z H;  4B3M Q;  1UE1 A;  3L0O A;  4Y52 H;  5C3E H;  1I4X A;  5ELF A;  1FJG L;  1TWF B;  2L15 A;  2F0W A;  4A3K H;  1EEF D;  5M3M H;  4FF3 A;  2L4N A;  3EQL C;  4Z9C B;  2B39 A;  4ZK9 B;  1SXT A;  2F4V Q;  2KCN A;  4PG3 A;  2HQE A;  3SK6 A;  1BXT A;  1GUT A;  1QB5 D;  4IJH A;  4ZLT F;  4DV7 Q;  1LUZ A;  2PMZ E;  3KF6 A;  1KRS A;  3G6J B;  2KCM A;  2NTT A;  3TP6 A;  1JB7 A;  1Y1V G;  1VQC A;  3MXN B;  4NDX A;  4OO1 I;  2Q8I B;  2B8F A;  4KK7 A;  1VQB A;  1NR4 A;  3R2I A;  1IW7 D;  5GAH C;  4N8F A;  3J80 E;  2HDL A;  2F0L A;  3I3C A;  4ZUJ A;  2UUC L;  2MGS A;  1X6O A;  3VDY A;  2QKI C;  3DWA A;  2GN5 A;  2LKV A;  2Y0S E;  1J8I A;  1ILQ A;  4GOP C;  3PQI A;  2H5X A;  1PXU A;  5CC4 A;  3I4N H; 
#chains in the Genus database with same CATH homology
 3R8B A;  5KND A;  1DXM A;  2BDO A;  3K5O A;  3HG9 A;  4NW2 A;  1RTN A;  3TP5 A;  3I91 A;  2VB3 X;  2FIN B;  2L1B A;  5FLX E;  3WDN A;  1D5Z C;  2JEB I;  1IKM A;  5AFW A;  1RTO A;  5C4Z A;  1LTG D;  3ND9 A;  5ELC A;  3K5N A;  2IT1 A;  4RAU C;  3N52 A;  4EVO A;  1GUN A;  4AYB B;  3KK7 A;  4ME5 A;  1U4R A;  1FD7 D;  4KY5 A;  3IFD A;  3R2T A;  4PNY A;  3H6M A;  2E76 C;  1X3Q A;  1STB A;  3HOZ B;  4H0L C;  3T16 A;  1ROD A;  4S3S A;  5D3D A;  3G7L A;  1IKL A;  1H9K A;  1VDZ A;  1HUN A;  1FNV A;  5C0X I;  1JWU D;  1G29 1;  4IUQ A;  4DNR B;  1A3U A;  3RD4 A;  1YNJ D;  1TY0 A;  4RA8 A;  2K1B A;  5E4X A;  2F4I A;  2JXM B;  2FJ2 A;  5I6Y A;  1JOR A;  4M8A A;  1SNC A;  1HTL D;  4YIJ A;  1E2Z A;  4A3F B;  2B2Y A;  2EJG C;  1QOH A;  4ZRZ A;  3J81 E;  3K5L A;  4XXE A;  3H94 A;  3BS1 A;  1E0B A;  3PIP 3;  3OW7 A;  3EJI A;  4DAP A;  2WII B;  1XX8 A;  4E6I A;  5C5L A;  3ITP A;  4BWG B;  3D3R A;  1JR0 D;  3OWF A;  4MN3 A;  4QF4 A;  1JOQ A;  4KV6 A;  3SK5 A;  1ENF A;  1I4H A;  4XT3 B;  4FVM A;  2KEE A;  3HOW B;  1M8A A;  2RVL A;  3MWY W;  2JA8 B;  4C3J B;  1XYI A;  1XWE A;  3N6R A;  1KAB A;  1NUC A;  1LTT D;  1QJO A;  5A2Q E;  1EFI D;  1SFO B;  1AP0 A;  2X6L A;  2R93 B;  2QEJ C;  4L6T B;  1EYD A;  3X3N A;  3SK8 A;  4X3U A;  1U4P A;  4CHT B;  4QMG A;  1OXU A;  3NTK A;  3P20 A;  1PLF A;  4ZQ3 A;  3PIO 3;  2R6G A;  2A6H C;  2VNU D;  4IN3 A;  2DNE A;  1SNO A;  4CGY B;  1Q1E A;  1EQV A;  4C3I B;  2YYZ A;  2BDN A;  5M3F B;  2F0D A;  1PTO D;  2K05 A;  5JEA J;  4KTA A;  1I6H B;  1IHZ A;  5C3W A;  2NN6 G;  2BA1 A;  2O2L D;  3DEP A;  4QB4 A;  1EIH A;  1GUG A;  2XNA C;  1C4Q A;  2F1M A;  2NVY B;  1SEB D;  1OXS C;  2FFK B;  5M5Y B;  3A7L A;  3DHQ A;  5TSS A;  4K14 A;  4RGN A;  2EYL A;  1R4P B;  2J4X A;  2RQX A;  4HR7 B;  5EKL A;  1T5E A;  1S5C D;  5FO7 B;  2B2U C;  1VMP A;  3GTJ B;  3D8G A;  2WKC A;  1WVL A;  1EY9 A;  3QG1 A;  2BA0 A;  3IFT A;  4R9W A;  2EPB A;  4O42 A;  2A68 C;  3QIA A;  2PMZ B;  4A3M B;  4Q5V A;  2EYF A;  2ICI A;  2O5J C;  2JSO A;  4CKB A;  1W6K A;  5KRU A;  2NVT B;  1LT4 D;  1ESR A;  3T4A C;  2Y0S B;  4O1N A;  3DWQ A;  4JBW A;  3DEO A;  4V0B A;  4IAL A;  4IUU A;  3D4D A;  4KI0 A;  4Y7N B;  1HXY D;  1D2B A;  4RCO A;  3TP8 A;  1C48 A;  1GUO A;  4FNF A;  4KD3 A;  3T13 A;  4N9T A;  2D62 A;  1DOL A;  2PZU A;  1RF2 D;  1FGB D;  4K2K A;  3A8J E;  5JEA H;  3E0J A;  2EZV A;  1BUV T;  1SJE D;  2EXZ A;  2WV6 D;  5M5W B;  1IW7 C;  2GA4 B;  3S2D B;  1TS4 A;  1Z7T A;  4BBS B;  4EQO A;  3QJY A;  1A3T A;  3S9W A;  3KLS A;  2EJF C;  1CHP D;  2H4O A;  2EYJ A;  4X3T A;  5JJZ A;  5F2D A;  1Q3L A;  1B9M A;  4J6H A;  3O13 A;  4HSP A;  3Q22 A;  1BCP D;  3ONA B;  5G3L D;  2MP1 A;  3M4O B;  5EBD A;  3PO2 B;  5IGE A;  3NP8 A;  5CV9 A;  2WB1 B;  3MXN A;  2F0K A;  5BN3 A;  5KEE A;  1O7Z A;  2JE6 I;  3DM1 A;  5EQ0 A;  3K6O A;  4WOR A;  2X69 A;  3EA6 A;  5D3I B;  1ET6 A;  2A6H D;  1QE6 A;  2G9D A;  2B2T C;  2IWH A;  1STE A;  1EYC A;  3SVM A;  4X3K A;  3U9O A;  1CHQ D;  1CTM A;  5IOC A;  5C0X J;  5DAU A;  2EE1 A;  1KDC A;  1RDP D;  4K5V A;  1OXT A;  2AUK A;  4XQJ A;  1SYE A;  2F3V A;  2QCP X;  1F9S A;  1ONL A;  4BA2 I;  1ZXT A;  1EL0 A;  5EGT A;  4U68 A;  1BQQ T;  1H9R A;  4DAV A;  2KUM A;  4OO1 G;  1PZI D;  1M4V A;  1EU3 A;  4EQP A;  1OO9 B;  1SYG A;  1EU4 A;  3OHX C;  4M1U B;  4N9P A;  1ZYR C;  3R93 A;  5G3L F;  1S4Z A;  4KJN A;  3RLF A;  3QB3 A;  1SE3 A;  3MXU A;  1S5E D;  5IT9 L;  1RHP A;  4IUR A;  4KJO A;  4L8J A;  3S1M B;  2JEA I;  1VF5 C;  2R61 A;  3OIQ A;  2EYO A;  1BDO A;  2O4X A;  4PQX A;  2A68 D;  3C1F A;  1DON A;  5EPJ A;  5JOB A;  4IFD I;  1I4G A;  3NQI A;  4ZKB B;  4OL7 A;  5E1F A;  1TWA B;  1LTI D;  4KHV A;  1JWS D;  2E2H B;  5CV5 A;  5ELB A;  1PRT C;  1A3V A;  4MIU A;  1ILP A;  2FHT A;  2IPK D;  3HOY B;  1LAC A;  2OEO A;  4HMJ A;  2F0O A;  3D4W A;  1F9P A;  3V05 A;  1DD2 A;  3GTG B;  1BOS A;  1TR5 A;  2JYO A;  1EZ6 A;  5C0X H;  2WAC A;  3VYS A;  3TBI B;  2EY5 A;  4I7Z C;  5E4W C;  1MSH A;  3Q0A A;  1PTO C;  4LMQ D;  5DEH A;  1DCZ A;  3H3V C;  2K5D A;  3H91 A;  2EYM A;  4ZKC B;  3ERQ A;  3S17 B;  1ZKO A;  2CVR A;  2EYH A;  2K33 A;  3I70 A;  5C6A A;  5D65 A;  1I4P A;  5FO8 B;  1EY7 A;  3NTH A;  1WTR A;  3BG3 A;  2RSN A;  4V19 0;  5FK9 C;  1CQV A;  4KY7 A;  3PUV A;  3CQZ B;  2RKS A;  3NUC A;  2ZXR A;  3RUZ A;  5LHY 1;  4I65 A;  2AQ3 B;  2JA5 B;  4IUP A;  2OXP A;  1SAP A;  1SYF A;  2EY2 A;  1G6Z A;  3MVV A;  2KCC A;  2MPM A;  3A55 A;  4KN4 C;  4DA2 A;  5LL6 X;  3F2U A;  2B63 B;  2E2D C;  1VF7 A;  3C1E A;  2E74 C;  3VA5 A;  3FVQ A;  1GJX A;  1TQO A;  3SXH A;  2CW0 C;  2LS0 1;  5CV4 A;  4KY6 A;  1Y69 U;  1B2T A;  3GTO B;  3C46 A;  1K8O A;  4C2M B;  4FXD A;  3HZX A;  3TN2 A;  1GHJ A;  2KEC A;  3NHH A;  2BE5 D;  3J7A F;  3NWT A;  3PUW A;  5I9P A;  2LFN A;  1K83 B;  1FNW A;  1MD2 D;  1XXG A;  2B2V A;  4TKO B;  1B9N A;  5I2X A;  1SE2 A;  3K59 A;  1SNP A;  2B2Y C;  1HCZ A;  4UAI A;  5BN5 A;  3IKJ A;  1I3Q B;  4RWS C;  4XTC S;  1TII D;  4BY1 B;  2K5W A;  2XRS D;  2KVM A;  1ZYR D;  3V96 A;  4A3B B;  1MI2 A;  2NB0 A;  2C9O A;  3T56 B;  5CMD A;  1SNQ A;  1A2U A;  4XDX A;  4ZYS A;  1RCV D;  1Q12 A;  2F0G A;  3GO5 A;  5EPK A;  2JA7 B;  2RDH A;  3K58 A;  3MHB A;  2J7Z A;  3HOU B;  4K8J A;  4DFA A;  5FOB B;  4FXK C;  1TVX A;  4K5W A;  2ZT9 C;  2KOL A;  2IX0 A;  1BCP C;  2MJ8 A;  4A3D B;  1L0X B;  5T1G A;  3SR1 A;  5M9O A;  1AN8 A;  1BNZ A;  2D2C C;  5DM7 3;  3MA2 B;  1PTO B;  1EY4 A;  1PRT D;  3W2D A;  1E2V A;  1SND A;  2F0H A;  1NCV A;  4HCS A;  1UEA B;  1X3P A;  5IGF A;  3OMC A;  4HCE A;  1G91 A;  4NP5 A;  3NTI A;  3AB9 A;  1WD0 A;  2I07 B;  2F0E A;  5CGK A;  1EQT A;  3P75 A;  4JK1 C;  4IQZ A;  5EKI A;  1LAB A;  4F7X A;  1Y8N B;  4FF2 A;  2PPB C;  3MEH A;  3P7J A;  5C4H A;  4WJW A;  2NZ1 D;  3GQB A;  4XYQ A;  1STY A;  1V8Q A;  3OWE B;  4HSV A;  4PV1 C;  1AFP A;  1I50 B;  3OOC A;  1NR2 A;  1JB3 A;  2F0Q A;  3I4M B;  3BVZ A;  2Z8L A;  3NK9 A;  1GOZ A;  1TKW B;  2L5T A;  5JPN C;  4A3E B;  1BF4 A;  2XN9 C;  5CBA E;  3OMG A;  5COR A;  2SEB D;  2F0T A;  3CKI B;  1MBY A;  5C44 B;  3BYY B;  1DOM A;  1H9S B;  1PMR A;  2L55 A;  1AEX A;  1EY0 A;  1CM9 A;  3PMF A;  2OT2 A;  4XIG S;  3FRP B;  2E2J B;  3GTQ B;  1SJH D;  3QWN A;  1WTO A;  1JCK B;  2XVS A;  1PRT F;  4C3J G;  4H13 C;  3LX0 A;  4FP5 D;  1CZG A;  5KYL A;  2IX1 A;  1UAP A;  5NUC A;  3PUX A;  1WTW A;  3BVG A;  3VR6 A;  1LTR D;  1RJT A;  4G7O C;  2Z4H A;  5DNF A;  2TMP A;  4CJ1 B;  4XQN A;  4KKS A;  4G7H C;  5HGT A;  4CJ0 B;  4IFD J;  4RKB A;  2CW0 D;  4ODG A;  2PNR C;  5CV7 A;  1CQF A;  4OHJ A;  1PTO F;  1NSN S;  2M2L A;  5JPM C;  5E3F A;  3TP7 A;  1A6X A;  1STA A;  3PV0 A;  2D9U A;  1I4R A;  1CZW A;  5EPL A;  3NSW A;  3WOE A;  5CR3 A;  2IL8 A;  2F0P A;  2HCI A;  5JEA G;  1R4Q B;  2ICE C;  3S15 B;  2TSS A;  2QIL A;  2IX3 A;  1B50 A;  3JAM L;  1BCP B;  4ZUI A;  1BR9 A;  4QCL A;  1DM0 B;  1YNN D;  3H0G B;  4CKE A;  4Q0F A;  2RDG A;  3W3A A;  2RDF A;  2EYP A;  1TY2 A;  1DOK A;  2WIN B;  1HFN A;  1SSO A;  1Z47 A;  1TS3 A;  4GZY C;  4F88 A;  2E75 C;  3GTL B;  1RD9 D;  3KLR A;  2J0T D;  3MAQ A;  3K0Y A;  3SHL A;  5I2Y A;  5JVG 3;  3VA7 A;  2XWB B;  1Q90 A;  1ET9 A;  4HMI A;  1KDB A;  1JOK A;  5K36 H;  2DNC A;  4LK1 C;  5C4J B;  3BDL A;  4B9W A;  2JA6 B;  3M7N A;  3SK4 A;  3M4Y A;  1B3A A;  2F03 A;  1IL8 A;  1F9R A;  3BDC A;  1TWH B;  3KUP A;  4IFD H;  5KIX A;  4R8I A;  1B44 D;  2N55 A;  4RHR A;  4EGV A;  1F2M A;  4PMB A;  2WKD A;  1UNS A;  2F0J A;  3HOV B;  3EFX D;  5IT9 E;  2B2W A;  5IGB A;  1D1I A;  1LT6 D;  1Z6H A;  4PMW A;  1ESF A;  2BE5 C;  1S5B D;  4C3H G;  1Y8P B;  2K28 A;  2N88 A;  2ID0 A;  4H44 C;  1CA5 A;  3KF8 A;  4MHE A;  4U67 3;  1U9R A;  3WOF A;  4L63 B;  1Y1V B;  2A69 C;  3GD7 A;  3TDQ A;  2RA4 A;  2L11 A;  1V1P B;  2EVB A;  5KNC A;  2PO4 A;  4HAE A;  2LY7 A;  1BCP F;  3VYT A;  2AWN A;  1HUM A;  1CFM A;  3A8I E;  3I8Z A;  2CHB D;  3TZU A;  1QCB D;  3CHB D;  5BN4 A;  1ZEQ X;  4F8M A;  5A35 A;  3QOJ A;  3BDO A;  1O7Y A;  2M9V A;  2NYZ D;  3NE5 B;  1TWG B;  2HCC A;  4KN7 C;  5COY A;  1B53 A;  3TZD A;  1LT3 D;  1STG A;  1F9Q A;  1TWC B;  4C1N K;  1KNA A;  4BS9 A;  1HTP A;  1Y1W B;  1PFM A;  1I4Q A;  1F2L A;  3GV6 A;  1S5D D;  2K32 A;  1IYV A;  1EOT A;  1EYA A;  2A6E C;  5CYU A;  5C0X G;  1BO0 A;  4BA1 I;  4FF4 A;  3R3O A;  1PZK D;  3C2P A;  5JVH 3;  3K7A B;  3ERO A;  3HP3 A;  1AZP A;  3D4R A;  4XYO A;  2L0C A;  2PQE A;  3A56 A;  1LTS D;  3S1Q B;  4IUN A;  1F77 A;  4QUF A;  4A93 B;  1PFN A;  1JQY D;  1L0Y B;  2K03 A;  2NBF A;  1F2Y A;  4RCN A;  5CV6 A;  2MUY A;  4UDU C;  5I4D A;  1WCM B;  1KDA A;  2FMC A;  4BBR B;  2SDF A;  4FO2 A;  3I90 A;  1D5X C;  2K7V A;  2F3W A;  4J8Q A;  3VR2 A;  2F0I A;  2XSC A;  3NQT A;  3OPO A;  1O7L A;  3L3O C;  4NKL A;  3Q6S A;  4CJ2 C;  3MXG A;  3Q24 A;  1VMC A;  1GUS A;  3VYR A;  1HA5 A;  2VB2 X;  1B4O A;  2L12 A;  2EDG A;  2DN8 A;  2NTS A;  1D5M C;  3HS0 C;  4J1M A;  1ENC A;  4DGZ A;  1PZJ D;  1D1K A;  5IGC A;  1SYD A;  4TRD A;  4C1N I;  4XT1 B;  2K01 A;  2VXW A;  1HQR D;  3PUZ A;  1HPC A;  3J80 L;  1K8M A;  1G8Z D;  3RZO B;  2PCF B;  4TQU S;  1SDF A;  4ILW A;  5J39 A;  2VUM B;  1KAA A;  2KED A;  3RMH A;  4DU9 A;  1HHV A;  1EY5 A;  5KYI A;  3PO3 B;  2ZXP A;  1SE4 A;  3OSO A;  1LTA D;  3M85 A;  1JC7 A;  1H9S A;  5IGD A;  2O5I C;  1JIC A;  5HUR A;  1TS5 A;  3E6Z X;  1SYB A;  4IUV A;  5FLX L;  4LJZ C;  3LWE A;  2NVX B;  4ABN A;  5C3X A;  2XWJ B;  2JP1 A;  1O80 A;  4FYD A;  2B2V C;  3HEJ A;  4K8I A;  4RHS A;  3BYT B;  5J1Z A;  4KMU C;  1XTC D;  1DZ1 A;  2A69 D;  3T53 B;  1RKN A;  3IAY A;  1PFB A;  4DF7 A;  3V2T A;  3FPP A;  2E2I B;  1BBX C;  1YNN C;  2X6G A;  1W6J A;  2MHV A;  1SBB B;  1ENA A;  3VR5 A;  1J9O A;  1PRT B;  1QG7 A;  2ENB A;  3MFY A;  5FO9 B;  3U9S A;  4K2L A;  3FKI B;  3K5M A;  2SOB A;  4CKC A;  5K5P A;  4DK0 A;  3NWS A;  5JAV A;  1SMY C;  2KJX A;  2YU9 B;  1CA6 A;  3BVM A;  3GTP B;  3HOX B;  1T5X D;  3TME A;  2EY1 A;  4A3G B;  1JOO A;  2IW3 A;  4FXG C;  1SNM A;  3X3M A;  3K57 A;  2I46 A;  1WD1 A;  4NMZ A;  1WTP A;  1IYU A;  3J81 L;  5ELE A;  1PYW D;  3E5S A;  2KA7 A;  3AU7 A;  3I73 A;  2A5H A;  1H9M A;  2A6E D;  1TT2 A;  4G57 A;  2KQ3 A;  4QIW B;  3P1H A;  1KLG D;  1STN A;  5DM6 3;  1MSG A;  1HRJ A;  3HRZ C;  2BCO A;  1WTV A;  2NUC A;  1EWC A;  2RSO A;  1II3 A;  1UUP A;  3QO2 A;  1LTB D;  3C3L A;  3HKZ B;  1EZ8 A;  2K04 A;  3RZD B;  4WRD A;  1TU2 B;  3AMU A;  5C4X B;  3I4L A;  4WFN 3;  3M3Y B;  4DN4 M;  4DK1 A;  3H09 A;  2CQA A;  2PYK A;  1O78 A;  1TS2 A;  5A2Q L;  2QDB A;  4K6L A;  2KHS A;  2LMC B;  3ZYY X;  1CK1 A;  4ULL A;  3S1N B;  2F0N A;  5EJW A;  1EWH A;  4H7B A;  2B8G A;  4B08 A;  4HED A;  5FKA C;  2K5Q A;  2NN6 H;  3SDZ A;  1QNU A;  4DXG A;  5J22 A;  4DXF A;  1FYC A;  1PDQ A;  3S16 B;  2NWG A;  1E2W A;  1LV9 A;  3LNN A;  3FEW X;  3DUZ A;  4RGO S;  5IIF A;  4IZ8 A;  2B2U A;  1FR3 A;  3KBX A;  4PMC A;  1MGS A;  3I72 A;  4OGQ C;  3GP7 A;  3JAM E;  2HUG A;  1AZQ A;  1ICW A;  3M7G A;  3URY A;  2PW7 A;  1JE4 A;  1PTO H;  2WP8 J;  3NPP A;  1V1P A;  3IL8 A;  3D6W A;  3S2H B;  2QF7 A;  2AQ2 B;  5ELD A;  3NBH A;  3FDT A;  3D31 A;  3CU7 A;  3HGB A;  1F2Z A;  3PUY A;  3VYU A;  2ZXO A;  4K5X A;  1EY8 A;  5I6W A;  4QUC A;  2C5C A;  2DY7 A;  4C3I G;  4RH6 A;  2A74 C;  1G2T A;  1U4M A;  5M5X B;  2PW5 A;  3NXW A;  4KHZ A;  1R9T B;  2RBM A;  2EJM A;  1KLU D;  3DMU A;  2NN6 I;  2IJ0 A;  3MZ5 A;  4IUT A;  4A3J B;  4C3H B;  1V1O A;  1LT5 D;  4EQN A;  5LL6 S;  2AQ1 B;  3MC0 B;  1EIG A;  1DYQ A;  3GTK B;  2HDM A;  3MTS A;  4HTH A;  3OIP A;  3TSS A;  1SMY D;  1ML0 D;  3SE0 A;  2F0M A;  2AWO A;  2F0U A;  2K6A A;  2R92 B;  5CBE E;  3FPU B;  1LLR D;  1U4L A;  5K36 G;  4DNT B;  4A3I B;  3T51 B;  1NAP A;  1Q1B A;  4G7Z C;  2Q8T A;  4X3S A;  3ND8 A;  4TSS A;  5KNB A;  1B1Z A;  2EY6 A;  2XIW A;  1D6E C;  4ID6 A;  5IGG A;  2F0F A;  2R3Z A;  3FMC A;  3A54 A;  2V4D A;  4RFB A;  1OXV A;  4IFD G;  1C8C A;  3SEB A;  1LO5 D;  3J7A V;  1V43 A;  4ZAI A;  2AUJ D;  4OIK A;  2EOT A;  2PZW A;  2M00 A;  2R7Z B;  1EEI D;  1GXD C;  3KBG A;  5C3E B;  1STH A;  1A2T A;  2FMM A;  3D6C A;  1VCI A;  2B2T A;  5EBC A;  1I6V C;  4A3K B;  5M3M B;  2B2W C;  3UI2 A;  2A73 B;  3CRK C;  3VR3 A;  3MFG A;  5KGU A;  2NVQ B;  1HFG A;  4R8N A;  4KKU A;  2SNS A;  1YNJ C;  2F0S A;  4DAY A;  1HA6 A;  3S1R B;  1GUW A;  3CRL C;  5T1I A;  1DJR D;  3LWU A;  1A15 A;  3Q23 A;  1S5F D;  5IOD A;  3I4N B;  4OIJ A;  3GV3 A;  4F87 A;  2Q8R E;  1GHK A;  2Z4I A;  3J7Y W;  1G2S A;  1WTX A;  1AW7 A;  2SNM A;  5I9O A;  3MXP A;  2F0V A;  3L7Z C;  1EY6 A;  1KNE A;  1X32 A;  1JWM D;  4LAA A;  4RKL A;  4OO1 H;  3A7A B;  1WTQ A;  2OF1 A;  1SYC A;  1HQM C;  4RGT A;  1FNU A;  3VR4 A;  4FF1 A;  4CBV A;  5CV8 A;  1QIL A;  1Q8I A;  3NBI A;  2D5D A;  2L9H A;  1H9J A;  2DY8 A;  3A8K E;  4K6D A;  1CT1 D;  4BY7 B;  1Y8O B;  4G4K A;  2WAQ B;  4P2C B;  3GTM B;  2PZT A;  3BZD B;  2XRQ D;  5D14 A;  1QWY A;  3L9A X;  3EVQ A;  1QNK A;  2H1E A;  4KKT A;  5C5M A;  1OXX K;  4HN7 A;  3DXJ C;  4XQQ A;  4C56 C;  3DWP A;  2Z1C A;  2BOS A;  5EKK A;  1CI3 M;  5ISR A;  3KLS X;  4KD4 A;  4RGM A;  3S14 B;  1KTK A;  2G9H D;  3QOL A;  4B9X A;  1I4X A;  5ELF A;  1TWF B;  2F0W A;  1EEF D;  4FF3 A;  2L4N A;  3EQL C;  4Z9C B;  2B39 A;  4ZK9 B;  1SXT A;  2KCN A;  2HQE A;  3SK6 A;  1BXT A;  1GUT A;  1QB5 D;  4ZLT F;  3G6J B;  2NTT A;  3TP6 A;  4NDX A;  4OO1 I;  2Q8I B;  2B8F A;  4KK7 A;  1NR4 A;  3R2I A;  1IW7 D;  3J80 E;  2HDL A;  2F0L A;  3I3C A;  4ZUJ A;  2MGS A;  2QKI C;  3DWA A;  2LKV A;  1J8I A;  1ILQ A;  1PXU A;  5CC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...