3T19A

Crystal structure of hiv-1 reverse transcriptase (wild type) in complex with inhibitor m05
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse Transcriptase
publication title Design and synthesis of conformationally constrained inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
total genus 155
structure length 554
sequence length 558
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3t19A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t19A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t19A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t19A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3t19A05
2YNGB 1S0OA 1FK9A 2IM2A 4ECUA 4PUOA 5F8LA 4JV1A 2CJQA 3QIPA 1UAXA 4ECSA 2D0AA 1T7PA 4GC7A 3AO1A 3PR5B 4W5TA 3DDKA 4FJGA 4KRFA 1BCOA 1T05A 5EDWA 3I5AA 4DF4A 4G1QB 4Y2AA 4IR1A 3OYEA 1DTQB 4K4XA 2ZQBA 4B9TA 2HAIA 3KK1B 1ASWA 1HYSA 2WONA 1IKVB 4CFDA 1REVA 1LAVA 4RW4A 5T7BA 4CFBA 5F9LA 2HB5A 4CJSA 1B9FA 5KFSA 2YNHA 4IFYA 4FJLA 1HMVA 3KOAA 3NBPA 5J1EB 4CEFA 4TY9A 3V9WA 2XY8A 3ZT1A 4NLGA 3ZSVA 2R8HA 1QS4A 2FVSA 4AHRA 4JRQA 2IAJA 4QPXA 2QK9A 3MR3A 1TAUA 3MR2A 3OL9A 4ZHRA 2GC8A 3DYAB 4FJMA 2YNIB 1FKOB 3ZSWA 5DLGA 3V6KA 4WE1A 4E1MA 3KLHA 3PW7A 1JLCB 4TSXA 4F2SA 4ZVFA 3GIKA 2AGQA 1IG9A 4DSKA 2AX1A 5J2QA 4FZYA 3LP1A 4KTQA 1NHUA 4RNNA 1LW0B 5CZ1A 1QUVA 3CIZA 1ITGA 4KE5A 2JLEA 3OSNA 4DQSA 3SCXA 4Z4IA 1Q9YA 3QLHA 4LH4A 4N56A 5KT3A 3PX6A 4Z4CA 4PQUA 4C8KA 3RBEA 1K6YA 5DGAA 1WNSA 1HQUB 1JLFA 1VK0A 3BR9A 5J2NA 2OPRA 5DG8A 5DGBA 3NGYA 1C0UB 3PO4A 2DTUA 4IRKA 3DOLA 2W7PA 4WZQA 4ED0A 4J9SA 3NH2A 3VQPA 1RA6A 1RT4B 1BQNB 3DLHA 4HUEA 2YKNA 2FLPA 4CEEA 3HVTB 1BGXT 2EX3A 3RB6A 4OKJA 3L2RA 2JGUA 3SUQA 4WXWA 5DQHA 4BDYA 1WSHA 3PX4A 2XC9A 2JC1A 5KG3A 2WOMB 2Z1JA 4MK7A 4GC6A 3WNHA 4EYIB 1RTDB 4F4XA 2UVUA 1QE1A 4CJ5A 4Q5VA 4W5OA 1NK5A 2E9RX 4OGEA 3UR0A 4KHMA 3K2PA 3QEVA 1TGOA 1TKZA 5KFKA 1HPZA 3AA2A 1HRHA 4ED7A 3O4NA 3LP3A 5J2MB 5D3GA 1S9GA 4KHNA 3EZ5A 4DS4A 4FJIA 1WN7A 2YNFA 4DWIA 1N6QB 4CJVA 2IBKA 2FC0A 1U04A 1S97A 4LSLA 3ZT0A 2HHVA 3NAEA 3G6YA 3MECB 3T1AA 3ZSXA 1BI4A 4U6PA 1LWCB 5DQIA 3QEWA 5DQGA 1RT2A 3ZT4A 4ELTA 4IKAA 4F4YA 4NLRA 3K58A 3H59A 4IDKB 3KLIA 3H5UA 5KT7A 2X78A 3DMJB 4JV2A 4IFVA 3I0RB 2FBVA 3I0SA 4PWDA 3DRPA 1VSLA 1WAFA 4EBEA 2P1JA 2R8JA 3V9UA 1NK4A 1EKEA 3WNEA 1S1UB 4OPKA 1WSIA 3UIQA 3ISND 1LW2A 4O44A 3SQ1A 5DK5A 3U3YA 4EYHB 2IMWP 1D1UA 1HQEB 3HJFA 1RT6B 3FSIA 4ECRA 1RDBA 1HYZA 3HPOA 3E01A 3C6TB 5HP1A 3AO4A 3PO5A 4ZMMA 1CXUA 4FYDA 1RT7B 4DFJA 4Q0BB 1VSKA 3I5CA 4URQU 4CHOA 3IRXB 4IG3B 4TYAA 3AVBA 5KT5A 1RILA 4FJ7A 4DQPA 1SH0A 1U45A 2ZE2B 4FM2A 1IKXA 4EEYA 2R2SA 4RU9A 4CJQA 2FJWA 4YR3A 1R0AA 3KHHA 3QIPB 3QO9B 1QAJA 3VA3A 2P5GA 1FKPA 4OVLA 2O5DA 3ITHB 2VWJA 5EWGA 3M9MB 2XGQA 2D0BA 4ED8A 3T5LA 4CIFA 4MFBB 3RB0A 2XY5A 5KT4A 3EY1A 3T3FA 4K4SA 1NOZA 4NLDA 3QGGA 3H5XA 3OYHA 1RT1A 3PJWA 3G86A 1IH7A 2F96A 5C25B 2OPPA 4FLUA 3JYTB 3LPUA 5KRSA 3LP2A 2IM0A 3PVXA 3AV9A 4IG0A 3KHRA 4NYZA 1Y97A 2ZD1A 4BE2A 4CHZA 2R2UA 2YNGA 5KGXA 5I42B 3CDEA 4FS2A 3DLEA 3H5SA 2OYQA 4ICLA 4B9SA 4CGGA 3PW2A 1I39A 3VQ4A 3I8DA 4J9KA 5DMRA 3GV5B 2JC0A 2XI2A 1EXQA 3KLHB 3CWJA 3AVCA 4G1QA 2WRMA 3NMAA 4RZRA 3EYZA 4IH5A 4K4ZA 1DTQA 1TKTB 3CDUA 1HYVA 3KK1A 4AHTA 4DL7A 1IKVA 4LD0A 4QW9A 4E7HA 4DU4A 3IAYA 1U09A 1VSEA 3SUNA 4ED6A 1Z4UA 3NCIA 1RT3B 4NZ0A 2OPQB 3OSPA 4I7FB 2UUWA 5J1EA 3M8RA 1SH2A 4LSNB 5F8IA 3TABA 4URSA 2X74A 1XC9A 3LAMA 4ELUA 3SFUA 4LQ3A 1ZYQA 2DFEA 2QKBA 1UWBB 5HRNA 3DYAA 3L2UA 4O3QA 1IKYB 3D28A 2YNIA 2D3UA 2G8FA 1FKOA 1TL1A 4F4WA 3V1RA 4TY8B 5L1IA 4KREA 1JLCA 4O4RA 1A5VA 1TL3A 1LW0A 5KGWA 1ZTTA 5KFQA 3O3FA 4FJ9A 1T3NA 3O4QA 1G15A 3GIJA 1CLQA 4CECA 3PR4A 4KHWA 2XY6A 4CJUA 1YVUA 3V9XA 2GIQA 4CE9A 4OPJA 1YVFA 1I3AA 4NLUA 2HNYB 1JL2A 4W5RA 5KFEA 1IO2A 3GIMA 3KMSA 3ZSZA 1C0UA 4EP5A 3T19A 2UVWA 1BL3A 2BQRA 1BISA 4OLAA 4CEQA 4ED2A 1LAWA 5L1LA 1N48A 2ASLA 1RT4A 1BQNA 3CYMA 3HVTA 1QQCA 4DQRA 3LANA 3KLIB 3D0PA 3SPZA 5K14B 1U47A 3H98A 4ED1A 3B6OA 1X9SA 1RBTA 4MK9A 2WOMA 4KFBB 3L3VA 4M41A 2G8WA 1C6VA 1RTDA 4ID5A 3LP0B 5FRNA 3OL8A 2EC0A 4QCLA 2B43A 4MIBA 3MF5A 3OHBA 4RNHA 3GV8B 2R8IA 3KD1E 2JEIA 5J2MA 1BIZA 4CHNA 5I3UB 1N6QA 4CK2A 3H08A 4LY7A 4CGDA 5KFWA 3MXMA 2AX0A 3KK2B 2D0CA 4MKAA 3SUPA 3S3MA 3BSAA 1C1CB 4Q45A 3QZ7A 1TV6B 1LWCA 3C6UB 1NKBA 4FLZA 1TKDA 3HVWA 3SFGA 4IDKA 1K1QA 4FBUA 1S1TB 5EUHA 3QETA 3SPYA 3I0RA 2J6UA 3MEEB 3IS9A 3AVKA 1J54A 5HLFB 3MFHA 2XO7A 2W42A 4E1NA 3TR8A 4FLTA 3P5JA 4CEAA 3WNGA 1S1UA 3VQ9A 3DI6B 3HK2A 3JSMB 4DL3A 5FRMA 3QESA 1HQEA 3HHKA 2XY7A 1RT6A 1S5JA 1RTJB 4KKOB 4GMJB 4CFAA 1RNHA 4XPEA 3FQLA 1BIUA 3C6TA 4NCAA 4TQRA 3VA0A 3Q8RB 4J9RA 1NKCA 1NK8A 3ISNC 3TANA 5KG0A 4CHPA 3AVIA 4RW7B 1RT7A 4Q0BA 1BCMA 3KKSA 2OPPB 1TAQA 3HPHA 3IRXA 3LP2B 4IG3A 2G8HA 2OZMA 1VSFA 4IG0B 1Q8IA 3OHAA 4IOBA 2E9TA 1RAJA 4J2DA 4N5SA 1RTHB 4CEZA 2ZE2A 4M94A 2XHBA 4ZP6A 4MIAA 1T03B 4J9QA 2O4GA 3VQAA 3DLEB 4AHCA 1GOAA 4ICLB 3QO9A 2E9ZA 1ZETA 3QNOA 5L1JA 4Z0UA 3ITHA 3M8PB 4KPYA 3LZIA 3DLGA 4MFBA 2WHOA 2HWIA 4NLPA 3VQEA 4ZP8A 3RRHA 4ZVGA 3HYFA 3N6LA 1U4BA 4NLQA 5C25A 3AVMA 3JYTA 3K5LA 2GIRA 5HROB 4KI4A 2GBZA 4O0JA 2IOCA 5I42A 3KJVA 3PW5A 4F3OA 4CIEA 1NK0A 4DU1A 4FXDA 3TARA 2HW3A 1SKSA 5KRTA 1TL1B 3UQSA 2JEJA 2C22A 4PY5A 2VG5B 4DTNA 1ZBFA 2DFHA 2W9CA 4HUGA 1TKTA 5KFAA 4HVJA 1TL3B 4BACA 4FLXA 1VRTB 2YHBA 1UA1A 2VG7A 1D8YA 4YFUA 2BE2A 4ELVA 1CXQA 4CF0A 2ITGA 3K5NA 4NLSA 3OLBA 3DLKB 2VG6B 1OS5A 1RT3A 3AO2A 2OPQA 3AO3A 3B6PA 3HP9A 4K4WA 4I7FA 2R8KA 3OYNA 2W7OA 2D3ZA 2BQ3A 2FVCA 1SV5A 3LDSA 4LSNA 1ZBIA 1NK7A 3V4IB 2R7YA 4E0DA 4U7CA 1UWBA 2FJXA 2X6NA 4L8RB 1IKYA 2HVIA 3Q8QB 1J9AA 5KI6A 4I2QB 3KK3A 2DFFA 4E7JA 4TY8A 3VQQA 4CF9A 2ASJA 1TVRB 3EPGA 3QGHA 2BANA 4K4VA 2W8LA 2ILZA 2BRKA 4WFXA 3AA5X 1U48A 3CQ8A 1ZTWA 4ID5B 4FJJA 3ZSOA 4Y34A 1XR5A 4J9OA 3RTVA 2I5JB 1QTMA 4DQQA 1WAJA 2HNYA 3G10A 2Q3SA 1W0HA 2B5JB 2G8IA 3RR8A 4DLGA 4CK1A 4NLTA 3RB4A 2A1RA 1HNVB 3L2QA 5KFNA 2R8GA 1S9FA 4HCBA 3MEGB 4X2BA 2X6SA 3S3OA 3SI6A 4YR2A 5KG4A 3FRZA 5K14A 3PJXA 3KHGA 3BDPA 1JIHA 2QXFA 1RT5B 4DS5A 3RB3A 3IS9B 4KFBA 4F4ZA 5SZTA 1SL0A 4NYFA 4ED3A 4M45A 3LP0A 2PZSA 3OVNA 2FJVA 3PV8A 2ASDA 2V4QA 3RMAA 4MK8A 4I9LA 5KFPA 4KSEB 2KZMA 2F8EX 3OYDA 4ZTFA 3PZPA 3LZJA 2FLNA 5I3UA 4DTXA 3IN5A 3VQBA 4DTMA 2Z1IA 4NLWA 1TP7A 4CCHA 3A2FA 1S9EB 4RNFA 2HHTA 3T5JA 2QV6A 3KK2A 2AWZA 2VWKA 2WCXA 2HHWA 1J5OA 1C1CA 1KVCA 1TV6A 1IKWB 3C6UA 4DSJA 2FVPA 3VQ6A 1QAIA 4DQIA 2OZSA 2RPIA 3BGRB 4KHSA 4M42A 3HL8A 3KHLA 1S1TA 2UUTA 4AH9A 4ECYA 4IKFA 3MEEA 3L8BA 4DTRA 5F8MA 3SJJA 5HLFA 4DEZA 1D0EA 1CZ9A 3E51A 5L1KA 3S3NA 2O4IA 4FW2A 3HPGA 3DI6A 1D9FA 2QE5A 1ZBLA 2FBYA 3JSMA 4JS4A 2YHAA 3BQ2A 1K1SA 1S49A 2EHGA 4TQSA 4R5PB 3DRRB 1RTJA 4KKOA 3DLGB 2R2RA 1A5XA 2JEGA 2KQ2A 1TK8A 2C2RA 2OA8A 2FLLA 1JLEB 4HCCA 4DF8A 3CFPA 3TQ1A 2IJFA 5KFRA 3EZUA 4H8KA 3AVGA 4RW7A 5KTQA 4N41A 3F73A 1VSMA 1VSDA 4F4KA 1VRUA 2ETJA 4KHQA 3SQ4A 2HHSA 3K5MA 2Y1IA 3MFIA 4QWAA 3RBDA 4RW8B 4OKKA 4HUFA 5KG1A 1SL2A 4CK3A 3IGVA 1RTHA 1JXEA 2OH2A 3HO1A 2B6AB 1S1WB 1T03A 3H40A 3KJVB 3D5MA 3MR6A 4DTSA 3C95A 2C28A 1J53A 3KLGA 4FZZA 3H4BA 4B9VA 5KFZA 3M8PA 4FK0A 2PY5A 3ZSQA 4E7LA 3T5HA 1ZBUA 3ZSRA 3L2VA 4C8LA 2W9CB 2FBTA 1I6JA 4J9LA 4O55A 4ZTJA 4IBNA 4C8MA 3LWLA 4GW6A 1JX4A 2E6LA 1U49A 3K5OA 2VG7B 1MU2B 2YKMB 1S48A 2BE2B 2IS3A 3C94A 5KFOA 4ZPCA 3HVAA 1RBSA 5HRPA 2JEFA 4H4OB 3OS0A 4MQ3A 5HROA 4AILC 4CGIA 3U6FA 2UVRA 3OYFA 4CF2A 3U3GA 1SV5B 1L3VA 3V6HA 3O3HA 3CJ0A 3CO9A 4ECQA 2Y1JA 4CJ3A 3D45A 3NF6A 2KW4A 3HM9A 3K59A 2YV0X 3KK3B 1KHVA 1DLOB 4HHTA 2VG5A 1RBUA 4AHSA 2BANB 4OKEA 3OL6A 3PUFA 1VRTA 4M95A 3TAMB 4R0EA 1TKXB 3MXJA 3SQ0A 1HNIB 4NCGB 1ASUA 4MKBA 3DLKA 2VG6A 3ALYA 4TYBA 1JLQB 3H5YA 4CERA 4M3RA 4CJPA 3TAFA 3CJ2A 1EP4B 4JUZA 1A5WA 2G8VA 1EETB 1C1AA 2IGIA 2XGPA 1XR7A 2WK4A 3V4IA 4YNQA 1NJXA 4KB0A 3M9OB 1BQMB 3AVHA 3UPFA 4I2QA 4BWMA 1NKEA 3MXIA 4J2AA 4ZPAA 3K57A 1TVRA 2W8KA 3VQCA 4M3WA 3CM6A 4RW9B 3Q8PB 1KFDA 1SKRA 3M8QB 3SI8A 4J9PA 2WB4A 4K4YA 1TK5A 3ZSYA 1X9MA 3FFIB 1LWFB 4QWEA 3N6MA 3KTQA 3OYAA 4FS1A 1XWLA 3PX0A 3DLRA 3OYLA 4KBIA 2I5JA 3NF9A 4KTWA 1DTTB 1GX5A 3V9ZA 3GYNA 4KB7A 3BJYA 2V4RA 4IRCA 4F50A 4KO0A 2B5JA 5KG5A 1RDDA 4CIGA 3V1OA 3NE6A 4J9MA 2BGGA 1WSJA 4DSIA 2AU0A 1JLGB 1S6PB 3TWHA 3F9KA 5C42B 5DG9A 1J5OB 3CJ4A 2R2TA 1HNVA 2FVQA 4N47A 3O3GA 3L2WA 1S10A 3RMBA 3SQ2A 2IC3B 1W25A 4KAZA 3MEGA 4FCYA 1N4LA 4FW1A 3DOKB 3S9HA 1RT5A 1JLBB 3BSCA 4O3SA 4KHRA 4DL2A 4EZ9A 5KFIA 5EU7A 1JL1A 3KKRA 1ASVA 4OLBA 3OY9A 5KFDA 1MMLA 4ZPDA 4FJNA 3VQDA 4NYNA 1KTQA 2VA3A 4M3TA 5F8HA 1S9EA 2HNZB 3IG1B 4N76A 4B3OB 4CESA 3SYZA 5KFHA 2P51A 2VA2A 3OYBA 4E3SA 4K4TA 1LV5A 3GIIA 4TLRA 1IKWA 2BRLA 4MH8A 2RKIB 3RAQA 1VRUB 2G8UA 1T8EA 4ECVA 3SV3A 4DSLA 5SWMA 4FLVA 3BGRA 1WSEA 3AA3A 4B9NA 5L9XA 4BDZA 1SH3A 4FJ8A 3V81B 3DRSB 4O0IA 1KVBA 1UA0A 5KFCA 1VSHA 3NHGA 4BDPA 4NRUA 3KLGB 3KLEB 4CF1A 4J9NA 3ZCMA 1NJWA 4R5PA 4QWCA 3DRRA 4CJEA 4WXOA 1UOCA 4B08A 1NJYA 3QNNA 4NLXA 1JLEA 5HBMB 3VQ7A 1SUQB 4KV8B 3NDKA 4QWDA 4M3UA 3KIOA 4I2PB 1O1WA 3HVRA 3ASMA 4LH5A 4RW8A 3G6VA 2ILYA 1SKWA 5KFLA 2KFNA 5KT2A 2B6AA 1S1WA 3DM2B 3QINA 2AQ4A 5E41A 5FROA 5CYMB 3DLBA 3VN5A 1QHTA 1S0NA 3NGZA 3CVKA 5FDLB 3UDLA 2XCPA 3WNFA 3FDSA 4EBDA 5CYQB 4DTUA 1XR6A 4EP4A 4CJWA 5KG2A 1JKHB 1L3SA 4O3PA 1KVAA 4FBTA 4IQXA 5J2PB 3TAEA 1MU2A 2YKMA 1RBRA 1RBVA 5C24B 5F9NA 3OL7A 4Z4GA 3V6DB 4BWJA 1WSFA 4H4OA 2W9BA 4C8NA 5KFVA 1W9HA 4G3IA 4CHQA 1WNEA 2W9AA 3GILA 2GUIA 4BE0A 3SNNA 4XO0A 4DL5A 4K8XA 4FM1A 4NLVA 1KLMB 2D41A 2GV9A 1T94A 4H4MB 4DL6A 2IDOA 4ZPBA 3KNAA 3G0ZA 1C2PA 3ULDA 4YP3A 5KFFA 3QERA 2UVVA 1DLOA 3ICLA 4URGA 3OS2A 1KCFA 4OL8A 1NK9A 3OYIA 1RYSA 4DL4A 5KT6A 3TAMA 2IM3A 3FQKA 5JXSA 2KZZA 2C2DA 1TKXA 4O4GB 3NH1A 2C2EA 1HJRA 2ATQA 4Q44A 3OYJA 1HNIA 4NCGA 2ALZA 4ZP7A 1JLQA 2IM1A 4DFKA 1Q9XA 3N6NA 3GQCA 3OYCA 4B9MA 5KFGA 4IR9A 4OJRA 1EP4A 5EWEA 3BQ0A 3H4DA 3PW0A 2DPJA 4ID1A 4B9UA 4KO0B 2XRIA 1EETA 1BHLA 2XI3A 3PY8A 4CJKA 4AHUA 3AVLA 4FLYA 4DG1B 2PYLA 4RW6A 1RYRA 4CEDA 2RF2B 3PW4A 3H2LA 3HSTB 1BQMA 1JLAB 3OYKA 3RAXA 2DPIA 4B9LA 1LWEB 4DTOA 1S1VA 4HKQA 3HKWA 1CSJA 1L3UA 1KFSA 4RW9A 1C1BB 5DG7A 1X1PA 3KLFB 4E89A 4IH6A 3M8SA 3M8QA 4NCBA 4CHYA 2HNDB 4F2RA 3EPIA 3FFIA 3CJ3A 3NKYA 1XI1A 2OPSB 1LWFA 1XHXA 4RUAA 1DTTA 4M3ZA 5KG6A 4CEBA 4KB1A 3P83D 4ZVHA 4QOZB 3MEDB 1C0MA 4XPCA 4ECXA 5JS1A 1S6QB 4R8UB 3AA4A 4K8ZA 2Z1GA 4E7IA 1JLGA 3V9SA 1NJZA 1S6PA 3GV7B 5C42A 1C0TB 5KFXA 3NH0A 3BSNA 3TAPA 2IC3A 4CGFA 4FJ5A 1F21A 4LQ9A 2LSNA 1N5YB 4F8RA 4KAIA 3OJSA 4Z4EA 4W5NA 3DOKA 1JLBA 4PA1A 4DMNA 1S1XB 3HP6A 3BREA 3M9NB 4O3RA 4TN2A 3OYMA 4XIUA 3RRGA 1RDAA 1RTIB 1B9DA 3TAGA 1KRPA 1ZBHA 3TAQA 2BQUA 4WYLA 2HMIB 1RDRA 4BE1A 3NF8A 4KTZA 1FK9B 4PUOB 2HNZA 3IG1A 4B3OA 2RDIA 4KI6A 3LWMA 4Y2CA 3AO5A 2E4LA 5KFTA 2RKIA 3SZ2A 4JV0A 3G6XA 2P5OA 1T05B 4HTUA 2AGPA 4GVMA 4WZMA 1IM4A 1QSYA 4ECTA 2FVRA 5DLFA 3NF7A 3CFRA 4WYWA 4B8AB 1L3TA 3V81A 1HYSB 3DRSA 3QEXA 2WONB 4CJ4A 4RG8A 2BDPA 4Z4FA 1REVB 1TQLA 2HHUA 4RW4B 2XWYA 2CKWA 3VQ8A 3PHEA 3KLEA 4J2EA 1WSGA 2YNHB 4IFYB 2DY4A 1HMVB 3NBPB 4YQWA 2V9WA 1S4FA 4M3YA 2HHQA 3RWUA 4K4UA 3NGDA 3ZT3A 1WLJA 4TXSA 5KFYA 2IAJB 3CM5A 4ZP9A 4RUCA 1X9WA 1QSLA 4ZHRB 5HBMA 4KHUA 4W5QA 1VSJA 1SUQA 1QSSA 4CGJA 4KV8A 4WE1B 4I2PA 4O5BA 2HHXA 2W9BB 4CFCA 2NUBA 4Z4HA 4FM0A 2XCAA 5J2QB 4FJHA 1RA7A 3LP1B 2KFZA 3DM2A 3MR5A 1VSIA 1KLNA 2HWHA 4RNOA 2IJNA 5CYMA 2FBXA 3QLHB 4Q8FA 1Z26A 5FDLA 4PQUB 4E7KA 3CJ5A 3THVA 2D5RA 4EO8A 5CYQA 4NRTA 1JLFB 3NFAA 1GOBA 3QYYA 4YMEA 5J2NB 2OPRB 4DTPA 1Z25A 1JKHA 3OS1A 3DOLB 4Y1DA 4M3XA 2A1SA 2G8KA 4FK2A 5J2PA 5C24A 4YR0A 4CJLA 3LAKA 4O3NA 1NNDA 2YKNB 2J6TA 4DLEA 3V6DA 3HT3A 3QGIA 3CG7A 2ZKUA 1NHVA 2RN2A 4CJRA 4OGCA 4Y1CA 3ZT2A 4FJKA 2J6SA 4CJFA 1GX6A 1L5UA 5HRSA 4EO6A 4F3TA 1KLMA 3BSOA 5JS2A 1QE1B 2KTQA 3I5BA 4H4MA 2HVHA 3OJUA 4RW6B 3CFOA 1N56A 1HARA 4CEOA 1TKZB 3AVJA 1HPZB 3VQSA 5T14A 3NGIA 5F8GA 3NAIA 5KFBA 3QZ8A 2E6MA 5D3GB 1HQUA 1S9GB 1S1VB 4ECZA 4DFMA 2YNFB 5F8JA 4I9QA 4FVMA 4FK4A 1YTUA 2D7SA 4FJXA 4JRPA 4LSLB 4DSEA 2B4JA 4O3OA 1YT3A 1BI4B 4O4GA 3VQ5A 1RT2B 5C5JA 2BR0A 3TVKA 3MAQA 2QKKA 3RMDA 2IA6A 4CF8A 4DU3A 4IFVB 3MTKA 3NAHA 2ATLA 3AVNA 1NOYA 3KMQA 3I0SB 4PWDB 1RCHA 3DRPB 4NLYA 3V6JA 4CGHA 2V0NA 3CDWA 5F8NA 4DG1A 4QWBA 1EX4A 1GOCA 3P1GA 2RF2A 1LW2B 4O44B 4IH7A 1D5AA 1JLAA 3QIOA 2AJQA 3TI0A 4HYKA 5HRRA 1LWEA 3T5KA 4ZVEA 3RMCA 3KLVA 5KFUA 3SV4A 2I1RA 4DTJA 3SUOA 1C1BA 4DFPA 4IRDA 3OLAA 3E01B 1RDCA 3KLFA 5HP1B 3OYGA 2HNDA 3MECA 4FLWA 4J2BA 1NK6A 4Y3CA 4WFZA 2OPSA 4EBCA 1JXLA 4QAGA 1KHWA 3L3UA 4KHYA 1KSPA 3Q8SB 3LALA 3QEPA 2F8TA 2WTFA 1S0MA 3DMJA 5CZ2A 1TK0A 3HXMA 3MEDA 3NL0A 1IKXB 1S6QA 4R8UA 4K50A 4WFYA 4RNMA 3RR7A 2F8SA 1R0AB 4E19A 5KG7A 3V1QA 3QIDA 1FKPB 1C0TA 2RDJA 5CY4A 3AVAA 2PYJA 1YTAA 4QW8A 4ECWA 1N5YA 5JUMA 5EWFA 3QEIA 4Q8EA 4NLOA 1JXBA 4JLHA 4EZ6A 4DSFA 4B8CA 2AGOA 1S1XA 4AHVA 3AVFA 1CZBA 4CJTA 4FZXC 4Q43A 1RT1B 5KFMA 1B92A 3KD5E 4UQGA 1RTIA 4H54A 3LPTA 1SL1A 1D9DA 2HMIA 5KFJA 3IGNA 2Z1HA 4C8OA 2ZD1B 4JS5A 1XHZA 1FXXA 3BQ1A
chains in the Genus database with same CATH superfamily
4CZGA 2F7VA 2YNGB 2IM2A 2Q1NA 3MOZA 4X4NA 3QIPA 2L9NA 2Q31A 1O51A 5GMKa 5BN9A 1N33J 4CM2A 2VBWA 1VQMS 4FJGA 3AOCA 5A8WA 3D1OA 3KZBA 4G1QB 1SQFA 2KHCA 4NZ7A 3GBTA 3OYEA 2ZQBA 5AJ3F 2HAIA 5A8RB 4GV3A 2FTRA 1R8PA 4FVCA 1FNOA 4N8OA 5LMNJ 1FXLA 1HLWA 1UL3A 2KT3A 2ASYA 1B9FA 1RAEB 2VF3A 2NUUG 1GXUA 4GVBA 1I94J 3NBPA 3KOAA 5J1EB 3J81U 4CEFA 4DR7J 1FDAA 4M5GA 4OV1A 2R8HA 1AT1B 3W5YA 1QS4A 2FVSA 2IAJA 3MCAB 1X4DA 2N4DA 3BPSP 3MM8B 5DZ6A 2GC8A 3QDKA 1SIWB 4FJMA 2YNIB 1PBUA 1FKOB 4E1MA 2I9SA 1JLCB 2XMKA 4TSXA 2ZM6K 4F2SA 4WCEL 1VQON 3J7ZO 1YRTA 4FZYA 4DJBA 2VBZA 4J8FA 4HHJA 3M2UA 3M2VA 5IT0A 3SCXA 4ENOA 4LH4A 2CWKA 2FJAB 4C8KA 3D66A 5DGAA 3SCIE 4I64A 2QJ3A 5J2NA 2HVDA 4DUZK 3NGYA 4JYAJ 1Y10A 2P6TA 2DTUA 1JMTA 3VEYA 3G87A 4ED0A 1F3VA 4J9SA 3M1VB 2N7CA 2VFSA 3LM9A 4W90B 3G71S 5LT5A 3EE9A 2D1KA 4BDYA 2IDEA 1WSHA 3PX4A 2O1PA 2NRHA 1RHRB 2JC1A 3A8IA 2Z1JA 3WNHA 3V4MA 4F4XA 4Q5VA 2J7WA 2VU5A 4OGEA 1NUEA 3UR0A 3A8KA 3K2PA 5MLCV 5GAGI 1GMUA 2EC2A 4WU3A 3LH2S 2DNMA 2HPUA 2HIQA 4HTJA 4IXCA 1UFWA 3MM7A 1S97A 1WF2A 2UZAA 5AXNA 3ZT0A 5IS2A 1WTFA 3M2RB 3MECB 2OHDA 2JNJA 1EQ0A 2BEFA 2V7YA 3R9LA 2HURA 2MYFA 2QL9B 3RYLA 2F40A 2CIMA 4IDKB 4IFEA 4DCPB 4ER8A 3DMJB 5AE2A 4BQZA 4FP9A 1DHMA 3DRPA 4BRCA 2RRNA 3OBYA 2R8JA 2J9CA 2COLA 2F65A 3UIQA 4HI1A 3SQ1A 1YJRA 3U3YA 2IMWP 2GQ2A 4BREA 1CLFA 1RT6B 3QT5A 3LDQA 3KUEA 2BX6A 3HPOA 3E01A 4OIXA 3C6TB 3PO5A 3DAWA 2LA6A 4ZMMA 1CXUA 2UU9F 3BZKA 2DITA 4R79A 4Q0BB 3I5CA 2E1ZA 3IP0A 2YWEA 1HKBA 3IRXB 3HX9A 3A5NC 1PJ6A 1JCEA 1EAYC 1TR0A 5IV3A 1SH0A 2JVRA 4FM2A 4CH7A 4K42A 4DV6J 4YR3A 5F3ZA 1ZH5A 2P9UA 4JI5J 2WC9A 2P5GA 1FKPA 4UY85 2O5DA 3ITHB 2ZBRA 2NXJA 2XGQA 2D0BA 4ED8A 3NNCA 2H5JB 3T5LA 3C6HA 4MFBB 2ZZTA 3ET6B 2PI5A 2NSBA 3EY1A 3EO3A 4NLDA 2DGVA 3QBWA 4M7XA 2D9OA 1RT1A 4LF7J 2DHAA 4QQBA 1IH7A 2F96A 4Q2LA 2OPPA 4X4OA 1IQZA 3LP2A 2IM0A 3AV9A 3CCZA 2P9SA 3CHWA 2XYGB 3UN3A 2ZD1A 4BE2A 2R2UA 5KGXA 4BQLA 3C15A 3MMCA 4BR5A 3O2IA 3GCXP 4WK3A 4B9SA 4DKWA 2GX9A 3C7NA 3PW2A 1BO5O 3IWXA 3GV5B 2KXFA 2FDNA 2EFPA 1KQKA 3AVCA 2P9KA 2QTDA 2Z0GA 2X1FA 2E1AA 1NH8A 3EJMA 3PLAA 1TKTB 4LJMA 2CPHA 3KK1A 4FKYA 4JI1J 3E2EA 4YN3B 3GIRA 1T3OA 3K0SA 2K1RB 3OW2R 5J1NA 3NCIA 3NCRA 4A2AA 4NZ0A 3OSPA 3EE3A 5FLXY 4KGVB 1P90A 5F8IA 1XC9A 4ELUA 2YCHA 3CD0A 2DFEA 4USJC 1UWBB 1VGYA 4KH0B 1OKJA 1BWVA 2PEBA 3V1RA 5L1IA 2G4BA 3BS9A 1RLDA 4O4RA 1A5VA 1B4SA 1U1NA 4AFFA 1RCXB 2OEMA 2R7TA 1NGJA 5KGWA 1ZTTA 4FJ9A 3Q89A 5AQKA 2A18A 1WSVA 1D09B 4G1PA 4F02A 1QVGM 4HLBA 2I6WA 1JL2A 3H2VE 4W5RA 4LBPA 3TZWA 3B78A 4PR6A 2M88A 1RWPB 4GVEA 2WZ1A 3W2VA 1BL3A 1PJ7A 3ENHA 3AAWB 3D0GE 2XO6A 1RT4A 5HMXA 4B1XB 4DQRA 1QQCA 3QNWB 5K14B 1ZAVA 1DQ8A 3B6OA 1ZAWA 4AM7A 3VTHA 2WOMA 3U9DA 3L3VA 4M41A 4FF3A 2G8WA 1C6VA 1RTDA 5BR8F 3LP0B 3OL8A 3DJCA 5JVHQ 1IBMF 3PFEA 2QWRA 1B7YB 4IJAA 2R8IA 2JEIA 4CNZA 1NMNA 5J2MA 2NUHA 3T69A 1YBTA 5AQPA 3H0PA 3BEGB 4ZCLA 3K89A 2AX0A 2D0CA 3EKSA 3QMQA 3MWPA 4LF6F 4KJIA 1YZ6A 2PIIA 1GLCG 5GMEA 1DARA 3QICA 1NKBA 1TKDA 3SFGA 2B9EA 2GHWA 3EWGA 3GLJA 2EFGA 4X62J 1VLOA 3LOUA 5EUHA 3I0RA 2CQHA 2ZJQQ 1GK8A 3Q8UA 1WDDA 1KAXA 4DV7F 4GKKJ 4NPOA 5A76A 1S1UA 3FK4A 3DI6B 2HSEB 1R0CB 3HK2A 3JSMB 3G8TA 4DL3A 1RAIB 5H9EJ 3CF5L 4EMDA 3CJRA 1EARA 2XY7A 4B3RF 1RTJB 1G6BA 1RNHA 2HF4A 1BIUA 3J7AP 4NCAA 4TQRA 4J9RA 1JWWA 1TL7A 5CA5A 3ISNC 4A48A 5KG0A 1BCMA 3ZC4A 3I82A 3KKSA 4IG3A 2G8HA 3QJLA 1VSFA 4YB7A 2HS3A 3LW5C 2F4FA 1FHTA 3OFFA 3TA1A 4J2DA 2ZITA 1IBLK 3VQAA 3DLEB 3WX8A 1SBRA 3A3PB 3G4SN 2NNWA 3NGSA 3QO9A 1ZETA 3GTYX 1DGKN 2IDLA 1N33K 5C12A 1NSKL 3M8PB 4IEEA 5IQQA 3QSYB 1VQ4N 3DLGA 2WHOA 3UE5A 5HI7A 5LMNK 1EX8A 3OFEA 3ILJA 4P75A 4C3MA 3M32A 1OY8A 1BA1A 1WBBA 1NPRA 1I94K 4OYIA 4DR7K 2MMYA 4O0JA 1UAWA 2KL8A 5K5MA 2OKQA 5I42A 3KJVA 4ILHA 1PGZA 4HDHA 2DRAA 3P5TL 5CZVA 4WKRA 5M1KA 4CQ1A 4FXDA 3NEKA 1WHXA 4PY5A 2VPYB 2BM1A 1NDPA 2VG5B 1ZBFA 2V8GA 2HFZA 1VAZA 1DY3A 5KFAA 4BACA 2RNEA 2YHBA 2VG7A 1YLXA 2ROGA 3CJKA 2GW8A 4ELVA 1CXQA 1VQ7S 3I96A 3DLKB 1RT3A 3EEQA 2OPQA 3CCRN 2EK1A 4I7FA 4K4WA 2R8KA 3OYNA 2D3ZA 2FVCA 4WBFA 2XLJA 4JYAK 2ZJRQ 4FPBA 1N5SA 2X6NA 4L8RB 1J9AA 2ZM6F 5KI6A 3Q8YA 1VHIA 2LKZA 1WBDA 3CC2S 3QGHA 1VC0A 5DM7L 2W8LA 4DI6A 2BRKA 3PKMA 1KDNA 4ID5B 5B7WA 4FJJA 1P1TA 3WC0A 3ZSOA 3HFKA 3RTVA 2VASA 4B02A 4DUZF 1WAJA 2HNYA 2ZOFA 2Q3SA 2P9GA 2L9WA 2RU9A 3RR8A 4RX6A 3UNYA 3VGMA 4DLGA 1Y3KA 2CJAA 4NLTA 3RB4A 3N28A 2K3KA 2RJZA 1HR0J 4USTA 5FIIA 4HCBA 3AJDA 4YR2A 3FRZA 3PJXA 3KHGA 2IRUA 4WYBA 4IQMA 4C0HA 4DS5A 2D0OA 3RB3A 3IS9B 2W01A 5SZTA 3R27A 3BBFA 4L3QA 3RG6A 1I51B 3R5DA 4B3MF 3OVNA 3VGTA 3TZYA 2W4DA 4M7YA 2YVSA 3GONA 5F1XA 1VCTA 3MCSA 4MK8A 3OV7A 2KZMA 5K8NA 3K9KA 2FLNA 5I3UA 3MD3A 1R8HA 5I9EB 3A3NB 2Z1IA 3MAHA 4NLWA 1FW6A 4CCHA 5M1QA 2XZTB 1S9EB 4RNFA 2DYAA 1JCGA 3WUHA 3T5JA 3ZX0A 3DLLQ 2VL1A 4A62A 1D4XA 3WQUA 4RPFA 3T1YJ 4DSJA 2FVPA 1HBMA 3AXMA 3PHTA 3EXYA 3GPAA 4KHSA 5A0YA 4M42A 4WPAA 3C14B 1ZM2A 2UUTA 2VGMA 4JI7J 4AH9A 2PBDA 2IPOB 3MEEA 2B8QA 4OYOA 4DV6K 5F8MA 1WG4A 1D0EA 4JI5K 2O4IA 3F0NA 4LREA 1RABB 1K0TA 1HKAA 5CCLA 1D9FA 3ZZZA 2FC9A 2MGZB 4BLGA 1RE1B 3J81Y 1T44A 2QW9A 2R2RA 2JEGA 4DPOA 3G96A 2JDJA 5DDOC 4Q2MA 2C2RA 2OA8A 2C2ZB 1JLEB 4HCCA 5GAGU 3BF1A 4LF7K 2HRYA 4A46A 1QUPA 1VSDA 2ETJA 3K5MA 2MQ8A 4QWAA 3MFIA 3DWLA 4RW8B 1JXVA 4EK2A 1RKJA 2CQCA 4P72A 3ONQA 4HUFA 1SL2A 1RTHA 5DDRC 4RU2A 2AEFA 2LVWA 3D5MA 3MR6A 2VONA 3C95A 1AXQA 2C28A 4NASA 1QAXA 1VQ6S 5IT9O 3FR0A 2CZ4A 2ZC3A 3THPA 3VAIA 4YDUC 1SB6A 2U2FA 2W9CB 4J9LA 3W0LA 4UOFA 5F0WA 1I3OB 4GW6A 4LFBJ 4JI1K 1U49A 3G25A 2YKMB 4QIEA 1FRIA 3HTVA 5HRPA 2JEFA 3M8YA 1AUSL 2AA4A 4TU9A 2UVRA 3OYFA 3N5BA 2RRAA 3PRVA 1G3OA 1YX2A 2QI2A 3F44A 2PAVA 3CJ0A 5BREA 3N01A 1VQMN 5M2PA 1S7IA 4DPUA 3PSIA 4ECQA 2Y1JA 3D45A 3NF6A 3ATVA 5KPTA 3KK3B 1KHVA 5CHIA 4HHTA 2K3IA 3T7ZA 1YJWS 3TJ8A 1VRTA 4M95A 5GAHP 4C98A 1TYQB 1AZSB 1NCLA 4R0EA 2Q0RA 2RVJA 2Y1LB 3SQ0A 1IJEB 2P9LB 4MKBA 4TYBA 2UUAJ 1Z6RA 3PACA 3H5YA 3TAFA 2ZJPQ 3I33A 2DNRA 1B70B 1EETB 3D3CJ 1C1AA 2IGIA 2XGPA 2KYXA 1NJXA 4KB0A 3M9OB 3JQMA 1NRKA 2BW2A 2CZ9A 4CH0S 4I2QA 2MJUA 2HFNA 2IVOA 3MXIA 2KKHA 1TVRA 1H1VA 3VQCA 1RHQB 4M3WA 3VWSA 2RU3A 2WUSA 3MPDA 5D15A 2F4VJ 1LWXA 3L4BC 4D3GA 3SDEB 3TEGA 1TK5A 2HF3A 3P96A 4K41A 4JOUA 1MWMA 4ZVRB 3OYAA 3PX0A 1V3RA 2VUGA 3AHPA 4KTWA 1GX5A 3WQTA 3BB5A 3BJYA 4P2XA 2ZBCA 1HI1A 3M7VA 3OTOJ 4CZJA 4YORA 3NE6A 4J9MA 2BGGA 4U96A 2FD2A 2LQJA 1S6PB 3G71N 3LL3A 2EFOA 3UN5A 1C0FA 2FVQA 1X4CA 3O3GA 1S10A 1FDBA 2KI2A 1Z1ZA 2FLOA 3MCPA 4KAZA 4X62K 4NI2B 2M8HA 2XMUA 1N4LA 4FW1A 4B1ZA 1U7LA 4F67A 4O3SA 1QDUB 4YOWA 1HI8A 2O8CA 5B0DA 4GKKK 1JL1A 4JKEA 3OY9A 2ZVIA 1YJ9S 5LY3A 5H9EK 4NA3A 2R4FA 3LGHA 1BC6A 4NYNA 4ZOSA 2VA3A 4M3TA 1VS3A 3BZCA 4CESA 2HVZA 3SYZA 1RDWX 2P51A 1WI6A 4K4TA 3GIIA 3QFPA 1HWJA 1VQLS 3BGRA 1AW0A 3AA3A 1FFSB 2HHHJ 3C0BA 3R2DJ 1OPIA 3DXBA 3TTDA 2BYCA 3JXUA 2AZ3A 4O0IA 2GHVC 1MWZA 4QS8A 1WELA 4RTFD 2E29A 4NWBA 3GMGA 2QMWA 2RILA 4YS2A 1NJWA 2ZGYA 3I9ZA 4DZDA 4F3QA 5HVFA 4L72B 1GXTA 4QWCA 1DFDA 3PFOA 1VLYA 3TYTA 2NPIA 1NJYA 2V2ZA 3QNNA 2WTUA 5HBMB 3D1HA 4PXDA 4KV8B 4PCQA 1DKGD 3HVRA 4FPAA 4LH5A 1IBLF 1KVKA 2EWSA 1XJWB 2KJVA 3WXKA 2R9LA 5KT2A 3DC2A 3BF4A 3DM2B 1N33F 4ANDA 2Y3YA 3MN5A 2QFIA 2J5AA 1WOQA 2X1GA 1QHTA 3CJTA 4M1KA 4EBDA 5CYQB 4DTUA 4JKFA 5LMNF 3H45C 4EP4A 1UVKA 1GMWD 4O3PA 1KVAA 4QR0A 3PYGA 4FBTA 1U2CA 3LGMA 3HRGA 2WSCC 4RBUA 5C24B 1I94F 2O01C 4OI4A 1VOMA 2CQ2A 2BVZA 4DR7F 2GVZA 1Q7YO 1RWMB 2W9BA 1FRXA 4G3IA 4CHQA 4FF2A 1FWLA 4XO0A 1N0UA 2DXDA 3CCES 2GV9A 4OYAA 4A5BA 3KNAA 3AD7C 1W2BR 3PJ9A 3ULDA 5KFFA 4CLKA 1CQNA 3OS2A 2ROPA 5GMDA 3M8ZA 1NK9A 3THXA 1CJTB 4FL9A 2QEXS 2IM3A 3FQKA 3CJCA 2KZZA 4O4GB 4O23A 2C2EA 2ATQA 3AD9C 4DUTA 3P4UB 2X3GA 4TVAB 3HHLA 4N77A 4JYAF 1Q9XA 3N6NA 3OYCA 5KFGA 5BPMA 1VJQA 3CC4S 1EP4A 5EWEA 4B9UA 2DPJA 3JAMO 4QU7A 2XI3A 3PY8A 2NRZA 4WKYA 4AHUA 4DG1B 3BGUA 2RF2B 1RAHB 3FSYA 3PW4A 1HR0K 1BQMA 2AP6A 4ZJQA 1JLAB 4YOYA 4FNIA 2DPIA 4B9LA 2E7WA 1LWEB 1S1VA 1L3UA 3D9BA 1HLUA 2Z2YB 4L76A 2MZJA 1K0VA 4CZMA 4NCBA 2HNDB 3RSEB 4F2RA 1SJ4P 3I31A 2E1PA 2DT9A 2E2PA 3MURP 1XI1A 3I87A 2OPSB 4CWBA 4MLHA 2DTJA 1GLFO 2R3VA 3H3NO 2YPYA 5IM0B 1DTTA 1Q86T 5KG6A 1P9YA 3P83D 3ENWA 4V19X 3MEDB 3AAPA 1S6QB 4R8UB 5F3TA 5CYJA 1YJ7A 1NEEA 4QU6A 1HHSA 4WWSA 1JLGA 1QHAA 3KG0A 3V9SA 1H72C 3T1YK 3NH0A 1N32J 3MMBA 4B3SJ 3EM1A 2JLGA 1N5YB 3HM8A 3CCLS 3OJSA 3WXLA 4JI7K 5TKWA 4W5NA 5E3RA 3DOKA 1JLBA 4DMNA 3HP6A 3JAMY 3M9NB 4TN2A 4CO3A 4BRQA 3TJAA 4XIUA 3GB0A 3TAGA 2BJDA 2ITMA 3TZZA 3KUGA 1XQSC 5LSOA 3HSJA 2B7BB 4PUOB 2DD8S 2HNZA 3IG1A 2YX7A 3FE1A 4YUDA 1REGX 3AO5A 2HVEA 5BPLA 2RKIA 3SZ2A 3O9TA 2P5OA 1T05B 2CPFA 1IM4A 2ZC4A 4DV6F 3CD6S 5DLFA 2BE7D 4JI5F 3HZEA 4WYWA 3V81A 3QEXA 4CLYA 4RLEA 5AQGA 4LT6A 1UZHA 2AYMA 1OPZA 1S6OA 4RW4B 3K0JA 1URRA 1X4EA 3PHEA 3DDNA 3KLEA 1BU6O 4OPHA 1HMVB 1F5AA 5BN8A 4PHTX 5AZIB 1MROB 4LF7F 4LFBK 1ELOA 4ZHRB 2DIUA 2EBGA 3H3OB 1UEUA 4MYUA 2H5IB 2V69A 4BRKA 4CGJA 1OMSA 3UE2A 4DL0C 3NVMA 1T9UA 4X4UA 3OR1A 1FNXH 4Z4HA 4FM0A 3RBXA 1KQSM 1O6XA 3ZTQA 2XCAA 5J2QB 3ZNUA 1MDUB 4CM0A 2HHPA 1VSIA 1KLNA 3O08A 2HWHA 2QXLA 4USVA 3W5XA 1N36J 3QLHB 4Q8FA 2D3OR 2KVIA 1MMDA 5FDLA 3SAGA 4E7KA 2JL9A 4NRTA 1JLFB 1H2TZ 1HBNB 2HZAA 4JI1F 3DXMA 4BHQA 2MZSA 3OS1A 3DOLB 4Y1DA 4LFAK 4M3XA 4FK2A 4U95A 1WHYA 4ID8A 2BUPA 2XTJP 1VHFA 3LAKA 1NNDA 2YKNB 2J6TA 3V6DA 3HT3A 2UUAK 1VC6A 3QBXA 1NAQA 2BJ7A 4OGCA 3GJRB 2J6SA 4ZLNA 4F3TA 3G82B 3BSOA 4H4MA 2HVHA 4I0WA 3OJUA 4OX8A 4M5IA 2M9KA 3R7BB 2V4JB 9RUBA 3VQSA 3AQOA 2IYGA 4X66J 3NAIA 2F9TA 1HQUA 1S9GB 2FJBB 5F8JA 2V2KA 3W64A 2F4VK 1VQ7N 4JI2J 4AE5A 4DSEA 1RAAB 2XMWA 1T9WA 4O3OA 1IBKF 1BI4B 5M2UA 1IQTA 3VQ5A 4C3KA 3MAQA 2QKKA 2UUCJ 4X4TA 2IA6A 2F7TA 2EFQA 3OTOK 3MTKA 3PTWA 2QWPA 3AVNA 3KMQA 5K8OA 1N5QA 3JS9A 3VGKA 2V0NA 1FXDA 3CDWA 3WZ0A 3ID8A 3P1GA 2CPEA 3CC2N 4IH7A 2FHJA 5JVHL 4CLWA 3GR1A 1ZXOA 2BUNA 1HKCA 4CLTA 3KLVA 3SV4A 4UUWA 3SUOA 3RZAA 1UJ5A 4IRDA 3OLAA 2Q3PA 4QZVB 1NZAA 2DO4A 1NK6A 1C4CA 5DRKA 4WFZA 4IO1A 2K8GA 1WKKA 1NHKL 2BKPA 3LALA 2CQ4A 4WU2A 3QEPA 2H4WB 1RISA 1S0MA 1HBOA 1TK0A 2XYHB 3HXMA 4HWIA 2W2MP 2XS5A 1IKXB 1J2VA 2ZJQL 4CO5A 4EHTA 1QQNA 1R0AB 4E19A 5AZJA 4JI3J 3TX0A 5AXKA 1UW4A 4X62F 4XEIA 1RWVB 2WBRA 4BRHA 3AVAA 4NLBA 4ECWA 1EWRA 5E84A 3QEIA 2HHHK 3T1HJ 4EZ6A 2AGOA 4GKKF 3ID6A 4CTAB 2XNQA 3LPYA 3UNGC 1BDGA 2W25A 3ETMA 1CZBA 3HZ6A 1ZAXA 4X84A 4UQGA 3W5ZA 2DK2A 4H54A 1D9DA 5A8KB 3SJHA 3ZZUA 1X0PA 1HNXJ 3EN9A 4P74A 1VFJA 3BQ1A 4ED4A 2VGNA 1S0OA 2OSRA 1FK9A 3RU0A 4CZFA 5F8LA 4JV1A 2CJQA 4PXEA 1UVMA 2RQ4A 1V4TA 4UQTA 2ZH6A 4GO7X 4MIWA 4W5TA 3DDKA 4EUVA 2GMLA 1BCOA 4F7VA 3I5AA 2NRVA 3GG0A 2GS8A 1FWKA 4FXVA 1DTQB 3MN7A 4K4XA 2NRRA 1CG2A 4KR0B 1VQNN 4CFDA 1LAVA 1ZS6A 1Y5LB 1CJVB 3CJBA 3RVCA 5F9LA 2OCEA 4CJSA 4HH1A 3UVJA 4LF9J 2QA4G 4FJLA 1AFJA 4MJKA 4TY9A 1T9VA 4CZIA 2DXFA 3ZSVA 2DJWA 3F5TA 4QPXA 5AQYA 1EJ7L 3ZTRA 3N4PA 4DR2J 1WG1A 3Q2SC 2KKZA 3O8MA 2V63A 3KLHA 4QOTA 1IG9A 2AX1A 4RNNA 1VQ6N 1LW0B 5CZ1A 3CIZA 1ITGA 4LF4J 3NS5A 2G13A 4Z4IA 1Q9YA 4BVPA 2RDDA 4N56A 5GADI 2ATCB 1TUYA 4Z4CA 4PQUA 1VBZA 3RBEA 1K6YA 1D3WA 3UKUB 3PDNA 2LEBA 2GVDA 1VK0A 1NGEA 3BR9A 2OPRA 2IHR1 4QIWD 5DGBA 4X4QA 2CJ9A 4ZN3A 4IRKA 5CQGA 1WD6A 2ZJRL 1BQNB 2EX3A 3RB6A 4OKJA 3UD4P 3L2RA 2RMLA 1KC8T 2DH8A 4L3NA 4OX6A 2MKJA 5JVGL 2XC9A 2A1BA 1LKZA 4NA2A 2ZNZA 4R0JA 4GC6A 4EYIB 1Y9OA 4CJ5A 1QE1A 5LXYA 1NK5A 1KAZA 1RWKB 4KHMA 1TGOA 2G1DA 1HPZA 1HRHA 3O4NA 1YJWN 3LP3A 4KHNA 3EZ5A 4FJIA 4X4SA 3MMAA 4DWIA 4CJVA 3DOMB 3H46O 2FC0A 5D0EA 1FTRA 2HHVA 3T1AA 3ZSXA 2J76E 3OTBA 1RT2A 1NDKA 5A6WA 4F4YA 4KIAA 3H59A 1F5CA 4NLCA 4WK1A 2X78A 4JV2A 4IFVA 2ZWHA 2E44A 2M2BA 1OY6A 2YTCA 4PWDA 3BP8A 3P6YC 1VSLA 4EBEA 1HR0F 1EKEA 1IR0A 2KYZA 1WSIA 3ISND 2QFJA 1N32K 4CYUB 4B3SK 1TTHB 3B6BA 4BRDA 4W92B 3EXCX 4CIOA 1RDBA 4JP8A 1U26A 4M5KA 4DB3A 1V9OA 5HP1A 3D7SB 5T7LB 2JLFA 4GO5X 3C6AA 1U6ZA 3I4PA 1RT7B 4FJ7A 4DQPA 1P8ZA 2ZE2B 1HFEL 1FDNA 1SS6A 2R2SA 4CJQA 3T1YF 1UW9A 3DU5A 3KHHA 3QIPB 4PAAA 1M90T 4OVLA 3EDRB 4QS7A 3OW2M 2CZVC 2V50A 4E98A 3L4QA 5EWGA 3M9MB 4JI7F 2FJDB 3SMSA 2LU1A 1VQ5N 3FEZA 4ZJLA 3WIVA 2Q43A 2MQNA 2DNOA 3T3FA 4K4SA 3LGNA 4FWMA 4CZCA 3QGGA 3TUPA 3CC7S 4I6WA 2QL5B 2FY1A 5HMZA 3HFZB 1FEHA 2RE1A 3IMQJ 3LPUA 5KRSA 2CG4A 3R8YA 4NYZA 1Y97A 1Y00A 1VR6A 2JZ5A 2YNGA 2CNOB 4HTLA 2OYQA 3TW0A 4ZKAA 2X1BA 4CGGA 3TJ9A 1VQLN 1I39A 1XQIA 3F56A 3FMBA 4F4AA 4NEYA 5DMRA 2RH3A 4AYBD 1X31C 2P6SA 2WFBA 3UDCA 1Q82T 4BRMA 1Z2ZA 2LA4A 2CFXA 4FOIA 4G1QA 3FRYA 1FJEB 4K4ZA 3CDUA 1HYVA 1GLEG 5A8RA 4KC5A 4QW9A 4DU4A 1B3TA 3L95X 3NWRA 1VSEA 3SUNA 1N36K 3HHLC 2CAJA 2HYIB 2BJ9A 2BJEA 4LRBA 1ZBSA 5ETTA 3NRBA 2UUWA 5J1EA 4ZLLA 4LFBF 1X4BA 2AP1A 3K17A 1YG0A 3MM8A 2QKBA 3L2UA 4O3QA 3QATA 5CHCB 3D28A 3AXKA 1O13A 4CZHA 1UFKA 2YNIA 1FKOA 1WDTA 4TY8B 1JLCA 2E88A 1I5OB 1FVQA 1IWAA 1NB7A 2DNHA 1X3NA 1BWEA 4L75A 3TOQA 1WC5A 3O3FA 3QMLA 3GIJA 2M5YA 4KHWA 2OLWA 4A8WA 4U7UD 2YHYA 1BWFO 1R8BA 4X66K 5LMUF 1PYOB 3GFZA 5C7PA 2AKWB 2P9IB 2DNQA 4JI2K 4LFAF 3KMSA 3ZSZA 2QLJB 3A5MC 2C2OB 3VALA 2BQRA 1BISA 1TMMA 2IIHA 2UUAF 3D68A 3M1VA 1XK8A 4PABA 2UUCK 1PC5A 3W3SA 3LANA 3SPZA 2FF3B 1U47A 3H98A 5M2RA 5G4DA 3TSPA 3K8VA 1X9SA 2MKSA 1J27A 1NMEB 3P4IA 4RNHA 4CI6A 2CNLB 2F4VF 2P9CA 2QEXN 1E6VB 4CK2A 1TUVA 4DPXA 3H08A 3VAFA 1GLBG 5KFWA 3VENA 4GRSA 3Q24A 1Q0NA 3M2RA 3KDOA 3S3MA 2Y1RI 1C1CB 3QZ7A 1TV6B 3BO2A 4YEAA 1JJHA 5A2QO 3CC4N 3HVWA 1R43A 4IDKA 3OTOF 1K1QA 4W4MA 2LXUA 1S1TB 4QR1A 4BC9A 1OO0B 3AVKA 4B3RJ 4JI8J 2W42A 4JI3K 4E1NA 4WTOB 2ADCA 1P9QC 3TWZA 1KONA 1VIXA 3P5JA 4FLTA 2J9DE 2MSSA 4CO2A 1FE0A 4UZCA 1ACMB 4C0OC 5FRMA 2ZWPA 3DHXA 1YRXA 1UETA 1VJWA 1RT6A 4H0PA 5I4MA 4CFAA 3W63A 1QY7A 4XPEA 3FQLA 3C6TA 1NGGA 3VA0A 3R1LA 2PSZA 1NK8A 4F0HA 4Q0BA 1C0GA 2OPPB 1TAQA 1NLKL 3IRXA 3LP2B 2OZMA 4DV1J 1HNXK 4LBIA 4IOBA 2YKAA 2FGCA 2PI4A 3EICA 4J9QA 5JMVA 3R5BA 3O9UA 3OD2A 4AHCA 5HVGA 3HOSA 3CCUS 2E9ZA 2NREA 2BOAA 3CJQA 3CCLN 2MJNA 3SBMA 3ITHA 4NXMJ 2HHHF 1RAGB 4WFAQ 4KPYA 1OH5A 4U8YA 2P9KB 4MFBA 2N3LA 3ET6A 1PKUA 2KVQE 2YPZA 4NLPA 2Z58B 3CDBA 3MOJB 4V19J 2YX6A 4PWWA 3R9PA 3N6LA 1PIEA 4NLQA 3BF3A 3ZZ0A 2HRTA 2BACA 4J5OA 4LF9K 4WF9Q 3K5LA 4K59A 3MUMP 3S8SA 2KRRA 3J7Z5 1XBWA 2C3MA 2QX0A 1F2HA 1NPKA 3PW5A 4DR2K 1AROP 1RHMB 4F3OA 2CQGA 4DU1A 3PYDA 4AUKA 3CD6N 1XTZA 3UQSA 2ACYA 3F41A 3O44A 5DM6Q 2CGLA 4DTNA 4K2XA 3TO8A 2DFHA 1K44A 2DGOA 1JQGA 1TKTA 4A2BA 4ZIWA 3M6GA 1UA1A 1D8YA 2IRXA 2BE2A 3L7PA 4LF4K 4KPCA 4ED5A 3K5NA 4NLSA 4ALZA 3OLBA 2IY5B 2K1RA 3UCUP 1OS5A 3AO2A 2MKYA 4UOCA 3B6PA 1PC4A 4H4KC 3HBTA 2C2MB 2IJRA 1SV5A 4DV2K 5F41A 1QQMA 1NM1A 1Q18A 4KBOA 1SJFA 4E0DA 3I6PA 2PFFB 2ALYB 1UWBA 2FJXA 2QLFB 2ASOA 2JX2A 3IR7B 4IYQA 4E7JA 3VQQA 2UYTA 3CCQS 3U1MA 2A3ZA 2GO8A 2O8EB 2A10A 5IC6B 2BANA 2MLYA 4K4VA 2ZBIA 2ABYA 4AM6A 4FF1A 3AA5X 3G8QA 1ZTWA 1BUPA 4F3MA 2CQ1A 4ES3A 3FBCA 2I5JB 2R7RA 5I3QA 2YWGA 2RQMA 3CMAS 4DQQA 2H4YB 1MNEA 3JQJA 5IOLA 4CK1A 2XMTA 2MHEA 2V9KA 1TFWA 3OQ2A 2A1RA 3C19A 2F9WA 3L2QA 2QT7A 2HG4A 5BPNA 2DRBA 4B1YB 2HEKA 4B3MJ 4IO8A 2AHOB 3S3OA 4BVOA 2VBXA 3SI6A 4P7TA 5K14A 3BDPA 1JIHA 2CQDA 4MO5A 2ZH4A 4OX7A 5E7OB 3TTFA 3NGKA 4NYFA 4LF8J 3LP0A 4PRFA 4WFBQ 4QYZK 5LSLA 5HL7Q 5GAEI 3RMAA 3JS6A 5KFPA 2F8EX 2WBNA 3OXLA 3I56S 5ETNA 2ZDPA 5HMWA 2YBVA 2AF6A 5IWAF 3C66A 3A2FA 4DV0J 1WORA 2HHTA 2J0WA 2VWKA 2HHWA 2JHEA 1ITPA 1WOOA 2X7IA 3VTIA 2ZOGA 3IWLA 1QAIA 3L09A 4H5VA 4RBTA 3CCSS 3NMUA 1QAYA 2KM8C 2AJ2A 5BR9A 2HRUA 5C10A 4ECYA 2CADA 4MDBA 3L8BA 4DTRA 3SJJA 2GAHC 1CZ9A 5L1KA 1N32F 2VJUA 3D3BJ 3O5TB 3UDEA 4B3SF 4PG6A 3DI6A 4M5DB 2C2KB 5E3QA 2FBYA 3JSMA 4JS4A 2JWLA 2W6LA 2YHAA 3BQ2A 2EHGA 4TQSA 2HIYA 2YKOA 3DRRB 2AIRB 1RTJA 3DLGB 1K8KB 4M5MA 2E66A 2VBYA 3QSIA 4HACB 3CFPA 1AYEA 2N3OA 2E8AA 2Q1LA 4N41A 3BEXA 1VSMA 1VRUA 2HHSA 2GTDA 2Y1IA 3VQTA 4I68A 4RL1A 4KGMA 4CK3A 3IGVA 3HO1A 2OH2A 2HZCA 2W24A 1S1WB 2HZVA 3H40A 3KJVB 2DGQA 4PYAA 2DNGA 5E26A 3UD5A 1E6YA 4B9VA 2ERRA 2NR0A 3M8PA 4FK0A 1UJ4A 2V52B 3SXLA 2B7CB 2MB0B 4C8LA 5M1FA 1G7CB 2FBTA 1I6JA 4ZTJA 4ISGA 1KOOA 2UXCJ 4IBNA 4P9SA 2Y8WA 5AQOA 2XM3A 2VG7B 1MU2B 2V7ZA 1S48A 4OZLA 4NX9A 3C94A 4KQZA 5B0EA 1GNKA 3L4IA 3OS0A 4MQ3A 1RK8A 4AILC 4CGIA 3U6FA 3CMQA 2GELA 4FN5A 5TKYA 5FPNA 2FHKA 3O3HA 3NP5A 5DDPC 3R1HA 4C97A 2E7VA 1AFIA 1MSWD 3NGRA 1T9TA 3K59A 3W2WB 2E5IA 2YV0X 1DLOB 2VG5A 3WHIA 1RBUA 3CEDA 4OKEA 3QT7A 4ANCA 3OL6A 1N36F 4JV5J 4JKDA 4ILJA 1TKXB 3ZZYA 3CT9A 1YWXA 2OUGA 4Y65A 2HBKA 1HNIB 3DLKA 3KWMA 3V2UC 5LOQA 4CJPA 4BC4A 1A5WA 2G8VA 4X65J 4C9DA 4OI6A 1FFWB 3EMTA 2MQOA 4L74A 4A8SA 1T6CA 1VYAA 4BWMA 3BKTA 1ZZNA 4ZPAA 2CQPA 2W8KA 1X8DA 3ENAA 1KQSR 3ZX3A 1FEEA 1SKRA 1N88A 3M8QB 1Q81T 1CS4B 3SAFA 3SI8A 3KXDA 4WQ4A 3FFIB 2XLIA 3J80O 4X66F 1LWFB 3N6MA 1UMJA 2DXEA 4FWPA 1BHNA 3DLRA 3M8WA 1AB8A 2ROEA 4JI2F 4L6V3 3V9ZA 3GYNA 4KB7A 2V4RA 5EHHA 5HJXA 4F50A 4KO0A 5KG5A 2CNNB 5E0OA 1RJJA 3V1OA 3O80A 4DSIA 1HBUB 1QZ6A 5AQVA 4C48A 5C42B 5DG9A 3FEYB 3CJ4A 2UUCF 3J7YP 3B82A 2YWHA 4CBWA 3L2WA 3VMFB 1IJFB 3SQ2A 3RMBA 1HBMB 3S1TA 2LQ5A 2EW9A 3O9RA 2OSQA 1SQKA 3IM9A 2WVFA 3D67A 4JN4A 3S9HA 2ACMA 3BSCA 2AJ0A 3Q22A 4B3RK 4YY3J 1OIAA 5KFIA 4JI8K 1FCAA 5EU7A 1BE4A 5DETA 1QM9A 2X51A 3JSRA 4XH5A 5FPEA 4JI6J 2J7UA 1CC8A 1ASVA 4BC3A 1JJ4A 5KFDA 4JKHA 4FVUA 3GJSB 4IZ9A 2AT1B 1Z2LA 4OYBA 1KTQA 1S9EA 1DEJA 2YH0A 1BY9A 2A0FB 3HHEA 5D6GA 3OYBA 4DV4J 2QMUB 3BYRA 4LRCA 2BRLA 1H7XA 3C2PA 5EOYA 4ECVA 4DV1K 2WSEC 5SWMA 5IC4B 3C14A 3VGSA 4B9NA 5L9XA 1SH3A 4BRIA 4JI3F 4KRWA 1VQYA 1FDDA 2G0JA 1KVBA 4PXCA 1U1QA 2QM1A 4Y6IA 5BYRA 5BRDA 2CUYA 2VICA 4OX9F 4LFCJ 1CQMA 4NRUA 4NXMK 1LQ9A 3KG4A 4J9NA 3MK6A 3ZCMA 1JCFA 3HD1A 2ZGZA 4OJGA 1X4FA 1IBLJ 1IV0A 1RKIA 3R7SB 2ZH5A 1JLEA 2F63A 2W6KA 1QVFR 1HL6A 1M5HA 1VQ8S 2FF6A 1URNA 2VC0A 1HNXF 1W2BM 4QWDA 4I2PB 5E5NA 1O1WA 3O6QA 3ASMA 4RW8A 1UTAA 4H0XB 2WW8A 2EXUA 4DDFA 2ZH2A 2KFNA 1RXOB 4UTGA 1NJIT 3QINA 2AQ4A 2QSWA 2P9PB 5FROA 3OUYB 3DLBA 3VN5A 1S77D 5L38A 2NLWA 2CPJA 2XCPA 3WNFA 3FDSA 1VQPS 1XR6A 1KP6A 3CC7N 1K8AT 4G1IA 1P6TA 2KN4A 2OEKA 5KG2A 5LJWA 1JKHB 1L3SA 4PL8A 4C1NK 2MLXA 5AQZA 3TAEA 4LF9F 2YKMA 1RBRA 2A5XA 2JRSA 3LDPA 1VISA 3P8BB 1T11A 2QSFA 5F9NA 3OL7A 4OZ5A 4C8NA 4CLZA 2EWHA 2W41A 4FDFA 4WQ5A 4BE0A 4DR2F 4DL5A 2DGWA 4NLVA 2IFXA 4QJVA 1A9NB 4DX5A 2BABA 4DL6A 3G0ZA 1HHTP 1YZ7A 4P7VA 1IXKA 2ADBA 3U8XA 4YDUA 4MAKA 4OL8A 3QWUA 4LF4F 2JOQA 3EZOA 3QQCD 1TYQA 4JHDB 1AZSA 3CD5A 3NH1A 1HJRA 3FC9A 4Q44A 3OYJA 4DUYK 3SAHA 3R1XA 2OP5A 2P9LA 1X0FA 1YITS 4ZP7A 1LFPA 4DV2F 4YOUA 1PYSB 2IA0A 4OJRA 3BQ0A 3ADAC 2XRIA 1EETA 4O0NA 1BHLA 2MKIA 1HNWJ 3P45B 3AVLA 4ANEA 1YXQA 1N52B 4FLYA 1NU4A 1RAOA 3UO0A 1Q8LA 4B3MK 4EI2A 3EGWB 1X5PA 3H20A 1Q16B 4DTOA 2ASPA 4HKQA 1PO6A 3HKWA 1CSJA 3EGVA 1KS2A 2QA2A 5KPRA 1PBAA 4E89A 5ELZA 4LF8K 3EPIA 3SDEA 3UR3C 1LCUA 3TPQA 3CJ3A 1TELA 1HNZJ 1GAOA 3PXGa 4RBVA 3GE9A 4KB1A 2R7QA 4USWA 3CPEA 2GMJA 1C0MA 2MQMA 5JS1A 3AA4A 4K8ZA 2DB1A 2D0PA 4DV0K 2P8IA 4E7IA 3NCPA 4XTTA 1S6PA 1G2EA 1L3KA 3PIOQ 3BSNA 2KT2A 1U1RA 4L3KA 1APSA 2APOA 3HMJG 3F2KA 1Q79A 3L7UA 3U1LA 4OHVA 3O8WA 1KC8O 4PA1A 4ZCIA 1VRQC 1KNZA 5F0XA 3VEZA 3BREA 3O1WA 2ZUAA 2VV5A 3ZZPA 4YOVA 1RDAA 3MM6B 1B9DA 1KRPA 3WQPA 1ZBHA 3TAQA 4WYLA 3UFCX 3MM9B 5C2FA 4KTZA 5GIPA 3T6BA 1RWWB 4KI6A 4KT0C 2E7XA 3QT8A 4Y2CA 2O67A 4K5RA 2LP4A 3Q8VA 5K9FA 2E4LA 5FLXO 5KFTA 2R7VA 3GDQA 5IQ6A 2XHWA 1NGFA 4JV0A 2Z4PA 2AGPA 3QRQA 3SQGB 4LF2A 4DOZA 5ETPA 1HYSB 3IFEA 2WONB 4CJ4A 1YTYA 2BDPA 1REVB 2MQQA 2HHUA 1F3FA 2XB2D 1YIJS 4J2EA 5ETVA 1WSGA 2YNHB 4IFYB 2J4RA 3VF0B 4OYWA 1F0XA 4NEZA 3I9V9 1S4FA 3G9CA 3RWUA 4K4UA 2OO4A 3NGDA 4JD2B 1Y0HA 4TXSA 1IM6A 1WLJA 2UXCK 5GAEU 1YDLA 1XC3A 4KH6A 4PQAA 5HBMA 3AQPA 3R3LA 2BH1A 4KV8A 4WE1B 3CCMS 4ES2A 2NQPA 2GVZB 2HHXA 2W9BB 2E2NA 5ADXA 3NGTA 3CCUN 2JWKA 3KHYA 4FJHA 3LP1B 2KFZA 3DM2A 2RUSA 1HWIA 1IR2A 4YDXA 2VKRA 4RNOA 2FBXA 4DX8H 4XH4A 2M0GB 1FRHA 3DLJA 3THVA 2D5RA 1M90O 4EO8A 5CYQA 2RE2A 1GOBA 3QYYA 2PMZD 4A4JA 4DTPA 3BKFA 4OZ3A 1Z25A 3Q7CA 3AOBA 4JV5K 3C8YA 2RD5C 1PG5B 1WC3A 1S72S 3D7EO 5M1OA 5C24A 1EIYB 1M5SA 4YR0A 4CJLA 3AOAA 4PG5A 2DR9A 4DLEA 2PA8D 1IVZA 3M6UA 1NHVA 4FJKA 2QYCA 3EDQB 4CJFA 2YHXA 4WP8A 2F9DA 4X65K 4DXLA 4F04B 2M52A 4ZVUB 2KTQA 1EZZB 2CPXA 3CTRA 4TKTA 1IBKJ 3CFOA 3BPDA 1RQ0A 4CEOA 1TKZB 5F8GA 5KFBA 5L9NA 5D3GB 4M5NA 1S1VB 2YNFB 4FVMA 4FF4A 4FK4A 1YTUA 2D7SA 2GJIA 4JRPA 4LSLB 1CJTA 1YT3A 1UWAA 4JI0J 3QFUA 4O4GA 4NYOA 5LM7E 2BR0A 2G0IA 3RMDA 3BGLA 3D6RA 3LDOA 4AXJA 2ATLA 3I0SB 3EVWA 1RCHA 4F0KA 4JI4F 2J0XA 1FFGB 3V6JA 2ZH8A 5CXTA 4DG1A 4FWRA 2RF2A 3MX2A 1LW2B 1LOUA 4O44B 2VKZG 3OTDA 1JLAA 3QIOA 2AJQA 3CJAA 4GMKA 1LWEA 2DH7A 4DR1K 3T5KA 4ZVEA 1S4EA 1T0TV 1J5EJ 5KFUA 4DTJA 3CNQP 3BKUA 4DFPA 1MG7A 3IM8A 2QRRA 4YY3K 2HSTA 1O0PA 2DNKA 2HNDA 2GV1A 3RSEA 4LBHA 4J2BA 4JI6K 1FNMA 2HBZB 1SC4B 2FSNA 2D9PA 2OPSA 1KHWA 2E1MC 3W1YC 4HR2A 5IM0A 3CF5Q 3GCWP 4WFNQ 4NXNJ 5CZ2A 3MEDA 3NL0A 1S6QA 4RKUC 4R8UA 1N8RO 2I7NA 4JK9A 4OZ2A 3ZO7A 4CW7B 4DV4K 2I2YA 1NM2A 4ZPTR 4QW8A 3PG9A 1N5YA 5EWFA 5B8HA 4HDGA 2AZ1A 4Q8EA 4JI8F 4IOXA 1XMBA 3H7HB 2GWJA 2KXHA 2IVMA 3TVYA 3CMES 4FXWA 4DSFA 4B8CA 4AQYJ 3BBCA 1M5OC 3LUYA 4Y0WA 1XERA 4A8KA 2QWQA 4LFCK 4CJTA 4FZXC 1T9YA 4K43A 1B92A 2JVOA 3KD5E 3K2YA 3QWPA 3LPTA 4Z2XA 2Z1HA 4JKGB 4B3TJ 4C8OA 1XHZA 2F5GA 1WC4A 2X3DA 1MWQA 4OZJA 4ECUA 4PUOA 4U7UK 3L0QA 4IEIA 2HLUA 4X4PA 4ECSA 4DV1F 4DR6K 2D0AA 2YQ1A 4GC7A 3PR5B 3HHLD 3A3OB 2PEHA 1T05A 4WFAL 2ZHBA 2IRYA 3OR1B 4CH1A 3LO3A 2DPNA 1RBAA 3WX4A 4B9TA 4GKJF 1ASWA 1RTZA 4DMZA 4NXMF 1IKVB 2P9NA 3ULEB 4RW4A 5CR4A 3FMWA 3ZNJ1 4M8LA 3L6QA 3O1LA 4CFBA 3DGVA 4DPTA 5KFSA 1BXNA 2HBMA 4WF9L 1HMVA 4P2SA 2XY8A 3ZT1A 5AZIA 1MROA 3JB9k 4JRQA 2BMBA 3R6LB 4CLUA 3MR3A 3DGPB 1TAUA 3I32A 3HZGA 1FJGJ 3MR2A 3VEOA 4ZHRA 1VQKS 3DYAB 2ZH9A 1ROFA 3Q86A 2QA4N 5DLGA 3IAS9 1FO1A 3GFYA 1G1XA 3PW7A 3BV8A 1KAYA 4FSVA 1NSPA 4ZVFA 5DM6L 2DEIA 5EXWA 4DSKA 5J2QA 3KNGA 4WQ4C 4KTQA 1NHUA 2CGKA 1QUVA 2JLEA 2YI1A 1FA0A 1NB2A 1Q7LB 2Z2LA 3QLHA 4MT1A 5KT3A 1M1GA 1F9HA 3ATUA 1WNSA 6FDRA 1HQUB 1JLFA 1PAUB 4M63C 5DG8A 1HBNA 1YSJA 3CUNA 1C0UB 3PO4A 4P2FA 4HTIA 3DOLA 2W7PA 3HI0A 4WZQA 5AE3A 3NH2A 3VQPA 1RA6A 2F9JA 2GGPB 2UXDF 2KB2A 3ILIA 4UF4A 2YKNA 2QLBB 1M5VC 3HVTB 2FLPA 4TU8A 2JGUA 5DQHA 1X3MA 1NBWA 3ENVA 3TR5A 1K47A 3FBEA 3MDFA 4FWNA 1UJ6A 3Q0AA 1HNWK 2UVUA 4W5OA 4PPZA 3CIPA 2NXCA 2NXNA 2V4JA 1RU1A 1RGIA 3QEVA 2NSCA 5KFKA 3AA2A 4ED7A 3WXMB 3OBWA 2W4PA 1S9GA 3CETA 1WN7A 2Z2MA 1N6QB 2WAQD 4EU0A 2IBKA 1U04A 1T6DA 2CVEA 2H65B 5C2DA 3NAEA 4DUYF 4IOAL 2XG8A 3NOGA 1BI4A 4U6PA 2NPFA 1HNZK 1LWCB 1OH7A 5DQGA 1SKUB 4NLRA 2G2YA 3UI3A 3B54A 3J81O 3KLIA 1U6FA 2GQCA 3H5UA 2BOPA 2FBVA 1CJKB 3CCVS 5GAGP 3CXCM 2O66A 1WAFA 1LFWA 4GV9A 2ZDOA 2P1JA 4UY8T 3V9UA 2C2NA 3CCJN 1WWHA 3WNEA 5HL7L 4EYHB 1HQEB 3HJFA 1WB9A 2B3TB 3FSIA 1UFLA 4ECRA 4LF8F 4CD3A 7FDRA 2F8HA 5H1SQ 4DR3J 1OYDA 5F2RA 2LQ8A 4F36A 3GJTB 4DFJA 3D2WA 3DRXA 1G99A 2QWOA 3CDAA 4URQU 3POTB 2U1AA 5ITHA 1YGYA 1Y3JA 4DV0F 5KT5A 3FNNA 1RILA 4CT9A 4ZJOA 2ZOMA 3WIUA 4XDDA 4BRFA 2VC1A 1GMVA 1IKXA 2OELA 2FJWA 1XN9A 1R0AA 2G2OA 1UPMB 3K8WA 2QIFA 1FD8A 5BYSA 4J7CA 2D74B 3FZ2A 1NMDA 3FBFA 1ATSA 1VHXA 3B4MA 3FZMA 1HW8A 3CO0P 2DR8A 4YB5A 4CIFA 1Y11A 1SC6A 1S22A 2XY5A 3A8JA 4CTAA 1NOZA 3VESA 5EGYA 4OMFG 3OYHA 2OFGX 1ESVA 1K73T 3V5RA 3PJWA 2L48A 3G86A 4FLUA 5C25B 4UOHA 3JYTB 2DNNA 1U1OA 2DGSA 3UVJB 3NGUA 5A8KA 4IG0A 3VZIA 2IMOA 4WQ5C 2DCLA 4CHZA 1GLAG 3VHQA 4JK7A 3CCRS 3H42A 4ICLA 2VZ9A 2XYPB 2Q97A 1VQSA 5F0UA 1DURA 2H51B 2LDIA 1U2VB 2BM0A 3VQ4A 3CJ1A 1VC5A 2PMWA 1S76D 2JC0A 2HQIA 2XI2A 1EXQA 3KLHB 4ZLPA 3EYZA 3VAHA 4IH5A 4DV3F 1FT8A 1DTQA 3CSKA 3E9OA 4H0OA 3D4JA 4AHTA 4LD0A 3AODA 1U09A 1CJVA 3FZKA 1EWQA 3HULA 1S59A 2FHJD 2XEXA 4UZBA 3EVOA 4KGXB 1OH6A 2IVNA 5FPDA 2QYGA 2UXCF 3M8RA 2HOEA 1SH2A 3PSFA 3KVGA 4NZ6A 3MEKA 1SPBP 3IC1A 4LSNB 1VQ8N 2RT3A 4URSA 2X74A 3LAMA 3SFUA 3PIPQ 4LQ3A 4CO1A 3RJMB 1WOSA 1MA9B 1IKYB 2DISA 3VAJA 2G8FA 2D3UA 4OHWA 4MKVA 1CVJA 1TL1A 3N79A 4ZIVA 4F4WA 2G2ZA 3IBFB 5AR0A 5LMUJ 2QA1A 3R5GA 1TL3A 1RU2A 4YB6A 3VEWA 1LW0A 5KFQA 2ZHOA 1KD1O 2HQ3A 4LFAJ 5LJ5Y 1T3NA 3O4QA 1G15A 3OR2B 4CECA 1VQPN 1F1BB 1IBKK 3MN6A 4CJUA 2YWKA 2UUBJ 5FD1A 2GIQA 4CE9A 2QG9B 4OPJA 1I3AA 4NLUA 3UKUA 4JV5F 2W2OP 5KFEA 3NCQA 1IO2A 5M1PA 3VVTA 1WF1A 4ZVTB 3KJQB 3GIMA 3B8AX 4EP5A 4OHZA 4JI0K 4OLAA 2Q36A 3ZYYX 4ED2A 1WI8A 2A42A 5AQWA 5L1LA 3MPWA 2AYGA 1BQNA 4HL9A 3LDLA 1U0HB 3D0PA 4X65F 2H3EB 2E20A 4ED1A 5D78A 4IWVA 4K25A 1RBTA 4MK9A 4KFBB 4ZN1A 3W66A 3ILOA 1WF0A 3PEHA 4JKBA 2EC0A 4QCLA 3VF2A 2B43A 4MIBA 4NB4A 4HH0A 1VMBA 3A13A 1J5EK 2DGUA 3RW7A 3VGVA 4CGDA 4S0MA 2IVYA 3MXMA 2PE8A 3KK2B 1V5IB 4MKAA 2XSJB 2JJ4D 1P27B 4BROA 1YITN 1RBLA 4PKGA 3C6UB 3MMVA 2LCWA 2R7WA 4FYXB 1UVJA 2IBOA 4QIGA 4LC9B 3KWGA 4NXNK 4C23A 2C3OA 4FBUA 3QETA 3SPYA 1GTHA 2J6UA 5MLCQ 1OYEA 1J54A 1U0SA 5HLFB 1SVDA 1Q8BA 5HO4A 2XO7A 4OJ3A 1XUPO 2SXLA 3THYB 3EUNA 2MY8A 2GEMA 3E8OA 4M5LA 3TR8A 4CEAA 3VQ9A 1KKHA 4DR1F 2DHGA 4Y2MA 3QESA 5AQSA 1W7WA 3HHKA 3X3UA 3NXZA 4YY3F 4PL7A 4OYPA 1S5JA 4KKOB 4GMJB 2L08A 4AQYK 4JI6F 4USIA 3JTPA 5L46A 4MLEA 1NKCA 2BXJA 5T7LA 1IUJA 2HBYB 4CHPA 3AVIA 1Q7YT 4RW7B 1RT7A 2V8HA 4FWOA 2M8DB 5AQXA 4P2MA 1HJOA 4ZVQB 4B3TK 1KQGB 1Q8IA 3OHAA 2E9TA 1XMOF 1GLJO 2ZE2A 4DV4F 2NZTA 4M94A 1WG5A 4ZP6A 1T03B 1B7FA 5D0HA 3UKRB 5L1JA 2PO4A 1JK9B 2MZQA 2HS0A 5AFUA 1UEKA 3FBBA 5JICA 3FLCO 3ZEUB 3LZIA 5CH7B 1HA1A 1S6UA 2LMIA 1CULB 2HWIA 3EGNA 4ILGB 1SC3B 3R2CJ 4LFCF 3R5CA 3ZETB 3OXFA 1KR4A 4ZP8A 3RRHA 4BRGA 1TL4A 4ZVGA 2MEWA 2GCFA 3HI9A 2MZTA 4LR7A 3AVMA 2UV8A 3WT0A 4AD6A 3ZTOA 1R3NA 5HROB 4KI4A 4AXIA 3TA2A 3QT6A 2IOCA 2Q66A 3AT1B 3SSSA 1FJGK 4DR6F 2W7AA 3DXKA 2CH5A 1V3SA 5KQDA 3TARA 3QJJA 2HW3A 1SKSA 5KRTA 2HMPA 2JEJA 2C22A 1RZMA 5JLFA 1S5ZA 3D2FB 2NRXA 3CW2C 4E1JA 1FJ7A 1YIJN 3E66A 1X4AA 3C65A 2ITGA 3QAEA 3TEHB 4JEPA 4ISFA 2VG6B 3AO3A 1ZC6A 1Y7PA 3HHDA 2W7OA 3KUHA 2QO3A 4I6AA 2BQ3A 4EWTA 3GZ7A 3S01A 3LDSA 2J8SA 1CZAN 3CJ7A 3K9JA 1ZBIA 4CVNE 1WC0A 1NK7A 1SQGA 3V4IB 2R7YA 3KFWX 3CCMN 2XWXA 2HVIA 4TY8A 4OFZA 4CF9A 4F9OA 2OEJA 3O3LA 1NDCA 2KJWA 4Z7CA 5DZ7A 2EFVA 2O8DB 2WBMA 2ILZA 4DZ6A 1GTEA 4FPIA 4IJNA 1HWLA 4WFXA 1U48A 3CQ8A 1H6KX 1OVQA 1LOTB 2J9EA 2NZCA 4ISEA 1NJIO 2O8FA 4Y34A 3M30A 4J9OA 3QGPA 3SEOA 1BG3A 3R8EA 2EI5A 4CLFA 2ZUGA 2GUPA 3HKZD 2P9IA 5M1NA 1S72N 2B5JB 3BGOP 4DU8A 2G8IA 2KH9A 2LXFA 3G8SA 1K8AO 1KOHA 1O5JA 4ETXA 1HNVB 2MSTA 5AQRA 5KFNA 2R8GA 5IT9U 3MEGB 2E5LF 5JLHA 5KG4A 3K5PA 3N4QA 1ATNA 2XBPA 5K8PA 1HNWF 1RT5B 4F4ZA 5HQLA 2ZFHA 1S99A 1SL0A 2XULA 4M45A 8RUCA 5IWAJ 2FJVA 2RAQA 2FSJA 1WHWA 3KKFA 2ASDA 2V4QA 2V8DA 3W65A 4I9LA 5D4NA 4KSEB 3OYDA 3SBTA 3LZJA 1HX1A 4P71A 1E6VA 2DHXA 4DTXA 4B1WB 1N34J 4ZS6A 2YQ3A 3MGJA 2RHSB 1HNZF 3LQVA 5C2CA 4DR3K 4LMZA 2AWZA 2WCXA 3EE8A 3M05A 1J5OA 4P10A 2CA9A 1C1CA 2I8EA 1TV6A 1IKWB 1C4AA 3PIOL 2G0CA 3JQKA 2OFHX 2LQ9A 2ZVSA 2RPIA 2NLXA 3HL8A 3KHLA 1S1TA 3VETA 3W7BA 1JJ2R 4DEZA 1F60B 3TU5A 3MWBA 4BR7A 3S3NA 2XMMA 1NGCA 4FW2A 2RHKA 1SJRA 4NOHA 5AXLA 1ZBLA 2AV5A 3QRRA 2DNYA 5ETOA 4X4RA 4R5PB 1GEHA 3CQXA 2YKQA 3SBGA 1A5XA 1KQFB 3IWNC 4DF8A 2KRBA 1GXLA 4NA1A 2IJFA 3EZUA 4H8KA 3AVGA 4I6MB 5KTQA 1WACA 3F73A 4F4KA 2PC6A 3MWTA 3ZZTA 3QAUA 4KHQA 3TQEA 3W60A 3RBDA 3IR6B 4OKKA 1HPMA 3MAAA 4D3HA 4C11B 1RWOB 2B6AB 2V34A 1Y4ZB 1W26A 4KH4A 3FZFA 3VOVA 3KLGA 3OA9A 3H4BA 4C6AA 1FRLA 1ZBTA 4LRFA 2K06A 3BM7A 1FI4A 3CMEN 3ZSQA 4E7LA 2OGUA 5H9FJ 2E1YA 1X4HA 1ZBUA 3ZSRA 3THWB 3AGRA 2VIHA 3T9ZA 4C8MA 2E6LA 3K5OA 1WC6A 2BE2B 2IS3A 1WC1A 5KFOA 5JJBA 1CJUB 4ZPCA 3HVAA 1RBSA 1NGHA 1H2VZ 4H4OB 4ILLA 1LEOA 4NYPA 4BC7A 5GAHI 3FZBA 4CF2A 1KXPA 1SV5B 3V6HA 2VPZB 4DHYA 4ZVSB 5HVHA 2Y8YA 4GV6A 2KW4A 5LL6Z 4CNYA 3ETOA 2JFKA 5LMUK 3MZIA 4K5SA 4AHSA 2BANB 4I67A 4R25A 3GOIA 3TAMB 2HQGA 2ZZMA 4IOCQ 3MX5A 2UUBK 4DPWA 3MXJA 4NCGB 4LIRA 5AQQA 3ALYA 2OAUA 1JLQB 2WB1D 4CERA 4M3RA 2WW4A 2QN6B 3GE1A 1VQKN