3T19A

Crystal structure of hiv-1 reverse transcriptase (wild type) in complex with inhibitor m05
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
558
structure length
554
Chain Sequence
b'SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse Transcriptase
publication title Design and synthesis of conformationally constrained inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
total genus 155
structure length 554
sequence length 558
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3t19A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t19A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t19A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t19A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3t19A05
5SZTA 5C42B 3K5MA 2UVVA 1CLQA 4FLXA 2W7OA 4RNMA 1LWEA 1QHTA 1ZTTA 2V4RA 4U7CA 3MECA 1N4LA 2D0CA 3TR8A 4M3UA 3OYJA 4DSEA 5I3UA 2IMWP 5I42B 4BWMA 3BGRA 3DRRA 1R0AA 4XPEA 3HJFA 3ZSQA 3QEXA 1S1TB 1S49A 1NK5A 4DQIA 4LH4A 1HPZB 3DOLB 4FS2A 2RDIA 1GOAA 3CM5A 2PYLA 1EKEA 1VRUB 2HVHA 1FK9A 3NHGA 3AV9A 5J2PA 2YNFA 4NLRA 3GV7B 2E4LA 4LSLA 3LP2A 3RRHA 5C24B 4WXWA 3DM2B 3RAQA 3CO9A 3SQ0A 5CYMB 4B9LA 3QIPA 5D3GA 1D8YA 4DEZA 4DF4A 1YT3A 1C1AA 2ZD1B 3VA3A 4O0IA 2P5GA 4NLTA 1RT5A 2BR0A 5T7BA 3RR8A 3G6VA 2WHOA 3CJ3A 4AHVA 3D0PA 1MU2A 1IG9A 1BQNA 1SL1A 4KFBB 4ED8A 4FJJA 1WLJA 4DL5A 3OYIA 3NH2A 5T14A 4BDYA 5HBMB 1VRTA 1FKPB 1S1VB 5CYQB 3UR0A 4X2BA 4F2RA 1XHXA 3LWMA 4KREA 3LP1B 2FC0A 1JX4A 3IRXB 4BACA 1KRPA 4O5BA 5KGWA 3DRSA 3V81B 5DK5A 1QQCA 1NKBA 3IG1B 2OYQA 5KTQA 4CJVA 3L2VA 1JKHA 2B5JB 4OKEA 1DLOA 3OHBA 5FDLB 3SQ1A 5J1EA 3N6MA 2FVRA 2R8GA 1DTTA 4BDPA 3BSCA 1JLQB 4Y3CA 3KMQA 4FLVA 4F4ZA 4DTSA 4Y1CA 2OZMA 4M94A 3SJJA 3GIIA 3G86A 3DLKB 4DFKA 1RDDA 2VA2A 4ZPDA 1RTHB 1RBUA 3I5AA 1IKVA 4FW2A 1UAXA 1L3TA 2W9AA 1JL1A 4AHCA 1LV5A 2KTQA 4J9KA 1EXQA 3TAEA 1TKXA 4NRUA 4MFBB 1RAJA 1BCOA 3HP9A 2XY5A 1NHUA 3L2RA 2XHBA 4J9QA 1IM4A 4XIUA 3C6UB 3MXMA 2R2TA 3MAQA 3M8PA 4DG1A 3KK2B 1F21A 3NF9A 3KOAA 3AA3A 1LWCB 2C2DA 1VSJA 3KLVA 2HHTA 3A2FA 5I42A 4TN2A 3S9HA 3VQAA 4K4ZA 2IC3B 1S1TA 1HPZA 4QWAA 5HRPA 5KFCA 4ELUA 3AVBA 5KT3A 4CEBA 3S3MA 4IKAA 1KVAA 2HVIA 1RBSA 5KFEA 4FLZA 4NLPA 4E7LA 1QE1B 4OKJA 3DM2A 4KHSA 5EDWA 5CYMA 4KV8B 3HSTB 3LDSA 3OJUA 1RT2B 4AHRA 2OPPA 3BSAA 1IKYB 2Z1GA 3QIOA 3LANA 4DTJA 3C95A 2B4JA 4CJ5A 1JLEB 2RDJA 4EYIB 4Y2CA 1HRHA 2DFEA 1KLNA 5KFQA 5F9LA 4QAGA 1ZBFA 2AGOA 2FVSA 2ZQBA 1ASWA 4K8ZA 1CZ9A 4ECRA 5HBMA 3FDSA 4CGHA 1FKPA 4H4OA 3LZIA 4NCGB 1RTDB 1S97A 4HUGA 3GIMA 4ID1A 3LP1A 3LP3A 3KD1E 1RT7A 4QPXA 5F8HA 5DGAA 3BJYA 3MEDB 3IG1A 1C1CB 2IGIA 3TANA 4FXDA 4O0JA 2B5JA 2Q3SA 4DLEA 5HRSA 5FDLA 3WNFA 1T94A 1WSHA 3H59A 5HP1B 5KFJA 3LPTA 4E89A 4JV2A 4FM0A 3PZPA 3BSNA 4CEDA 4R0EA 1W9HA 2OH2A 4Q8FA 1K1QA 4CHPA 3OYNA 1TAQA 2QV6A 3OL8A 4NYZA 3KLIB 4J9LA 4O4GB 4CIFA 1RA7A 3CYMA 4MFBA 3BQ0A 5KRSA 3O4QA 4CGIA 2G8VA 4Z4CA 2JLEA 3OY9A 1SKRA 3OYEA 1A5VA 4M3RA 2AQ4A 3ZSRA 4RZRA 3MEEA 3KK2A 3RMBA 2XY6A 1I39A 2E6MA 4HUFA 4M3XA 2QXFA 3SPYA 3SV4A 4FLTA 2AU0A 2IC3A 5DGBA 3AA2A 3LALA 4CEAA 3RWUA 4C8OA 2IM1A 4DLGA 3S3NA 1D0EA 4OPKA 2X78A 4TXSA 3RRGA 4IRCA 2VG5B 4J9NA 3M9NB 3RB6A 4QOZB 4RW9B 1X9MA 5KFIA 1LW0B 1JXEA 4KB7A 4I7FB 3NGZA 1LAWA 1QE1A 3CJ2A 3H5SA 3U6FA 1C0UB 1HNIB 4RUCA 1TVRB 1K1SA 2RKIB 2HNYB 2HNDA 3ICLA 2YHAA 4WFXA 1NNDA 1IKYA 1TL1A 3CIZA 2GV9A 4JUZA 2XI3A 1SUQB 3O3FA 4K4SA 1S4FA 3QEPA 1KFSA 1S0OA 5KFSA 1J9AA 1JLEA 4R5PB 4TY8B 3U3YA 3ITHB 3SV3A 2YKNB 4Z4GA 3CFPA 5EWGA 2ASLA 3K57A 3DYAB 4FK4A 1U04A 3LP0B 2VG6B 4KRFA 1IKWB 1D5AA 4MKAA 2BRKA 4FJGA 3ZT2A 2W8LA 2VG7B 5J2QB 4NCGA 1RTDA 4DSJA 4I9QA 3KLGB 1EETA 1BIZA 4CFCA 3HK2A 4B9SA 1T05B 1Z26A 4ZVGA 2D0BA 4DMNA 1HQUB 1GX6A 4MIBA 4M3YA 4I9LA 1N5YB 4F50A 2R7YA 4M3TA 1C1CA 3SUNA 4DTUA 3ZSWA 3RB0A 4R8UA 1W25A 3F73A 4IRKA 2P1JA 1WSJA 4F3OA 4CGJA 1K6YA 2OPQA 5HP1A 3MTKA 2GIRA 4KTQA 4ED3A 1JLAB 4CHQA 1LWEB 3WNGA 3ZT0A 4MK9A 5DG8A 4DSKA 4CK2A 3QLHA 3V9ZA 1TGOA 2FBVA 3KLIA 3GIJA 4EYHB 2C28A 1FXXA 4J9OA 2I5JB 4NRTA 2D7SA 1U09A 1UA0A 2BGGA 3V6HA 3VQEA 2B6AB 4CEFA 3RMDA 4J9MA 3OS1A 3CJ5A 3TAMA 4ECWA 4EP4A 4F4XA 3DRPB 1IO2A 1RTIB 1RT4B 3CDWA 3KK1B 2YNFB 2J6TA 2OZSA 1RTJB 4LSNB 2XRIA 1S9EA 4LSLB 5KFKA 5F8LA 1LW2B 3H2LA 1I3AA 2G8HA 5KFMA 1QAJA 1XR7A 2OPRB 3QIPB 3AVAA 4RW7A 5L1IA 4O3NA 4RW8B 1NK8A 2FVCA 3KHLA 5KG7A 3QEWA 1RT5B 2VG5A 3IN5A 4RW9A 4WZQA 2G8FA 1BGXT 4CK3A 4I7FA 3LAMA 2UUTA 4ED6A 1WSIA 3FRZA 4NLOA 1TVRA 2RKIA 1RDRA 4EBEA 3SFUA 3MR3A 4ZVHA 4BE2A 2QE5A 4H4MA 2JEJA 1SUQA 1HYZA 4KHYA 1VRTB 1XR6A 4Y34A 3H5YA 3NGDA 2A1RA 2QK9A 5F8NA 4R5PA 3ITHA 3N6NA 4DU4A 4URGA 5JS1A 2XCAA 1NJWA 2XGQA 3DRSB 1SH3A 3DYAA 3SZ2A 2VG6A 2R8JA 4ID5B 3IGVA 2AJQA 4EO8A 4FLYA 2VG7A 5J2QA 1JKHB 4KHQA 3KLGA 2D5RA 4O3RA 1T05A 5F9NA 2BQ3A 2JEGA 1JL2A 2F8EX 1DTTB 1NK9A 3UPFA 4MK8A 4Y2AA 5KFZA 1RDAA 5K14A 4K4WA 1N5YA 2E9RX 4E1MA 1XWLA 2AX0A 4J2BA 4K50A 1Q8IA 3BQ1A 2NUBA 4CGDA 3NAIA 4IRDA 2FBTA 3AVFA 1Q9YA 4MIAA 3Q8PB 5HRRA 3DLRA 1JLCB 4OJRA 3HPOA 3T3FA 1TKXB 1JLAA 3PR4A 3N6LA 4J9SA 2JEFA 2BDPA 3CFRA 2JEIA 3V9UA 3RB3A 3M8PB 4DG1B 3D45A 4CEZA 3CVKA 3KHHA 1T7PA 4CIGA 3HYFA 1TK8A 1TKDA 4ED1A 4IH7A 2I5JA 5EWEA 4QW9A 1ZETA 2B6AA 1S5JA 3THVA 4K4UA 4K4VA 2EX3A 1T8EA 1NJXA 1JLFB 4DTPA 2FVPA 2G8WA 1WNSA 3DRPA 4EO6A 4J9PA 4LY7A 1RTIA 4QWCA 1BIUA 4M41A 1RT4A 4CIEA 3KK1A 1RTJA 4LSNA 4J2AA 4PWDB 3AA5X 4I2QA 4TQSA 2VWJA 4LD0A 1LW2A 3TI0A 1TV6B 1UWBA 2OPRA 3PV8A 2OPPB 3JSMB 4RW8A 3LWLA 3DDKA 4O44A 3RR7A 3EZUA 3V1OA 3SI6A 4FJ5A 5F8JA 4Q45A 5DLGA 3PW7A 1KVCA 3TAFA 4ZHRA 3P5JA 4ECVA 2D3ZA 3H4BA 1U45A 3MR2A 4E7JA 1YTAA 4DQPA 2CKWA 4W5OA 4H4OB 1B9FA 3QO9B 4EZ6A 4MK7A 2G8KA 4FJIA 3T19A 3CQ8A 1RT7B 4PA1A 2FJWA 4ECUA 1ZBUA 4CERA 3H98A 4ID5A 3VQQA 4O55A 4KTWA 1UA1A 3G6XA 3NFAA 4DTRA 2FLPA 4IDKB 3QEIA 2HMIA 3KD5E 2ASDA 5KFLA 3TQ1A 4JRQA 4NYNA 5KT6A 2UVRA 3QGGA 5JXSA 4ED2A 2RF2B 2R8HA 1L3SA 3HVWA 1S48A 4Y1DA 3WNHA 4W5QA 3VQDA 4I2PB 5KFUA 1JLCA 4B9TA 4IOBA 3UQSA 3K59A 3HKWA 1U47A 4WYLA 3L2QA 3OJSA 4B8CA 5KFXA 3E51A 4JLHA 3V1QA 4NLVA 2XI2A 4OKKA 3MEEB 3WNEA 4KO0B 3HVAA 4YNQA 3SI8A 4IH6A 4CF2A 2HAIA 3QGIA 3OYFA 4FJ8A 4CE9A 3MXIA 4FK0A 2BRLA 3MR6A 3OL9A 3GV8B 1JLFA 3BQ2A 3AO4A 4MQ3A 1RBVA 3SUQA 5KT4A 4DQRA 2IM3A 1B92A 3PX0A 4NLYA 1HYSB 1TK5A 4PWDA 3ALYA 2BQRA 3G0ZA 3AVMA 3FQLA 2EC0A 4FK2A 1TV6A 1VSIA 2HNDB 5L1JA 4FVMA 4KTZA 1JLGB 4WYWA 4CF9A 3HPHA 1TL1B 3JSMA 4Q0BB 2W42A 2HHVA 3I0SB 1HNVB 3ISND 2YNIA 3PJWA 3H08A 4M3ZA 1XHZA 4KHMA 4CJKA 3QNOA 4WE1B 3DLHA 3H5UA 2AX1A 1D1UA 3QO9A 2F8TA 1EETB 3ZSXA 3AO1A 1BISA 1VSMA 2W9CB 4CGGA 4N56A 1NKCA 5KFHA 5HLFB 2X6NA 3SUOA 4YMEA 2HHWA 4WZMA 4IR1A 4AH9A 4R8UB 4IDKA 3AVLA 4M45A 4Q43A 4E7KA 3PJXA 3KKSA 2GUIA 2Y1JA 5J2NB 2OPQB 2F96A 2C2RA 4CJWA 2Z1JA 3G6YA 1TAUA 2RF2A 4FLUA 3Q8RB 4CJFA 5F8IA 3NF7A 1RBRA 3HM9A 4ZVFA 4DWIA 4ICLB 5DMRA 1U4BA 4WFZA 5KT7A 2CJQA 4I2PA 3QLHB 1T03B 1RBTA 4KI6A 3GILA 4NLQA 4O3QA 3F9KA 3ULDA 3KIOA 3VQCA 4IQXA 4F4KA 3TAMB 4RNHA 3ZCMA 1LAVA 4B3OA 2OPSB 4KO0A 3BSOA 2PYJA 3QEVA 4CJQA 1S9GA 4HYKA 2LSNA 1OS5A 3AVKA 1KHWA 1S9EB 5KG5A 3QERA 1RDCA 4IG3B 4FJ9A 4J2EA 4YR2A 4CEOA 3DLGB 5HRNA 3DI6B 4NYFA 2FBYA 4YP3A 3VQ8A 1G15A 2E9ZA 4RW7B 4CJEA 2FJVA 4OVLA 3PX4A 1DTQB 2HHQA 1HYSA 3UDLA 2KFNA 3LAKA 1TKTB 5HROA 3FQKA 4OLAA 2XY7A 4L8RB 4CJTA 1JLGA 3KLHA 1KVBA 4Q0BA 4FW1A 4GMJB 4H4MB 4YFUA 3AO2A 4CJ3A 4RU9A 4RNNA 1WN7A 3C94A 1JLBB 4DF8A 3I0SA 4HTUA 2X6SA 3V9SA 4JS4A 2V4QA 2ZE2B 1KHVA 3O3GA 1HNVA 2YKMA 1IKXA 1QSYA 4IG0A 3E01A 4ECZA 4F8RA 4WE1A 3VQ9A 3I0RB 1U49A 3P1GA 3CG7A 2FJXA 3KHRA 4O3OA 4JRPA 4URQU 1N56A 1EX4A 1RT6B 3EPIA 4ZTFA 2W9CA 1SKWA 1TP7A 1ZBIA 3IGNA 3M8QB 2B43A 5K14B 5HLFA 4PY5A 4N76A 3ZSVA 2WONB 5KFFA 2JGUA 4BDZA 2YHBA 4OLBA 2XC9A 3ZT3A 2BE2A 3VQSA 2IA6A 2YNHA 4ED0A 5F8GA 4KKOB 1RILA 1JXBA 3K5NA 3NBPB 2WK4A 2W7PA 5J2NA 3CDEA 2G8IA 2YNGB 1NK4A 2O5DA 1GX5A 3UIQA 2W9BB 2EHGA 1WNEA 1C1BB 3H40A 3KKRA 3CM6A 4DSLA 1LWFB 5KG3A 4ICLA 4F3TA 3D5MA 1CXQA 4RW4B 5KFPA 1T03A 1JXLA 3QZ8A 4W5NA 5L1LA 3OLBA 3OYGA 2KQ2A 2Z1IA 2WTFA 3L2UA 2R2RA 4IR9A 3NMAA 2OPSA 4DL2A 3TWHA 2DFHA 1U48A 4DFMA 5FRMA 3T5KA 3LZJA 4ZP9A 1WAFA 4E3SA 3V4IB 4CHOA 3PW5A 2C22A 3HVTB 3IAYA 1L3UA 4I2QB 4IG3A 4CHYA 2WRMA 3DLGA 4N41A 3DI6A 3M9MB 4OPJA 1S9FA 1UWBB 4E19A 1CSJA 2IJNA 1WSGA 3QNNA 2J6SA 1DTQA 5KFOA 4O44B 1CXUA 1SV5B 2UVUA 4Q44A 1NK6A 4DS5A 3TAPA 3CJ4A 2E9TA 1TKTA 4CK1A 1J5OB 4ZP6A 2IS3A 4ZHRB 1SH2A 3BR9A 2W8KA 2HNZA 1J54A 4N5SA 3VA0A 3DLEB 2R2SA 4DQQA 5KT2A 4JS5A 1S1XB 2DTUA 4B9NA 2XCPA 1JLBA 4H54A 3DMJB 3TABA 3ASMA 1L3VA 3EZ5A 2P5OA 2ZE2A 3NE6A 1N6QB 5EWFA 3V9WA 2FLNA 4DFPA 1QSSA 3I0RA 1HMVA 2HWHA 3VQBA 4CF0A 2IOCA 4YR0A 4KBIA 3SCXA 2HMIB 4RNFA 4CGFA 1TKZA 1RT6A 3MXJA 4NLDA 4Z4HA 3PX6A 2ATQA 1NJYA 3AVHA 4Z0UA 1NK0A 1C0MA 5KFRA 3M8QA 4FBUA 1ITGA 4ZPCA 4NLGA 2WONA 1S10A 4FZYA 1KFDA 3RBEA 2IDOA 5C25B 4KKOA 3NBPA 1VSDA 5KFAA 4FJKA 2YNGA 1WSFA 4E7HA 2W9BA 5DG9A 3KLEB 4HCCA 1C1BA 4FJMA 1HQEB 1LWFA 4CFBA 4DTMA 4AHSA 4G1QB 1YVFA 2WOMA 4YQWA 1QTMA 3PO5A 4RW4A 4OL8A 4NCBA 3NAHA 3PR5B 4EEYA 4CJRA 3T5JA 4ELTA 4CF8A 1ZYQA 2ALZA 2R8KA 2GIQA 3OSNA 2IAJA 4KSEB 1QSLA 3BDPA 4FJLA 3PHEA 3HHKA 1C6VA 2AGQA 3IS9A 4E0DA 1C2PA 2I1RA 1ZBHA 4CFAA 3V4IA 2ILYA 1VSEA 4O3SA 3B6PA 1NOZA 3HVTA 4M42A 1BL3A 4NZ0A 3CJ0A 1HARA 2DY4A 4W5RA 4DL7A 4EP5A 4B08A 3KJVB 3FFIA 3VN5A 3V1RA 3ZSOA 4N47A 1BI4A 3AVCA 1S0NA 4NCAA 1SV5A 1QUVA 2E6LA 2V9WA 3CWJA 3DOKB 1J5OA 4AHTA 3AVIA 4DS4A 5KG2A 2YNIB 3DLEA 1VSFA 4OGEA 4PUOB 5KG4A 1WAJA 1XI1A 4M95A 3CDUA 4ECYA 4MKBA 1S1XA 3MFHA 3AA4A 4DL4A 3VQ7A 4J2DA 1Y97A 3DMJA 3MEGB 5L9XA 1BHLA 2KZZA 2VWKA 2J6UA 1N6QA 5KFGA 2O4IA 4Z4EA 4WFYA 4QW8A 4BWJA 4CJLA 3PW4A 3HPGA 3I5BA 3SQ4A 4XO0A 4DFJA 3EPGA 4CF1A 4DL6A 1SKSA 3T5LA 2QKKA 3NF6A 4FS1A 4RUAA 4HKQA 4K4XA 5SWMA 4Q5VA 1S6PA 4TLRA 2GBZA 3MF5A 3K58A 3NF8A 3HL8A 3RMCA 1J53A 3KK3B 4ECSA 5C25A 5DQHA 4FLWA 3K5OA 3QETA 3JYTB 1YVUA 3TAGA 4O3PA 2DPIA 3KMSA 1S1UB 3OYDA 3RB4A 5EU7A 3RMAA 5KFNA 2BQUA 1W0HA 3EYZA 3KLEA 1NOYA 4E1NA 1A5WA 4OGCA 5KT5A 2G8UA 1HQEA 1S6QB 4DSIA 1EP4A 3OYMA 4G1QA 2HHXA 2XGPA 3GYNA 4B3OB 2ASJA 1VSLA 4H8KA 4B8AB 4GC6A 3PY8A 1T3NA 2DPJA 3V6DB 1S9GB 5C42A 3MFIA 1RT1B 2PY5A 2XY8A 5F8MA 4RW6B 2V0NA 4LQ3A 5E41A 4CFDA 1RA6A 1SL2A 4FJ7A 5KG0A 5KG1A 4YR3A 3H5XA 2D0AA 2R8IA 1KSPA 3M8RA 3PVXA 4JV1A 4QWBA 4DTNA 4ZPBA 1HJRA 3PO4A 2KW4A 2UUWA 5HROB 2DFFA 3DOLA 3ZT1A 3C6TB 4ZPAA 2FLLA 3KJVA 1VRUA 4FM1A 3KLHB 1ASVA 4B9UA 4KE5A 4F4WA 1VSKA 3AO5A 5C24A 3DOKA 2QKBA 2YKMB 4CEQA 1IKXB 4PUOA 4ECTA 2ZKUA 4EBDA 4UQGA 4IG0B 2ZD1A 3E01B 4IFYB 3Q8QB 3NCIA 3SQ2A 4CJUA 4URSA 3PW0A 1KTQA 2Z1HA 3OYAA 1N48A 1RT3B 3MEGA 4ZP7A 3OS2A 5JUMA 4KFBA 3RAXA 2FBXA 1RNHA 3OYKA 3B6OA 4IKFA 2RPIA 2D3UA 1X1PA 3OVNA 4TSXA 4ZVEA 1VK0A 2O4GA 1BQMB 1S1VA 2BE2B 2ETJA 2YNHB 5CYQA 5KFWA 2IJFA 4ED7A 4B9MA 3IRXA 2R2UA 4BE1A 3NGIA 3V81A 4DU1A 1TL3B 1TQLA 1S1WB 3HVRA 4FJXA 3I5CA 3KK3A 1NK7A 3FSIA 4XPCA 3OL7A 3OLAA 4LH5A 3L2WA 3JYTA 4IFVB 1TK0A 4J9RA 1S1UA 1XR5A 3HXMA 4NLUA 1MMLA 1JLQA 4KB0A 5KRTA 2A1SA 3KHGA 1D9DA 1S6QA 4K4TA 2ATLA 3DLKA 1Z4UA 4EZ9A 4LQ9A 4Z4IA 1JIHA 1RTHA 2AWZA 4TYBA 4C8KA 4Q8EA 1ZTWA 4W5TA 3V6DA 4RNOA 4JV0A 1RT1A 1L5UA 3PW2A 3V9XA 3SFGA 4ELVA 4AILC 4RW6A 3T1AA 1RDBA 4E7IA 3C6UA 4G3IA 3K2PA 3OHAA 3NH1A 4ECXA 4PQUB 1LWCA 4ECQA 4GC7A 1I6JA 3HT3A 4CECA 3DLBA 3QIDA 5KFYA 1FKOB 1D9FA 4FBTA 3LPUA 2BANB 4ZP8A 3T5HA 2IBKA 5KGXA 3C6TA 2UVWA 3GQCA 2HNZB 5DG7A 1GOCA 3QINA 4NLWA 4KAZA 3U3GA 5EUHA 5KG6A 1IH7A 3OYCA 4CHZA 4AHUA 2P51A 4HUEA 4C8MA 5FROA 3L3VA 3QESA 2C2EA 2ILZA 3AVNA 1RCHA 1UOCA 3OYBA 1C0TB 3GIKA 3L3UA 4CJ4A 4KV8A 4M3WA 1RT2A 3RBDA 3EY1A 4KPYA 2HHUA 3TARA 2AGPA 4DSFA 4IFYA 3KLFB 4ZMMA 2VA3A 1HMVB 4FZXC 2FVQA 2XWYA 1ASUA 3OYLA 1RT3A 4DQSA 3SUPA 1GOBA 4KAIA 3OSPA 1TKZB 3ZSZA 2X74A 4CJSA 4K4YA 3OL6A 2JC0A 4QWDA 4KB1A 3NDKA 5J2MB 4F4YA 2HW3A 3AO3A 3SYZA 4KHRA 1BQMA 1CZBA 3S3OA 2WCXA 4HVJA 3M9OB 3P83D 4QWEA 1S0MA 2JC1A 4CCHA 3OS0A 4RG8A 4B9VA 3MEDA 5CZ1A 1RYRA 1KLMB 1TL3A 5FRNA 2GC8A 1S1WA 4C8NA 3HP6A 4MH8A 4KHUA 1NHVA 2WOMB 3ZSYA 3NGYA 4HHTA 4IFVA 1REVB 4Z4FA 3NAEA 4IBNA 4CESA 1VSHA 2IAJB 4IH5A 3K5LA 4CHNA 1O1WA 3IS9B 2HHSA 3KNAA 2OA8A 1SH0A 3MECB 4FJHA 4DTXA 2HWIA 4TY9A 5CZ2A 4O4RA 5I3UB 3QYYA 2Y1IA 3BGRB 4O4GA 3DRRB 4FM2A 1R0AB 3RTVA 2PZSA 3VQ4A 4KHWA 3KTQA 4GW6A 1HYVA 1QAIA 3NKYA 1X9WA 1NKEA 3FFIB 5L1KA 4EBCA 5C5JA 4PQUA 1FK9B 3AVGA 3O3HA 1BI4B 5J2PB 1KCFA 3H4DA 3VQ6A 1FKOA 3LP2B 5KFDA 4K8XA 2BANA 3ISNC 3NH0A 4DTOA 4WXOA 4KHNA 3NL0A 4TQRA 3M8SA 1X9SA 5D3GB 3OYHA 2IM0A 1A5XA 3V6JA 3CFOA 3VQ5A 2KFZA 3TVKA 3O4NA 4BE0A 4NLXA 5DQIA 3Q8SB 1LW0A 1Z25A 3L8BA 1MU2B 1BQNB 5KFVA 1C0UA 1HNIA 2D41A 1C0TA 1B9DA 2HNYA 5CY4A 4CEEA 3TAQA 4FJNA 4FZZA 4DU3A 2KZMA 3KLFA 3SPZA 3SNNA 1Q9XA 4CJPA 2XO7A 5JS2A 5KFBA 4DL3A 3ZT4A 4HCBA 3I8DA 1RYSA 4TY8A 4QCLA 2YKNA 3QZ7A 1BCMA 3GV5B 3PUFA 1S6PB 3LP0A 5KFTA 4TYAA 1SL0A 4FCYA 1IKWA 5J2MA 2RN2A 4U6PA 3AVJA 4KI4A 2IM2A 3G10A 2ITGA 2WB4A 1DLOB 1XC9A 4C8LA 5DLFA 4F2SA 3BREA 5J1EB 1NJZA 1ZBLA 3VQPA 3MR5A 1HQUA 3QGHA 4NLSA 3D28A 1KLMA 3V6KA 4ZTJA 5DQGA 2YV0X 1YTUA 1EP4B 4FYDA 2HB5A 2F8SA 1WSEA 1IKVB 1QS4A 3HO1A 4GVMA 1REVA 5KI6A
chains in the Genus database with same CATH superfamily
3PRBA 3O4WA 4BC2A 2A42A 2CPXA 3W3SA 5IZHA 1UL3A 3AD7C 1YJRA 4LF6F 4KJIA 2W4CA 3GB0A 5EGYA 2QMWA 4DZDA 4BWMA 3DRRA 5LJWA 4TLQA 1S49A 1JJ2M 2E7XA 3SMSA 2LVWA 2J0QD 2RDIA 4ID8A 3VESA 1FI4A 1OYDA 3NHGA 2DHHA 5J2PA 4ZDNA 4F3QA 4PR6A 3BV8A 2DHGA 4LSLA 2F8HA 2I6WA 3LP2A 4U8VA 2VPYB 1UVIA 4WXWA 1HR0F 3RAQA 3CO9A 2RE2A 4B9LA 2KRBA 3QIPA 3ENAA 1WSRA 3HFKA 2ZD1B 3ZTSA 4NLTA 1AW0A 4JYAF 4ER8A 3SMZA 2WC9A 1SL1A 4KYZA 4KFBB 1GXTA 3EGZA 3P38A 4FJJA 1ZAVA 3KK7A 4AXIA 4WYBA 3MOJB 4QPTA 4CI0B 4EUVA 1S1VB 5CYQB 4NEYA 4F2RA 2ITMA 3THYB 1Y64A 2Q36A 2FC0A 1JX4A 4ATNA 3MCNA 3WXMB 4O5BA 5KGWA 3DRSA 3DXSX 2OYQA 3LGMA 1KS2A 3F56A 4OMFG 4CJVA 2B5JB 4PXCA 4EI2A 3OHBA 3NLCA 5ETVA 5A6PA 4BRQA 5AQUA 2R8GA 1DTTA 1JJHA 4YB6A 4QIWD 1APSA 2XMUA 4F4ZA 4DTSA 3U02A 2OZMA 3LGHA 1DBDA 3GIIA 3DLKB 1EKRA 4DFKA 4LVNP 1RTHB 4OV6A 1VQKS 2DJWA 4ZJQA 3CDAA 4FW2A 1UAXA 1N34K 1L3TA 2W9AA 2M4MA 1RE1B 4M5GA 2RS2A 4WFBQ 1SC4B 4J9KA 1TKXA 2A0FB 3ATVA 2FZCB 2ZOGA 3C3LA 4JD2B 1OMSA 3HP9A 2P9PB 2XY5A 4JI0F 2XS7A 2DNRA 5I3QA 4J9QA 3C6UB 2HPUA 5CHCB 2A6OA 3MAQA 4A5BA 4DG1A 3KK2B 1Q95G 3D3CJ 4DR1F 4WQ5C 3NVKA 1VHFA 7FDRA 4LF4J 1SJ1A 1RWVB 2IC3B 1RKIA 1U0SA 3QRQA 1N8RT 4PPDA 2JDJA 5KT3A 2FLOA 4CEBA 4WF9L 4QQBA 2VKRA 1RBSA 3I33A 3ILLA 4P6QA 4B3MJ 4E7LA 4DR4K 2Q79A 1QE1B 1T9VA 2VFSA 1GMVA 4KHSA 3TJ9A 3U1MA 3MUVP 2H3EB 1CBKA 3QIOA 4JBCA 3LANA 3C95A 3PIOQ 4ZN1A 1RHUB 4EYIB 3JS6A 4Y2CA 2E2OA 3M32B 2XZDB 5M1FA 4KPCA 4JP8A 3O3LA 1WB9A 1ZBSA 2WVFA 2AGOA 9ATCB 1ASWA 2QA4G 4CTAB 5CXTA 1Q53A 4H4OA 3LZIA 1RTDB 3B4MA 3G8TA 3CIPA 3THYA 3PYGA 1YKWA 4QPXA 4ED4A 4HLBA 2GHWA 1RI7A 4U67Q 2IGIA 2OSQA 4CO0A 1F1BB 4O0JA 4A8KA 2B5JA 4OZ5A 3UD5A 2Q3SA 4DLEA 3H59A 4M5KA 3A8EA 3M8YA 1VLYA 3PZPA 1NDCA 4JNEA 4UF4A 4PG5A 3BSNA 4R0EA 2OH2A 4PWWA 2HK3A 5D0RA 4K5SA 3IP0A 2QV6A 2YWFA 4RWWA 4NYZA 4J9LA 2YBVA 4L3QA 4CIFA 1RA7A 2P9EA 2BVZA 3SBTA 1A5VA 2AQ4A 4K59A 3KK2A 4Q2LA 1WUUA 1XN9A 2ZUGA 4P2SA 1IBMK 4ZLLA 2A2CA 2QXFA 3SPYA 2IC3A 4CO1A 3VENA 3LALA 4CEAA 4ZVPB 4C8OA 3OD2A 2B4UA 1D0EA 4OPKA 4M63C 3I56S 2XS2A 1BO5O 4PEOA 1N36K 4QOZB 3RB6A 1FRXA 4K0KK 1X9MA 2GVZB 5CR4A 1JXEA 2E7WA 2EFQA 3NGZA 1QE1A 1KQSR 1C0UB 2BZ2A 1H3DA 1XIQA 1K1SA 3TQEA 1SQKA 3QWUA 2HNDA 3ICLA 2UYTA 3CMEN 1NNDA 2VZ9A 3J81Y 3MPUB 5ETNA 2HHHJ 3DAWA 4K4SA 4E2FB 1S4FA 1F3FA 1KFSA 5DO2A 5KFSA 4R5PB 2W2NP 5FPMA 3M32A 5L9NA 3O6WA 1VC5A 4DX6A 5EWGA 3DYAB 3A13A 4FK4A 2VG6B 4CTAA 4MKAA 4FJGA 4LF7K 3ZT2A 3K89A 1RTDA 4DSJA 3ADAC 3FBBA 3F41A 4B9SA 1T05B 1QJHA 1Z26A 1WUAA 3BZQA 4JI3J 1ATSA 2V2ZA 2D0BA 1GX6A 1X4GA 4I9LA 2FGCA 2R7YA 1QZ5A 3SUNA 5GMEA 3ZSWA 3RB0A 4DV7K 4DHYA 1HBUA 1K6YA 1MROB 2ZH3A 5HL7L 5DS7A 4RU2A 1LWEB 4L74A 4P2XA 3ZT0A 5A8WB 1HNXJ 2HAFA 5C0YA 4DSKA 3N01A 3QLHA 2BABA 3W63A 3V9ZA 1TGOA 2CQCA 5AE3A 5KPZA 3GIJA 1U1MA 2C28A 4J9OA 2I5JB 2D7SA 1U09A 2BGGA 3V6HA 3VQEA 1RGVA 2ZGYA 3CCRS 1K0VA 3OS1A 3UNGC 1ESVA 1DRZA 3ZO7A 3SJHA 4F4XA 2HZAA 5A0YB 2MY7A 1RTIB 1KAXA 2EFPA 2FDNA 3IAS9 2J6TA 2YNFB 2OZSA 3FSXA 1SC1B 3RW6A 1FHTA 3H2LA 1IR0A 2G8HA 1TFYA 5KFMA 2IPOB 3CJ8A 5CZVA 2FYXA 2OPRB 4ZCMA 4CP5A 3VGSA 2G2YA 5L1IA 1YITS 4RW8B 1KC8T 4DDFA 1NK8A 2MHNA 3KHLA 3QEWA 2FC9A 4QIFA 1IUJA 2G8FA 4CK3A 3EO3A 3LAMA 3FRZA 3TSPA 4HDHA 4EBEA 3MR3A 4DPWA 4ZVHA 4BE2A 5AXMA 2CNLB 3H5YA 1U1QA 2QK9A 3MAAA 4R5PA 5C2CA 3N6NA 2YKOA 4MDBA 2DTJA 1YZ7A 2U2FA 2GGPB 5IV4A 2XGQA 3DYAA 3FZFA 2VG6A 2R8JA 4ID5B 2CADA 5H9FK 4KHQA 1BWEA 3M2UB 5AJ3J 1T05A 5F9NA 1YBAA 4CO3A 1PJ5A 2DEIA 4K43A 5HQLA 2NPIA 4MK8A 1RDAA 5KFZA 1VQSA 1UWAA 3EX7B 1TZ0A 4HVZA 5M2UA 4F25A 2E1AA 2W25A 4CNYA 5IWAF 3BQ1A 4OLPA 4OQJA 3UB5A 3NAIA 4IRDA 2FBTA 4C11A 3Q8PB 3DLRA 1JLCB 1MROA 4CRJA 2E5LJ 2APOA 3T3FA 1RWNB 4J9SA 4FPIA 5A8WA 2BDPA 2KT2A 4JN4A 2Z0GA 2JEIA 3RB3A 4C0HA 4A8YA 3CVKA 4CIGA 1TK8A 3FMBA 1VQLN 2XBPA 4WU2A 2I5JA 4X66F 1S5JA 4HTLA 1NJXA 4DTPA 2FVPA 4OZ0A 5ETRA 2RD5C 3AJ1A 2G8WA 3NCPA 1T9YA 5A0YA 3DJCA 1RTIA 4E8UA 2PGCA 3DNCA 3TSUA 3ZX3A 4CO5A 4TQSA 5HK4A 2I9SA 5DDOC 2OPRA 2UUBJ 1NGDA 3SLCA 4J90A 4RW8A 2EKNA 2J7KA 2E5HA 3VTHA 2RU9A 5F8JA 3L95X 2KHDA 3PW7A 4RL1A 5H1SV 4PL7A 3UD3P 2V8PA 4OI2A 6FD1A 4JV5K 5HMZA 3MM5B 3SSRA 4W5OA 3S41A 4MK7A 2MKJA 5AQVA 1U1NA 4M5HA 2GGPA 3D0IE 2N4DA 1ZBUA 1FEHA 1GK8A 4ID5A 2HFNA 3S1TA 3VQQA 4O55A 1UA1A 3B82A 4IDKB 5CCLA 3KD5E 2BYCA 1VC0A 4LSZB 2XZTB 3TQ1A 2FF6A 5ETOA 4NXNK 5B09A 3J7ZO 3IO1A 5JXSA 5AFUH 4O0NA 4LBPA 3D7SB 5B0AA 1LKZA 5L39A 3IBWA 4BR4A 1F9FA 3HVWA 5ETQA 4PAAA 4I2PB 3A3PB 1JLCA 3RU0A 4B9TA 4IOBA 4M63A 4ZIWA 1X8DA 3V1QA 2E88A 2XI2A 4OKKA 2FSKA 3TYTA 3WNEA 4K8RA 4KO0B 1HR0J 4YY3K 1QAXA 4YNQA 4EHTA 2Z30B 2AV5A 4ZVQB 3DC2A 4IH6A 1X0PA 3GG4A 1TU0B 1N88A 1UEUA 4FJ8A 4AM6A 3CNQP 2XMAA 3GV8B 3JSRA 4H0XB 2VU5A 3AO4A 3SBMA 4KH4A 2Q97A 3W9IA 2KN4A 3CJCA 1K8AT 1HYSB 1N52B 4LJMA 1TK5A 3ALYA 1QM9A 2EC0A 3HSZA 4DR6J 4FK2A 5L1JA 1WC6A 3OXGA 1JLGB 2K06A 4WYWA 4KTZA 1TL1B 4RUBA 3CJ7A 2XLKA 2D3O1 2JH3A 1WHXA 5JVGQ 3HHLC 2XMWA 4ZPVR 5GAEI 2ZDOA 2GMHA 3J7AP 4LFAF 2YNIA 5ETMA 3DLHA 2E20A 3M6WA 1SB6A 1EAYC 1W26A 2F8TA 3SK3A 3T1HF 3TO8A 2W9CB 1OVQA 1NKCA 1WG5A 3N9UC 2GEMA 2ZH1A 3THXB 2EXUA 2DH8A 4WZMA 3RBXA 5G4DA 1FDNA 2ROEA 4IDKA 3U1LA 4JI1J 2GUIA 4OV1A 2Y1JA 4IOAQ 4OYOA 5J2NB 2OPQB 2AZ3A 4OHZA 4KH5A 2DRAA 3BO2A 1BG3A 1VQPS 2ZHAA 3MGJA 1C4CA 2J9DA 4ICLB 4OHVA 1XNQK 1U4BA 2PBDA 1ZS6A 2KXFA 4AQYJ 2F40A 4WFZA 2VQEF 1PKUA 2CJQA 4I2PA 3P6YC 1Y00A 4OZ1A 3ILIA 2RHSB 2ZZTA 5CYJA 1N33F 4O3QA 3UI3A 5M1QA 5HQ8A 2DNPA 2JFKA 3M6VA 3VQCA 2AHOB 2HBKA 4F4KA 3TAMB 4RNHA 3PYEA 3J81U 4BR0A 1P8GA 4KO0A 3TP2A 3BSOA 4R25A 4JI4K 1X5OA 1CC7A 4CJQA 3PEHA 3A8JA 4O8UA 4DV6K 1OS5A 3FCVA 1KHWA 2FJAB 4J2EA 4CEOA 3DLGB 3JTPA 2PN6A 5GAEP 2EWHA 3J7Z5 1M5PC 2E9ZA 3PX4A 1Q81O 1DTQB 1GLFO 1HX1A 1YDLA 3DWLA 1HYSA 4LF6K 1WELA 3D66A 4UQTA 2KH9A 4OLAA 3AD9C 1ZH5A 1JLGA 4GMJB 1SBRA 2DR6A 1IBLF 1WN7A 1WOOA 2PA8D 3O1LA 4CM0A 4HTUA 1RWUA 3V9SA 1S59A 2V4QA 2ZE2B 1YZ6A 1Q0NA 3O3GA 2K7KA 3GFZA 1CQMA 1VQOS 1IKXA 4IG0A 3GG1A 4YHHF 3I0RB 1VQ5S 1BWFO 3EMTA 3QPIA 2ZH6A 3CG7A 3P1GA 1URNA 1WHWA 2FJXA 4TU7A 2L9NA 4JRPA 2RQKA 4URQU 2RJZA 1EX4A 2QFIA 2OFGX 2W9CA 4JYAK 1ZBIA 1RGIA 1KKHA 3THXA 1SJ3P 5K14B 4PY5A 1NZAA 2CZ4A 3CCJN 3W64A 1CULB 3H7HB 2YHBA 2QJ3A 2P9SA 4OLBA 2HFVA 2IA6A 2FHOB 3OTEA 2W7PA 1B0PA 5J2NA 3MPYA 5G0RB 4LRAA 2GQCA 2W9BB 2EHGA 3UWTA 4ICLA 2VODA 4F3TA 2IDLA 4RW4B 3FCWA 4B1UB 4ILGB 5LMUJ 3P3DA 3VHQA 2YJFA 5K5MA 5E5NA 4P9SA 3VEVA 3CCUN 3CERA 3OTOF 5RUBA 1U6ZA 3HHLB 1I5OB 1NU0A 3R6MA 3GJTB 2IYGA 1U48A 4DFMA 3H46O 3GG0A 4FWQA 4EHUA 1Q1KA 1M5HA 2EBEA 3IAYA 1K47A 2DGWA 3IM9A 1M1KO 1MLAA 1WG1A 2W2MP 2ZJRL 4IO8A 2VC1A 3DLGA 4N41A 3M9MB 4M1KA 5EOYA 1NJIO 1F5CA 1F60B 4JI0K 3C16B 5M1PA 1DTQA 2QA1A 3JB9k 1CXUA 4XH4A 1EO1A 1SV5B 4DR1K 2HZCA 3IR5B 2UXDK 2E9TA 2UUAF 4CK1A 2VV5A 1J5OB 2KU7A 3IWLA 4ZHRB 2IS3A 1SH2A 1FF2A 2W8KA 5FD1A 5AQPA 3VA0A 4M7YA 5K8PA 2DNNA 1QVGM 2BM1A 1NEEA 4RJVA 5KT2A 3KUGA 2FSNA 2RVJA 4GVLA 4K2JA 4H54A 3ASMA 1BD6A 5MLCV 4F7VA 1NSPA 2ZE2A 2F5GA 4OHYA 3PDNA 5EWFA 4OX6A 3MM8B 3QICA 2MQPA 2FD2A 2LEPA 4ANDA 3I0RA 1H74A 2LA4A 4QS8A 1U8SA 2O8CB 1RU2A 4CF0A 4YR0A 4G1PA 3BEGB 3SCXA 2GJ2A 3FGVA 4X65F 4FP9A 4KH0B 3MXJA 4Z4HA 3PX6A 2ATQA 4KIAA 1Q16B 5HJYA 1NJYA 4J8FA 1S10A 3TU5A 4FZYA 2R7QA 2YY3A 3RBEA 2IDOA 5C25B 3CCTA 3D1HA 3BGFA 5E7OB 2ZJPQ 3CCSN 2BUNA 3ENVA 4FJKA 3QAUA 3RUBL 4AUKA 5G0RA 2VDHA 2B8QA 2W9BA 5DG9A 5F2RA 4HCCA 2OTJS 2VPWB 4FJMA 2WOMA 2F7TA 2ZM6K 4NCBA 4RW4A 4OL8A 2UUCF 2HQ3A 3T5JA 1U0HA 4Z94A 3D1QA 2IAJA 2OUGA 2Y0BB 3MURP 4KRWA 1L3KA 3UR3C 5IC6B 2O01C 2IVPA 1EKSA 2DPNA 1WI8A 3B6PA 3NWGA 3GE1A 1UZDA 1BL3A 4ISGA 5E3PA 2DY4A 4EP5A 4B08A 3FFIA 4H5RA 3LTOA 3SDEB 1ILYA 1BI4A 3I8BA 4GKJF 4NCAA 3G8SA 1SV5A 3LQVA 2A3ZA 5KAKA 2V9WA 3CWJA 3DOKB 1J5OA 4MDAA 1X4AA 4Z7CA 3QJLA 4DHVA 3RRKA 1WAJA 2ZVSA 4M95A 4CD3A 3W8GA 3MFHA 3AA4A 1UP1A 1E6YA 3VQ7A 1BHLA 2KZZA 1RAHB 3FKBA 1YAGA 3FVYA 5IWAJ 3BBBA 5K8MA 2MQQA 4OI3A 1H73A 4Z4EA 4DUYJ 4ZCLA 1HL6A 2X1GA 2O8CA 4A62A 3SQ4A 4NX9A 2V67A 1BLUA 2QI2A 4FS1A 2EWSA 4HKQA 4K4XA 4V1Ak 1ZM3A 1HWIA 4WIIA 3MOZA 4M5DB 3F44A 2QW9A 1YVNA 4J9VA 3A1YG 5HMWA 3NGRA 2G0JA 1BMQB 4PKGA 3KK3B 5C25A 1IG8A 2X1FA 1Y9OA 3JYTB 5AXKA 4X4TA 4O3PA 1NSQA 2PC6A 2J9CA 2YPYA 3C6HA 1S1UB 2NXJA 3OYDA 3RB4A 3CE8A 5EU7A 3RMAA 5KFNA 1W0HA 2ZHBA 4UUXA 3EYZA 1KQSM 1CJKB 2GW8A 1FVSA 2B4PA 2WBMA 3I82A 2QA2A 2MXYA 4ANCA 2XGPA 3GYNA 2WSCC 4WP3A 3PY8A 2YWKA 3IFEA 4UY8T 1HNZJ 5C42A 1GLJO 5F8MA 2D9OA 4FXWA 3PG9A 2V0NA 4LQ3A 3O8WA 4Y2KA 3SXLA 4LREA 4FJ7A 5KG0A 2VICA 2MQOA 2NR0A 1PIEA 3HHNB 3H5XA 2W24A 2R8IA 4JV1A 1K73T 4BRCA 1HJRA 1Y3KA 1K44A 2KG1A 2KW4A 3K7RA 2BJ3A 5HROB 3NGSA 3VTIA 4ILJA 1U8WA 3DOLA 1NB7A 4A8OA 2XS5A 2UXCK 4FM1A 3KLHB 1FDDA 2CH5A 3SDEA 3CMQA 4MJKA 3L6QA 3GMGA 3CSKA 5KPTA 1EX8A 1PYOB 1RDUA 4B1VA 3CCLS 4CLWA 2VGMA 5JMNA 2P6TA 4WCEQ 5E84A 3DOKA 2K3KA 3VAHA 5CA5A 2YKMB 4A2AA 1RBAA 4CEQA 4UQGA 4IFYB 4MMOA 3Q8QB 4HT7A 4FN5A 3SQ2A 4BVOA 2Z1HA 3OYAA 4GKKK 4OZLA 4XDCA 3OS2A 4ILMA 2MDAA 2FBXA 5GAGI 4NA1A 2RE1A 3B6OA 2RPIA 4IKFA 3W5XA 2VF3A 3THTA 3RSEB 4RLEA 2IIHA 3MMCB 2BKPA 2IRXA 5AZJA 3CCUS 4ZVEA 2NNWA 2BE2B 2ETJA 1VQMN 4B9MA 2VD3A 2E1PA 2GELA 1XMQJ 3FE1A 5LOQA 4BE1A 3NGIA 2UU9J 3V81A 4DU1A 2LXFA 2YQ1A 1S1WB 3H25A 4X4PA 4MLEA 3KK3A 1NK7A 2LQ9A 3OLAA 2WVBA 3JYTA 1SVDA 4IFVB 3HZEA 2F9DA 4J9RA 1S1UA 1VQ6N 4JI7K 4K7QA 1MMLA 3UCGA 1JLQA 3DGVA 5KRTA 5CD4H 2A1SA 1K9MO 2NYIA 4EZ9A 3ZNJ1 2U1AA 3OXFA 4C8KA 3EVWA 4CBWA 2ZOMA 4RNOA 3WEEB 5KOXA 3CGIA 4DCPB 1L5UA 3V9XA 3SMPA 2XTJP 1OIAA 2CQ1A 4AILC 2CRLA 3OTBA 3SEOA 1UJ5A 4DV1F 4E7IA 4HACB 2LP4A 1O13A 4B3SJ 1LWCA 4LFAJ 5IT4A 3HT3A 2FJBB 3TA1A 1DGKN 4YDXA 2B4OA 2W6LA 3LPUA 2BANB 2KKZA 3ZEUA 3C65A 1TUWA 3O9SA 2ASMA 3T1HJ 5K8NA 4X64F 1N0UA 3GQCA 3D9BA 4X66K 4KAZA 2GZOA 4JI6J 5EUHA 4DV3F 4CHZA 3JAMO 2P51A 2B8PA 1HLUA 1N32K 4ERDA 5FROA 2HBZB 3W5YA 1VMBA 4UOCA 2J0SD 3CCSS 4KV8A 1NUEA 2GHVC 2NXEA 4DSFA 4IFYA 4JI2J 2VA3A 1HMVB 1B7YB 3OBIA 1H38A 5AQIA 5EX3A 3OYLA 1S72S 3BKTA 4KAIA 3TZXA 3ZSZA 4A8XA 2VQEJ 4K4YA 1VBZA 4QWDA 2EFOA 3RSEA 4MT1A 1ZZFA 4B1XB 5CAAA 1N33J 5GADU 3MMCA 2HW3A 3AO3A 1R59O 2NRRA 4K42A 3V2UC 3M9OB 1FKAF 2CH6A 4A5AA 3VGMA 1RYRA 3D3BJ 1S1WA 3HP6A 3U9ZA 2BM0A 4CH1A 1LK5A 3VGKA 3F5TA 2FPHX 2HLUA 5IQ6A 2DRBA 3NGYA 4IFVA 1V5IB 2BA9A 5IQQA 3RAMA 3RW7A 4CESA 4OX9F 1UJ6A 3W65A 4CHNA 5M1NA 1O1WA 3IS9B 2HHSA 4ZLNA 3GBTA 2KVQE 4FJHA 4NMLA 3K8VA 4FWRA 4TY9A 4DTXA 3M1VB 5DDRC 2D3OR 2WFBA 2DGTA 3H1VX 1R0AB 3RTVA 3R5JB 1GNKA 4K5RA 2KJWA 1IBLJ 5BYRA 3I31A 4OJHA 4ZLPA 5C5JA 3MEKA 1NXIA 2ZGZA 1WEXA 3H4DA 2W1BA 4YHHJ 3DU5A 1RAGB 1TMJA 2DNLA 2ROPA 2BANA 1HI8A 4WXOA 5ETLA 4WF9Q 1RBOB 5D3GB 3OYHA 2OEKA 2MMYA 1WHVA 3R5DA 2YQ0A 4DN9A 2XNQA 3K5PA 2BTFA 3R1HA 3TVKA 2MKYA 4NLXA 1LW0A 3ZZ0A 2JSXA 2KKHA 4BRKA 1BQNB 5KFVA 3AGKA 1HNWF 1T3VA 3PIPQ 4LFCJ 1PJ6A 2ZUAA 3P8BB 2C2MB 2XO7A 2GX8A 1RYSA 1P90A 4TY8A 3G6EN 4QCLA 1OKJA 3GFHA 5ADXH 1EZZB 4IFEA 2JZ5A 1S6PB 4LF9J 5KFTA 4FCYA 4K2XA 1IKWA 2QL7B 4DV2F 4U6PA 3G10A 2WB4A 1DLOB 3OTOJ 2BACA 4F2SA 1HA1A 3WX4A 5J1EB 1NJZA 4NI2B 3J81O 4QYZJ 1U1OA 3D28A 3V6KA 3HHEA 4ZTJA 5DQGA 2YV0X 2EFVA 1YTUA 2KM8C 4QU7A 3DFEA 1KD1T 3Q22A 3VGTA 5KPRA 3D2EB 1YJ9N 3K5MA 2UVVA 1CLQA 2W7OA 4RNMA 4JI8F 2QWRA 3GR0A 2IFXA 5AZIB 2XSFA 4EK2A 3D4JA 4U7CA 4DV0J 3GYXB 4USWA 3TR8A 3OYJA 5FJ4A 3LDLA 5CABA 1O5JA 2FZGB 1R0AA 3HJFA 1LEOA 2BW7A 1U1PA 4DQIA 1HPZB 4FWNA 1Z2LA 2OP5A 2ZH2A 1Q78A 3RYLA 2ZH5A 3CM5A 2J0WA 2O3DA 4YN3B 4WQ4A 1T9UA 4NLRA 2LU1A 3GV7B 3ILOA 1I1GA 1NPKA 2Z2ZA 3RRHA 1VQMS 3DM2B 3G71N 3KG1A 5DRKA 3FZKA 2HMPA 5D3GA 5D15A 3ENHA 2RUSA 5HI7A 3D6TB 2P5GA 5F3ZA 3RR8A 3G6VA 3CJ3A 4CT9A 1BQNA 3R3TA 2DNGA 2J9DE 4PYDA 2KL8A 2EK6A 3BS9A 5HBMB 3TJAA 1VRTA 3UR0A 1N5SA 1XHXA 3F0NA 3LWMA 3LP1B 3IRXB 2BE9B 2CUYA 5DK5A 1QQCA 3IG1B 2LA6A 1YHQN 4BC9A 4ZKAA 4H0VB 3V5RA 3JQJA 1DLOA 5AQMA 3D68A 4NLBA 5FDLB 3SQ1A 5J1EA 2QTDA 3N6MA 4KBOA 3MD1A 1Z6RA 1FCAA 4XK8C 4Y3CA 4Y1CA 2X3GA 4M94A 2WB1D 1FJEB 4I56A 3ONQA 1U1RA 1MDUB 4ZPDA 4FYYB 1FW6A 3NGUA 1WORA 3LM9A 1X4BA 3I5AA 1ROFA 5HL7Q 1JL1A 2VBXA 4DX7A 3VVUA 2GO8A 2KTQA 2DXEA 1BCOA 1RAJA 1G4CA 4JK7A 1YJVA 5A2QU 4B3TF 3L2RA 3TZYA 2FZKB 2J8SA 3BKUA 4XIUA 3MXMA 4A47A 2NRTA 4JOUA 2W40A 1MW7A 4DPXA 4TN2A 1S76D 2OD6A 3THPA 1FVQA 1PJ7A 1YK9A 1HPZA 3UNYA 1R6VA 1OO0B 5HRPA 2EI5A 2UXBK 3Q86A 3OTOK 4A46A 5BREA 2G9OA 3HJVA 4NLPA 4F0MA 3HT0A 1GFWB 3DM2A 3WUHA 2AA4A 1RT2B 3TEHB 4AHRA 4M5MA 2Z1GA 3NGTA 3R7BB 5H9EJ 2B4JA 1SQFA 3AOBA 2QO3A 5DM7L 2RDJA 2KM8B 1YBUA 4ES3A 1PILA 1KLNA 1HRHA 3O6QA 4QAGA 4RBTA 2MLZA 4FPAA 2UUAK 1CZ9A 4ECRA 5DDQC 3CCWA 5HBMA 2XHCA 2DGOA 3FDSA 3TX0A 4A61A 4CGHA 5LMNK 3POTB 3GIMA 3LP1A 2N7YA 2FSJA 1AZSA 5GAHI 3J7A1 3GFXA 5BPMA 3P4IA 3IG1A 1UAWA 3ZZYA 2DGUA 4FXDA 5HQMA 3J7YI 4CI6A 5F3TA 2FGOA 2OO4A 5HRSA 1YJWN 5FDLA 1T94A 2MJNA 4I0WA 5AXNA 2P9KB 1VR6A 2GO9A 1WSHA 5HP1B 2D1CA 1CVJA 2DXDA 4D3HA 3LPTA 1JNRB 4X65K 3R8YA 4JV2A 4FM0A 2WBRA 4CEDA 1W9HA 2B3TB 1K1QA 4CH0S 5A8KB 3CJKA 3UN3A 2QG9B 4O4GB 3FUYA 3O4QA 2G8VA 2DR8A 4B3RF 2HBRB 2HQIA 1VQ4S 4KHPF 2XMTA 5DDPC 4BQZA 5M1KA 4C1NI 2KO1A 3RMBA 2Q0RA 2K1RA 2HHPA 1HLWA 3N4WA 2R9LA 1JCFA 2RU3A 2IA0A 5HMYA 5D0HA 2UUCK 2AU0A 4LF8J 3J80O 4ZS6A 1WHYA 2BKNA 3AA2A 4BLGA 3KVGA 3R1XA 2MLYA 5F0XA 1X4FA 3I4HX 1HNIB 1TVRB 3GYGA 5GAHP 1AUDA 2HNYB 3WQPA 3LA0A 1Q8BA 2AEFA 1RACB 5E0OA 4ZJLA 1SUQB 3LDPA 4PG8A 2NXUA 3U3YA 4GKJK 1WSVA 4AL7A 5A76A 2ASLA 3K57A 3C66A 4KRFA 3WBZA 1JQGA 2IVFB 2VG7B 4I1TA 1UFKA 2DT9A 4NASA 1EETA 4F4AA 4CFCA 1O0PA 2YX1A 4ZVGA 2CQ4A 1HWJA 1W97L 1CG2A 3IA0A 1SZ2A 2IIRA 4M3TA 1WEYA 2P2CB 4DOZA 4DPYA 4DTUA 2LQBA 4R8UA 4RTFD 5JICA 1W25A 4ALZA 5DETA 2P9KA 4CGJA 5HP1A 4LF5K 1HD0A 1WOSA 2C3PA 1NGIA 1IQZA 3DN9A 4DPOA 3WNGA 3JSBA 3CPWM 3G71S 2J7UA 1R43A 3IR7B 2QC3A 2BJDA 5A8KA 4X64J 4USHA 4CZCA 3Q7BA 1TL4A 1HHQA 4DV3J 5GVQA 1UA0A 5IT0A 1RJJA 3OTCA 3AQOA 5HO4A 5GADP 4C0OC 2JLGA 1RT4B 2Y9HA 2ADBA 4HTIA 1RTJB 4LSNB 1MN9A 1XQIA 2DCUB 2OD4A 4CZFA 5F8LA 1I3AA 1VQ9N 4KGMA 3C2PA 3MCAB 2RDDA 3AVAA 1UPPA 2BW2A 4CZLA 1YHQS 1RT5B 1R8AA 4OI6A 1RWWB 3ZZRA 1HQ2A 2MQ8A 1VCTA 2E1MC 1OPIA 1WSIA 3MM7A 1TVRA 2YKAA 4F0HA 1B70B 2N4CA 4ILRA 1RDRA 2C3YA 1SUQA 4KHYA 4Y34A 5LSRA 2Q2RA 4AYBD 3SIPB 4DU4A 2W6KA 4RBUA 2XCAA 2RS8A 4CZEA 3QT7A 5D4LA 3K8WA 3A5LC 3M3ZA 3O1WA 2AJQA 2VG7A 4KGZB 4OX9J 1JKHB 3GE9A 3HFVA 3HFZB 3EE8A 5IM0A 2ZBPA 4C8YA 3THWB 1WC3A 1RISA 4C1NK 3K17A 2V9KA 5A6WA 4YOYA 2HQFA 4E1MA 4ED5A 2XB2D 3KDNA 1Q8IA 4CLTA 2KXHA 3HOTA 4USMA 3AVFA 4JKEA 3HPOA 4OJRA 2MEWA 1RHRB 3PR4A 2ZC4A 3N6LA 2JEFA 4CM2A 3CFRA 3CB4A 3M8PB 4A8QA 1RADB 4CEZA 1XJWB 3KHHA 1VQYA 1X5TA 1HBNB 1TKDA 1KN6A 5IOLA 3VEOA 5EWEA 4QW9A 1Q7YO 3UCZP 4NA2A 1BUXA 3CMAS 4H0OA 1RDWX 3IR6B 4EO6A 4J9PA 4QR0A 4QWCA 3U7JA 1RT4A 4DV5J 1RTZA 2DYAA 1RTJA 4LSNA 4J2AA 2E44A 1OJ4A 3A8YA 1TR0A 4J5OA 2VJVA 5DZ7A 2BJ9A 1Q5VA 4QYRA 1UWBA 3W3DA 2G0CA 3CPEA 3PV8A 1FERA 2NXCA 3F2KA 2OPPB 2FUG9 4DV1K 4OHWA 4O44A 3R2DJ 3SI6A 4FJ5A 4DV2J 4Q45A 5BYQA 4DR3F 1YJWS 2GWKA 4XEIA 3H42A 4ECVA 2JWLA 1U45A 4LF4F 2FY8A 2RIJA 1YTAA 4E7JA 4DQPA 2CKWA 3CF5L 1HHTP 2N3OA 3QO9B 1B9FA 2ZWPA 3PRDA 3N4PA 2G8KA 4FJIA 3T19A 3CQ8A 1RT7B 5IFMA 2FJWA 3O9RA 2VUGA 4ECUA 1UEKA 4CERA 3H98A 4KTWA 1QY7A 4JI8J 3WZ0A 3QEIA 3AARA 3R27A 1WKKA 3DGPB 1FESA 2HF4A 3O8MA 3THWA 3M4XA 2UVRA 2VBZA 1IJFB 4CZKA 5L8RC 4USUA 4J7CA 2RF2B 3BPDA 1T44A 6FDRA 3US5A 5K9FA 4Y65A 2R8HA 2C3MA 2XO6A 1EWRA 4Y1DA 3ZTRA 1HKAA 3Q23A 4C7QA 4MAKA 3UQSA 3DLLL 2IYIA 4L3KA 1UJ4A 4JLHA 5BR9A 1SXLA 3MEEB 1Y11A 1Y3JA 2XMJA 5FIIA 3SI8A 4CD1A 1VQ8S 1WI6A 3OYFA 1PAUB 1HBNA 3BKFA 4CE9A 3MXIA 4I6YA 1GT8A 8RUCA 4FK0A 4DMZA 4M7XA 2HKEA 1CJUB 3E9OA 3GL1A 1Z2ZA 3I55S 1N5VA 3AD8C 4MQ3A 3GPAA 2F4VF 1RBVA 3TJ8A 3SUQA 4A59A 4PKDB 1TUGB 2IM3A 3U4LA 3PX0A 4NLYA 4UZBA 1DURA 3G0ZA 1TTHB 3I6PA 3FQLA 1RHJB 1UZHA 4DV4F 4FVMA 2H5IB 2J9EA 1RAAB 3O9UA 3M05A 4E1JA 2VKZG 2ZDPA 3CJBA 3TTDA 2D74B 1N8RO 1NCLA 3FBFA 1EB0A 3PJWA 3H08A 4M3ZA 3DDNA 3NS5A 2K2PA 4CJKA 4WE1B 3H2UB 1D1UA 3QO9A 1VHXA 2YHXA 1QQNA 1P8ZA 1QQMA 1Y4ZB 4FKYA 3AO1A 3SAHA 2QYGA 1NO8A 5KFHA 3GWCA 1UVLA 3L7OA 1R6YA 3SCJE 1NDLA 4DCOB 4IJNA 4IR1A 1HNWK 2VONA 3MUTP 4HH0A 4B3TJ 4M45A 3PJXA 4IJAA 3DGPA 1D4XA 2OEMA 4W98A 1E3MA 2Q6CA 2F96A 4IUFA 3J8AA 3IAM9 4CJWA 2RF2A 2ZBCA 2L9WA 5F8IA 3HM9A 4ZVFA 5AQXA 1S57A 1W2IA 2NLWA 2IRYA 1T03B 3CQXA 4KI6A 3GILA 4ZPTR 5HJXA 1OY8A 1J5EJ 3QSYB 2QSWA 3KIOA 3I9ZA 1UFLA 3TWZA 3CCZA 3VCDA 5EN1A 2IVMA 4USTA 1LAVA 4OYBA 4B3OA 4A8MP 4CNZA 2ZEJA 3TA0A 3CD0A 1S9GA 4HYKA 2EG1A 2BUPA 1S9EB 2BOAA 4PWUA 3QERA 4L76A 4IG3B 1VQNN 3AB4B 4FJ9A 1XNRF 3CULA 1XQSC 3DHWC 4YP3A 3VQ8A 3VMFB 2NXNA 1G15A 4RW7B 1XMOF 4CJEA 3P5BP 4OVLA 2M52A 1M5VC 1UVJA 3TW0A 1DEJA 4CZJA 1FD8A 2O8EB 1SC3B 3MR7A 1YRTA 2ACMA 1HNXF 2MJUA 2E2NA 3WT0A 5DZ6A 2CQDA 1TKTB 2ZC3A 1ZA1B 3DXMB 2XY7A 1E4GT 3DOMB 3WHIA 4ZCIA 2P8IA 2ALYB 2V52B 1KVBA 2W2OP 4FW1A 4H4MB 3ZETA 4BREA 4RU9A 1CZAN 3C94A 1T9XA 2X51A 3BB5A 1JLBB 4DF8A 4JAXA 4J91A 4DQ8A 4F0KA 3VAKA 2K8GA 2C3OA 2ADCA 1JCGA 4WE1A 3VQ9A 2AYEA 3MMAB 5AE1A 2JL9A 4NL5A 2OANA 4U7UK 3EPIA 3UN2A 3NNAA 3M8QB 4CLFA 3EGVA 1GTHA 1T11A 5KFFA 4IDHA 3CC7S 2XC9A 2H48B 3ZT3A 2YNHA 2Y3YA 4ED0A 2CXEA 5F8GA 4B3RJ 4IZ9A 3K5NA 4FVUA 3NBPB 5A2QO 2ZJQL 5B0DA 3CDEA 4I6WA 2V50A 2H54B 1NK4A 4WFAL 1FFGB 1WNEA 4WFBL 1PG5B 5AQZA 5KG3A 5AQOA 1EQ0A 1CXQA 3VF4A 5KFPA 3OBYA 1TYQB 4EMDA 1T03A 3HTVA 4KH1B 3QZ8A 3HDSA 6AT1B 3OLBA 3G8QA 3OYGA 2WTFA 4NXMK 3O80A 2QWLA 2V7YA 2DFHA 3M2VB 4DN0A 5FRMA 3LZJA 3ULEA 1WAFA 4EFHA 1F3VA 2NUUG 2VL1A 3HVTB 4LIWA 4I2QB 2GUPA 4IG3A 3IBFB 2HGLA 4CHYA 2WRMA 5D78A 2M9KA 1S9FA 3ZZOA 4TNOA 4B3TK 3OFHA 3BYRA 1WSGA 1KR4A 3QNNA 2J6SA 5KFOA 4N8OA 2UVUA 4FYXB 4Q44A 3WIUA 4YB1P 4DS5A 3JQMA 1YI2N 3PIOL 1TKTA 1BDGA 1Z05A 2V5HG 3PKYA 4BC4A 4DCJB 3CCVN 2HNZA 3DOMA 3ENOA 1U2VB 4DQQA 1PAEX 3EKSA 4USIA 2OI2A 3GZ7A 1S1XB 1JLBA 1KC8O 3NE6A 2AP6A 1I94F 2RRNA 3V9WA 3GJSB 2Y8WA 3VZHA 1QSSA 3JXUA 1U02A 3MMAA 2QA4N 2PMHA 3VQBA 3AOCA 4KBIA 2HMIB 1SJ4P 4RNFA 4CGFA 4NLDA 3WIVA 2UUBF 3O9TA 4YDUC 4Z0UA 1P1LA 1C0MA 3A0IX 3M8QA 4FBUA 1ITGA 1KVJA 1FJGF 4IOXA 3PJ9A 5HVGA 2ZZNA 3VAFA 1F0XA 2CPEA 4LUBA 1Z1ZA 2P9NB 3NBPA 3IKMA 2GA7A 4R79A 5HSPA 1RP5A 5C2FA 4RWTA 4JKAA 1S5ZA 3NP5A 4E7HA 1SQEA 5EY4A 2R7RA 1I3OB 1T0TV 1VGYA 4OX8A 2B56A 1HQEB 1NU4A 1YVFA 1U24A 1TYQA 2I7NA 1IQTA 4I6MB 1ZYQA 2R8KA 4H4KC 1B99A 1PBUA 3PHEA 2NUHA 5E3RA 3OR2B 1C2PA 3M2VA 4H5TA 4IEIA 3HSGA 2I1RA 2XHWA 3BGLA 1M5OC 1ZBHA 2ILYA 4BY9C 3HVTA 3CO0P 4M42A 3FEZA 4HHJA 4NZ0A 3CJ0A 1HARA 4DUZK 2H9ZA 5IS2A 2WSEC 2F4FA 4F9OA 3EZWA 3EVOA 3VN5A 3LL3A 3ZSOA 4KHPK 3FRYA 3AVCA 5D0EA 5I4MA 1RAFB 4OHXA 2LEBA 1S0NA 2GVDB 5SUHA 2E6LA 3M7VA 4LRBA 1KXPA 2V7ZA 2YWWA 3CDBA 5KG2A 1U2VA 1VSFA 4LR7A 4IEEA 1G6BA 1N0VC 5FLXO 5KG4A 1XI1A 1FNXH 4ECYA 4MKBA 1S1XA 2CQ3A 2XLJA 1GEHA 3VAJA 1LNQA 4UUWA 5BYSA 3QSIA 5LM7E 5L9XA 5AXLA 3EJMA 2ZVIA 3OR1A 3HULA 1IBCB 2J6UA 1VBYA 4ES1A 4GO7X 3CJTA 2O8FB 3PW4A 3I5BA 5B7WA 5IV3A 3SCIE 4XO0A 3LGNA 5LT5A 3EPGA 4OI1A 9RUBA 3DDIA 2QKKA 4DR6F 4Q5VA 2GBZA 3HL8A 3RMCA 2PO4A 4X4NA 4ECSA 3T69A 2OTLS 3HSJA 5ETSA 2MGZB 1XK8A 2P9NA 3L7UA 3T41A 2DPIA 2CGKA 3MUMP 3UKRB 3EXCX 3GDQA 4EWTA 4WFNQ 1QVGR 1IN0A 3M5RA 2OLWA 3CTRA 2G8UA 1HQEA 1UVMA 1IJJA 1K0TA 2HHXA 2LDIA 2ASJA 3KUHA 4H8KA 3LH2S 4CW7B 2YX4A 1EWQA 5T7LB 2AJ1A 4I6MA 3MFIA 3H6EA 2GS8A 2BJ7A 1WG4A 4JI1F 1RA6A 1SL2A 4DR3J 1NGGA 1IBKF 3OR2A 2D0AA 3S6EA 1KSPA 4ITSA 4YOTA 2CQ2A 1Q86T 4QWBA 3NNCA 4DTNA 4ZPBA 4AQYF 3VVTA 2V8VA 4DR5J 4JI5J 3ZT1A 2DHSA 1VBKA 3VALA 1IJEB 1V4TA 3CCMS 2VJUA 1ZBTA 1YSJA 2YPZA 4Y6IA 5IC4B 1V4SA 4ZK7M 1IWAA 2RMLA 3CCQS 3C0BA 4XH1A 2DNQA 4E98A 2L08A 3R1LA 2QKBA 1K8AO 4IOCL 2ZD1A 3E01B 5LJVA 4CJUA 4URSA 1SAZA 1ZM2A 2IMOA 1FNMA 1FX4A 4ZP7A 4KFBA 1NWKA 3OYKA 4YOEA 3MD3A 3AAWB 4M5NA 2O8FA 3IXQA 3BF4A 2HGMA 4OYPA 4ZLJA 1S1VA 1XTZA 3PFEA 5CYQA 1OY6A 1ZM9A 3PFOA 4NZ6A 4Y28C 3PTWA 1MMNA 2JJ4D 5GAEU 1ZOTA 2QMUB 3LDOA 2CPYA 3DXKB 3TPQA 4D3GA 1O8BA 1MSWD 3BF1A 4LH5A 3L2WA 2F4VJ 2LQ8A 3HXMA 3UKRA 4NLUA 3AXMA 3R5BA 4KB0A 4DKWA 3D0GE 2AZ1A 5AQNA 1YI2S 4K4TA 2ATLA 3DLKA 1SQGA 4LQ9A 3E2EA 1RTHA 3O2IA 2DVIA 5LY3A 4Q8EA 4LFBJ 2I7PA 5T7LA 4RKUC 4DV4J 4JV0A 3SFGA 4JD2A 1S6UA 1FWPA 2P9PA 2E5IA 2GMLA 3C6UA 4G3IA 3K2PA 3NH1A 3VWSA 3G4SS 2R7UA 2H3GX 5AQFA 1QVFM 4OYXA 5FPDA 4CLKA 3BO4A 3QIDA 4C6AA 2VPZB 3KZBA 1FA0A 1KEKA 4X62J 2PA3A 5LMUF 2G0IA 4YDDB 5DG7A 2H51B 4NLWA 4YDUA 2QEXN 3ZTQA 3NWRA 1GLLO 5KG6A 2QWMA 4AHUA 4HUEA 3L3VA 2C2EA 2ILZA 4DL0C 1S77D 3AVNA 2D1KA 1PYSB 2ZBRA 4M3WA 2QT7A 4DU7A 4CVNE 2D69A 3KLFB 1U2RA 4FZXC 2XWYA 1ASUA 4DQSA 1LWXA 3UO0A 2MHEA 1TKZB 4YORA 4J37A 4CJSA 1YIJS 4DR3K 1IVZA 1WKLA 1WD6A 2DNKA 4KB1A 3CJSA 5J2MB 5AE2A 3SYZA 1JNZB 2EK1A 4LF4K 1EIYB 1VHIA 2NS1B 4QWEA 1S0MA 2JC1A 4S0MA 4CCHA 2B9EA 3OS0A 1T3OA 4OPAA 1WWHA 1WDTA 2ZF5O 4B9VA 4RG8A 5CZ1A 4DR2J 1Q5YA 2GC8A 4MH8A 4LF1A 2P9LB 4BRPA 1O51A 3VEWA 1GH8A 3ZSYA 1XNRJ 3DHXA 4HHTA 4B3MK 1REVB 1RUSA 1FE0A 2Z2MA 3NAEA 1XMOJ 2G2ZA 3R9PA 2W4DA 2Z2YB 1SJFA 2QLBB 4IH5A 1VJWA 4C8ZA 5BRDA 1M0SA 3RGIA 3KNAA 3MECB 3E8OA 4DR4F 3PYFA 4O4RA 4TU8A 3QYYA 2FHJD 2Y1IA 3BGRB 3VQ4A 2L48A 4HL9A 4KHWA 2OHDA 1ELOA 2VFUA 3BZCA 1WTFA 1R7IA 3R2CJ 3K0SA 3UKUB 1FK9B 3IDHA 5BPNA 3S7RA 3P96A 3C8YA 1S12A 3HLUA 3VQ6A 4QU6A 2DIVA 3U9DA 4ZVUB 3ISNC 2O8BB 1Y5NB 3IWXA 3B8HA 2IM0A 3RZAA 4QBUA 3AT1B 5H1SQ 3V6JA 3VQ5A 2KFZA 2MTLA 3O4NA 2GVZA 1Z25A 3L8BA 1FDBA 4DJBA 1C0UA 1W2BM 1B9DA 2CFXA 4CEEA 5CY4A 3TAQA 4DU3A 2KZMA 3KLFA 3FEYB 3LF0A 2R7SA 5DM7Q 1HD1A 5HVFA 4DV4K 2MZSA 4DL3A 2B7CB 3MZIA 5BN8A 2BH1A 1WOPA 5M1OA 3QZ7A 3HHLD 2Q3PA 4FWKA 4TYAA 1SL0A 5J2MA 2M3DA 2HRTA 2X1BA 4P7VA 1U25A 4BVPA 2MKSA 2KFYA 5B0EA 2LDYA 4ZVSB 1XC9A 4C8LA 2MKIA 3ENBA 5DLFA 2A2DA 2V8HA 1AROP 3Q0AA 4WQ5A 1HWKA 1V5VA 3QGHA 3QFWA 3WXKA 2Q0UA 4AXJA 4FYDA 1EP4B 1WSEA 4YOWA 1IKVB 3HO1A 4GVMA 4USVA 1REVA 4DUYF 1TL5A 1WF0A 4FLXA 1FJCA 3ELHA 1LWEA 1QHTA 3U1NA 2V4RA 4L6V3 2HHHK 3MECA 1N4LA 2E1CA 2D0CA 4X4QA 1Y0HA 2AD9A 3BGRA 2PI4A 4FL9A 2DRDA 4PYAA 1PC4A 1S1TB 1NK5A 4BC3A 1N5TA 2CJYB 1EKEA 1VRUB 3UKUA 1FK9A 1I94J 4DR7J 4OYWA 3AV9A 2YNFA 3BO3A 4JI3K 5C24B 2WSFC 4ZITA 5CYMB 1D8YA 1HNZF 1YT3A 4IO9L 2J4RA 3VA3A 3QDKA 3P5TL 3FMWA 2WHOA 1FJGJ 3CCEN 1WF1A 2NSBA 4ED8A 1U26A 1WC4A 1HNXK 5GINA 4DV7F 3NH2A 3OYIA 5T14A 4BDYA 1SJQA 1FKPB 1SS6A 5D6GA 4XAKA 5IT9O 2HFUA 1KRPA 1Q4RA 4GVBB 5KTQA 3T6BA 4CBUA 3VF2A 2HVZA 3L2VA 1KWMA 2K3IA 3M2UA 1TMMA 5E3QA 3UDVA 3BF3A 2C1EB 2FVRA 3BSCA 3HF5A 1CLFA 3KMQA 1BHNA 4FLVA 2C3UA 4NPOA 5I9EB 2YKPA 3H3NO 1RDDA 4U7UD 4BROA 1RBUA 1VI7A 3JS9A 1IKVA 1AYEA 4FPRA 1UW9A 2RUGA 3T9ZA 4AHCA 2V34A 1K8KB 1LV5A 2Q66A 3TAEA 1VQ7N 4MFBB 1KONA 2GAHC 1NHUA 2ZWOA 1IM4A 2GV1A 1HW8A 3QGPA 1XMQF 3KOAA 3M6GA 3CMES 3D6MB 2C2DA 2UU9F 2GCFA 3KLVA 3C7NB 2YQ3A 2QM1A 3NY0A 3GONA 3S9HA 2E2QA 3VQAA 3H1QA 1TL7B 1S1TA 1CS4B 4UY8O 5A8RB 4OJ3A 4X84A 1HI1A 5KFCA 2VQFJ 4ELUA 1DHMA 2FQQB 2HFOA 5AJ3K 3S3MA 4IKAA 2HFZA 5KFEA 4H0PA 4W90B 1H2TZ 1UTAA 3MDQA 2F9WA 2BX6A 4PPZA 3P45B 1QTNB 2PEHA 5EDWA 5CYMA 5BPLA 1K73O 3BSAA 4HHUA 1GLAG 1S7IA 4CJ5A 2E5LK 3E66A 3WQUA 1ACMB 4B3SF 3KHYA 1M90T 4PL8A 3ZLJA 1QZ6A 2DFEA 5KFQA 1ZPWX 5JLFA 3ZZPA 3MM5A 1D8ZA 3HSCA 3RVCA 1FKPA 2JOQA 4NCGB 3A5NC 1ICEB 1S97A 2MSTA 5BR8J 1B4SA 4RWXA 3LP3A 1WC0A 3KD1E 4JI6F 5M2PA 4DI6A 3BJYA 3MEDB 2V8GA 2J5AA 5EX5A 2QLFB 4GVBA 5BN9A 1C1CB 4NYOA 2R7VA 2F3JA 2PFUA 3G96A 1IBKJ 3FEXB 4Z7YA 4YB7A 3MN6A 3QAEA 1NRKA 5HOOA 4HI2A 1M5SA 4JI2F 5GAGU 4E89A 2QLJB 4USJC 4MYTA 4OYIA 4OO1J 4O5FA 2UUBK 3KDOA 1REGX 4M5IA 2NSCA 2HG4A 1TAQA 3OL8A 4TVAB 3KLIB 3W60A 2DB1A 1K8KA 3H0PA 4XDDA 2VFTA 2P6SA 4MFBA 4CGIA 3MM9B 2PEBA 1LOTB 4Z4CA 4NO7A 1DY3A 4N8NA 3OYEA 4JKCA 4M3RA 1FXDA 1MWQA 5AFUA 4FPBA 2AJ4A 5M2RA 4C4WA 1DARA 4HUFA 4P73A 3R6LB 2H1YA 3SV4A 4FLTA 2YTCA 1X4EA 2PFDA 4JV5F 5DGBA 1CS4A 5U47A 5A8RA 4AF1A 4WBFA 4DLGA 2M8HA 3S3NA 4PXBA 3MCMA 4ENOA 4TXSA 3SBGA 4J9NA 3M9NB 3ZXWA 4RW9B 4HHHA 4KB7A 4KR0B 4EU0A 3H5SA 1MWYA 2QFJA 4RUCA 3PHTA 2C2KB 4BRLA 4WFXA 4PCQA 1OPZA 1TL1A 3VGLA 3CIZA 2XI3A 1EARA 3QEPA 1S0OA 1J9AA 3CHWA 3IUCA 3SV3A 4CWBA 2YKNB 4Z4GA 1HBOB 1C0FA 2W7AA 3LP0B 1U04A 3CF5Q 3ISZA 1HR0K 2BRKA 2DNMA 3CETA 4EIAA 2W8LA 4UY85 2CJXB 4NCGA 4I9QA 3KLGB 1X5PA 1KP6A 1BIZA 2E2PA 3HK2A 2DR9A 4ZCKA 1HUXA 3KKFA 5B0CA 4DMNA 1HQUB 1VQLS 5TKWA 2MZTA 4YY3F 2CYYA 1C1CA 3VQTA 4X4VA 3F73A 1VLOA 2P1JA 2VOPA 1OWXA 1X9JA 2F7VA 4BRHA 2OPQA 4LFCF 3MTKA 4DR6K 2C2NA 2GIRA 3A4TA 4KTQA 1JLAB 4AM7A 2ZH7A 3OFEA 2XNRA 2A5XA 4MK9A 4EAHD 2F63A 3JXOA 3FZBA 4CK2A 1RWMB 4L75A 4QR1A 3DLLQ 2HIQA 4A8WA 4LF9F 2FBVA 3KLIA 2P9GA 4RR5A 1EHWA 1FXXA 2IY5B 1KNZA 4NRTA 4OX7A 4F3MA 1A7GE 1R8PA 3MM9A 1MWZA 2B6AB 4FYVB 3RMDA 4J9MA 3TAMA 1NH7A 4EP4A 3DRPB 2MZJA 2E1ZA 5KOWA 2OELA 3UE2A 4C3LA 4RPFA 2BJEA 2XRIA 4LSLB 2XLIA 3AJDA 2J8AA 4ZPWR 3QIPB 2IJRA 4I69A 3GJQB 2I0XA 4JI1K 4JKHA 3W2WB 5KG7A 3O5BA 2GNKA 3I32A 3TUJC 4RW9A 1BGXT 1NMEB 4KT0C 2UUTA 1RHQB 1S22A 4ED6A 4DV0F 4NLOA 2VYPA 3ILJA 1X3MA 2O1PA 4U96A 3Q83A 4ZOSA 4AQYK 2B9WA 2JRSA 4FDFA 5CH7B 1XR6A 2YX7A 3OPKA 2CPHA 5F8NA 5EXWA 2KJVA 2EFGA 1SJRA 5JS1A 2HWTA 5C12A 2FHJA 5B0GA 1NAQA 3DRSB 1VQ7S 4V19S 3I56N 1OQ3A 3KLGA 2JLFA 2D5RA 1WKJA 1JL2A 2M5YA 4NWBA 4UW2A 3MWTA 5J1NA 2W2QP 3O08A 1DTTB 3A5MC 1NK9A 4DR4J 5K14A 2PMZD 2E9RX 1NG9A 1CULA 4JI4F 3W9HA 2F8MA 3MK6A 3VERA 3GLJA 3QT8A 4CGDA 4MIAA 3R9LA 5HRRA 2RT3A 4GY2B 1TKXB 4L73A 3UCUP 1JLAA 3N5BA 2MKCA 3V9UA 4G1IA 4DG1B 1V9OA 3OQ2A 3K9JA 3LOUA 1HWLA 2BXJA 3HYFA 1DJ0A 2BEFA 4IH7A 4ED1A 5E3CA 2I2YA 2C2ZB 4LIRA 2B6AA 4K4UA 1T8EA 1KD1O 2A1BA 1JLFB 3HHLA 1JCEA 1WNSA 3DRPA 3UDEA 4LY7A 1BIUA 4M41A 3R7SB 3VR1A 2PE8A 4IO1A 2VWJA 2WZ1A 2CJKA 5CQGA 1TV6B 3N28A 3UN5A 3PSFA 5C2GA 5HANA 3JSMB 3LWLA 3C16A 3GFYA 3RJMB 4YB5A 1RWXB 3D6HB 3W2WA 3BGOP 3EZUA 1DQ8A 2IHR1 4CZIA 1GXUA 3CCRN 2Z2LA 2LLZA 4ZHRA 3HCXA 1OVYA 2LECA 4U8YA 2B51A 2D3ZA 1ITPA 2HRYA 3H4BA 3CPWR 3MR2A 4UTGA 2ZFHA 1ZA2B 3WX8A 4KGVB 1UEVA 5LMUK 4H4OB 4EZ6A 1G3OA 1SKUB 3Q7CA 2NQPA 1IBMJ 2OCEA 2HFSA 1KQFB 1YITN 1H0HB 1IR2A 2V2KA 2E8AA 3MM8A 1Y5LB 4P7TA 3CC2N 3G6XA 4P74A 1S79A 2ASDA 3CEDA 1N36J 1QHAA 3MCPA 4JRQA 4K0KJ 4NYNA 4M8LA 5KT6A 2HQCA 3QGGA 2DEJA 2M0GB 4DPTA 3AAPA 3SSQA 1H2VZ 1PGZA 4F67A 3KYLA 2ZJQQ 1IR1A 3VQDA 1F5AA 1NDPA 2LMIA 1KBRA 2AYBA 4WFAQ 3K59A 3D54A 1XC3A 4WYLA 2GHPA 3JAMY 3OJSA 1Q82T 3E51A 4NLVA 3AY9A 3E9PA 1MG7A 4LF2A 2DNOA 4LF7J 2UXDF 4NZ7A 4ES2A 2HAIA 2LFVA 3TTCA 1UKUA 3CC4N 1RAOA 3R8EA 4PG6A 2HBJA 1JLFA 1NMDA 2JX2A 3BQ2A 2IVNA 4G65A 4DQRA 1CQNA 1P9YA 1B92A 1S3XA 4DV7J 3UE5A 2BQRA 2CQIA 2JHEA 1E6VB 5AQHA 1TV6A 3E3XA 2HNDB 5AQWA 5JVHQ 4CF9A 3HPHA 3JSMA 1KAYA 5D77A 3CCJS 3PIPL 2W42A 4CO4A 5JLHA 2HHVA 1UFWA 3FZ2A 2HRUA 1XHZA 2AW0A 4KHMA 3H5UA 4CZGA 4LF8F 4LRDA 3B78A 2AEMA 2QL9B 3OVBA 3ZSXA 1SC6A 1T6CA 1ATNA 5D4NA 4N56A 2ZM6F 2X6NA 2NPFA 1OY9A 3FC9A 1T9WA 3SUOA 4BRDA 1RWPB 4AH9A 4NOHA 3QJPA 3AVLA 3OFGA 1HBUB 3KKSA 2ZITA 2QLXA 4M5DA 3A3OB 3ZFVA 2Q1LA 1URRA 3G6YA 1TAUA 4QS9A 1HKBA 2FHKA 3NF7A 4BG8A 3EEQA 1RBRA 4DWIA 5DMRA 4PXDA 5BRFA 3QLHB 2Z8QA 4HT5A 3P4UB 3H90A 4WWSA 5GAHU 1S6OA 3ULDA 2ZH9A 2G1DA 4CLSA 1CJKA 4C48A 1HBMB 1QUPA 4OZ3A 3HI9A 3ZCMA 1X5SA 2A10A 3J7YU 1YRXA 5D4OA 1ZM4A 2PYJA 5H9FJ 1WJ9A 3AVKA 5IWAK 3CXCM 4WKRA 1PO6A 4DUYK 3CD6N 2AKWB 5HRNA 3DI6B 2FBYA 2XEXA 2R7WA 5BXIA 2R7XA 2FJVA 2ROGA 1RAIB 2DITA 1RB0A 2HHQA 3FCHA 4AD6A 2FB0A 5I3PA 3EICA 2A18A 1FRHA 4FXVA 3LAKA 1E6VA 2OEJA 5HROA 3FQKA 1MWMA 5GAGP 4L8RB 3KLHA 3WXJA 3QQCD 1F9EB 4YFUA 3AO2A 2WBNA 4CJ3A 2BJ1A 3MAAB 5K8OA 4JS4A 3UDCA 1LXJA 2YKMA 3ULHA 3NNHA 4QZVB 1VK8A 3C46A 5AQJA 3MMJA 1U49A 1HNZK 2VH7A 4O3OA 2M88A 1RT6B 1SKWA 4QR2A 4JK9A 1TP7A 4H5WA 3BBCA 2B43A 4N76A 1LXNA 1VC6A 2JGUA 4BDZA 2BE2A 2YWEA 1RILA 2XMVA 2WK4A 4C11B 3TOQA 2G8IA 2YNGB 2AJ2A 4C3KA 2O5DA 1GX5A 1NPRA 5GMKa 1QAYA 3KKRA 3PACA 2M7SA 3TEGA 5F1XA 4JV5J 3D5MA 1FRMA 1FDAA 5AQQA 2QLWA 1JXLA 1HIYA 2UXCF