3T19A

Crystal structure of hiv-1 reverse transcriptase (wild type) in complex with inhibitor m05
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and synthesis of conformationally constrained inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse Transcriptase
total genus 155
structure length 554
sequence length 558
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3t19A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t19A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t19A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t19A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3t19A05
4IH5A 2KFNA 5KFGA 3H40A 3OL6A 1Z25A 3RAQA 4TLRA 2PY5A 4Q0BA 1SL1A 1JXEA 4EP5A 5KRTA 2YKMA 3BJYA 3QLHB 4O0IA 4DWIA 2O4GA 4M3YA 3G6XA 4ZHRB 4M95A 1W0HA 3DM2B 4FBUA 3UR0A 2FJXA 2OPPB 1I3AA 4FJ7A 1S1WA 2HHTA 2FJWA 4TYBA 1KFSA 4CGFA 1NNDA 3SUNA 4AHTA 4ZTJA 1R0AA 3NHGA 1T03A 2J6UA 4H4OA 3H5YA 3CJ5A 4BDZA 5F8JA 3C6UB 3DYAA 1JLAB 1RDBA 3TI0A 4G1QB 4B9SA 5J1EB 2D41A 1RT7A 2ZE2B 4DL2A 2YNGA 4K4VA 3RTVA 5C24A 4O3QA 3AVMA 3PJXA 3ZSXA 5I42A 3QZ8A 3H2LA 2RKIA 4I2QB 2W7OA 3NAEA 3OLAA 2O5DA 2JGUA 1GOCA 3AVFA 4J9OA 1VSKA 3DRPA 3OS2A 3NH0A 4CK1A 4Y2AA 3MEDB 4MFBB 1I6JA 1HQEA 1XC9A 1S1VB 3VA0A 3KJVA 4RW9A 1RT3A 2G8VA 1T05B 3PZPA 4E7KA 5SZTA 2D5RA 3U3YA 2IAJA 4DSIA 4KTWA 1A5WA 3C94A 3QIOA 4WZQA 4CGHA 4EZ6A 4EBDA 1RTHA 4DU3A 3KNAA 2X6SA 3K5OA 2HHVA 1HJRA 2R7YA 3H5SA 2WONB 3M8PB 1LWFA 4WE1A 4CEDA 3ZT4A 1RDCA 3V9XA 1VRUA 4ZP7A 3DRPB 4EBEA 1RDDA 3OJSA 4B3OB 3OYKA 3VQEA 2AJQA 2QXFA 4CERA 3EYZA 4R8UA 4FXDA 3RB3A 4HCBA 4KHMA 4DFPA 3C6TB 4M41A 3ITHA 1WN7A 4F3TA 5I42B 3MEEB 1NK5A 4KHQA 3OS1A 4Q44A 5T14A 3QINA 1TKZB 1TKZA 1JLGB 2FLPA 5D3GB 2WK4A 1IKXB 3ITHB 5KFMA 1A5VA 2RPIA 4H8KA 3UPFA 1RTIA 5J1EA 1N6QB 3KIOA 2FBVA 4FK2A 4JLHA 3T5JA 2R2UA 1HMVA 4LQ3A 1NKCA 1TL1A 3MXJA 1VRUB 3NAHA 4DTXA 4N41A 3I8DA 3H08A 3MEEA 3OVNA 3ZT0A 3CDWA 4H4MB 4N47A 2JLEA 3DI6A 3OYCA 4ZVGA 2RF2A 4MIAA 5F9NA 2JEJA 3DOKB 3V9UA 3OYBA 2BE2A 2E4LA 2R2RA 3T3FA 2FVPA 2JC1A 2IAJB 4FM1A 2I1RA 4CJVA 4FJJA 4FBTA 3HM9A 1C6VA 1C0UA 3UDLA 3QERA 4YP3A 3RBEA 3V9SA 4IR1A 4CHQA 5L1IA 2YHAA 1RTHB 5KT6A 1JLEB 4NRUA 1B9DA 4KI6A 3KKRA 4FW1A 3OYIA 3NAIA 1WNSA 1NK6A 1SKRA 1MU2A 1NK0A 5KFKA 4CJ5A 3G10A 4O3OA 4H4MA 4IKAA 4ED3A 2C22A 3TABA 5CYQA 4DMNA 1HQEB 2YNFB 1RDRA 5J2PA 4CJUA 1TL3A 3SQ4A 4K4ZA 2G8KA 1HMVB 3PR4A 3VQ6A 1REVA 1S10A 3VQQA 4ZVFA 1YTAA 3JYTA 3CJ0A 1QQCA 1DTQB 3L2RA 1BGXT 4CFAA 2RN2A 2DY4A 1SH2A 2AWZA 4ZPAA 4Z4EA 5F8LA 1JLGA 1S0OA 3IGNA 2GUIA 4RUAA 2OPRA 3M8RA 3HYFA 1ZBHA 1IKYB 4DTSA 4DSEA 5KGWA 4Q5VA 3NE6A 1RBVA 3ZT1A 1R0AB 2HWHA 3BQ2A 1S1TA 1K1SA 4DG1A 4K8ZA 4CJLA 1ZBUA 1BIUA 4WE1B 1C1BA 1RYRA 1HRHA 2OPPA 3MFIA 5KGXA 3SUQA 4IH6A 1SH3A 3KLEB 3N6LA 3PX4A 1S6PB 4GMJB 1ZBIA 4ELUA 4F4KA 4NYFA 3HK2A 2LSNA 3OYGA 2HNYA 4IDKB 2V9WA 1TK5A 2XGPA 4J2BA 1SL2A 4FM2A 2IBKA 1WSJA 3O4QA 3TAMA 1RT3B 3MF5A 4RW7A 1BI4B 4AHCA 2ZD1B 3BSAA 1YVUA 2IJNA 5E41A 2ATQA 2V4QA 1C0MA 3S9HA 1F21A 3DRRA 3TAQA 3OHAA 1NHVA 4QOZB 4FJNA 3G6YA 4J9RA 1SH0A 3VQ7A 3DDKA 3KLGB 1S0MA 5L9XA 4ECVA 2XY6A 4DQIA 4OKJA 4RNMA 3L2UA 2RDJA 4ED1A 3OL8A 1JX4A 1IKVA 4IG3A 2BQ3A 2QKBA 2W9CB 4M45A 1K6YA 4WFZA 2HVHA 3HPOA 1B92A 1TKDA 2VG6B 3QIPB 2FLLA 1KHVA 4DF4A 4CHOA 4J9KA 3PHEA 1C0TA 5L1KA 4EEYA 1RTDB 3PY8A 3D28A 5DLGA 3AA3A 1S1TB 4EO8A 4KO0A 2UVVA 3EZ5A 3NF9A 4CK2A 4B8AB 3V6HA 1RT4A 5KFXA 1TAUA 4ZMMA 4ECUA 3PX6A 3AA5X 5JXSA 1FXXA 1HPZA 2QK9A 1IKWB 2IA6A 5KFTA 4CF8A 4ZVHA 3ISND 1JKHB 1YT3A 2BRKA 2WTFA 4J2EA 3DLEA 3M8QB 3LP2A 4CK3A 3DRRB 2OZSA 4IFYA 4NZ0A 3BQ0A 1SV5B 1N4LA 4Z4FA 3NH2A 1T8EA 2D3UA 1QUVA 2OPQA 4MQ3A 3OLBA 4ECQA 2HWIA 2XY8A 4K4SA 4ECYA 2C28A 4KHNA 4IFVB 1XWLA 4JS4A 4NYZA 2W7PA 3DLEB 4Q43A 3G6VA 4OLAA 3HPHA 3BGRA 4NLGA 1FKOA 2IOCA 4DFKA 2E6MA 1C1BB 4ZPCA 1WLJA 2IC3A 4DSLA 4TY9A 3OHBA 1RT4B 2ZQBA 3AO5A 1EX4A 1ZBFA 4DQSA 4FLYA 3LWMA 3PW4A 4M3TA 1CLQA 4F4XA 1S6PA 5CZ1A 1OS5A 2DTUA 4CF9A 4XO0A 1KFDA 4B8CA 1J53A 1VK0A 3AA2A 1UA0A 1SUQA 4URGA 3EPIA 4TSXA 5C5JA 3M9MB 4TQSA 1ASVA 1KLMA 4WYWA 3AVJA 5C42B 4PQUA 3KHGA 1N6QA 3L3VA 5DQHA 3HVAA 5L1LA 2R2SA 3MEGB 1BISA 2VG5B 3DMJA 1IKVB 5KG2A 4URSA 3LPUA 2Z1HA 4NLUA 1LW0A 5KFZA 4JRQA 5K14B 4JRPA 2G8FA 1RCHA 2FVSA 1EP4B 5DG9A 1N5YB 3VA3A 2DFFA 3PJWA 4KTQA 4EZ9A 3KHRA 3D5MA 3KHLA 4B3OA 3AVAA 4RNHA 2D0BA 2B4JA 1TK8A 2IM3A 3HVTA 4ED2A 4KFBA 4DTMA 3QEPA 1IH7A 3RWUA 4DS4A 3MR5A 5J2QA 1LWFB 3M8PA 4UQGA 5KFOA 2O4IA 4G3IA 1TVRB 4NLVA 4YR3A 1D5AA 5EU7A 1HNVB 3ASMA 3I5AA 3B6PA 1KRPA 4FZYA 4K4XA 1EXQA 1S1XA 3O4NA 2D7SA 2OZMA 2HHXA 4ZPBA 3NH1A 2KQ2A 3RAXA 3I0RA 5DMRA 4DL6A 2ATLA 4OGCA 3HVWA 3VQPA 2EHGA 5HRPA 1EETA 4FZZA 1WAJA 5JS2A 1HQUA 3NDKA 3OYAA 3T5LA 5CYMA 4W5OA 3ZSYA 4RW6B 1GX6A 1GX5A 1VSFA 4FLUA 3H5UA 4EBCA 2OPRB 3QNNA 1C2PA 3AO3A 3K5MA 3K59A 4TN2A 3IG1B 3BREA 3GV5B 1C1AA 4FJHA 3AO2A 4BE2A 1RNHA 1JLFB 1N48A 2V0NA 1IO2A 4FJ8A 1MMLA 3GIIA 1RYSA 1JLAA 5C42A 4PQUB 2AU0A 4E89A 1S1UA 3NL0A 5CYMB 3FRZA 3VN5A 3NF8A 3OS0A 3GIJA 4CJKA 3ZSRA 2ASDA 4DTNA 4RUCA 3ZSQA 4J9MA 3IG1A 4J9NA 3QGIA 2XRIA 3EY1A 1ASUA 3V1OA 3VQ8A 4KE5A 1HNIB 5HBMB 1TV6A 2FVRA 3C6TA 4O3PA 4K4TA 4Q8FA 4ZHRA 4R8UB 1RT1B 4NLDA 3HO1A 1YTUA 5KT3A 2QV6A 2YKMB 4NLYA 4NLWA 5F9LA 4ECZA 3H4DA 3CIZA 4KFBB 4FS1A 5KT2A 3MR3A 3NBPB 3FFIA 4CFBA 1LWEB 4CJ4A 3T5HA 3KKSA 4ZPDA 3O3GA 3OYMA 4IG0A 4AH9A 1VSMA 1HNVA 4NCGB 1XR6A 3QEWA 1KLNA 5KG5A 4NLRA 2XC9A 2I5JA 1LW0B 3PW0A 2PZSA 4Z4GA 3FQKA 3WNGA 3SV4A 1IM4A 2E9TA 3QZ7A 2VWJA 4K8XA 4K4YA 3VQ5A 3CM6A 3PW5A 4HUFA 4C8MA 5KRSA 2R8IA 4O44B 2RKIB 3ICLA 5KI6A 5DLFA 3ZSWA 4CEBA 3V1RA 3VQAA 2KZMA 1LW2A 1RT2B 1W9HA 3SUOA 5C25A 2XCPA 2VG5A 4CJSA 3L2VA 4ID5A 5KFDA 4G1QA 3C6UA 3DYAB 2BRLA 3L2WA 4WFYA 4H4OB 1J5OA 1Q8IA 4RW8A 3OYFA 1QHTA 1HQUB 4MIBA 3VQBA 2DFEA 4AHUA 2J6TA 3LP1B 4QPXA 5KFQA 4GVMA 5KFNA 4I7FB 4FW2A 2ASJA 4E19A 3LP0A 3MFHA 4GC6A 2FC0A 2E9RX 1CZ9A 5DQIA 4HUEA 3KK3B 2XI2A 4CJQA 4O55A 5KFBA 4IRKA 4IKFA 2WB4A 4ECXA 5HLFA 3SPZA 4CF0A 4QWBA 1S6QA 4M3ZA 2HHSA 5J2NB 1XHZA 4DLEA 3SFGA 3OSPA 3CJ4A 3HVRA 3ISNC 3FDSA 4KHYA 4IFVA 4NLXA 3VQDA 4PUOB 3V81A 3Q8RB 1RT5A 2XY5A 2KFZA 2OPQB 3IAYA 2ZD1A 4DL7A 4CJPA 3DLBA 2F8SA 1CXUA 4DF8A 4FYDA 4EO6A 3NCIA 3M8QA 5FROA 4DU4A 3GV8B 4FLTA 1KLMB 4J2DA 4XPCA 3LZIA 2HVIA 4KV8A 3H5XA 5HP1B 3BR9A 3K5LA 4N56A 4M3RA 2IMWP 2F8TA 3A2FA 5KT5A 1D1UA 4MK8A 4MKBA 4KB0A 3RMDA 3U3GA 4DTUA 1RBRA 2YV0X 1TAQA 4IH7A 5HRRA 3VQ9A 4CEQA 3K58A 3HT3A 4W5NA 4CEOA 3F73A 3AVBA 4HVJA 3D0PA 5KFLA 1C1CB 5F8MA 3DRSA 2HNDA 4O4GA 3QGGA 1XR5A 4NLQA 4QWDA 1WSIA 5KG4A 2W8LA 3OJUA 3H98A 3N6MA 3AA4A 4FVMA 4CGGA 3V4IA 4YMEA 3PW7A 1VRTB 3M8SA 2AGQA 3SUPA 2B6AB 4BWJA 4DL5A 2AGOA 3GIMA 5J2NA 5KT7A 1WSGA 2NUBA 2HHQA 1T7PA 5CY4A 5HROB 3RRHA 4RNOA 4ECSA 4QW8A 4WXWA 3M9OB 2OH2A 3KK1A 3V6DA 4LSLB 4F3OA 3MTKA 4IOBA 4NYNA 4WXOA 3BQ1A 2JEFA 2XY7A 2FBYA 1B9FA 2Y1JA 1W25A 2KZZA 4PY5A 4IDKA 4NLTA 4BWMA 2VG7B 3KLHA 4CHYA 3KLEA 3CDEA 3ULDA 3T1AA 3S3OA 2X78A 1NHUA 3GILA 4L8RB 4FJLA 2D0CA 1VSJA 3TAGA 4RW4A 1U49A 3FQLA 1X1PA 4BE1A 3K57A 2W8KA 4NRTA 4CIEA 1DTTA 3V6JA 3KTQA 4KO0B 1HNIA 5HBMA 1RT2A 4LQ9A 4YNQA 1S97A 1RTDA 4DG1B 2JEGA 1BCOA 4WFXA 4CJFA 5KTQA 2HHWA 4FK0A 4M42A 1JXBA 3GQCA 3NGYA 3LP3A 2Z1GA 1QAJA 1ZYQA 3LAMA 3I5CA 1CZBA 5I3UA 1TKXA 1Q9XA 4H54A 4E3SA 2JC0A 1RTIB 3MXIA 4CEAA 1IKXA 4DFMA 3H4BA 1ITGA 3AV9A 3IRXA 3SPYA 1TQLA 4LY7A 4FZXC 1Z4UA 2XO7A 4N5SA 4DSFA 5KG1A 3KK2B 2KW4A 4KSEB 3V81B 5KFHA 4U6PA 5EDWA 5KFUA 3LPTA 3HJFA 3KLIA 3KLFA 4TYAA 3CQ8A 3FFIB 4NLOA 3AVKA 1QE1B 4W5QA 1Q9YA 2YNFA 1DLOA 2IM2A 1C0UB 1S5JA 3CWJA 1BI4A 1BCMA 4ED7A 3TAMB 5DG8A 1ZETA 3C95A 4O3SA 3KK3A 3DOLA 1VSIA 4DTJA 2G8IA 3K2PA 3DLHA 4PWDA 4HYKA 1QS4A 3CM5A 3DOLB 2BQRA 1X9MA 3LP0B 3DI6B 4CJ3A 4DQPA 4I7FA 4CESA 2D3ZA 2GIQA 3LP1A 5KFIA 1BQNB 2A1SA 1S9FA 1FK9B 3KLFB 1J5OB 3RRGA 1XHXA 3NKYA 1FKPB 4ECTA 2AQ4A 2RF2B 1S9GB 4F4ZA 3TWHA 4ID5B 3OYLA 4RNNA 1HYSB 2CKWA 1I39A 4IQXA 1LAVA 1QAIA 1JIHA 1S49A 3OYNA 4IRCA 2G8UA 1DTQA 3LAKA 4OPKA 5I3UB 3QO9B 3QO9A 2CJQA 3OSNA 2Z1JA 3P5JA 4QWCA 5F8GA 3T5KA 2P51A 4O5BA 4YR0A 2G8HA 1NJXA 4KRFA 4ELTA 2WONA 1BHLA 3I0SB 2E9ZA 4FJMA 4B08A 3RMAA 4YQWA 2AX0A 2E6LA 4ZP9A 2WHOA 1CXQA 3HSTB 1TK0A 3GV7B 4KB7A 2IS3A 4Y1DA 2ALZA 3NMAA 3EZUA 1BQMB 3KD5E 3N6NA 4DTPA 1BQNA 2QE5A 3Q8SB 4CHNA 3ALYA 1S1VA 3KLVA 1JLCA 4QWEA 4CJEA 4U7CA 5JUMA 4O4RA 4I2PB 3Q8QB 3QYYA 4KREA 1SL0A 4Z4IA 4EP4A 4E7JA 4TQRA 2AX1A 4Z4CA 3KK1B 3V6DB 4OJRA 1ASWA 2ILYA 3KJVB 3CYMA 1KVAA 4FS2A 1DLOB 3MEDA 4MFBA 4DU1A 3ZSVA 4EYIB 3TVKA 4KHUA 3KOAA 4OKEA 3RR7A 4IRDA 4CGJA 2HAIA 4Z4HA 3PW2A 2GBZA 3TAPA 1LWCB 1SUQB 2HNDB 3IRXB 3BSCA 4DLGA 4YR2A 1G15A 1LAWA 2BDPA 1DTTB 5KT4A 3VQCA 2OYQA 4F4WA 2ITGA 3RB0A 2UVRA 4ZP8A 1L5UA 4K4UA 2IGIA 3SI6A 1UWBB 1SKSA 3SYZA 4Q0BB 3LWLA 1UA1A 1X9WA 4GC7A 3NGZA 4KAZA 4OGEA 2X6NA 4OKKA 2VA3A 1XR7A 1RBSA 1KVBA 4URQU 4HCCA 3OYHA 2WRMA 5EUHA 4RW4B 2X74A 4LD0A 2Q3SA 3NF6A 3QEIA 4E1NA 2IC3B 1RTJB 3QESA 3SJJA 3HP6A 4RG8A 1SV5A 2C2RA 4IR9A 3KLHB 3KLIB 1ZTTA 3CDUA 2P5OA 4CJRA 5DGAA 4NLSA 1RBUA 4DS5A 2W42A 3AVCA 4B9TA 4B9NA 1ZTWA 3AVHA 2HMIA 4E7IA 1N5YA 5KFSA 1U45A 1X9SA 2IM1A 3IN5A 4FJ5A 1IKWA 1KHWA 3VQSA 3CVKA 3QEXA 4AILC 3THVA 5C24B 3EPGA 1XI1A 2YNGB 2C2EA 4OL8A 4BDYA 4WZMA 3FSIA 1U4BA 2BANB 3WNHA 4NCBA 3H59A 3I5BA 4J9LA 5CZ2A 4KAIA 4ID1A 3VQ4A 3MECA 2HNZA 1GOAA 3TANA 4TXSA 3CFPA 1S1WB 4J9SA 2BQUA 4FLZA 3QIDA 5KFJA 3UIQA 3DLGA 2R8KA 4KHWA 3OL7A 2FVCA 4CGIA 2YNHA 1RA7A 5KFCA 2FVQA 1UOCA 4F50A 3OL9A 1QSLA 3KD1E 4NCAA 3SQ2A 1LWCA 5FRNA 4KV8B 4Y1CA 3PV8A 1C0TB 2VG7A 3D45A 4E0DA 4KKOB 1IG9A 4HTUA 5EWGA 3AVIA 2R2TA 4DL4A 3LALA 4JV1A 2QKKA 1VSLA 4ICLB 4M3UA 2V4RA 4QW9A 1JLQA 4JS5A 3Q8PB 2FLNA 1VSHA 3SV3A 4B9MA 4RW7B 1QSSA 3LZJA 3O3FA 2YNIB 1RT5B 3SNNA 3PUFA 4MH8A 3T19A 1MU2B 1QSYA 1NOZA 3RB6A 2W9BA 4CEEA 4FLXA 3OYJA 4IBNA 4O0JA 1JLEA 4KKOA 1J9AA 2R8JA 4CECA 2PYLA 5KG0A 3NBPA 4FJKA 4DTRA 4E1MA 3PO4A 4KB1A 2P1JA 1JKHA 3BDPA 3PX0A 5HLFB 4F4YA 4HHTA 4C8OA 1HYVA 2VWKA 2D0AA 5SWMA 4ZTFA 3AO4A 3RMBA 4JV2A 3O3HA 3DOKA 4YFUA 3WNFA 1S48A 1RT1A 2IDOA 4CGDA 4Q45A 4CJWA 4X2BA 4FM0A 4E7LA 5KFEA 4R5PA 1D8YA 4KHRA 3I0SA 1J54A 3S3MA 3HP9A 1LW2B 1U04A 3JSMB 4FJGA 4O44A 4BE0A 3MECB 4BDPA 3UQSA 1TL1B 1U48A 2VG6A 3MR2A 4CIGA 3JYTB 5HRSA 1S1UB 3ZT3A 3IGVA 5KFFA 3ZCMA 2FBXA 5KFPA 2WOMA 1L3SA 4B9LA 4RNFA 1L3VA 5CYQB 1TP7A 2I5JB 5KFAA 1VSDA 4DQRA 3KLGA 3PVXA 4FK4A 4NCGA 4PA1A 4PUOA 1A5XA 1D0EA 4TY8A 2Y1IA 1FKPA 4XPEA 3HL8A 5KFYA 4CCHA 1ZBLA 4J9QA 5DG7A 1TL3B 4LH4A 3QETA 1NKEA 3P1GA 1K1QA 1S6QB 3HXMA 3TAFA 1D9DA 3LDSA 5F8NA 4ELVA 1RTJA 1NK9A 4E7HA 1TKTA 1RT6B 3DLKB 4XIUA 1S9EA 3IS9B 4IG0B 4LH5A 2HNYB 1SKWA 1LWEA 2G8WA 4RZRA 3NF7A 2FJVA 1RT6A 4J9PA 5KG6A 3KMQA 1JLCB 4I9QA 5EWEA 2HHUA 3G86A 1U47A 1RAJA 4RW8B 2F8EX 1IKYA 4OPJA 2OPSB 2BE2B 1NKBA 2GV9A 2EC0A 4QCLA 3KK2A 3KHHA 4AHRA 1EP4A 1TV6B 3LANA 3AO1A 4I2QA 2IJFA 4I9LA 5K14A 2GC8A 4JUZA 3V6KA 2BR0A 2UUWA 3NGDA 4CJTA 5DGBA 3CFOA 3WNEA 4B9VA 5DK5A 5FDLA 4DFJA 3V9ZA 3KMSA 3BSOA 1TKXB 3QNOA 4AHSA 3CJ3A 1Y97A 1REVB 3OY9A 5J2PB 3HHKA 1NK4A 1VSEA 1U09A 1JL2A 5KFRA 1D9FA 3MR6A 3SFUA 3SZ2A 4DSJA 4QAGA 4M3WA 3DM2A 1Z26A 5FRMA 3TARA 4R5PB 4K50A 4MKAA 2R8HA 2ETJA 2HB5A 1HARA 3TR8A 3P83D 2OPSA 4Y34A 1YVFA 3SI8A 3IS9A 2B43A 4C8NA 4CE9A 1TVRA 3ZSZA 4B9UA 1TKTB 1KTQA 4ECRA 1EETB 2EX3A 5DQGA 3AVNA 3RBDA 1EKEA 2ASLA 3V1QA 3TQ1A 4RW9B 2PYJA 3ZT2A 4F2RA 4J2AA 4W5RA 3I0RB 4OVLA 1BQMA 3HVTB 2F96A 3BGRB 4N76A 1S1XB 1UAXA 2YKNA 4ED8A 4HUGA 3OYEA 1KVCA 4PWDB 4TY8B 4ZP6A 1S9EB 4GW6A 3DLKA 4CEFA 1BIZA 1T05A 4QWAA 4F8RA 3ZSOA 5J2QB 4O3NA 2XHBA 2A1RA 3MAQA 2WOMB 3RR8A 3G0ZA 5KG3A 2ZE2A 5EWFA 2GIRA 4O3RA 2DFHA 3CO9A 2VA2A 1KCFA 5FDLB 3GYNA 1L3UA 4JV0A 1JLFA 4OLBA 2IM0A 4C8KA 4FCYA 4CFCA 2RDIA 1KSPA 5D3GA 1WNEA 1T3NA 4FLVA 1QTMA 3DRSB 2R8GA 4K4WA 1RBTA 1GOBA 2AGPA 1HYSA 3MEGA 1WSFA 1N56A 4DTOA 1RT7B 3L2QA 1S9GA 4M94A 3V9WA 4RW6A 2FBTA 2KTQA 3L3UA 4DEZA 2OA8A 2P5GA 1JL1A 1T03B 1FK9A 4MK9A 4FJXA 4FJ9A 4F2SA 5L1JA 3CFRA 3NFAA 2HNZB 3TAEA 1JXLA 3QEVA 4ED0A 3QIPA 2ZKUA 5T7BA 4KTZA 2ILZA 3AVGA 1T94A 3QLHA 4DSKA 3CJ2A 4Q8EA 2BGGA 2W9AA 4Y3CA 4CF2A 3GIKA 2W9CA 4ZVEA 4LSLA 2B5JB 1L3TA 3NGIA 3B6OA 5HRNA 4DQQA 5HROA 4ECWA 4CFDA 1LV5A 1RILA 1NJWA 2UVWA 1FKOB 4CHZA 1QE1A 5F8HA 4IFYB 4R0EA 4LSNA 5J2MA 3HPGA 4KBIA 4HKQA 3U6FA 4EYHB 2XWYA 2HW3A 2W9BB 4LSNB 2XCAA 4DL3A 3PR5B 4MK7A 4O4GB 4KHSA 1HPZB 3K5NA 4Y2CA 1C1CA 3E01A 1CSJA 2UUTA 3QGHA 4CEZA 1JLBA 2DPIA 3DMJB 5JS1A 4W5TA 3L8BA 2B6AA 4ICLA 3LP2B 3OYDA 3HKWA 3V4IB 3AVLA 2J6SA 3JSMA 3S3NA 4ED6A 4CHPA 1TGOA 5HP1A 1HYZA 2YHBA 4CIFA 1RDAA 4FLWA 1UWBA 2WCXA 2YNHB 2UVUA 4RU9A 4FJIA 3DLGB 3MXMA 4IG3B 1NJYA 5C25B 1JLBB 1NJZA 4AHVA 2XI3A 2JEIA 3RMCA 2XGQA 4KI4A 2BANA 3SQ1A 3BSNA 1NK8A 5KG7A 1NK7A 4KPYA 3PO5A 3E01B 2YNIA 4WYLA 1RA6A 3F9KA 2C2DA 4Z0UA 3CG7A 3SCXA 4C8LA 5F8IA 2B5JA 1JLQB 2DPJA 1WSEA 4NLPA 3DLRA 2HMIB 1WAFA 4M3XA 4BACA 1BL3A 5KFVA 3M9NB 4CF1A 1VRTA 2Z1IA 2YKNB 5J2MB 1O1WA 1WSHA 4I2PA 1NOYA 3SQ0A 1S0NA 3RB4A 3E51A 5KFWA 1S4FA
chains in the Genus database with same CATH superfamily
1IWGA 4IH5A 2CQDA 5KFGA 1X4HA 1VQMN 1LOTB 1IBMJ 4M1KA 2MZJA 2XMAA 5GAEI 5D8HB 4X4QA 5KRTA 3CCWA 3TZWA 4LMZA 3QLHB 4DWIA 4Z7YA 4M3YA 3AA9A 4ZHRB 4JK9A 1RWXB 2WVBA 2V6AA 1EQMA 1S1WA 4FVCA 4TYBA 4DHVA 4GRSA 3SUNA 2MB0B 1NHKL 2M52A 1M1GA 3CJ5A 5F8JA 3J7AP 1AT1B 3D0HE 5J1EB 3HSCA 3RG6A 2MY7A 4C98A 3P45B 2A2DA 3CQXA 5T7LA 4WK1A 2B9WA 2Q36A 2I0XA 3FEXB 5D0HA 4DR1J 3ZSXA 1YJUA 1U0HA 3NAEA 2RT3A 3D2EB 1VQ6S 2U2FA 3QAUA 2JGUA 1M1KO 1XIQA 3KNGA 2M8HA 3AVFA 1NSQA 3DRPA 2A18A 1UFKA 1UZDA 1C4AA 2GJFA 3GDQA 4MFBB 3VA0A 5K8OA 1F9EB 1T05B 1NGEA 4DSIA 3C14A 1KR4A 1HNXF 1FWPA 4OQJA 4KTWA 2A10A 1A5WA 3C94A 3QIOA 2UUAF 4CGHA 3WXJA 4EZ6A 4DU3A 2QIFA 2WONB 1LWFA 1FTRA 2HGMA 4CEDA 1N36F 3ZT4A 1ZAXA 1RDCA 2DNQA 3V9XA 2DGTA 4PXEA 1NG9A 2W40A 1RDDA 1FXDA 3CCSN 3OYKA 4F3QA 2VZ9A 4HCBA 2PEBA 1S59A 4LF1A 3E9PA 4C9DA 1E3MA 3ITHA 3DCAA 4AF1A 3MEEB 1NK5A 4KHQA 3A1YG 4AXJA 5T14A 3QINA 1JLGB 5H1SV 3CT9A 2Q6CA 4NA3A 2A5XA 4H8KA 3UPFA 2A6AA 3KIOA 1YJNS 3PIOQ 4RBVA 2FBVA 2YX6A 3EM1A 4X62F 4DR5K 1UP1A 2HS4A 1TL1A 3TSPA 4DTXA 1SJ3P 4HI1A 4P2FA 2JLEA 3ENHA 1YJTA 1FJCA 2RF2A 3VESA 4F0HA 3V9UA 2JEJA 3DOKB 2LP4A 3H46O 4X84A 2E4LA 4B3RK 3H3OB 5EY4A 2I6WA 4DL0C 3TU5A 3I9V9 2IAJB 2I1RA 4CJVA 2ZFHA 2DNZA 3HM9A 4OO1J 3QERA 3ADAC 4P75A 2DR7A 2W1BA 3ISZA 2E5HA 3RBEA 4LRAA 2C2OB 5IZHA 1SKRA 1MU2A 1VQLS 4H4MA 3ILIA 5CYQA 3UO0A 5J2PA 1N33F 2B4PA 3SQ4A 1N32K 3MM6A 2ZGYA 2HYIB 1S10A 2RD5C 4OX6A 4CDIA 4JI5K 2XZWA 3HSGA 4BBYA 3UB5A 4A8WA 1SH2A 2PA8D 5AQQA 1YBAA 2RB7A 1GMVA 3EVMA 2P9LA 2NZTA 5D0EA 4IO9L 4RUAA 2OPRA 2CPIA 3HYFA 1ZBHA 2KG1A 4JV5K 1WHVA 1RBVA 2P9SA 3BPDA 3ZT1A 3AXKA 1W7AA 3BQ2A 3MOZA 5LM7E 4X64J 4K8ZA 5HVHA 1C1BA 1RYRA 1HRHA 4PKGA 4FF3A 1LFWA 4J8FA 3KLEB 2AJ2A 3N6LA 4N8NA 4LBPA 3GJQB 1ZBIA 2W41A 4ELUA 3HK2A 5GVQA 3OYGA 2I8EA 1Q18A 4J2BA 4FM2A 2MSSA 1IN0A 2VB6A 4JI0F 2X51A 3PJ9A 2YQ1A 3C16A 3MF5A 1GLFO 1BI4B 4GVEA 4OPAA 2MEWA 3HMJG 4FWRA 1C0MA 3S9HA 3M5RA 1BA1A 4Y2IA 3Q2SC 4K25A 3OHAA 2GWKA 2ZC3A 3TZYA 3PIPQ 3I82A 2VQEK 4J9RA 1N8RO 2V94A 1TELA 2XY6A 2NREA 4RNMA 3TRGA 4IQMA 2RDJA 3Q86A 2V34A 3LA0A 1ZXOA 4PWUA 3OL8A 1JX4A 1IKVA 2UXDF 3M6GA 2W9CB 3LH2S 4M45A 2E1PA 4DJBA 4OZ2A 3WIVA 1Y9OA 1KHVA 4CHOA 4TU7A 3OD2A 3C0BA 4ZLPA 3KWMA 1B70B 5DLGA 3M05A 1U6BA 4EO8A 4KO0A 3GZ7A 3AD8C 4B8AB 1ZH5A 1TUWA 2JFKA 1TAUA 2MZQA 5LXRA 2HF4A 1YZ7A 1IKWB 2IA6A 4GKJJ 2DK2A 2ZH2A 1TFYA 1YT3A 3QSIA 2BRKA 3MWPA 3HHLA 3IBFB 4P71A 2DH9A 5AQWA 2D9PA 4GKKJ 4CK3A 3O9RA 4IFYA 4NZ0A 1N4LA 3MCOA 4HH1A 4PABA 1J5EK 1QUVA 4JKHA 4K4SA 2HVDA 2E7WA 4OI4A 2C28A 4IFVB 4YOWA 5GAGU 1QD1A 1F2GA 2MHEA 3HPHA 2XMMA 4FSVA 2VQEJ 1FKOA 4X66K 4DFKA 1C1BB 1F9FA 3SCJE 2R7OA 4RWWA 3WT0A 3W60A 1NH8A 3LM9A 1HWLA 3ZETB 3DXKA 1B0VA 3IM9A 2BJDA 2FB0A 1EX4A 3CMAS 3PW4A 4M3TA 4YOEA 3BGLA 4B8CA 1LWXA 1QZ6A 1UA0A 5DDRC 4X65F 2DO4A 1X5PA 3EPIA 4YB7A 3CIPA 4FF4A 4YDXA 4O5FA 2IRXA 2PO4A 4TQSA 1ASVA 2DRDA 5IFMA 2RJZA 2IDLA 1UJ6A 1X4FA 5C42B 1N6QA 2DRAA 1OIAA 1QVGR 2O8EA 2DNNA 1VQNN 3NMUA 5KG2A 5ETNA 2IYIA 2P9LB 2GW8A 3ET6B 1QZ5A 2ZH9A 1LW0A 3BBCA 1HLWA 4BC9A 5K14B 4C4WA 4JRPA 2G8FA 3CC7N 1RCHA 5DG9A 4KGKA 5C2CA 1LEOA 1UKUA 4EZ9A 3O1BA 1WG1A 3MAAB 4RNHA 2J4RA 4C0HA 4ED2A 2JJ4D 5EX0A 3QEPA 1OY8A 2J76E 4C6AA 5KFOA 4KJIA 4G3IA 2EKYA 1RI7A 5EU7A 1VDHA 1OO0B 3ASMA 4FKYA 5HATA 1E6VB 4M5LA 2O8FA 5B8HA 2M9KA 3O4NA 2HHXA 3TA0A 4PYDA 1SVDA 2KXFA 3NH1A 3I0RA 4DL6A 4OGCA 5TKYA 2LU2A 4K7QA 5C0YA 2V8GA 1EETA 5JS2A 5LMNK 1ESVA 5CYMA 4W5OA 1RP5A 2HK2A 3AFGA 1GX6A 1I51B 4BRMA 1VSFA 1FERA 1VQ7N 1DY3A 4EBCA 3A8KA 2VICA 3QNNA 2EK6A 2PI4A 3AO3A 3ZTOA 1HWKA 2HFNA 4TN2A 3O6QA 1SQKA 3JAMY 5A2QO 3D2FB 2QW9A 4LF7K 1C1AA 4FJHA 3AO2A 2M8DB 3MN6A 1JLFB 1KQGB 2V0NA 4LF9J 1MMLA 1JLAA 4PQUB 4FYWB 4E89A 4QIGA 3VN5A 2O8CA 3L4QA 2HQ3A 3BV8A 4DTNA 4J9MA 4OMFG 2RNEA 3IG1A 3QGIA 4Y2MA 3THPA 3V1OA 4KE5A 5CE3A 1TV6A 4K4TA 1XNRK 2YPZA 2JX2A 3MPUB 4JK8A 3M3ZA 2V52B 2KU7A 4NLYA 2BW7A 1NDLA 1VQKN 3K9JA 1VHFA 3SCKE 4C1NK 5IQ6A 3QJJA 4ANEA 3NBPB 4CFBA 3KZBA 3IP0A 3KKSA 2YKAA 2Q6BA 4IG0A 3EMTA 3PYDA 1MW7A 4NCGB 3QEWA 1KLNA 4DHYA 2J0XA 2XC9A 1V6HA 3CC4N 2HBYB 1RJJA 1HBOA 1LW0B 1KNZA 2PZSA 3FQKA 1FJEB 4FZVA 1APSA 3CC4S 4CZCA 2KH9A 4YUDA 3FZKA 5A6WA 3W9IA 4HUFA 3QGPA 5KRSA 4L75A 3N79A 5DLFA 3I9ZA 1T3VA 2VPWB 1RT2B 1Y00A 5C25A 3MDQA 1K73T 2F4VF 3D4JA 3G71N 3D2WA 5IT4A 4DCPB 3ILOA 4WPAA 1PCAA 5EXWA 1Q8IA 2ZOMA 1QHTA 3ZZOA 3VQBA 2DFEA 2G0CA 3TJ9A 4GVMA 2YX1A 2NRZA 3Q8VA 4ZVSB 4OX9K 4JD2A 3OHRA 1PO6A 2IVFB 3M1FA 4X65J 1SQFA 4IO1A 5E5NA 3PLAA 1HBUB 4O55A 4GKJK 5KFBA 4DR7F 2PFDA 5HLFA 4CF0A 2FHMA 2HQIA 5A8KA 2HHSA 3TYTA 1XHZA 2DXFA 4K43A 5LJ3Y 2CQGA 3SFGA 4AXIA 2WC9A 3ISNC 4NEZA 1CULB 1AFIA 3MMCA 1M5OC 3W2WB 2E2PA 1DBDA 1NGGA 2LQJA 3IAYA 2ZD1A 4DL7A 2E2QA 3JQJA 3X3UA 4DV0K 4DF8A 5KAKA 3NCIA 2EFGA 4LF5K 4G6VB 4DU4A 4HDGA 3A3OB 3VOVA 2EPIA 4RBUA 4ER8A 1Q16B 1U02A 3LZIA 4USTA 5G0RB 5HP1B 2RQMA 3NMRA 1N34K 5KT5A 5AQPA 1D1UA 1I1GA 3QBWA 2AYGA 1Z2LA 2YV0X 1TAQA 4HTIA 5HRRA 4CEQA 3HT3A 4H5WA 4ZIWA 4ZPWR 2Y8YA 2HNDA 2P9KB 1XR5A 4NLQA 3HI9A 5KG4A 3OJUA 2FD2A 4BRQA 4FVMA 4JYAJ 3TA1A 3MM7A 1RSCA 4NE9C 3MN9A 3G71S 3TUJC 3PW7A 4LVOP 3BGUA 1U6ZA 3SUPA 2B6AB 4BWJA 1LKZA 3GIMA 3Q22A 1V3SA 1H74A 3EUNA 4RPFA 4QW8A 3M9OB 3KK1A 3MX2A 4IOBA 4WXOA 3FCWA 5B0EA 2D3OR 1B9FA 1TYQB 2KZZA 2CDQA 1JCEA 2D0PA 2Y8WA 4WF9Q 3KLHA 1ZM3A 2QX0A 2HSTA 1V5IB 3CDBA 5I3QA 2CNLB 1LCUA 3TAGA 5C2GA 3G8TA 1X1PA 3M2RA 3TPQA 3QT7A 3R6GB 4NRTA 3SAGA 4BLGA 2V51B 1Q7YO 2AJFE 1VQON 2C2ZB 3EN9A 1RT2A 4YNQA 5K8PA 2VOOA 4DG1B 3T1HJ 2RHQB 2FDNA 3P8BB 2ZHBA 3LP3A 1VBZA 2OD4A 1TKXA 1Q9XA 3FCVA 2NLXA 2QT7A 3CMAN 2DO0A 2Q1LA 3GSDA 4RTFD 4LF7J 5GAHP 3SPYA 2YY3A 4XTTA 5M1OA 3Q8UA 4FZXC 2OLWA 2ZOGA 4ZVPB 4YDDB 1YJWN 2GVZB 4NLBA 1S5ZA 2KW4A 4KSEB 3V81B 2QN6B 1ZS6A 3LPTA 4DN9A 3MM6B 3HJFA 5E3QA 3E8OA 4TYAA 2OIHA 3CQ8A 3AVKA 2RS8A 4O8UA 3NOCA 4B3TJ 3VMFB 2H4YB 2PDAA 4KY3A 3DGPA 3CWJA 1BCMA 4DV1F 3QT5A 2R7QA 3UN5A 2Q3PA 4B3SK 2QTWA 4DU8A 2EXUA 4O3SA 2AYEA 4DTJA 2G8IA 4PWDA 1Q0NA 1OWXA 3CJTA 3TA2A 5AQRA 3THYA 5KFIA 2QL7B 2A1SA 2DNRA 2B3TB 2KL8A 4ETXA 3D66A 4LIRA 3OYLA 4LFAK 4QPTA 1SAZA 4R79A 1QAIA 1JIHA 1FD8A 2BKPA 5AZIB 4GNIA 2BJ8A 4WP8A 4USVA 4JI7F 1N8RT 1Q8KA 2G8UA 1J27A 3B8HA 3EJMA 3PSIA 3QO9B 1IWAA 3RYLA 4FXVA 5F8GA 2QFIA 2P51A 5H9EK 3SAFA 1CJTA 4U95A 1S6OA 1SJQA 4FJMA 2CPDA 4AUKA 3FE1A 2AX0A 4ZP9A 3GV7B 4KB7A 3ONQA 3S41A 3KHYA 3CCTA 3HSZA 4Y1DA 2ALZA 3NMAA 2IDEA 2YHYA 1BQMB 3KD5E 2CQHA 4DTPA 3CGIA 4DR3F 1Z2ZA 2LXUA 4CHNA 3ALYA 4FPBA 3DLJA 3HX9A 4QWEA 5JUMA 3O6WA 2AD9A 4O4RA 4I2PB 1ICEB 4C11B 4Z4IA 5GADU 4E7JA 3SIPB 1OKJA 1AUSL 4LRBA 3KK1B 1ASWA 1UVNA 2ILYA 3OR1B 3KJVB 4FS2A 2ZBIA 2BYCA 3DGPB 4JKGA 4JP8A 4EYIB 4KHUA 4OKEA 1O8BA 4IRDA 1GLJO 2KJWA 2HAIA 2DT9A 3L3CA 4CO1A 2DGOA 2CG4A 3PW2A 2GBZA 2NUUG 3OXFA 3TX8A 4D3HA 4BRHA 4BVOA 2HNDB 1OVYA 3IRXB 3BSCA 3CF5L 3GSIA 4YR2A 1G15A 5KQ8A 1RAHB 2BDPA 5KT4A 3R6MA 1X4AA 4F4WA 2ITGA 3L7OA 3RB0A 1FJ7A 4K4UA 4H0OA 2YVSA 1VJQA 3SYZA 4Q0BB 2XO6A 2QJ3A 1PYOB 1ZC6A 5KPRA 3CCUN 1X9JA 3GLJA 2CPHA 4OGEA 3GE9A 2X6NA 2KRBA 3HFVA 4OKKA 1RWWB 2RSQA 4CBXA 2HIYA 1U8WA 2JLFA 4U67L 2X7IA 1TYQA 4HCCA 3M2RB 5HOOA 2WRMA 3GU0A 5EUHA 4RW4B 5KOXA 3KJQB 4BRGA 3QESA 3G4SS 1KAYA 1RWNB 1TUUA 1SV5A 3PIOL 3FZ2A 2GAHC 2Z30B 3CDUA 2PFFB 5DGAA 4IFEA 3NCRA 2IMOA 4E8UA 1WF0A 4U8YA 3I32A 2QEXS 4B9NA 1ZTWA 3ELHA 3J7AN 3W2VA 1X9SA 2IM1A 4FJ5A 3VQSA 2YKOA 1P9QC 4X4TA 3VAMA 1H7WA 3THVA 4CIOA 1XJWB 3FSIA 3WNHA 1HNZF 5GMDA 5CZ2A 2H5JB 4KAIA 5B08A 4NXMF 1NSPA 1UTAA 1IBKK 3CFPA 1NMDA 3JAMO 3NCPA 4RR5A 4A8OA 3OL7A 1MG7A 2EG2A 3CJ9A 2HGNA 4FWKA 3MPWA 1UOCA 2XLJA 2NCKL 3SDEB 2HFZA 2VC0A 3LL3A 4HR2A 3NS6A 3CTRA 1T0TV 4CI6A 1VQ5S 3JB9k 3SQ2A 2VFUA 4Y1CA 2HBZB 5D78A 2VG7A 3QSYB 4K0KF 4E0DA 4KKOB 2CPJA 1Y11A 4N7TA 2JDJA 2CNNB 4DL4A 3LALA 2QKKA 4M3UA 2V4RA 2BJEA 5JICA 1HD0A 1E4GT 3C46A 2YCHA 1EO1A 3VTHA 1VSHA 4M8LA 4RW7B 1QSSA 3PSFA 2J0SD 4ZVTB 4MH8A 4ZPTR 3OFEA 2Z8QA 3OYJA 1KAZA 1J9AA 2CQPA 2HIQA 2QMUB 1VQ8N 3NBPA 3PO4A 3JQMA 2HFSA 4CI0B 2LQ8A 3Q83A 4HHTA 1QAYA 3CO0P 3OXGA 1WOPA 5SWMA 3OV7A 4YB5A 2HAFA 3RMBA 5AQZA 1T9WA 3O3HA 3DOKA 4J90A 3WNFA 2IDOA 1X8DA 4R5PA 2IBOA 4KHRA 3S3MA 4K59A 1U04A 3IWLA 4DOZA 4JEPA 2HKEA 3MCNA 3MECB 4BDPA 2AHOB 5HN0A 5H1SQ 1U48A 3MR2A 3K5PA 4AM6A 3ZT3A 1FF2A 1YK9A 2LYVA 1X0PA 4NA2A 4DR6K 2EI5A 3NGSA 4F0MA 3Q7BA 3POTA 4JKGB 3P39A 3OFGA 3QBCA 4B9LA 1L3VA 5CYQB 3OR1A 2ADBA 2QA2A 1SJFA 4CH0S 1VSDA 5BRDA 1UEUA 3KLGA 4OHVA 1G1XA 1HFEL 1A5XA 1IBLJ 2Y1IA 3J81O 5H9EJ 2F63A 3DAWA 3VEOA 3W8GA 5DG7A 1TL3B 1NKEA 5EVZA 1K1QA 1KP6A 5BR9A 5HQ8A 1MN9A 1KQKA 5HMYA 2W4DA 3C66A 1SIZA 4KGMA 3WXLA 1YX2A 1YVNA 4WTYA 4LH5A 1WOQA 1VJWA 1N5SA 4LC9B 3NF7A 2FJVA 4J9PA 1ZPWX 4CLTA 1K8AO 4Z7CA 1FCAA 1T9YA 2HHUA 2GVDB 2QLFB 1BD6A 1DJ0A 3GR0A 5D77A 2IVYA 1HL6A 4P52A 3UKUA 5IWAK 4UTGA 4ITSA 1V3ZA 5SUHA 1WORA 2ZGZA 3KK2A 3OFHA 3KHHA 5IM0B 1P90A 3AO1A 2N3OA 4I9LA 2DR9A 3V6KA 3CJKB 3VPZA 3UI3A 5DGBA 1E4FT 5EOYA 5DK5A 3HF5A 3QNOA 3MM8B 5AXLA 5J2PB 1Y5NB 3QFPA 1VSEA 1X5TA 1JL2A 3P6YC 1D9FA 4V19J 3SFUA 1SPBP 1WEXA 3B6BA 1Z26A 5FRMA 4R5PB 1Q86O 2R8HA 4LF2A 3TR8A 1R8CA 3P83D 1BC6A 1YVFA 3UNGC 3IS9A 2B43A 4C8NA 1TVRA 1TKTB 1KTQA 4ECRA 2EX3A 2EFOA 4USMA 3TQ1A 4RW9B 1N0VC 3ZT2A 2H51B 4F2RA 3NEKA 4W5RA 2LQ9A 4K0KJ 2NXNA 1S1XB 1UAXA 4ED8A 3OYEA 3QRQA 1VFJA 1RAGB 1G4CA 1WG4A 4CEFA 2YKQA 3J7A1 2ROPA 5KQDA 2P9UA 2GELA 4F8RA 2Z56B 1I3OB 2DNMA 6FDRA 4O3NA 1U2CA 2XHBA 4DV3F 3G0ZA 1VIOA 5ETPA 5C15A 5KG3A 3AY0A 4M5KA 3NNAA 2O01C 1KCFA 5FDLB 2V8PA 2IIHA 1U1MA 2VPYB 1KSPA 5D3GA 1WNEA 1RU2A 1T3NA 3O80A 3LO3A 1RBTA 3KWGA 3MEGA 1GMWD 1WSFA 2HHHJ 2DNYA 1KS2A 3BDEA 2O8EB 3TW0A 3UDEA 4RW6A 2CPXA 3RU0A 2B4UA 1IBKJ 3UKRA 1Q8LA 1WDTA 4CP5A 4IJAA 3WXKA 3PNIA 4ZCMA 4AQYF 4A8KA 3D3CJ 5T7BA 4OJ1A 1I94K 3O9TA 5C2DA 2UUAJ 4DSKA 2J8SA 1JJ2M 2VF3A 4ZVEA 3BM7A 2B5JB 3PRVA 2RQKA 4ECWA 3O8MA 3MCPA 1NJWA 2P9PA 4PG5A 3A12A 5F8HA 4IFYB 4IO8A 2WTUA 4DV5K 4R0EA 4LSNA 1FWKA 2JL9A 3GG1A 1HW9A 2GCFA 4ED5A 3HBTA 3NG8A 4DV6F 5GMKa 2BJ3A 4GKKF 5ETSA 1NBEB 4KHSA 1HPZB 1UL3A 2ZBQA 1C1CA 3BKFA 5BR8J 4CEZA 1JLBA 2FSNA 5JS1A 1UFWA 3M2VB 2RILA 5D0GA 1GLAG 3LP2B 4QU7A 3OYDA 2MKCA 1DT9A 3HKWA 1H0HB 1TMMA 4X66F 3JSMA 1S4EA 4LBIA 1ZA2B 3CC2S 1FVSA 2ASYA 2GQQA 3N4QA 4CIFA 4ANDA 2OKQA 2FF6A 2UU9F 2DXDA 3OTOF 3B4MA 5C7PA 3DLGB 4LF5J 3VVUA 2P8IA 4YORA 4KGZB 4H0VB 3QJPA 3BKTA 3MR7A 4KPCA 2XI3A 2JEIA 2HBKA 4UOGA 1H2TZ 1UW9A 3F0NA 2HRUA 3PO5A 1Q53A 4P7VA 2YNIA 4WYLA 1R89A 2F1FA 3F9KA 2C2DA 1EIYB 2IYGA 4C8LA 2AZ3A 4J91A 2VFVA 3I33A 3CMEN 1JLQB 1WSEA 5E2QA 3NVMA 2HMIB 3PG9A 1BL3A 4GMKA 1VLYA 2YKNB 5J2MB 3N4PA 1S6UA 3NRBA 4DV3J 1S0NA 4QIWD 3GBTA 5KFWA 1CG2A 1S4FA 2EBGA 3H40A 1T9TA 3CNQP 3RAQA 4TLRA 2PY5A 1K44A 1JXEA 4EP5A 2L9WA 2NRWA 3H7HB 4FNHA 3ZZZA 1FVQA 1KN6A 4M95A 2ZBPA 2DKOB 2PIIA 2GV1A 2YJEA 3UR0A 2GX8A 2LEAA 4FJ7A 2D69A 4CGFA 2DIUA 1R0AA 3NHGA 2O67A 5IWAF 4LRFA 3C19A 2D41A 2ZE2B 3M2VA 3NS7B 5E3AA 2YH1A 2XTJP 1JJ2R 2YX4A 2DNKA 1U1NA 3GFXA 1YTYA 1NM1A 2HHPA 1PKUA 3EICA 3R5GA 3M32B 3AODA 5I42A 4CO3A 3QZ8A 2RKIA 5AFUH 2W7OA 3FRYA 3CETA 2AEMA 2GA7A 4JI6K 5K8MA 3C15A 2VIHA 1VSKA 2LDYA 3OS2A 3MOJB 4JI4J 4CK1A 4Y2AA 3R1XA 2K3IA 1I6JA 3DN9A 1S1VB 3CCRN 2VQFJ 3WEEA 2LEPA 4CLKA 2IAJA 1WEZA 3N01A 3TUPA 3HZEA 1CVJA 2JVRA 4HACA 2JWKA 2QSWA 1FFSB 2HHVA 3K5OA 2NSBA 4NXNK 1HJRA 2EK1A 3M8PB 1NSKL 3MMAB 4ILJA 1VRUA 1EZZB 4RWXA 4EBEA 1RABB 3T1YJ 4RBTA 5B7WA 3OJSA 3VQEA 2BX6A 2PGCA 1CS4B 3RB3A 3C6TB 4JK7A 2HLTA 4M41A 3LW5C 1WN7A 5I42B 1BE4A 2GNKA 3OS1A 1HX1A 4Q44A 2KVQE 1TKZA 4OX9F 3K7RA 2FLPA 3ID6A 4M7YA 1A5VA 2RPIA 3VAFA 2BH1A 2KXHA 1RTIA 2MYFA 5J1EA 1YIJS 4FK2A 1F2HA 1YKWA 3T5JA 3J80Y 4IUFA 2U1AA 2K3KA 1NKCA 3NAHA 2E1RA 5A8RA 4PKIA 2F4VK 3I8DA 1QVFR 4LFAJ 2J9CA 3MTJA 4W90B 4OYIA 4Y6IA 3FR0A 4USWA 2W2QP 5GADI 3CDWA 1VQPN 3CCMS 1G99A 3OYCA 4F04B 4LF8K 3T9NA 3MD1A 3T3FA 2FVPA 4BRCA 2JC1A 4FYYB 4QJVA 2B9XA 4FBTA 4USKA 3CCEN 2UV8G 1C0UA 3GFYA 3UDLA 5HQLA 4U7BA 3J80U 4YP3A 3CD6S 4HHJA 3MX5A 4ILGB 4K0KK 1B9DA 1ZBTA 3AB2B 4JI4F 2P5VA 3NAIA 1WNSA 3C14B 5KFKA 3G10A 4O3OA 2V2KA 2GQ2A 4DR2K 3SQGA 1AZSB 3TABA 2IFXA 4DMNA 1WUAA 2D74B 4CJUA 1TL3A 4K4ZA 3R27A 3PR4A 1KOHA 3VQQA 2H3GX 4ZVFA 4WKYA 3CJ0A 1DTQB 3TOQA 4FVUA 1N36K 1BGXT 2RN2A 5F8LA 1S0OA 1HKAA 3OW2M 3GCWP 3FFKB 4I68A 3M8RA 4KIAA 1WC3A 5H9FK 1IKYB 4EFAC 3UKUB 2GO8A 1R0AB 5AE3A 3J7YU 3CCVN 1FX4A 3TJ8A 1NSAA 2ZEJA 1V4TA 2OPPA 5G0RA 4IH6A 3D6MB 4OZ1A 2ZZMA 4F4KA 2DISA 4NYFA 2LSNA 3FBEA 1N88A 1RLCL 1SC6A 1TK5A 3DXKB 1EAYC 3R5JB 3KK7A 3TAMA 2CVEA 4QIVA 2ZD1B 2HRYA 2LEBA 4LREA 1RZMA 4FO0A 2ATQA 3W7BA 1X4DA 1F21A 7FDRA 4XDCA 4P74A 4Y65A 1OY6A 1FRKA 2QWRA 4CLZA 1HNZJ 3G9CA 4QOZB 2BUPA 3QRRA 4LR7A 4L73A 3DDKA 2FUG9 1S0MA 5IV3A 3ET6A 3A0IX 3IR5B 2CPFA 2VKZG 4IG3A 2QKBA 2QYGA 3E9OA 3KJNB 2QI2A 3VGUA 4JKBA 1Q95G 3KVGA 3HJVA 1TKDA 3KG4A 2FLLA 3PHEA 1C0TA 5L1KA 4EEYA 2DR6A 3D28A 3AA3A 3RZAA 1B64A 3EZ5A 4RWTA 2MLYA 3K0SA 2LLZA 1XTZA 3W3SA 3ATVA 3RJMB 3CD0A 3TTDA 1TL7A 5KFXA 5LJ5Y 1WEYA 4ECUA 2HQFA 1P8ZA 4B1YB 4JN4A 5JLHA 2RDDA 2FTRA 4PKDB 1HPZA 2PSZA 4CF8A 4FDFA 3ISND 1JKHB 4J2EA 4B3SF 4CZFA 1HA1A 2WFBA 1VBKA 3DRRB 1S99A 1SJ1A 1WOSA 5AQJA 2B8PA 3BQ0A 5JVGL 1OSCA 4CZHA 2UV8A 2D3UA 8RUCA 4X4UA 2OPQA 4MQ3A 4ECQA 4JI6J 3ZFVA 3VGLA 2XY8A 2MLZA 4ECYA 5F0WA 4KHNA 2NQPA 4JS4A 3PACA 4C11A 4YB1P 3HFKA 3DLEB 4CM2A 1QDUB 4OLAA 2CPYA 4NLGA 2XULA 3QB0A 5GIOA 2VQFK 5KPZA 1WLJA 4DSLA 1PC5A 3SBGA 4UF4A 3L09A 3OHBA 2NRTA 1EQ0A 1KC8O 2XSJA 4TLQA 3JQKA 3MEKA 1CLQA 1S6PA 3BYPA 4XO0A 1KFDA 4PQAA 1IM6A 3G8SA 1VK0A 1URNA 3AOBA 2LXFA 3JS6A 4YY3J 2E7XA 3M9MB 2Z2LA 2XMWA 3BF4A 2K06A 3R5BA 3AARA 3KHGA 1EWQA 5DQHA 2D3O1 1RHQB 2R2SA 4K8RA 3MEGB 2NRXA 3BEXA 3PYFA 4NLUA 2VOPA 4JRQA 5LY3A 5L9NA 3S7RA 3GOIA 3VZHA 5BYQA 1N5YB 3VA3A 5DZ7A 3PJWA 4KTQA 1M0SA 3TVYA 3BKUA 4FXWA 2E1ZA 3KHLA 1F3FA 5FPMA 3AVAA 1WG5A 1XMQF 1R8PA 3CCMN 1TK8A 3DHXA 2IM3A 2KJVA 4OYBA 2NZ4A 4UQTA 4DTMA 1NLKL 2ZNZA 3HI0A 5EN1A 3MR5A 1DFDA 1LWFB 1HPMA 1TVRB 5DZ6A 1TUGB 2OP5A 3HDSA 2M7SA 2FZCB 1HNVB 3I5AA 3TVZA 4DUYF 1G2EA 1EXQA 5C12A 2R7WA 3BO3A 4YOXA 4JV5J 3RAXA 5DMRA 3AAWB 5FD1A 1SQGA 3HVWA 1NGFA 2EHGA 3G6EN 1U6FA 3NWGA 1WAJA 4HHHA 3C65A 3T5LA 4RU2A 2BM1A 3WX8A 1HI1A 2ZWPA 1SJ4P 3FUYA 4CO4A 3MD3A 4F3MA 4PHTX 1PAUB 5J1PA 3QFUA 1RAFB 1R8HA 4QQBA 3IG1B 3BREA 2QA4N 1FJGK 5IS2A 2A6MA 2FZGB 5DDQC 2XMVA 3GIIA 1RYSA 1GLEG 2AU0A 4OI3A 1ZM2A 3NF8A 3GIJA 2QA1A 3ZSRA 4RUCA 4BC2A 1FEHA 1VI7A 3MMAA 4C1NI 2FVRA 5H9FJ 1NGCA 4O3PA 4OZLA 4Q8FA 2ASMA 1B99A 4R8UB 3BN4A 3HO1A 3GIRA 5KT3A 3K8WA 2UUCK 4ISGA 1W2IA 3UE5A 4CZLA 3MURP 4ECZA 4NXNF 1FFWB 2QWMA 1ZPVA 3GWCA 2DVIA 4KFBB 3HLUA 2DNOA 4KH0B 2LECA 2QO3A 2YWFA 3O3GA 2JSXA 4OZ5A 3ENWA 4AH9A 3G2XA 2WBRA 4EI2A 1IQZA 2B4VA 4M5MA 4O8KA 4NLRA 3H3NO 2W2PP 3UN3A 4Z4GA 1QVGM 3WNGA 2V8VA 3J80O 2VWJA 4K4YA 1FRJA 5FIIA 2RRNA 3CM6A 2DYAA 3EEQA 3C3LA 1YUWA 5KI6A 1DRZA 1T95A 2BE7D 3D7EO 1LW2A 4QR1A 2VONA 1Q86T 4NWBA 1NPKA 5IM0A 2ZH8A 5DM6L 4LF5F 4ID5A 1FKAF 5ADZA 3FGVA 2Q2RA 3DYAB 3O9UA 2ZWOA 5I9EB 2HS3A 3Q2TC 3M4XA 5CH7B 2MZTA 3VGMA 1MWQA 4MYTA 4C8YA 3IR6B 2OUGA 2ASJA 1B4SA 2C42A 2XMUA 2ZH5A 1G3OA 1UZHA 1VQPS 3LP0A 4WFAL 4GC6A 2DTJA 3LTOA 2FC0A 3TTFA 1DZ5A 1DQ9A 3KK3B 2XI2A 4JI5F 3LGHA 3FZLA 3W66A 3J81j 4ZJOA 4IKFA 5TKWA 4ECXA 3SPZA 3LDPA 3NXZA 3HM8A 5ETOA 1YHQN 2A3ZA 1F6TA 1RLDA 2VASA 4NMXA 1LK5A 4X4PA 3OTDA 3R5CA 1FDDA 1GLCG 5BN9A 3Q8RB 1HNZK 3D2EA 3V2UC 5CABA 2EFPA 3RUBL 3A5MC 2B51A 2IY5B 2DEIA 3KUHA 5HL7Q 2XLKA 4CO0A 4CJPA 3VWSA 3C2PA 1KQSM 1FTCA 2NXCA 4CQ1A 3D6RA 1RHUB 3A3NB 3M8QA 1PG5B 4DV5J 4JYAK 4FLTA 1KLMB 1XUPO 3I8BA 4JI7J 2J0WA 4KV8A 3BR9A 3K5LA 4DR7J 1SBRA 2X1GA 3DOMB 1TL7B 4GVLA 4KB0A 1RBRA 3VQ9A 3K58A 4A62A 4CEOA 3F73A 1QJHA 2EWSA 1C1CB 5F8MA 3DRSA 1VK3A 4DV0J 3H1VX 3CMES 2NXEA 4X4SA 1YWXA 4QYZK 3MWTA 2E5GA 3H98A 2VFSA 3AA4A 2VFRA 2AKWB 1WF1A 3FK4A 4CLSA 2ZDOA 3W5ZA 1VRTB 3DU5A 1DURA 3A4TA 1RE1B 5J2NA 1GNKA 1HI8A 2NUBA 2JH3A 2XYPB 1HBOB 5HROB 5CY4A 4RNOA 4ECSA 5CQGA 2OH2A 1IG8A 3E2EA 4NYNA 1EHWA 2XY7A 2FBYA 4DV5F 2XYHB 4IDKA 4NLTA 1RHKB 2VG7B 4MLEA 4CHYA 3M1VA 3VGSA 3HOTA 3CDEA 3ULDA 1FRIA 2KO1A 3S3OA 2C3PA 1WKLA 2B0GA 3D6HB 1NHUA 1GFWB 1H72C 4FJLA 2D0CA 1NJIO 3K57A 4DR2J 2W8KA 2CJ9A 3V6JA 4AQYK 3KTQA 1X31C 4ZVRB 2DGWA 4LQ9A 3EZOA 4ZKAA 1RTDA 2W01A 2JEGA 1BCOA 5KTQA 3FSYA 4FK0A 1EKRA 2VBWA 1UEKA 4LR9A 3GQCA 3NGYA 2BOAA 1QAJA 4IOAL 4CJ7A 3N9UC 5B0GA 1CZBA 5I3UA 3PHTA 3K8VA 4CYUB 1QTNB 3AY9A 4M5JA 3KYLA 4H5VA 4DFMA 2KDOA 3H4BA 3HHNB 3AV9A 1TQLA 3AD9C 1YRTA 2XO7A 4N5SA 5KG1A 2P9UB 3ENAA 3TR5A 3KK2B 5D4OA 5KFHA 5HK4A 3BO4A 4ES3A 3R2DJ 4H5RA 1FXRA 1S72N 1K73O 3VF0B 2V8DA 1XMOK 3VEXA 1Q9YA 5F0XA 3J81U 2IM2A 1S5JA 3LGNA 3TAMB 3V5RA 3KK3A 3NCQA 3W9HA 3O4WA 1XMOF 3DLHA 3FMWA 3BN7A 3FCHA 3CM5A 2XHCA 3BZQA 4R0JA 1UVJA 4I7FA 5DJBA 2GAGC 1RBAA 3HT0A 1FDBA 2E5LF 4ETZA 3R5AA 3CCQN 2V67A 3KLFB 1RGIA 1GXLA 2UXBK 1XHXA 4KH4A 2AQ4A 4LFCJ 3TWHA 4RNNA 2CKWA 3F9MA 4BRFA 4CT8A 1LAVA 3OYNA 3TO8A 5E7OB 4CH7A 1Q82O 1PYSB 1N5QA 4OX8A 1C0FA 3J7YI 4OPKA 1JNRB 3IFRA 2CJQA 4DV7K 4U9RA 2NNWA 2M4MA 4GVBB 3P5JA 4QWCA 2CUYA 3T5KA 2QWNA 2GWJA 3IWNC 4O5BA 4WQ4A 1EARA 3TSQA 2GVDA 3MM9A 1GK8A 3THYB 4KRFA 4ELTA 2WONA 1BHLA 3I0SB 3AAQA 4ISEA 1MNEA 3ENOA 3SJHA 3B82A 1CLFA 1IJEB 2E6LA 2HHHK 3W64A 3U1LA 2X1AA 1KVIA 2XSFA 3SCLE 1YZ6A 5IXUA 3N6NA 2QE5A 3BZKA 2XS5A 3KLVA 3ZTRA 2VBZA 3CCSS 3VGKA 4PZVA 4N8OA 1N33J 1UVMA 2IVNA 2CG8A 4F26A 4KREA 1GMWA 2HLUA 4TQRA 2BKNA 2EC2A 4OJRA 2O1PA 1WSRA 2POKA 2FY8A 3P5BP 1OYEA 1KVAA 4DU1A 3B54A 3D6TB 4JV5F 3NGKA 3KOAA 1CZAN 4IOCL 1YHQS 3JAMU 4A5AA 3MM7B 4Z4HA 2KKHA 2IVPA 1S7IA 4I0WA 3TAPA 2QWLA 3H20A 4CVNE 1LWCB 1VGYA 2H4WB 2PD1A 1K0TA 3D2FA 3AOCA 4PL8A 4BROA 4DLGA 4DX7A 4HH0A 3AD7C 1DTTB 3VQCA 2RUSA 4ZP8A 5LOQA 5JJBA 4EHUA 3UCGA 3O5TB 4QS9A 4M7XA 2OEMA 1UA1A 4GC7A 3NGZA 2D1KA 2A42A 1A6LA 4LFBJ 2VA3A 4FWOA 3DGVA 1OY9A 2O8FB 2RVJA 3R2CJ 3NF6A 4LF4J 3QEIA 4E1NA 4DCJB 3NGTA 3SJJA 4YOTA 1GH8A 4JI0K 4WKRA 3HZGA 4OYXA 4DS5A 2W42A 3AVCA 4B9TA 1KXPA 2BM0A 4PL7A 2HMIA 1C4CA 3IAS9 1U45A 2FYXA 2EKNA 3IN5A 2ZC4A 1KHWA 2Y1LB 1XI1A 2FJBB 1XNQK 4BDYA 4NASA 4DV4J 4WZMA 3R8YA 2BANB 2W2OP 3H59A 2HQCA 1FE0A 1YAGA 3DOMA 2HNZA 5BYRA 1GOAA 1S1WB 4J9SA 4E2FB 4FLZA 1UPMB 1YJ9S 1UCNA 3UIQA 3BBFA 1Q5VA 3DLGA 4KHWA 3OBYA 3D0GE 4H0PA 2FHJA 3O08A 4CGIA 4DPWA 5BREA 1N32F 3EE8A 3DLLQ 2FVQA 4FF2A 1W2BR 5HVGA 5DM7Q 5GAHU 3OL9A 3F56A 2F8MA 1LWCA 4H0YB 1JJHA 3F2KA 2MKKA 3D45A 4PYAA 3C8YA 1IG9A 4HTUA 4DN0A 5EWGA 3AVIA 2R2TA 3U02A 4JV1A 3CERA 1CQNA 4X66J 4KR0B 4OZ0A 1JLQA 4JS5A 3LZJA 3O3FA 2DRBA 2CNOB 4ALZA 3SNNA 3PUFA 3AJ2A 3T19A 1HBUA 3S1TA 1JXVA 4K42A 2CXEA 2Y1RI 1X3MA 4KQZA 2W9BA 3M30A 3JXOA 4JKAA 5AXKA 5KG0A 4FJKA 2RQCA 2P1JA 4JI5J 2C2NA 3PX0A 2DPNA 2CQBA 2JHEA 4NYOA 5A8WA 2VWKA 1RKIA 3DHWC 4EIAA 4PG8A 3R7NB 1ZM4A 3FZMA 4JV2A 1OQ3A 4YFUA 3OTBA 3O9SA 5HMWA 3NWRA 4Q45A 5KFEA 5BPNA 3I0SA 3HP9A 1LW2B 3MM9B 1T11A 2SXLA 2CJKA 1U2VB 4U67Q 1Y64A 4ZJQA 3CE8A 1URRA 2FHKA 3JYTB 1S1UB 5KFFA 5DETA 1R8BA 3ZCMA 2FLOA 5E33A 3I55S 5ETKA 4RJVA 4WF9L 1L3SA 4LRCA 4RNFA 1FI4A 3OXLA 3CJ7A 2OELA 1TP7A 1HW8A 1VHIA 4AT1B 1LNQA 4PUOA 2XMJA 4JI2J 4I56A 5AQYA 1FKPA 2FPHX 3HL8A 2PT0A 5KFYA 4CCHA 4J9QA 3P1GA 5F1XA 4KHPF 5CAAA 2MQMA 3P4IA 3HXMA 5D6GA 1HQ2A 4FWLA 5A0YA 4ELVA 2XBPA 2DGSA 4XH5A 4E7HA 1TKTA 4UY8O 1RT6B 3E1YA 1S9EA 2OTJS 3IS9B 2M70A 4IG0B 3R3LA 3Q0AA 2AJ0A 2XHWA 4I4BA 2HNYB 1SKWA 2NPIA 4LF8J 4DDFA 1RT6A 4DR3K 2CH6A 2YQ3A 1X4CA 3I4HX 1T9XA 5GAHI 3G86A 3SQOP 4JI1K 4HTLA 1FT8A 1FRHA 4RW8B 1IKYA 4OPJA 3C15B 2BE2B 5JVGQ 2V63A 3R9PA 2V50A 1RKJA 1NMNA 1EP4A 3FKBA 4I2QA 5BRHA 4PEOA 2GC8A 4I6MA 4LF9F 4JUZA 1KC8T 4H5NA 1HBNB 3ZNUA 2R7RA 3I4PA 3WNEA 3QDKA 3PDNA 5FDLA 3UDVA 4ZVUB 3KMSA 1TKXB 5T41A 5IT9Y 4J5OA 2IRYA 3OY9A 3HHKA 2FXUA 4JNEA 1PBUA 1TL4A 3DC2A 4LFAF 2DNHA 4DSJA 3DM2A 3TARA 4K50A 1U2FA 2GZOA 2ETJA 1HARA 2QM1A 5IT0A 1MROB 3J8AA 2GIFA 3SI8A 3NP5A 4WIQA 4CE9A 5ADXA 3AVNA 1EKEA 4WYBA 5JMVA 1WKJA 2GHVC 3D68A 4M63A 4P72A 4ILRA 4F67A 2GHWA 4IO9Q 4OVLA 4L3KA 1HNWK 2MPUA 4ZN1A 4N76A 2YKNA 2CVIA 5AQUA 2MY8A 4HUGA 3D1OA 5GADP 1KVCA 3A5NC 4ZP6A 4J37A 1T05A 4QWAA 2H65B 5EX3A 5J2QB 1N32J 4X4RA 1YG0A 1VBXA 2VCPA 2WOMB 4XEIA 1WBDA 3CIMA 3OR2A 1IV0A 3GE1A 2GIRA 2FIUA 1Y7PA 3CO9A 5ETQA 2ADCA 4A8XA 2DGUA 1CJKB 4FCYA 3DDIA 4JI8J 5KOWA 1WC6A 3DRSB 3HD1A 2HRTA 4K4WA 2AGPA 1GAOA 2VDIA 4NZ7A 4LF6J 1N56A 1RT7B 4M94A 3V9WA 4OIXA 5AZJA 1ATNA 2C2KB 2DBBA 3R7SB 2PMZD 4C97A 4FJ9A 1Z6RA 2BABA 3OFFA 2ZUAA 3RRKA 1S57A 4MKVA 2HNZB 4ED0A 4JHDA 4Z2XA 3AVGA 2QLWA 2AIRB 3CCLN 1SC3B 1PJ6A 4Q8EA 2BGGA 1RAOA 3PYGA 2W9AA 3J7Z5 1FFGB 2YWHA 2EVZA 3B6OA 2CGJA 4FOIA 2UVWA 3MUTP 1Z1ZA 3W2WA 2OSRA 1HLUA 4Q2MA 1NMEB 3HPGA 3U6FA 2F5GA 2ABYA 2XWYA 5F2RA 2AZ1A 2LQ5A 2FC9A 4MK7A 4MDBA 4AFFA 2UUTA 3VEWA 3DMJB 3L8BA 3I87A 1Q82T 5CR4A 4C3KA 3TQEA 5IC4B 2IVOA 3BEGB 3HHLB 3PRBA 3AVLA 4J9UE 1RDUA 2E1MC 3LUYA 4AM7A 4GV9A 1TGOA 3CJCA 2F8HA 2IIRA 1ZZFA 3MAHA 3AAPA 3H1QA 4FLWA 2WCXA 1PSDA 1DARA 1NJYA 5C25B 1XMQJ 3O9QA 3S6EA 4AHVA 1EKSA 2EFVA 2Q97A 4WCEL 5I3PA 5I4MA 1CEZA 3R3TA 1U1LA 2BANA 3TJAA 1R6YA 2QWPA 2H3EB 1U1KA 2OHDA 2YBVA 5KG7A 3HHEA 4ATNA 1RA6A 4C0OC 4XH4A 1MLAA 3I6PA 1RISA 3QT6A 3C16B 3EKSA 2NYHA 3AXMA 2B5JA 4NLPA 2P6TA 5B0DA 2ZOFA 1WAFA 2QXLA 5KFVA 3M9NB 4CF1A 1O1WA 3ZX2A 4FYXB 3E51A 4OJ3A 3JXUA 2HFUA 2KFNA 4AL5A 1N33K 5EX5A 2N4CA 1Z25A 2EFNA 3VF6A 4BQLA 5AT1B 2RHSB 2OFGX 4LT6A 2AJ4A 2YKMA 3A3PB 4L6V3 4WWSA 2O4GA 4GO5X 5ETMA 5EHHA 3SSQA 5IQQA 3ULHA 4WK3A 3G6XA 2P9IB 4F36A 1A7GE 1BUPA 3DM2B 3VAJA 4FBUA 2XB2D 1NXIA 2OPPB 3TEHB 1NPPA 2HHTA 2V9KA 1OPZA 4AHTA 4ZTJA 2ZH4A 1T3OA 2V68A 1SXLA 3H5YA 2B8QA 3DYAA 2BA9A 3CHWA 3TI0A 1RDBA 5B0CA 4B9SA 3CXCM 2IRUA 1RT7A 4B3RF 3AQOA 3RTVA 1BWVA 3PYEA 4BC3A 4AQYJ 3AVMA 3ZO7A 4I6MB 2QL9B 5DDPC 3H2LA 4IWVA 4I2QB 2J9DA 2CDRB 4KYZA 3MUVP 2JVOA 4DBQA 2OTLS 2O5DA 2KM8C 2E1YA 3CPWM 2OJ3A 4J9OA 2E66A 3T1YK 1ELOA 2IVMA 4JI2K 5CHCB 1HQEA 1RT3A 1Q1KA 1VHXA 1R59O 4E7KA 2D5RA 3U3YA 4QU6A 1S12A 2ALYB 4WZQA 1RTHA 4ZS6A 4A61A 4JI3F 3KJFB 3EXCX 4P73A 4JD2B 1KVKA 2R7YA 2ZJQQ 4JI6F 4WE1A 4C0BA 2ATCB 2QL5B 1N0UA 3DXBA 4ZP7A 3O44A 3DRPB 3W62A 1UPPA 1OH6A 2AJQA 2QXFA 3AHPA 1F9HA 3EYZA 4FXDA 3CI5A 3O3LA 4DFPA 1YITN 2VODA 2UUAK 1VQSA 4BRKA 3HHLC 4OV1A 1TKZB 4B3MJ 3QQCD 1YITS 2AA4A 1IKXB 3AT1B 4DV4K 2AP6A 2CQ2A 2L9NA 4GVBA 1FHTA 1N6QB 2MJUA 4JLHA 3ZZUA 2R2UA 3CJ8A 3VAIA 3GPAA 3U1MA 2KT3A 1EB0A 3I55N 4N41A 3C7NA 5HVFA 3H08A 1KQFB 1NUEA 3N4WA 3OVNA 3ZT0A 2V7YA 4H4MB 3FBCA 2YWGA 2BE2A 2R2RA 3L7UA 1JWWA 3JTPA 4FM1A 4FJJA 4FNIA 1WUUA 3WEEB 2F3JA 2W2MP 2E5LK 4OYPA 1GXUA 3DKDA 3KFWX 3ZXWA 3DRYA 5M2RA 4CHQA 2HSEB 1AW0A 4BS2A 5KT6A 4NRUA 3MM5A 4XDDA 3OYIA 2QSFA 1NK0A 2ASOA 5L38A 4CJ5A 5C2FA 2C22A 1X5OA 1HQEB 1RDRA 1AYEA 2BJ7A 2G8KA 1HMVB 1REVA 2UXCK 4Y28C 4CZKA 3W61A 1VC0A 3BH6B 2GMJA 1YTAA 5E0OA 1QQCA 2NLWA 3L2RA 2V2QA 4ZCLA 2DY4A 1MWMA 2AWZA 4ZPAA 4Z4EA 3AH6A 1JLGA 3CJSA 3IGNA 2EEYA 4BG9A 1NDPA 4JI8K 2GUIA 2ZZTA 2GX9A 1DQAA 4CYUA 5FJ4A 1K9MO 2HF3A 4B1VA 1U1PA 1GLLO 4DSEA 4JKEA 4Q5VA 1FA0A 4A47A 3UFCX 1K1SA 4CJLA 1ZBUA 1BIUA 4WE1B 5IC6B 5IT9O 3MFIA 2K7KA 4ZDNA 2CQ0A 1M5KC 3SUQA 1SH3A 1HJOA 4GMJB 1Q8BA 4DV2F 4NEYA 4Q7AA 2OI2A 4UY8T 4IDKB 2V9WA 5GINA 4ZPVR 1ZA1B 1WSJA 2UUBF 4EGLA 3UDCA 5HI7A 3EVWA 1RT3B 4NX9A 5A0YB 3L7PA 4C48A 4JI3K 1YVUA 3D7SB 2V4QA 2KHDA 3EO3A 3DRRA 3TAQA 2VHGA 1LK7A 3LQVA 2WVFA 1NHVA 4FJNA 1I5OB 4MIWA 5FPEA 1SH0A 3KLGB 4E1JA 4BVPA 5AFUA 3J7ZO 4OKJA 1GTEA 3L2UA 4JKDA 3T1YF 1Y5LB 4FWMA 4PCQA 2BQ3A 3GCXP 4ED4A 4QIEA 2FSJA 3HPOA 4CZJA 3MZIA 3DJCA 1B92A 2VG6B 4J9KA 1Y0HA 4L76A 2I9SA 3PY8A 5E26A 4UT4A 1BLUA 1S1TB 2DHSA 1JB0C 2IJRA 2DCLA 3QWUA 3BPSP 1F60B 3D6FB 3V6HA 3IUCA 3TUIC 1VISA 2VV5A 2M5YA 3HFZB 3PX6A 2QZ8A 1YF5L 2MMYA 2QK9A 4ZVHA 4IYQA 2WTFA 1W7WA 1BG3A 1RCXB 3DLEA 3M8QB 4HT7A 3LP2A 3LPYA 4WJBA 2Q79A 3PKMA 2OZSA 3L4BC 1SV5B 1RBLA 4ZVOB 4Z4FA 3HD2A 1T8EA 1W97L 1HKGA 1SCJB 3KXDA 3WXIA 4BR4A 3FZHA 4ILHA 3AJ1A 1XWLA 4L3NA 4NYZA 1YJWS 2W7PA 4Q43A 3G6VA 5AQVA 1V5VA 1IQTA 4WQ4C 1DHMA 4LSZB 4MKYA 2P9KA 2IOCA 3RW6A 3ETMA 4YOVA 4DX8H 3OW2R 4OLOA 4TY9A 1RT4B 4BHQA 4YHHJ 3CCES 4CZGA 1MROA 3A8JA 1VMBA 3GJTB 2ZQBA 3G6ES 4MTPA 4UOFA 4FLYA 2P9NB 3LWMA 5AQIA 4BC5A 1OS5A 5J1NA 1J53A 3TNVA 3PKYA 4HI2A 4URGA 3ETOA 2KRRA 4PPZA 5C5JA 2HBJA 4ILLA 2O8CB 1HD1A 3AVJA 4PQUA 4X62J 3UWTA 4P9SA 3FEYB 3HVAA 2VFTA 3CQYA 1P27B 3DMJA 4URSA 4WQ5A 3LPUA 2Z2MA 2G0IA 5CHIA 2Z1HA 4H0XB 2J7WA 1WTBA 3NY0A 1EP4B 1H2UX 4I64A 2DFFA 3THXB 3NNCA 1BXNA 3U9DA 1QVFM 4B3OA 3BF3A 1HHTP 3HVTA 2CQCA 1IH7A 5J2QA 4ZCIA 1OH7A 3M8PA 3R1LA 2MQNA 3ENQA 4UQGA 3ZTQA 2UUCF 4NLVA 1P9YA 4YR3A 3CJRA 4P7TA 1FRXA 4FZYA 3LGMA 4FOEA 2CNKB 2D7SA 4LUBA 2E5LJ 5DO2A 2XWXA 1XEZA 4I1TA 3RAMA 1P6TA 2M2BA 4OYMA 2Z58B 3VQPA 5HRPA 3G8QA 4MLHA 3T6BA 2MQQA 3ZSYA 5ETRA 4DR6F 4FLUA 2CWKA 4HWIA 1FJGF 3H5UA 4YS2A 1C2PA 2M88A 3K5MA 3TX0A 3K59A 2PA3A 2CJAA 2BVZA 1CJTB 1F5BA 4CT9A 3GV5B 3WC0A 5BN8A 2F65A 4BE2A 2KKZA 1FDAA 1RNHA 1IO2A 4FJ8A 3U7JA 5C42A 3K2YA 3FRZA 3OT9A 3OS0A 3ZSQA 4J9NA 2BW2A 1KEKA 3EY1A 1VBYA 1ASUA 5FLXY 3VQ8A 1HNIB 2LCWA 1FD2A 2CFXA 2HG4A 3C6TA 2HGLA 1RT1B 4NLDA 3IBWA 3FNNA 3FMBA 3EL2A 2QV6A 4N77A 1KOOA 5ETLA 4NLWA 1PAEX 3W63A 1MSWD 3RW7A 1EQYA 1FJGJ 4CTAB 5BR8F 4O0NA 2ROGA 5LJWA 1U2RA 4UZBA 5GAEU 2HHHF 1FNMA 4FS1A 4QIFA 5KT2A 2DY9A 5IOLA 3MR3A 1MWYA 2CZ4A 2FF3B 1LWEB 1F1BB 3T5HA 4ZPDA 3OYMA 3QT8A 3PXGa 4F02A 1NNEA 3K0JA 1VSMA 3PTWA 5KG5A 4YDUA 3CEDA 3C6AA 1MWKA 3PW0A 3ZZPA 2BJ1A 1N5TA 5HANA 1WC1A 3MDFA 1R27B 1SS6A 1YJ7A 2E9TA 2B9EA 1X4GA 2HZVA 2WVDA 2UXCJ 3PW5A 4L3QA 4C8MA 3ICLA 2OMLA 4CEBA 3M32A 1IBMF 1XERA 5AQSA 4OHXA 2KZMA 3CCZA 3SUOA 2GFFA 1LQ9A 1WC0A 2UXBF 5KFDA 3EE9A 2KXNB 3C6UA 2QLBB 4A8SA 1HR0J 2KI2A 1IBLK 4H4OB 2R3VA 3J7ZT 4RW8A 4LF9K 3OYFA 1HWIA 4NZ6A 4JBCA 1QQNA 2J6TA 2VQFF 3LP1B 1RWMB 2DITA 4FW2A 1Y5IB 4E19A 2NYIA 3P4UB 3WUHA 3HZ6A 2E9RX 1NGAA 4JI1F 4UW2A 5BPMA 4XAKA 3T1HF 2MZ1A 1AA1B 2VGNA 4QWBA 3SK3A 4C3LA 2GHPA 4XK8C 2C3OA 5J2NB 2CJBA 1HHSA 1HI0P 4RL1A 3OSPA 3CJ4A 1TTHB 1X7VA 3H6EA 2P9CA 3FDSA 7AT1B 4IFVA 4B1XB 3VQDA 2H5IB 3V81A 3L9ZA 1J5EJ 2F4FA 2OPQB 5A76A 2ZM6F 2NXUA 2AF6A 3UD4P 1OH5A 5FROA 3GV8B 4J2DA 4XPCA 2K7JA 5LL6d 4J9VA 3TUZC 3UW1A 4DV6K 2KLAA 4M3RA 4EUVA 2HFOA 2IMWP 3GB0A 3A2FA 4F0KA 1DQ8A 1TFWA 4MKBA 4CLWA 3MI7X 3RMDA 2RRBA 3FSXA 4I6AA 3UVJB 2OFHX 4IH7A 1Y4ZB 1C0GA 1VQNS 5FLXU 1O6XA 4LF6F 4LR8A 2W7AA 4B3MK 4OLPA 3AVBA 1FESA 4HVJA 3D0PA 3DU6A 1ZBSA 2CRLA 4ZITA 2G2ZA 2VD3A 3QGGA 2APOA 1KD1T 2JOQA 1CJKA 2CJYB 3I56S 4CGGA 1RWUA 2FZKB 4DUTA 4YMEA 3M8SA 4DL5A 4A57A 2KB2A 1WD6A 2P9PB 2RE1A 5MLCV 1NJIT 2HHQA 3VQTA 3RRHA 1AZSA 2YWEA 3FBBA 3RSEB 2YXLA 3MCMA 3V6DA 4LBHA 4PRFA 1K47A 3MTKA 3BQ1A 3H2UB 3JSBA 4PKHA 4JYAF 1DGKN 3MMVA 3T1AA 1KWMA 2JLGA 2X78A 3OVBA 1IR0A 2J8AA 1E6YA 1QY7A 1U49A 1J2VA 1VQMS 1M5HA 2D9OA 3FBFA 4OFZA 2KN4A 4DZDA 1HNIA 3VAHA 1ZAWA 1S97A 3WIUA 1D4XA 2FSKA 4LJMA 5LMNJ 4WFXA 2HHWA 4CJFA 4CBUA 4M42A 1JXBA 2W2NP 4M63C 2CYYA 1RU1A 2ZVIA 3VEYA 3DFEA 3R1HA 2Z1GA 3VEVA 1ZYQA 4DUZK 4EK2A 1IBMK 3I5CA 4NYPA 4E3SA 2JC0A 2GS8A 2VYPA 4USIA 1UFLA 2RU9A 2NR0A 5DM7L 4DMZA 1ITGA 3IRXA 2O3DA 4LY7A 1Z4UA 3EGVA 1Z05A 4DSFA 2MQOA 3ZYYX 1JJCB 1DEJA 3KG1A 1PBAA 4U6PA 2JNJA 4A2AA 5EDWA 1V3RA 5KFUA 1Q78A 1YRUA 1IR2A 2DNPA 2BKOA 2Z2YB 4X64K 3FFIB 9ATCB 5CA5A 4KH6A 1DLOA 3MCSA 5AJ3F 2ITMA 4ERDA 3C95A 4M5IA 3BYRA 1VSIA 3GMGA 4HYKA 2O8DB 3PM9A 1QS4A 2FHOB 3DOLB 1X9MA 3LP0B 3GR1A 5D4PA 4DQPA 2D3ZA 5AQLA 1NRKA 3LP1A 1IXKA 2I38A 1CJUA 1NO8A 4Y0WA 1D9AA 4HTJA 2ZITA 3NVKA 1ULRA 5AZJB 1FKPB 4ECTA 3SLCA 1RDWX 1S9GB 4F4ZA 3HSDA 3S8SA 1RUSA 3H0PA 5AQXA 1HYSB 1WF2A 1I39A 3G82B 2RE2A 4DR4J 1O13A 1P1LA 1RBOB 3EX7B 1DTQA 3LAKA 2BXJA 3BY5A 2PI5A 2HQDA 1ZAVA 6FD1A 4A59A 4PXCA 4BRDA 2Z1JA 1WC5A 1F3VA 4JOUA 4K5SA 2CAJA 2HURA 4OHZA 3L95X 4TU9A 4YR0A 1NJXA