3T19A

Crystal structure of hiv-1 reverse transcriptase (wild type) in complex with inhibitor m05
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse Transcriptase
publication title Design and synthesis of conformationally constrained inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
total genus 155
structure length 554
sequence length 558
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3t19A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t19A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t19A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t19A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3t19A05
2CKWA 2E4LA 4ZHRA 2R8IA 5FDLB 2EC0A 4CK3A 4NLXA 3KIOA 1HYZA 1TK5A 4N5SA 1RDRA 3K5LA 1FKPB 3ISNC 1X9SA 4KB0A 4KKOA 4MIBA 4I2PB 1RDAA 1T3NA 1A5VA 3AA4A 4RW8B 2IMWP 1U4BA 4J9QA 4KTWA 1SKWA 4L8RB 3PY8A 3C6UB 4HCCA 4C8LA 4EYIB 2R2UA 1JLEB 1HNVB 1QSYA 3FRZA 4C8MA 2HWHA 4Y2CA 1XI1A 3LP1B 1LW0A 3HPOA 3H4BA 2P5GA 4FZXC 5HP1A 4H4OA 1RDBA 3RR8A 2ASDA 4IFYA 1D9DA 3OJSA 1WSEA 4FBTA 2AGOA 1HRHA 4YR3A 4J9KA 1ZBUA 4C8KA 4EZ9A 1BIUA 4ZPBA 3QETA 2OZMA 3OYLA 4HUEA 1FKOB 4TY9A 3PW2A 3CJ4A 2ASLA 3ULDA 3KD1E 3T5HA 2HWIA 4DG1A 1BISA 4RW9B 3M8QB 4KV8A 1XR5A 3NMAA 1BHLA 3TWHA 2BGGA 4ZP9A 3BSNA 3CJ3A 1JLCA 4O0JA 3QERA 1WNSA 1L3VA 2X6NA 4FVMA 5HLFB 2YNIA 4QWBA 4BACA 2W7PA 2OPRA 1N4LA 2AGQA 4CJ5A 2RKIA 1HQEB 1JLGA 2E9RX 1D8YA 2DPJA 3QNNA 3KKSA 4DL5A 1Z25A 2FVRA 2QE5A 1RILA 2FBTA 4RW7B 5KFUA 2YKNB 3ZSWA 5C25A 3AO1A 3MXMA 4ECTA 4FK2A 1N5YB 4NLWA 1NJWA 5C42B 1EXQA 3OYKA 4NLRA 1T03A 2C2EA 3QIPA 4GC6A 3PJWA 2G8UA 4BDZA 3CVKA 1IKWA 3QEXA 4W5NA 2JEGA 3RMAA 2D0CA 2B4JA 1S1VB 3V9ZA 2A1SA 3V9WA 3GILA 5DQIA 2ILYA 2OZSA 5T7BA 4DTMA 3IRXA 4PQUB 4WYWA 2W7OA 4FJGA 1WSHA 1NJZA 2WOMA 2YNGB 4CF8A 1XHZA 4G1QA 1T05A 3VN5A 3H5YA 5KG3A 5D3GB 1CXUA 1NK8A 4JV1A 3OSPA 1BCOA 1RBUA 2D0BA 2OPPA 1YVUA 4ICLB 3H5XA 3RTVA 2HNYB 4NYFA 2QKKA 4U7CA 4WFZA 1IKYB 3DM2B 3JYTA 1S6PA 1JIHA 4EYHB 2WRMA 3KLHA 4J9RA 3HT3A 4J9LA 1WLJA 1S0MA 1SL1A 4DSEA 1UOCA 3VA3A 4ZVGA 3ZT2A 3SJJA 3L2RA 3CWJA 3VQ9A 3AVCA 5JXSA 1JX4A 1C1AA 1KLMA 2F8TA 3PW4A 4IFVB 4TQSA 2XRIA 4M45A 4B9UA 3OL8A 1WSIA 1S0NA 4N56A 5KFTA 2W8LA 1VSKA 3V1RA 3MR5A 5CYQB 3HK2A 2VWJA 2VG7B 3SI6A 1XR6A 2B6AB 3E01B 3CQ8A 4F2RA 3HVAA 2FC0A 1S1XA 5KFZA 1S1TB 3OS0A 1TKDA 1ASWA 2FLLA 3NFAA 3BGRB 5F8NA 1R0AB 1LW2B 3QNOA 4UQGA 4DTUA 1S1UA 2WONA 3DMJA 5K14B 1HQUA 4W5RA 4ZP8A 3DLBA 4KHMA 3KLGA 3SFUA 3G6YA 1RYSA 4CHPA 2JEIA 4NCAA 2QV6A 4ECZA 1TK0A 3A2FA 3QO9A 3NAIA 4K8XA 2IJFA 3KJVB 1NKCA 1D1UA 3Q8QB 2O5DA 2D3UA 4ID5B 3FQLA 2UVUA 4WFYA 2HHVA 3MEDB 1ZBIA 1T94A 2Z1GA 2ATQA 3HSTB 1RTDB 1VSLA 2BE2A 3VQCA 1REVA 1RT4B 3O3GA 5EU7A 1WSGA 4CK2A 4TXSA 4CJPA 3DLKA 3V9SA 2AX0A 4QWEA 4B9VA 1RTJB 3H59A 1L3TA 1KLNA 2OPSA 1X9MA 3THVA 4M3ZA 4KSEB 3BR9A 5T14A 4OVLA 2P1JA 3MEEB 4IOBA 3QZ8A 3AO2A 3NBPA 1TP7A 4YR0A 5KRTA 3PO4A 4LSLA 2IGIA 3S3OA 4ZVEA 4DTRA 2JEJA 4U6PA 3VQBA 5KFRA 4EBCA 2HHUA 1FK9B 3VQ7A 2BANB 1VSHA 3DYAA 3CYMA 4J2AA 3ISND 3G86A 3CJ5A 5EUHA 3K5OA 3Q8PB 4DFKA 4BDPA 3UQSA 3KK2A 3CO9A 3H4DA 3ZT0A 4B9NA 3F73A 4CCHA 3M8RA 3VA0A 1SV5B 4X2BA 4FZYA 3AA3A 3LP2A 3S3NA 4WZMA 3IGNA 2XWYA 1BIZA 4H54A 2ASJA 4DL7A 5HBMA 4M3YA 2Z1IA 4URGA 3NH2A 3HXMA 2IS3A 1KHWA 4IR9A 4PY5A 4ED7A 3H5SA 1C6VA 3EY1A 1JLAA 5KG1A 3VQ8A 1LWCA 1IKXA 2YV0X 3LP0B 3CIZA 5L1KA 3EPIA 1VRTB 4LQ9A 1EETA 2VA3A 2XI3A 1TV6A 5J2PA 3V9UA 3MTKA 1S9EA 3IRXB 2UUTA 2BQUA 4FW2A 1ASUA 4R8UB 2ETJA 4H4MA 3RAQA 3P1GA 1B92A 3RB4A 2FBXA 3SYZA 3HKWA 1TAUA 1RDCA 1VSDA 4YQWA 4B08A 4OLBA 1BI4A 4GVMA 3HVTA 5DQGA 2IBKA 1RDDA 1WN7A 1N6QB 4ED2A 3NDKA 1G15A 4DU4A 5HRSA 4JUZA 4NLYA 1B9FA 4IG3B 4QW8A 2FVSA 3NKYA 4BE0A 2J6UA 4CE9A 1JL2A 3PX6A 4RG8A 2D7SA 4DL3A 1UWBA 3T3FA 4RW6A 4XIUA 5EDWA 3ALYA 1ZTTA 5F8JA 1KLMB 2FVCA 4YNQA 4IRKA 4ED6A 4QWAA 1EX4A 4TLRA 3G6XA 4FLZA 4Q0BB 3LPUA 3PV8A 5KFQA 3DOLB 1RA6A 3DRPA 4IQXA 4ECUA 3FQKA 3M9OB 4E89A 4QPXA 2HB5A 4FJNA 1KRPA 4F4KA 2F8EX 2BRLA 3DLGB 1JXEA 4H8KA 4FS1A 2YHBA 3MFIA 1RT5A 3L3UA 4CFCA 4FJJA 4E7IA 4BE1A 4FJHA 1I3AA 4N47A 1S1UB 4BWJA 1BQNB 3DOKB 4WE1A 2W9CA 5F8GA 4KHUA 1SUQA 1RT1A 1TL1A 4FLUA 3LWLA 4FJ7A 1JLBA 1S1WA 3I0RA 2P51A 1S10A 1SL2A 3MAQA 4DU3A 4FW1A 4CEZA 5HROB 3SPYA 4OLAA 3LAMA 1Z4UA 3OL9A 4ECQA 4FK4A 4CIEA 1X1PA 1UA0A 5KFBA 1W9HA 4N76A 2XY5A 4OPJA 4MKBA 4Y1CA 4B8AB 4CJ3A 4ECWA 1UA1A 3GV7B 5KFOA 4RW4A 3KHHA 1TKXB 3K2PA 3KKRA 2O4GA 4CGFA 4FXDA 3ZT3A 2JGUA 1RT2B 5DMRA 3RRGA 4F3TA 1QQCA 3SZ2A 1U09A 3T1AA 1NHVA 3VQ4A 4LH4A 3ZSZA 4CGGA 3OYHA 4J9SA 3SNNA 3BSAA 5J1EA 3M8PA 4TN2A 4O3PA 1RA7A 4DL2A 1UAXA 1S49A 4DQQA 4ELVA 3L2WA 3ZSQA 4IR1A 3KMSA 3DRRB 1I6JA 3K57A 4CIGA 4KO0B 1C0TB 4MK7A 2IOCA 3N6MA 3OYIA 1RBVA 1IKVA 1J53A 1K6YA 4MK9A 4RNHA 3KLEA 3QIDA 3AO3A 3D5MA 2XI2A 3ICLA 3NAHA 4E7HA 1YVFA 1RT3A 3FFIA 4KRFA 1XWLA 4DLEA 2E9ZA 4O5BA 4NCGA 3KLFB 1WSFA 1TL3A 2UVVA 1JLQB 3V4IA 3V6DA 4B8CA 4FK0A 3RAXA 5KT5A 2DTUA 4FJ9A 3ZSYA 4IBNA 3KHLA 5KFFA 1A5XA 2HHSA 4E0DA 4LSNB 3I5AA 1HPZA 3IG1A 4E1MA 4FYDA 3NL0A 4F4YA 4NRTA 3K58A 4R0EA 1NK5A 2HHWA 1Q9XA 2C2RA 2W9BA 1IKXB 2GIQA 3QYYA 3RMDA 4Z4EA 3OHAA 1C0UA 1U48A 4J9PA 3TAMB 2I5JB 4KHQA 4KHNA 1RTIA 3DI6A 1IH7A 2R7YA 3U3GA 1GX6A 2J6TA 4DEZA 3QESA 1TVRA 1C2PA 4J9MA 4ECVA 2CJQA 1TAQA 4Q8EA 1VK0A 4CFBA 5J2NB 3VQAA 1VSEA 3TAEA 4O3OA 4RU9A 5JUMA 4EBDA 2O4IA 3HM9A 4M3UA 2YNHA 3ITHB 2XCPA 4ZTJA 3UIQA 1NJXA 4CHOA 1KTQA 2GBZA 3KK1B 4AHSA 4LY7A 1WAJA 4CJRA 3OLBA 1RTHA 3QLHA 2ZE2B 4AH9A 3HHKA 1GOBA 4PWDB 3HYFA 3TVKA 1RBSA 1KHVA 4I9LA 2HHTA 5KTQA 4FCYA 4URQU 5L1IA 5FRMA 2AQ4A 2VG6A 4WFXA 1A5WA 2IC3A 3K5NA 4URSA 1HMVA 2WK4A 2G8HA 1QAJA 2HW3A 2IAJA 5KG0A 4ID1A 4IDKA 2OPQA 3BQ0A 2BDPA 2YNFA 2ZD1A 3DRSA 3L2QA 4Z0UA 2FVPA 1W0HA 2QKBA 3O3FA 5I3UA 3JSMA 4CJEA 3OY9A 4OJRA 4CIFA 1TKZA 4IRDA 4BE2A 4AHRA 3OYMA 2OA8A 1JXLA 1QHTA 1MU2B 1LWEA 4E7JA 1EP4B 4B9MA 4JS4A 2FBYA 3BSOA 2XY8A 2X6SA 2B5JB 2Y1IA 2W9CB 2RDIA 3AVIA 1SKRA 3D45A 1BQMA 4O44A 3MXJA 4CJQA 1SUQB 5KG4A 2HNZA 2RF2A 4MK8A 4F50A 3SUQA 5F9NA 2HNDB 2HMIA 4KTZA 3T5LA 3MXIA 4FZZA 3PW5A 1SH0A 4Q8FA 3L2VA 1RBRA 4IG0B 1N56A 4O4GB 1Q8IA 2ALZA 4DQPA 5J2QB 3OYEA 5KFMA 3QEVA 4CF2A 1DTTA 4AHCA 3MEGB 3PUFA 3V6JA 3IS9B 4EP5A 2BRKA 4M3WA 3MR3A 4FJKA 3V81B 3LWMA 3K5MA 5KT4A 1D5AA 3IAYA 2R2TA 3DLEB 3KK3B 3SQ1A 1JKHB 2HVHA 3TR8A 4YR2A 1S4FA 2JLEA 3OYFA 4XPEA 5KT7A 3PO5A 4KI6A 2R2RA 3NGIA 4CHQA 1YT3A 4Z4GA 4CEFA 1HYSB 4R5PB 5I42A 1VRUA 3UPFA 1L5UA 3KLEB 3H08A 4ZMMA 4TY8A 4FLXA 1SH3A 4FLWA 2JC0A 1S0OA 2PY5A 3L3VA 1RT6B 3OJUA 1RT3B 3S9HA 4NLUA 4F4ZA 3MECA 1NJYA 4O4RA 4KHRA 2UUWA 5FROA 1QE1A 4ZHRB 5JS1A 3PX0A 1MMLA 2DFHA 4DF4A 4AHTA 5KFSA 4ED0A 4W5TA 4B3OA 4W5OA 4K8ZA 4Z4IA 3P5JA 2V9WA 2AU0A 2RPIA 1C1BA 4KKOB 4AILC 3I0SA 3SUNA 1QSLA 3LAKA 3D0PA 4N41A 4FJXA 5KT2A 2A1RA 1DTQA 4NLSA 1D0EA 3OSNA 5C24A 3VQDA 4EO6A 3NF7A 1LW0B 3C6TA 4JRPA 2DPIA 3AVHA 5HP1B 3CDEA 4H4OB 5DG7A 2XHBA 4IFYB 3TANA 3AVGA 3DDKA 4ELUA 2RDJA 3HP6A 5CYMA 2HHQA 1S9GA 3AVFA 4Q45A 2X74A 5KFGA 2PZSA 2QK9A 3M8SA 5KFNA 4ZP7A 4CECA 4Y34A 4TYAA 5DLGA 4ZVHA 3OYBA 4DG1B 3HVWA 5F8IA 3TQ1A 4KV8B 4ZPCA 1X9WA 3GIJA 1JLCB 1JLFA 2YNIB 4QW9A 3PZPA 4CEDA 4MH8A 2OPRB 2XY7A 2RKIB 1JLGB 1RNHA 3AO4A 1C1CA 2W8KA 4I7FA 1RT7A 4HVJA 3WNGA 2JEFA 1YTAA 4KFBA 3RWUA 1NHUA 4XO0A 4WYLA 4K4VA 4M41A 5C25B 3OYNA 1HNIA 4B9TA 4GC7A 3V6KA 3CDUA 3CM6A 3VQPA 3HJFA 4QAGA 4CEQA 2X78A 1DLOA 2IM1A 3MFHA 3NF9A 2RN2A 4XPCA 1T03B 5F8LA 4M95A 3TAPA 3QIPB 3MR2A 1LWFA 1WAFA 2VWKA 4KE5A 4KHYA 5KFKA 1Q9YA 3CM5A 4MIAA 3KTQA 1IKWB 1NK9A 5FDLA 2HNZB 2DFEA 4E1NA 4FM1A 4ZPDA 4CJLA 4IH6A 1FKPA 3M9NB 4C8NA 5KFJA 3ZT1A 4I2PA 4RW8A 2WOMB 4DWIA 3TI0A 4G1QB 1T05B 3EPGA 3OLAA 3C6UA 1JLEA 4DFPA 3NF6A 3H5UA 2OPPB 4J9NA 3ZT4A 1HNVA 3L2UA 2C22A 4PA1A 3LP1A 4IH5A 1U49A 2C2DA 4K4SA 3JYTB 3LDSA 3NGZA 1S6PB 3DLRA 1KFDA 3VQQA 3KLHB 4B9SA 4Q5VA 3WNEA 2Z1JA 4CEEA 5DLFA 4ED8A 3CFPA 1KFSA 3CJ2A 4YMEA 4Z4FA 4M94A 3PR5B 5KFXA 3LANA 5F8HA 2PYLA 4JV2A 4RW9A 3M8QA 4CJKA 3TAQA 3CDWA 2DFFA 2BR0A 2HAIA 5HLFA 4QWDA 4K4TA 3B6PA 4TSXA 3KLIA 1QE1B 2V4QA 3RB6A 2GC8A 1S1XB 3HL8A 1HQEA 5KG7A 2GUIA 1GOCA 3BSCA 2XC9A 2V0NA 3BQ1A 1ZETA 4WZQA 4RW7A 2HHXA 2Q3SA 3SQ0A 2YKNA 2WONB 3DMJB 3GIKA 1HQUB 3U3YA 3D28A 3KLGB 4HYKA 4CF0A 1N5YA 4DFJA 1QSSA 3ZSOA 2Y1JA 3QO9B 3M9MB 1QTMA 1RBTA 1SL0A 3CFOA 4ED1A 3UR0A 4NLVA 3NH1A 4CJSA 4CGDA 2Z1HA 3I8DA 4OKEA 4EBEA 4DLGA 4DTPA 1S1VA 3OS2A 2BE2B 1REVB 4CGJA 5L9XA 5J2MA 4PQUA 4Q43A 2LSNA 2VG5A 3DLKB 1LAVA 4TQRA 3G0ZA 1KVCA 2YNGA 2OPSB 3GIMA 2KW4A 3OYCA 2G8VA 3I5BA 3NCIA 4FM0A 4BDYA 5D3GA 3NBPB 2F8SA 4OKKA 4LSLB 3TAGA 3TARA 4ICLA 3O3HA 2HNYA 3SFGA 1IKYA 3WNHA 3DYAB 3HVRA 3DM2A 3LPTA 5CZ2A 4K4YA 4Y3CA 3KK2B 1T7PA 4ZVFA 2WB4A 4I2QA 1F21A 2AX1A 2PYJA 4I7FB 1J54A 3LP2B 5L1JA 3ZSXA 5SZTA 4KBIA 4EP4A 4ZP6A 4NYNA 5KFLA 5HBMB 2YKMA 4IFVA 2P5OA 3UDLA 3RB0A 5DQHA 5KFWA 3AVJA 1TQLA 1FXXA 2KZMA 4CJ4A 2OYQA 4E7KA 4K4UA 3NAEA 2EX3A 2VG7A 2FJWA 3OL7A 2B6AA 4NLOA 1BGXT 1Y97A 3QEWA 4M3XA 1JLAB 4J2EA 1J9AA 1LWCB 3HP9A 2QXFA 4KPYA 1S1TA 4QWCA 1EETB 2UVRA 1TV6B 1K1SA 5J2PB 3QGIA 4LQ3A 1S9EB 3BGRA 1R0AA 1LW2A 5KGXA 4HUGA 1ZBLA 4NLDA 1TKTA 3SUOA 4H4MB 5C5JA 5K14A 4ECSA 1C0MA 4KTQA 3B6OA 3OYJA 3G6VA 1EKEA 2W42A 4KREA 3LZIA 1BI4B 4YP3A 3HVTB 2XGPA 3KJVA 3AA2A 4WXOA 2HVIA 4C8OA 1IO2A 4M3RA 4ID5A 4HUFA 2G8KA 1XC9A 3MEDA 1SKSA 4PUOA 1W25A 3SUPA 5HRPA 3GV5B 1RTDA 5JS2A 3T5KA 4CERA 1CZ9A 4CEOA 3QEIA 4JV0A 1RT4A 3PX4A 5KT3A 3ASMA 4RNMA 1UWBB 1HYVA 4F4WA 4RW6B 1NNDA 1RYRA 1RTJA 1B9DA 5FRNA 3MEEA 2R8HA 4CGIA 4CGHA 1NK0A 1XHXA 2IM2A 4CJWA 1S6QA 3DRPB 4DS5A 1FK9A 2BANA 1SH2A 3VQSA 3IGVA 4DL4A 4BWMA 4RUCA 3KLIB 4DU1A 3DLHA 2NUBA 4QOZB 3SQ4A 4FLVA 4EO8A 4GW6A 3F9KA 2WCXA 3OYAA 1QUVA 3NHGA 4B9LA 4NLTA 3SPZA 1SV5A 1HARA 4DF8A 1TGOA 1RT5B 3SQ2A 3RB3A 5KFAA 3ZSRA 4F3OA 1QS4A 4WE1B 3SV3A 3C94A 5HRRA 1RT1B 3GIIA 1TL1B 3TABA 2ILZA 1JLBB 1S1WB 3I0RB 4ELTA 5KFHA 5KFCA 3AVLA 3V1QA 2AWZA 1U04A 4ECXA 1GOAA 4FJ5A 1NK4A 2XCAA 4WXWA 2R8JA 2V4RA 5DG8A 3K59A 3GQCA 3OL6A 4CJFA 3LP0A 4O0IA 1VRTA 4RW4B 3RBEA 5J2MB 2FJXA 3N6NA 2R8GA 3NGYA 1S9FA 4R8UA 2VG5B 3HPGA 4DSFA 4CJTA 1CLQA 4JS5A 4FJIA 4E3SA 3NE6A 2FLNA 4MFBA 3FSIA 2ITGA 3QGHA 3HPHA 5J1EB 3M8PB 3SI8A 1ZBHA 1RCHA 3AA5X 3HO1A 1N6QA 2D5RA 3I5CA 4FLTA 1IKVB 4K4ZA 4IG3A 1LV5A 1LAWA 2E6LA 2FVQA 4FM2A 4IKAA 3QZ7A 4ZTFA 4I2QB 3CJ0A 3FFIB 3MF5A 4NCGB 4ECRA 1KVBA 1TL3B 2ZKUA 3V4IB 3V6DB 1NK7A 5L1LA 2YKMB 3GV8B 1Z26A 3QIOA 4I9QA 4Q0BA 1S5JA 4Z4HA 4KB1A 3KHRA 4KB7A 1HPZB 3DOLA 4K4XA 5EWGA 3IG1B 3C95A 1VSFA 1D9FA 4Q44A 2E9TA 4Y1DA 1XR7A 4CFDA 4RNNA 3LZJA 4DSIA 4M3TA 1L3UA 4CJVA 4ZPAA 4RUAA 2W9BB 4AHVA 2KQ2A 4DFMA 2ZQBA 2E6MA 3DLGA 1ZBFA 1C0UB 2OH2A 1IG9A 1VSIA 1TKTB 4HHTA 2DY4A 1WNEA 1BQNA 3DOKA 1RTIB 3DI6B 4DTXA 3QEPA 2BQ3A 4DQRA 1TVRB 4KHWA 1OS5A 4O3NA 1S97A 4OKJA 1O1WA 5HROA 4Y2AA 1VSJA 3V1OA 4AHUA 1KVAA 2YNHB 4E19A 2F96A 4PUOB 4KAIA 5E41A 2G8WA 4RNFA 2R2SA 4DS4A 5F8MA 3O4NA 3NGDA 3OHBA 4YFUA 4FJLA 2IM0A 2BQRA 2FLPA 4DTNA 2UVWA 1TKXA 3T19A 1U47A 3SV4A 1RTHB 4NLQA 2VA2A 3QLHB 1RT2A 2FJVA 1HJRA 2IM3A 3EZUA 3OYDA 4DMNA 3OS1A 1N48A 1IM4A 4LD0A 2VG6B 3NH0A 2IC3B 2KFZA 4NRUA 1HMVB 3ZSVA 1S6QB 2IAJB 3DRRA 4KO0A 1C0TA 2C28A 3O4QA 4IDKB 1L3SA 2OPQB 4K4WA 3VQEA 2YNFB 2ZD1B 4NLPA 3DRSB 3OVNA 4NZ0A 1JL1A 5I3UB 3JSMB 4DL6A 1TKZB 4DTSA 2J6SA 3LALA 2KTQA 2G8IA 3PW7A 3V9XA 3EZ5A 4NLGA 1LWEB 4FJMA 4TYBA 3KLFA 3P83D 5HRNA 1J5OA 1JLQA 5KFPA 3VQ6A 1BQMB 4O44B 4CESA 3TAFA 3EYZA 4G3IA 3WNFA 2KZZA 2RF2B 4OL8A 4LSNA 2HMIB 3RMCA 3ZCMA 1BCMA 4CF9A 3CG7A 2WTFA 5KFVA 3NF8A 4KAZA 4MQ3A 3AVKA 3KD5E 3AO5A 2EHGA 3RBDA 4MKAA 4F8RA 1DTTB 4CHNA 3RRHA 1NOYA 2IA6A 4DQIA 5KFIA 5EWFA 3TAMA 2XGQA 4HCBA 2I5JA 2D0AA 5DK5A 5KRSA 5EWEA 4DQSA 3KMQA 1S48A 5KGWA 4CK1A 4ED3A 2B43A 4IH7A 5KT6A 4OPKA 4MFBB 4J2BA 1ITGA 3OYGA 2IDOA 5DGAA 3SCXA 5J2NA 5CZ1A 2AGPA 3QGGA 4FBUA 2ATLA 5KG2A 4FS2A 1NK6A 4IKFA 3ITHA 3E51A 1ZYQA 5I42B 4F2SA 1FKOA 1VRUB 5KI6A 4QCLA 3L8BA 4TY8B 3KLVA 3KK1A 4KI4A 5KG5A 3CFRA 1QAIA 4DSJA 2ZE2A 3BREA 3IN5A 3MECB 4PWDA 3AVNA 1ZTWA 4CF1A 4RZRA 2WHOA 4DTJA 1YTUA 4O3SA 5DG9A 3H98A 3G10A 4CEBA 3Q8RB 4DSLA 3VQ5A 4HTUA 4B3OB 1T8EA 4O3QA 2I1RA 4KHSA 2IJNA 5DGBA 3S3MA 4FJ8A 3PJXA 1NKEA 3V6HA 1C1BB 2AJQA 3I0SB 3KHGA 2GIRA 4RNOA 5CY4A 1CZBA 3BQ2A 4GMJB 4CFAA 1CSJA 1U45A 1ASVA 4IRCA 2GV9A 1DTQB 5C42A 3MR6A 5C24B 4CEAA 1MU2A 4OGEA 3GYNA 1EP4A 4EZ6A 4F4XA 3C6TB 3PR4A 4DSKA 2B5JA 1NOZA 4NCBA 3LP3A 3BJYA 4ECYA 3T5JA 3KOAA 4E7LA 2HNDA 5CYMB 3PHEA 3AVAA 4J2DA 1S9GB 3AVBA 4IG0A 4O4GA 5KFYA 5KG6A 4M42A 5J2QA 5KFEA 2YHAA 1RAJA 3FDSA 4NYZA 1JXBA 1CXQA 3MEGA 4J9OA 1KCFA 2JC1A 3IS9A 4W5QA 4JRQA 2D3ZA 4EEYA 3V81A 4OGCA 1I39A 1JLFB 3PVXA 4CHZA 2FBVA 3H40A 4FLYA 4K50A 3DLEA 3KK3A 5KFDA 3H2LA 3U6FA 1JKHA 4JLHA 1VSMA 1NKBA 4LH5A 3Q8SB 1K1QA 4CJUA 1C1CB 2XY6A 4DTOA 1RT7B 3BDPA 3AVMA 5F9LA 3AV9A 4KFBB 4O55A 1TK8A 1HYSA 1GX5A 4R5PA 4Z4CA 4CHYA 3RMBA 1HNIB 2G8FA 1KSPA 2R8KA 1BL3A 2W9AA 4HKQA 1DLOB 3RR7A 1RT6A 2D41A 5CYQA 4O3RA 3QINA 3KNAA 1LWFB 1J5OB 3PW0A 2XO7A 5SWMA 3E01A 1WSJA 2KFNA 3N6LA
chains in the Genus database with same CATH superfamily
2CKWA 3O08A 3R8YA 3BO2A 2EC0A 4CK3A 2O8BA 2RUSA 3VCDA 1XNRF 2CQ0A 2RH3A 4NLXA 1FEEA 2J0XA 1PYTA 1IN0A 2Q2RA 3GBTA 1T44A 4IOAL 5HSPA 4KKOA 2HQDA 4I0WA 5E3PA 1RDAA 4NZ7A 2HSTA 3AA4A 4RW8B 3THYA 2AP6A 3VQTA 2IMWP 1U4BA 5A2QU 1RHQB 1EWQA 2WAQD 3PY8A 3C6UB 1OYDA 4EYIB 1T6CA 3P31A 5C12A 5M2RA 2VFVA 2HWHA 1XI1A 2LKZA 1P9QC 2LCWA 4P52A 4K5RA 4FWRA 5K8PA 3UN2A 3RR8A 4IFYA 5T41A 5IWAJ 3OJSA 2OMOA 3I4PA 3CB4A 1PYOB 3RSEB 4DCHA 3CCLN 4HUEA 5F0WA 2UZAA 3CJ4A 3ULDA 1BUPA 2BGGA 3BSNA 3CJ3A 4FYVB 4FVMA 2QEXS 5HLFB 2YNIA 1S59A 4QWBA 3RAMA 1RDWX 2W7PA 2GO9A 1VQ9N 2AGQA 1AZSA 1JLGA 1R0BG 2H3GX 2DPJA 3HZ6A 3QNNA 1URRA 4CZKA 3KKSA 1KVIA 3QFWA 1P8GA 2QE5A 1RILA 2FBTA 3RGIA 1Y9OA 2JFDA 2E44A 4ECTA 2D4WA 2N82B 4KGXB 1NJWA 2UXCF 3B8HA 1H7WA 1K8AT 2NRHA 4CZFA 3M2RA 3GPAA 3PJWA 3UDEA 3TJ9A 4BDZA 4DR6J 5L46A 2JVOA 1HWIA 4FPBA 3CVKA 5D0GA 1IKWA 3TZYA 2IDLA 3HSZA 3P4UB 5DQIA 2JWLA 5KQ8A 2DISA 3C3LA 2ABYA 4DTMA 1U2VA 3OXGA 4LFCF 2W7OA 1VGYA 2PEHA 3M2UB 1KP6A 1NJZA 5BR8K 2WOMA 4OZ3A 3S6EA 1R8BA 2CWKA 1T05A 2L9DA 5LMUF 1Z2ZA 5A0YB 1NK8A 3B54A 2QL5B 4EGLA 2N4CA 3A5NC 3H5XA 1RACB 4ZVRB 3O1LA 4NOHA 3DM2B 4OZLA 2PFDA 3O6QA 2WBNA 2ZVSA 1FJ7A 1I5OB 2P9CA 4DV0J 2WRMA 1NG9A 4I64A 1LFWA 2OO4A 1WLJA 3BV8A 1SL1A 4DSEA 1V9OA 1UOCA 1OH8A 1IR1A 2OMLA 3CWJA 4W98A 1JX4A 4FYYB 1KLMA 3J7AP 3PYFA 3DGPA 2V8GA 2GIFA 2G1HA 2FUG9 3PIOL 1WSIA 1S0NA 2G4BA 5IWAF 3MR5A 4BC5A 3ENVA 2VWJA 2VG7B 4QR2A 3PXGa 2VFUA 3HVAA 5DZ7A 5MLCQ 5I3QA 1U1OA 1R89A 2MQLA 5LJWA 2DH7A 1U1KA 5GAGP 2FLLA 3JS6A 4A5BA 1R0AB 3G2XA 4CTAB 3M1VA 1H3DA 4MIWA 1S1UA 2WONA 3DMJA 5K14B 3VEYA 4XEIA 2YH0A 1WC1A 2EW9A 3G6YA 2QV6A 3EKSA 1J5EK 1XUPO 3VZIA 2W2QP 3QO9A 3RUBL 4YDUA 4K8XA 2IJFA 3G87A 2O5DA 3OV7A 4ID5B 3FQLA 3QFHA 2HHVA 3MEDB 2E2NA 1VSLA 2NLWA 2BE2A 3EICA 2ZWOA 2WZ1A 3O3GA 3BGOP 1WSGA 2A6AA 2VBXA 3PEHA 3PEJA 3DLKA 4UUXA 2RHSB 2HVZA 3G25A 2E1MC 4KSEB 2RB7A 1K73T 4DR6F 3VTHA 1SJFA 5CXTA 1RU2A 3Q8VA 3NBPA 1TP7A 4YR0A 5KRTA 5IZHA 3K7RA 4EWTA 3SCJE 2G9OA 5EGYA 3VQ7A 1VSHA 1PBUA 3J7YI 3CJ5A 2JH3A 4WFNQ 4JD2A 4UW2A 3UQSA 5A6PA 3KK2A 3H4DA 3ZT0A 1KQSR 4CCHA 1KKHA 4NEYA 3AA9A 3CJRA 3VF2A 3PRDA 3BZCA 3DOMB 1WOSA 3D0HE 1Q78A 3DU5A 2ZM6J 4MTPA 4H54A 5HBMA 9ATCB 1WF0A 3NY0A 2KI2A 2HOEA 4GO7X 4YB1P 3RBZA 3NH2A 4DV0F 2XLKA 4NEZA 2IS3A 5H9EJ 2LQ9A 3ENAA 1DHMA 1HKAA 3QDKA 2LDIA 1ZAXA 5AQLA 1JLAA 3HOSA 3VQ8A 1H7XA 1LWCA 1SJ4P 2BABA 2CZ4A 2XYGB 2V68A 2VA3A 2KO1A 5J2PA 3H25A 1RWKB 3AA8A 1NLVA 4CH7A 2M8DB 2V7YA 2G0CA 1ASUA 4R8UB 3P38A 3AT1B 4RKUC 3R2DJ 1ZAVA 3UDCA 2ZWHA 4Y0WA 3WDOA 3HMJG 4OLBA 1NPRA 1REGX 3CC2S 4QS8A 1RDDA 2ZITA 1WN7A 1N6QB 5HRSA 4JUZA 3O80A 3CC4N 2JHEA 3NCRA 3UVJA 3LGHA 1VQSA 2FVSA 3NKYA 4ALZA 3ZZPA 1ZM2A 4I6WA 2EWSA 2WTUA 3CCQN 5B0DA 3MUVP 5F8JA 4LFBK 2FVCA 4IRKA 4DV1J 1EX4A 4R0JA 1VJQA 2LU1A 4MMOA 3C0BA 2J0QD 3FZFA 2C3YA 3GFZA 1RA6A 4F4AA 2CQIA 2GMJA 1X9JA 1RAOA 3CCRN 4NE9C 2O8DA 3FQKA 1UEUA 1KQKA 2QXLA 2ZHOA 2M52A 2BRLA 1YZ7A 4BG9A 1JXEA 4H8KA 3MFIA 1IXKA 2QLBB 4CFCA 2VU5A 1GMUA 1I3AA 4BWJA 1UZDA 3DOKB 1Y64A 1FDNA 2R3VA 5D6GA 2EFPA 2N3LA 4NI2B 4DKWA 1JLBA 3CO0P 1N5TA 1VIXA 1FX2A 3MAQA 2KFYA 4KH6A 5HROB 4FF4A 3OL9A 1NMEB 1JNRB 4CIEA 1X1PA 2D3O1 3QFUA 1UA1A 2ZM6F 4NLBA 2KRBA 1DQ9A 2F9DA 1N32J 5JICA 4DU7A 3AARA 3ZZRA 4KR0B 1S79A 2OFHX 4U67L 2X1AA 2NREA 5DMRA 2Y1LB 2HS3A 3DRYA 2DXDA 3T1AA 1NHVA 1RWOB 1TMJA 3RW6A 4BRDA 4J9SA 3MX5A 3QAUA 3SNNA 3JAMO 2BM0A 4DL2A 2VH7A 1S49A 4E2FB 2AEJA 4DQQA 3ZSQA 1FE4A 3O44A 4E98A 4KO0B 4X4SA 3QAEA 1RBVA 1J53A 4YOXA 1K6YA 4MK9A 1Q53A 3F56A 3KLEA 4LFAK 4DV4K 3D2WA 5A8RB 3D5MA 2HURA 1RT3A 3N4QA 4DLEA 2E9ZA 2VQFJ 2GX9A 4QIEA 3V4IA 2RILA 3T9ZA 4FK0A 5HN0A 4AL5A 2R7WA 2YX6A 5KFFA 1A5XA 1KC8O 2GCFA 4LSNB 3JSBA 1WD6A 4FYDA 3NL0A 2MHNA 1NK5A 2YHXA 2M3DA 2VOOA 2P8IA 3RMDA 4DV1F 4UF4A 2Y9HA 2KVIA 1F60B 1U48A 1C0UA 2COLA 4J9PA 1U0HA 2I5JB 4KHQA 1S76D 2DGSA 1SBRA 1FTRA 3TTDA 1EB0A 3P5TL 2R7YA 3U3GA 5BYSA 3POTA 2U2FA 2V4JA 4BC2A 1VQKS 1TAQA 3NS5A 5L8RC 1Q86T 4OMFG 2ROGA 2YNHA 1NJXA 4P2SA 2V69A 2QJ3A 5G0RB 1ZC6A 3CSKA 1FEHA 2RE2A 4AH9A 1E6VA 3HYFA 3CJ8A 3EZWA 3F5TA 3W8GA 2KM8C 4M8LA 4URQU 2OTLN 5L1IA 4OI0A 1WC0A 2VC1A 2ZH1A 4URSA 2G8HA 2M7SA 3OW2R 5KG0A 4RBUA 1N32F 1BC6A 4IDKA 2BDPA 3DRSA 3CJ7A 4BR2A 4Z0UA 4AT1B 3L2QA 1VQNN 1SPBP 2QKBA 4OJRA 4CIFA 1AYEA 4BE2A 2OA8A 4DX5A 2ASOA 1EP4B 4EI2A 4BR7A 3MM9B 2Q43A 4JS4A 3NVKA 2CPEA 1R3NA 1V3SA 3AVIA 3MXJA 1SUQB 2HBRB 5E3AA 2RF2A 4F50A 5F9NA 1MWMA 3MM6B 4KTZA 3T5LA 3O9UA 3M4XA 3MXIA 3PW5A 2FD2A 2V5HG 3D66A 2ALZA 1VQ6N 5J2QB 2V6AA 2VQFF 5KFMA 3KDNA 1DKGD 4J9VA 3TUZC 4AHCA 4MDAA 3V6JA 3AHPA 1PIEA 3C15B 5IT9U 4EP5A 2GHPA 4M3WA 4P9SA 4WTOB 3MR3A 2HHHK 4JI3J 4WFAL 2QLFB 3ILIA 3PTWA 1G6BA 3CDAA 5C2GA 4LREA 3DLEB 5F0XA 1S22A 2R7RA 2JOQA 5D4PA 2HVHA 1O6XA 1KNZA 3TR8A 1BQXA 1I94K 4XPEA 2RMLA 5KT7A 2D74B 2MZJA 1YT3A 3BBCA 2I8EA 3L4BC 4NL5A 4CQ1A 4R5PB 4HHJA 3UPFA 4GO5X 1MROB 3H08A 1RXOB 4TY8A 2V2KA 1WELA 1YITS 2FF3B 2PY5A 1Z6RA 3S9HA 3EE8A 2FDNA 5FROA 1PSDA 5JS1A 2F4VJ 2C3OA 1MMLA 2O8BB 5F41A 4RX6A 1UEKA 4W5TA 4W5OA 2E7WA 3TP2A 3P5JA 3QT6A 5E26A 4KKOB 3SUNA 1QSLA 3I0SA 3CCJS 3EE9A 3ZXWA 4A62A 3CNQP 3THYB 3F9MA 2VKZG 4WCEQ 2A1RA 2GJIA 4BGBA 2QIFA 2BBEA 4NLSA 4E8UA 4S0MA 2QEXN 3L7UA 1HBNA 3OPKA 3BYPA 2DPIA 3CDEA 1M90T 4IFYB 2G0JA 1SAZA 3DDKA 3HP6A 2RDJA 5CYMA 2D69A 3GG0A 2C2NA 5E5NA 4BY9C 2BEFA 2P9EA 5KPTA 2GGPA 2QK9A 3M8SA 2V8PA 4DR7K 1F9FA 4ZP7A 1U25A 2APOA 4Y34A 2QLXA 4TYAA 5DLGA 3EVWA 2XWXA 1K0TA 3TQ1A 1U6FA 1X9WA 2I0XA 4Z94A 3GIJA 4FOEA 2YNIB 3PZPA 4KC5A 4F0HA 2GFFA 3FEYB 4RPFA 2KU7A 2Y3YA 1AZSB 1JLGB 3M6XA 3WXKA 1X4HA 2HGLA 1RT7A 4HVJA 4KFBA 4M41A 3R5CA 3H7HB 4B9TA 4JI3F 1N5SA 3CDUA 4C0OC 3CM6A 2QWQA 2X78A 3VEVA 2RN2A 4M95A 3N01A 2VYPA 3UKUA 3M2RB 4Q2LA 2AW0A 2DR9A 3AB2B 4MIAA 1TUYA 3K0JA 1IKWB 3GDQA 4PG6A 5ETPA 2HNZB 1PO6A 1RKIA 5A76A 2ZC4A 4ZPDA 1U2VB 4ZLLA 3M9NB 2UV8G 2E8AA 4K2XA 5KFJA 1KQGB 2BV3A 4QIGA 2WOMB 5LJ3Y 1FRKA 1T05B 3G82A 2HK3A 3OLAA 4DFPA 2F4VF 3H5UA 3ZT4A 1HNVA 4OI1A 4YOTA 4PA1A 2MGZA 3M2VB 3KKFA 1U49A 2C2DA 2P9PA 4PXEA 3LDSA 2D1KA 2AKWB 3VQQA 1QUPA 4B9SA 3AJ1A 3FCVA 1GMVA 3SLCA 1VQPS 4CEEA 3R27A 5GIOA 2KLAA 2AEFA 1VAZA 1NGFA 4ED8A 2HFZA 3BGUA 3W9JA 4DV7K 2FHMA 4YMEA 3QSIA 5J1PA 3PR5B 3DGPB 1RISA 2YKPA 5LOQA 4OHXA 3OD2A 1L3KA 4CLKA 2XMAA 3IMXA 5C2FA 4JV2A 2CQHA 5AQQA 3CDWA 1FVSA 1U7LA 1QE1B 4F04B 3CJSA 5LY3A 1HQEA 2NRWA 3JS9A 2CPZA 4OZ1A 2FJAB 3M1VB 4RW7A 4BQZA 2YKNA 2WONB 3DMJB 3GIKA 4WU3A 4QYZK 1HWJA 1GLAG 4HYKA 3LQVA 4CF0A 3O2IA 1N54B 4M5GA 1PILA 3I32A 4ZVTB 4CP5A 3QO9B 1QTMA 4G9ZA 2FHOB 2HBJA 4YB5A 1M1KO 3MM8B 4CGDA 2J7WA 4ANEA 4DLGA 1HNXK 2BE2B 3D3CJ 4DUZK 4CGJA 5THWA 5L9XA 4CM2A 4C11A 2H5IB 3UNGC 3CJTA 4Q43A 2VPXB 2VG5A 3BF3A 3DLKB 2CJYB 2KW4A 2OJ3A 3NBPB 2CIMA 4B02A 5H1SV 1KD1T 2C42A 1HI1A 2HNYA 3VF0B 2MKHA 4JNEA 3HVRA 3GU0A 4AL7A 1LOUA 3FBFA 3LPTA 4KGMA 4OZNA 4JD2B 1HQ2A 3KK2B 1T7PA 1PYSB 2O8FA 4ZVFA 2WB4A 1F21A 2AX1A 4WQ5C 4QIFA 2DHAA 3G71N 4OLPA 4BR9A 5SZTA 1F3VA 4KBIA 3VENA 4EP4A 2VFTA 4NYNA 1O5JA 1XNQK 4JI4J 5HBMB 5KFLA 4IFVA 1RB0A 3UDLA 1UJ5A 1PJ5A 4NXMJ 3CC2N 3AVJA 2QFIA 4LR8A 4K4UA 3NAEA 2FJWA 2B6AA 4FXVA 1WC4A 2VICA 2J0WA 4P10A 1RGIA 4M3XA 1JLAB 3W1YC 2MLZA 3ZTSA 1LWCB 4ILGB 1WSVA 4KPYA 4XTTA 1S1TA 2UVRA 2BJ9A 5J2PB 1TMMA 1I3OB 2F9JA 4OYXA 4LQ3A 3A5MC 3BGRA 2JDJA 5JVGL 1X4EA 3H0PA 2K7KA 3SUOA 3BO3A 3HTVA 5C5JA 1PBAA 3IM8A 1C0MA 1A7GE 3G6VA 2CQGA 1WC5A 5IQQA 4YP3A 1ULRA 3KJVA 5FLXO 1WF2A 3KJQB 2E5JA 4HUFA 2UUAJ 1SKSA 4PUOA 1W25A 1RDUA 4GKJK 2EEYA 3GV5B 2NZCA 1RTDA 1M5HA 3UVJB 3C6AA 3QEIA 2WFBA 1RT4A 1X0FA 4PRFA 2YKAA 4ZVSB 2AJ1A 2VPZB 2DRBA 2A6OA 2GV1A 4OLOA 1NNDA 1RFQA 3J7AN 5JLHA 2O8CA 1R6YA 3SBGA 3T1HK 2OEMA 1S6UA 1HBOA 3GZ7A 1FK9A 3KLIB 1XMOJ 1FJGK 2O8DB 1KOHA 2WCXA 4WFBL 1VK8A 4NLTA 3SPZA 1UZHA 4MJKA 3UNYA 1TZ0A 2B8PA 1HNWJ 4LF4J 2ZH7A 4OX9K 2AT1B 3RB3A 1UFKA 2AYMA 1SQKA 5BR9A 3THWA 1B4SA 3MGJA 4ZLNA 3J7ZT 5HRRA 1H73A 3P45B 1G3OA 1JLBB 4ELTA 3O4WA 1F6TA 2A2DA 1BO5O 4FKXA 5ETOA 1T9UA 2PFFB 4ECXA 1HJOA 3OR2A 1JXVA 2YHWA 2RQ4A 2XCAA 3K59A 2GAHC 3LPYA 4LC9B 3GYXB 4PXBA 4CJFA 2BH1A 3LP0A 3RBEA 3GFHA 4J7CA 3KXDA 4JI4F 5E3RA 2FJXA 9RUBA 3NGYA 5ETRA 5F1XA 4NXMF 4HI1A 4ES1A 2EKYA 1VC0A 2HVEA 3FKBA 2FLNA 5A8WA 1NRKA 2KH9A 5CABA 3MPWA 2IIRA 3HO1A 2EK1A 5EXWA 3KG0A 3OR1A 3LDQA 2QX0A 2OSQA 1NHKL 4FM2A 3R3TA 2IVFB 2ZEJA 3QT7A 3TVZA 1YJTA 3QZ7A 4ECRA 1KVBA 3D2FA 3DGVA 4AF1A 3V4IB 1NK7A 4CLLA 4V19S 1RAGB 2CGKA 2UUAF 2WW8A 4RUHA 4LVNP 5JVHQ 3U27A 3DOLA 4OYPA 4K4XA 2IMOA 1I51B 2ZBQA 3GG4A 3M8ZA 1HNZK 1AT1B 3VOVA 4X4NA 4Y1DA 4DUYK 3M7VA 3G9CA 2FYXA 5I9EB 3H46O 4RUAA 4AHVA 2D3OR 2KQ2A 3B6BA 3K0SA 2E6MA 3AD8C 1ZBFA 1C0UB 2OH2A 2GEMA 2JJ4D 1U0HB 1VSIA 4ANCA 3CMEN 3CUNA 2W2NP 4DUTA 3GCWP 1GXTA 2PA3A 2AYBA 3VMFB 2JFKA 4YDDB 1G2EA 1DURA 4HLBA 4OJHA 3CULA 1XMOF 4KHWA 3POTB 4O3NA 2V4JB 4YOEA 1R0CB 2DGVA 1O1WA 3MI7X 1YKWA 1P1TA 3V1OA 3I8BA 4AHUA 2Y8YA 1ZOTA 2YVSA 4KBOA 2YNHB 1HNWF 1ZXOA 4KAIA 4LF4F 4RNFA 2HQFA 4O5FA 4DS4A 2ZH6A 5BN8A 1JCEA 3VWSA 2XSJA 5BR8J 4QU6A 1UVKA 3GONA 4DMZA 1ZA1B 1TKXA 2ZZNA 1U47A 3SV4A 2K2PA 2VA2A 3EGVA 2NZ4A 3JAMU 1RT2A 1RK8A 1DY3A 1NDKA 2NSBA 1U8WA 1KAZA 2A5XA 2IM3A 2ZH4A 1N5VA 1BY9A 4DMNA 2W4DA 3OS1A 1N48A 2F9WA 2CFXA 3MHYA 3W62A 5CCMA 5E0OA 5ADZA 3ZSVA 1S6QB 2G2YA 2YX1A 5DDPC 3F44A 4IDKB 1L3SA 2DXEA 4NLPA 3DRSB 5AQRA 1WTBA 1XK8A 2DR7A 4DL6A 4DTSA 3V9XA 4YHHK 4LSZB 1X4GA 1P8ZA 3KLFA 3KG1A 5ETQA 4PQAA 5HRNA 5KFPA 3NVMA 3I82A 1UETA 3TAFA 2BJ3A 5AFUA 5GMEA 2RF2B 4KGVB 3RMCA 2VPWB 2WVFA 2EBGA 1WG4A 4GKKK 2KT3A 5KFVA 4TVAB 4DZ6A 2POKA 4MQ3A 3FGUA 3CCES 1KEKA 4FKYA 3RBDA 3FMBA 3G6EN 5JVHL 1LWXA 3QPIA 1U1RA 4DQIA 5KFIA 3RZAA 1J5EJ 3UD5A 5AXLA 1X4CA 5DK5A 2B56A 1MA9B 2EVZA 5EWEA 2YX4A 4F0KA 2DKOB 4X4OA 1N8RO 5KT6A 3W5ZA 1XIQA 2R4FA 4A48A 3VGMA 2AJ4A 4ILHA 4J2BA 4OHYA 3SCXA 4Y2KA 5CZ1A 3LW5C 2AGPA 3W3SA 4JKGA 2DGXA 3CCJN 4FBUA 4UUWA 4FS2A 1NK6A 3WEEA 4IKFA 3ITHA 4NX9A 2WC9A 4H5TA 4TY8B 4KI4A 1GEHA 2CNNB 4ERDA 3H42A 3BDEA 2AJ0A 3IN5A 4PWDA 4BRFA 2VQEK 1QJHA 4RZRA 1W7WA 2RU3A 2FZKB 4YDXA 1YTUA 1EWRA 1U2FA 2LFVA 4CEBA 3Q8RB 1HD1A 2QWLA 4O3QA 2I1RA 5BR8F 2IJNA 3IWNC 3C7NA 3ENOA 3I0SB 5IQ6A 5CY4A 1CZBA 1SQGA 3BPDA 4GMJB 3FRYA 2YBVA 4BLGA 4IRCA 3HI9A 3MR6A 2G2ZA 3EXYA 4LRAA 1MU2A 3GYNA 2XULA 4AE5A 5GADU 3PR4A 4CLSA 1BA0A 2B5JA 2GQCA 1VIOA 4NCBA 4WK1A 2VZ9A 5AQOA 3T5JA 5CYMB 5AE3A 1WSRA 1VS3A 4USIA 1R8AA 3AAPA 5IT0A 4IG0A 2GGPB 4OI6A 1YXQA 4M42A 5KFEA 2YHAA 1RAJA 2ZOFA 5GADI 1XERA 1JXBA 3I56S 4ZPTR 5AQUA 2UYTA 3R5BA 2J7UA 2OGUA 3C66A 3IS9A 2MZQA 4JRQA 1NM2A 2X1GA 1GLCG 5ETKA 4U95A 3H40A 4FLYA 3KK3A 4LMZA 1MWQA 5D0EA 4CJUA 3PJ9A 1K9MO 1M5SA 1RT7B 8ATCB 3BDPA 5F9LA 4KFBB 4O55A 3DXSX 3VTIA 1J5EF 3CMQA 3RMBA 3Q7CA 2CNKB 5D77A 2FC8A 4LFBJ 3GP9A 3U4LA 2SXLA 2DEIA 3RR7A 1WHWA 3QINA 3UKUB 1FNMA 1J5OB 1MMNA 2CJXB 2E4LA 4ZHRA 1W26A 1VQPN 1HYZA 2GA7A 2FPHX 4DHVA 2WSFC 1F3FA 2E29A 4MLEA 2HMPA 1JB0C 1SKWA 4L8RB 3G82B 1VC6A 3H1QA 3M8YA 2ZBPA 5DZ6A 4C8LA 2ZJRQ 1YAGA 1Q95G 3TZZA 1S72S 1HNVB 4F26A 1SJ3P 4C8MA 3TJ8A 2LXIA 3TZWA 2MGZB 3R5GA 3HPOA 3H4BA 2P9PB 5HP1A 1RDBA 4K41A 4ZVPB 3TJAA 4ILMA 2QTWA 4ETXA 4FBTA 3S1TA 4F0MA 2AGOA 1WB9A 3VETA 4C8KA 4IEIA 2OZMA 3OBYA 3OYLA 2RQCA 1FKOB 2V52B 1CJKA 2WVBA 3PW2A 1UPMB 2ASLA 3SMZA 3SK3A 3T5HA 4DG1A 1XR5A 1SKUB 4ZP9A 4TU7A 3QERA 2F63A 2W6LA 1L3VA 2X6NA 3GJTB 4CO4A 3E9PA 4L3QA 2H54B 2Y0BB 2E66A 4RWTA 2OPRA 1N4LA 3N28A 2W6KA 4X4RA 3HHLD 3NG8A 2EFGA 5HVFA 1HQEB 1FA0A 3CIPA 5E7OB 2E9RX 3WHIA 1D8YA 5AQWA 4D3HA 4DL5A 4FF1A 4H0XB 1K8KA 4LFAJ 4DV4J 2X51A 3QJJA 5GAHI 4RW7B 3VAJA 3LM9A 1HBMA 2YKNB 4ENOA 1T9VA 3AO1A 3ZTRA 2XYPB 1K8AO 1IBMK 4NLWA 4OV6A 3R5JB 2CPXA 3CIMA 1T03A 2C2EA 3GLJA 3QIPA 1A6LA 3O8WA 2HS0A 3TUJC 2QGFB 2YQ3A 3D6HB 4W5NA 2JEGA 3RMAA 3HFZB 2RHQB 4RCHA 3FVYA 2ILYA 2OZSA 4C11B 3OTDA 4LFBF 4WYWA 3IR5B 4G1QA 1N33K 2DNPA 3KUHA 2HQCA 1JJCB 1CXUA 5D4OA 1RBUA 2D0BA 3MDQA 3IFEA 1ATNA 2VF3A 2HNYB 2MZSA 4F67A 2HQ3A 1YIJS 2LVWA 4U7CA 4P2XA 1CJTA 3L09A 5D4NA 1S6PA 1JIHA 3ID6A 4LF7K 3J7Z5 3KLHA 4J9RA 2O8FB 2EFNA 3AXMA 1OPZA 4J9LA 3NGKA 2PT0A 4KY3A 4CBXA 3U8XA 2NYIA 3UCZP 2I2YA 3VA3A 2Z2MA 4DV2J 5JXSA 2HFVA 1RKJA 3QBWA 2YWGA 1TFWA 3PW4A 4IFVB 4M45A 4B9UA 5ELZA 3W2WA 1CULA 4N56A 2W8LA 1VSKA 5CYQB 4HI2A 1E6YA 1B7FA 5JMNA 2B6AB 3E01B 4ZLJA 3ATUA 2CPIA 4ISGA 4YOYA 2A18A 4HACA 1S1XA 3GFYA 2EFOA 3CHWA 1S1TB 3OS0A 1TL7A 1ASWA 1LXJA 3BGRB 3QNOA 4XDCA 3UN5A 4DTUA 1IJEB 1NH8A 4W5RA 3O3LA 4KYZA 2PGCA 2IVYA 3PFOA 1RYSA 4NCAA 4CHPA 2JEIA 3J80O 2BACA 4ECZA 3UE2A 2NLXA 2DNMA 1QLNA 2PIIA 3A2FA 3OT9A 3KJVB 5BRDA 3WQUA 1D1UA 2CADA 4LFAF 4DV4F 1T3OA 2DRAA 1YX2A 3A8KA 1ZBIA 3PDNA 3HSTB 1RTDB 5AE1A 4OPHA 1RT4B 1HI8A 4CK2A 1UW4A 2R7OA 4CJPA 3IM9A 5IS2A 1VMBA 1K73O 4H5WA 3V9SA 4QWEA 1GAOA 3H59A 1KLNA 1X9MA 2BJ7A 4OVLA 1OH7A 2O8CB 2HHHJ 3QZ8A 3AO2A 3W61A 2IGIA 1HBOB 4DTRA 4ZPWR 4EBCA 1I94J 2HHUA 3GJSB 5ETNA 1FK9B 4J2AA 3DYAA 4W4MA 3CYMA 3ISND 4A8YA 2Y8WA 2B4UA 4DFKA 2CQBA 3ZTOA 2P9IA 3KJNB 4KH4A 3CO9A 4DR4K 2YCHA 3F73A 1WEZA 2HBZB 4DHYA 3M8RA 2CZVC 3NXZA 2RUGA 3VA0A 5AQFA 4X2BA 2IVPA 4FZYA 5GINA 2H5EA 3TNVA 1BIZA 2ASJA 4DL7A 1GK8A 2BJDA 3WC2A 1AROP 3OVSA 3I55S 4A47A 5CE3A 3HXMA 2A2CA 1KHWA 5KPRA 3OR2B 2LQBA 3H5SA 3HHLC 2I7NA 4ZCLA 3QBXA 1HKBA 3EY1A 3UCUP 2NS1B 4OYAA 4DV2F 2K3KA 3ILLA 4JKCA 4JKAA 3HDSA 3LP0B 5L9NA 3EPIA 1EETA 2XI3A 1MN7A 1QQOA 3V9UA 3IRXB 2BQUA 4FW2A 3MN9A 5FLXU 3RAQA 3SYZA 2FBXA 3HKWA 2MZ1A 1FTCA 1TAUA 4QS7A 5A8WB 1RCXB 1PGZA 4B08A 3EX7B 4Q2MA 3HVTA 3BUZB 5B09A 3OBWA 2EK6A 5C15A 2E2PA 3OR1B 4DU4A 2BKOA 2W4PA 3PCOB 5AXKA 2OCEA 3IAM9 4NWBA 4QW8A 4DR7J 4CE9A 1H72C 1JL2A 3PX6A 2RSQA 4KGZB 4JB8B 5HJXA 3D2FB 1FDDA 1X60A 3ALYA 1Y5IB 4LBPA 4DN0A 4ED6A 3EZOA 4CYUA 3G6XA 4FLZA 2KVQE 1X31C 3SQGA 3F0NA 3KZBA 4PKHA 2OAUA 2OLWA 4OHZA 3DOLB 3DC2A 2HWTA 4N8NA 2QW9A 3W60A 4YB6A 3DU6A 3BN7A 4UOCA 3M30A 4CO5A 4FJNA 2J9DA 1YRUA 2HBYB 2J9DE 3C14A 2HHHF 4BRKA 2F5GA 3MTJA 4FS1A 4BRQA 1RT5A 3L3UA 4G1PA 4EUVA 1F5AA 3CCLS 1I94F 1RWMB 1RE1B 4KH0B 4D3GA 3LWLA 4FJ7A 2IBOA 4CO3A 2HK2A 3EJMA 1S10A 1NJIO 2CQPA 1SL2A 3CCSN 3LA0A 5ETTA 1Z4UA 4ECQA 3VGVA 2BJ8A 1VISA 5KFBA 3CCUS 4N76A 2XY5A 3R3LA 1VQ9S 4MKBA 4CJ3A 5AQTA 2XSJB 3GV7B 4OV1A 4ZCIA 5KFOA 4RW4A 2XMJA 3MPUB 1TKXB 3KKRA 4FXDA 4CGFA 3ZT3A 5HQLA 1RT2B 4USVA 1QQCA 5EOYA 3ENBA 1GTEA 4J5OA 3VQ4A 2BW2A 4ILLA 4LH4A 3ZSZA 4CGGA 1U6ZA 4PL7A 1Z05A 3WQTA 1EQMA 5J1EA 3M8PA 4TN2A 2FF6A 3L2WA 3KMSA 3MK6A 4MK7A 2B7BB 3N6MA 2K7JA 3OYIA 3MCAB 1E4FT 1F5BA 2YX7A 3T41A 4DV7J 2QWNA 3HSGA 3AO3A 2XI2A 3BY5A 3NAHA 3FFIA 1N52B 4JP8A 1HWUA 4JKEA 3DHWC 5BYRA 3KLFB 2IRYA 2JLGA 1IQTA 3GCXP 4B1UB 1NGHA 2DTUA 4FJ9A 2QA4S 3ZSYA 4IFEA 1XQIA 3KHLA 5F3ZA 2DK2A 4DR7F 4F4YA 1UJ6A 4A4JA 1Q9XA 2JLFA 3K17A 2W9BA 1IKXB 2GIQA 4QYZJ 3NOCA 3U1LA 4H5RA 1B0VA 4Z4EA 4WU2A 1ELOA 2N7CA 1EKSA 2LXFA 3C16A 4PXCA 5DDOC 5K9FA 2KXHA 1CS4A 1RTIA 3AJDA 3DI6A 2AYEA 4RWWA 1IH7A 3VERA 1FT8A 2J6TA 4DEZA 3QESA 1C0GA 2QSFA 2HRYA 3OUYA 5AQNA 4ECVA 1Q86O 1VK0A 1HNXJ 3VQAA 2F7VA 2OTJS 4JKGB 1VSEA 2HG4A 4DUZJ 3TAEA 4CH0S 1ZM9A 3HM9A 2Q79A 3WEEB 3ITHB 4OYMA 3TA2A 2MKJA 1BUXA 2ZNZA 4CJRA 4X62K 1RTHA 3ZNJ1 1E3MA 3HHKA 2ZNYA 1Q0NA 1QZ6A 1RAFB 2OP5A 4PWDB 4V1Ak 3TVKA 1RBSA 4C1NI 1M1GA 4IJAA 4UOFA 2DH8A 5F3TA 2XSFA 2KB2A 2VG6A 4QOTA 3K5NA 4N7TA 2IAJA 4OHWA 1C0FA 3BQ0A 5HMWA 3W7BA 2DEJA 1UMJA 3FZMA 4CJEA 1XNQJ 3HLUA 5EX3A 5DO2A 1QHTA 5EY4A 4B1WB 1CBKA 1MU2B 1R27B 2CVIA 1LWEA 4U96A 1VQ5N 3D67A 4B9MA 2FBYA 2XY8A 1H98A 2B5JB 4KH5A 2W9CB 2RDIA 3RJMB 3TW0A 1NM1A 3D45A 3UD4P 3BGLA 2B9XA 2HMIA 1SIWB 4JHDA 2CH5A 4CW7B 4WKYA 4C3MA 3N79A 4DV7F 3VF6A 4LF8K 1NDLA 4IG0B 2C3UA 3NGUA 4LR9A 1Y5NB 4FOIA 3OYEA 1EJ7L 1RHRB 4CD1A 3IS9B 2BRKA 5LJVA 4FJKA 2VDIA 4QZVB 2ZOMA 2AV5A 3KK3B 1RGVA 3SQ1A 3T1YK 2M0GB 1I1GA 1FHTA 4YR2A 2JLEA 4GKJJ 4X4QA 6FDRA 4OO1J 2R2RA 5DETA 1S5ZA 1Q5YA 8AT1B 4X64K 5CA5A 1VRUA 4ZMMA 3A3OB 3EE3A 4FLXA 4FLWA 1S72N 1S0OA 3HSCA 3FNNA 3OJUA 5GAGI 1NBWA 3T1HJ 2Q1LA 3MECA 2HBKA 1NJYA 3DDIA 2E1CA 1HNXF 6AT1B 4WP9A 4ZHRB 3PX0A 4DUZF 4OZ5A 4F02A 2ROPA 4DF4A 5AR0A 3SBTA 1FJGJ 4ED0A 2BTFA 3GJQB 5AQIA 2AU0A 4C97A 3NNCA 1C1BA 4USKA 1VQ4N 4JI5K 2VODA 5KT2A 4OX9J 1MN9A 3CC4S 3CCMN 3CJ9A 4ZN1A 1TL4A 2BUPA 3PM9A 1D0EA 5CH7B 5C24A 1SZ2A 1M90O 3CETA 3CCQS 5C7PA 3C6TA 1YF5L 2KM8B 2RRAA 4JRPA 5HP1B 2XMUA 5DG7A 2CWXA 1BLUA 2CGJA 5BPMA 2E1ZA 1KR4A 3NEKA 3NGSA 3UB5A 3EMTA 4ZJOA 2X74A 2VBZA 1XNQF 2PZSA 2CA9A 1CEZA 5KFNA 3GL1A 2L08A 1CJKB 3KUEA 2KJWA 1EIYB 7FD1A 4ZVHA 3OYBA 4DG1B 5F8IA 2R7QA 4WTYA 1T9XA 2O01C 2NCKL 2PAVA 2LU2A 1HLUA 1JLFA 2QL9B 3L7PA 4CI0B 2B8QA 2FC9A 4MH8A 3K2YA 2OPRB 4GV6A 2XY7A 1U1LA 1OH5A 1M0SA 3AO4A 2LDYA 2X1BA 1C1CA 1K8KB 2W8KA 4I7FA 1HBMB 2RQMA 4WYLA 2IFXA 3LOUA 2J9CA 4C2MA 1RHMB 2R7UA 3JTOA 3FR0A 4QAGA 2H4YB 1DLOA 1CC7A 1J6ZA 4JI8K 1T03B 3TAPA 1VDHA 1VQYA 3QIPB 1YIJN 4GKJF 2VWKA 4KE5A 4KHYA 3CM5A 2KYXA 2QA1A 3E8OA 1HNZJ 5HMXA 2CJAA 1SB6A 1VQ7N 1Y00A 4DUYJ 1SC4B 4YY3K 4FM1A 4CJLA 2MXYA 1S0VA 1X5PA 3OA9A 4I2PA 2ZZMA 3CMAN 1FRMA 5HVHA 3T1HF 4G1QB 4QS9A 3EPGA 4BRNA 3PNIA 4B3MK 3G4SN 2BMBA 2WSEC 1JWWA 4U8YA 5D15A 1RWWB 4FN5A 3W3DA 4QPTA 4CNYA 1FJGF 1YBAA 1CJTB 4A8FA 2ZJPQ 3NGZA 1S6PB 3ZZUA 1KQFB 1KFDA 3VGUA 3KLHB 2ERRA 4OX9F 2Z1JA 1IBKK 2QYCA 2FTRA 1LXNA 3J81Y 4USJC 4WPAA 3CFPA 4MKVA 4W92B 2GQQA 4Z4FA 4M94A 3ZZYA 1BE4A 2ZHBA 1CULB 5F8HA 2PYLA 4RW9A 3M8QA 3TAQA 3NLCA 1E6YB 4K4TA 2E2QA 3B6PA 4TSXA 3RB6A 2V2ZA 1KDNA 4HACB 1S1XB 3HL8A 2CQ3A 3PHTA 1OH6A 5KOWA 2VDHA 1CLFA 4IQMA 3CTRA 1X4DA 4I4BA 5CQGA 1G99A 3D7EO 1TL7B 2F40A 2QO3A 1GOCA 2CNLB 1IUJA 1K47A 3LGNA 5I3PA 5B08A 2V0NA 1ZETA 3KFWX 2VFSA 4JV5K 2FXUA 4YHHJ 1WBBA 3U3YA 3D28A 3NNHA 1N5YA 4DFJA 2E5LK 2EXUA 3M9MB 1IBLK 3QRQA 5CHCB 2ZWPA 3Q89A 4CJSA 4EIAA 4OKEA 4GKKJ 2F3JA 4DTPA 1FXLA 2OTLS 2GJFA 1ATSA 3B8AX 4K0KJ 2E7VA 3Q8UA 4EMDA 4P7VA 4RBTA 4CWBA 3I4HX 1HFEL 4ZDNA 2DNKA 1LAVA 1KVCA 3SIPB 4IOCQ 3LF0A 2MKYA 2RJZA 4LIWA 4QIWD 1VQNS 3NCIA 1KD1O 1O13A 5D3GA 2XG8A 1HNZF 3TAGA 4RO0A 4CO0A 1NMDA 2UP1A 4DUYF 1YTYA 2VBYA 5EN1A 1YQHA 4O8UA 4GVBA 2IVNA 2P5VA 1FJCA 3WNHA 2AP1A 3E9LA 3DYAB 3UDVA 1DQ8A 1U1NA 2P9IB 2V7ZA 1FNOA 1PAUB 2GJ2A 1FVQA 4I2QA 2PYJA 3ISZA 1J54A 2UV8A 1U2CA 3ZSXA 2JWKA 4OYBA 1VQ6S 2YJFA 2VQEJ 2ZUAA 1ITPA 2P5OA 4HH0A 3G8SA 3VVTA 3UW1A 3RB0A 4OFZA 2DIUA 5LJ5Y 3SAFA 5B0CA 2KZMA 4CO1A 2EX3A 3OL7A 4J9UE 2QZ8A 4NLOA 1BGXT 1O0PA 1X4AA 2QFJA 1Y97A 3QEWA 2W2MP 1BXNA 3VESA 1J9AA 1QVGM 3VEXA 1ICEB 5KPZA 1EETB 2WVDA 3J80U 4OQJA 1LW2A 5KGXA 1T11A 4NLDA 1TKTA 5HQ8A 3MXHP 4B1YB 1TYQA 2DGTA 3LO3A 2MY7A 3VAGA 5GVQA 3CD7A 1HW9A 3HVTB 1YRXA 2W4CA 4C8OA 4TNOA 2WVEA 2GW8A 3Q2TC 3AOBA 5LSRA 3SUPA 3W5XA 1CQMA 5HMYA 1U1MA 5JS2A 4YHHF 3T5KA 4FO0A 1FD2A 5D0RA 4RNMA 2CG4A 3UCGA 4R25A 2PBDA 1NH7A 2JNJA 1RYRA 2ZH5A 5LSOA 3QSYB 4CYUB 5FRNA 3MEEA 3SQGB 1WEYA 1NK0A 3L95X 2M5YA 4GKKF 1XHXA 3B78A 2IM2A 4CJWA 2V94A 3VEZA 4K0KF 2CNOB 4IOCL 1Q8KA 2NUBA 3CCUN 3MPDA 1RHJB 3DNCA 3M30B 5HATA 3SQ4A 3IR6B 2XMTA 2DNHA 5MLCV 3C14B 1YDLA 1TGOA 1RT5B 3J7ZO 2Q3PA 4F3OA 4WJBA 4DQ8A 2CH6A 4IO1A 3FCWA 2ILZA 4JKFA 1VRQC 1FFWB 4PAAA 2NRXA 3AVLA 1U04A 4ANDA 2FY8A 1NK4A 4TU8A 4DXLA 3OL6A 2DTJA 4O0IA 1VRTA 4RW4B 3P6YC 3ZNUA 4ZA1A 2BW7A 2VQEF 5J2MB 2R8GA 3OTBA 4PKGA 4FWKA 2HKEA 3HPGA 3CJAA 4CJTA 1B70B 3RU0A 4N8OA 1PKUA 2QA4N 5E33A 4FJIA 1O51A 3NE6A 4MFBA 3FSIA 5J1EB 3M8PB 1SCJB 3EO3A 4O23A 4ID8A 3I5CA 1Z1ZA 4AD6A 4LF9K 4CBUA 4IG3A 1FW6A 2E6LA 1DQAA 1Q79A 3DFEA 3KUGA 3CJ0A 4B1VA 4BR5A 3FFIB 4F36A 3MF5A 3DLJA 2BZ2A 2EFQA 3C8YA 3ILOA 3T9NA 2L3MA 4TU9A 4PKDB 5ETLA 4WYBA 5L1LA 3L7OA 4DR2K 2YKMB 1NU0A 2M88A 1Z26A 2FJEB 1HHQA 1S5JA 2HSEB 2RQKA 3KHRA 4BRHA 3TYTA 2HFSA 4KPCA 3SCLE 2NNWA 2OTJN 1VSFA 4HL9A 3CW2C 2NRVA 1XR7A 2GMLA 4RNNA 3LZJA 4PCQA 3QMQA 4OIXA 1SS6A 3GR0A 2H65B 3MEKA 2W9BB 3QQCD 4X4PA 2CDQA 2ZQBA 1HBUA 3DLGA 1IBMJ 1AUDA 2DY1A 1Q81T 5IM0A 3C16B 3MMBA 4FWNA 4HHTA 2DY4A 3R6GB 1CS4B 4USTA 1RTIB 3DI6B 4DPOA 3QEPA 1NWKA 2J5AA 1OS5A 1MWYA 3OUYB 2HQGA 2YXLA 5A2QY 4OKJA 1VQMN 4Y2AA 5H9FK 1VCTA 2JZ5A 2DCLA 1KVAA 2QN6B 5E41A 3O4NA 3NGDA 4YFUA 1YJ9N 4A8WA 4FWMA 2BQRA 2QLJB 3ZX2A 2XLIA 1N33J 4LF1A 4B1XB 1KN6A 1RTHB 2AZ1A 3J7YU 2B4OA 1EQ0A 3THTA 2HFNA 2VG6B 1X5SA 4LF7J 1BU6O 2HIQA 2VV5A 2IAJB 2FHKA 2LYVA 3DRRA 4FPRA 3FE1A 1JK9B 1C0TA 2C28A 1PC4A 2Z2YB 1Q8LA 3VEOA 4L73A 5E3QA 2GUPA 3MWBA 1JL1A 5AZIA 3I9V9 3LALA 5M1QA 3PW7A 2NSCA 3A3PB 1LWEB 4TYBA 3RRKA 3P83D 2R7SA 3CE8A 2OEKA 2GO8A 3NCPA 4CESA 3WNFA 2PI4A 2HMIB 4JHDB 1OSCA 3ZCMA 1IVZA 7AT1B 1BCMA 3CG7A 2H51B 3R5AA 1BMQB 5B7WA 2WTFA 3PACA 3KD5E 1RWVB 3AO5A 2EHGA 4MKAA 2KG0A 4F8RA 4CHNA 2XHCA 1CC8A 4P7TA 5EWFA 2AD9A 5AT1B 1XN9A 3G71S 2D0AA 3KMQA 1RABB 1S48A 5KGWA 3WX8A 4CK1A 2B43A 1B0TA 3R6LB 3KG4A 1ITGA 7FDRA 3OYGA 2IDOA 2GHWA 2ASYA 3NNAA 2ZOGA 2DB1A 3S01A 1P27B 2K3IA 3VVUA 1IBMF 4ZITA 1W2BR 2ZH9A 3E51A 1VRUB 1PAEX 1KAXA 3SMSA 1MWKA 3KLVA 4KHPK 4GNIA 1T0TV 4C9DA 1A0OB 1CJUA 4BVPA 2ZE2A 2ZDPA 4H0VB 4FP9A 1TELA 3MECB 3H45C 3AVNA 2WHOA 4DTJA 3OFHA 3ILJA 3VQ5A 4IOXA 3PYGA 4KHSA 4DR4J 3GMGA 5BREA 3S3MA 5G4DA 1NKEA 3ZZTA 3V6HA 2AEMA 1C1BB 2AJQA 2ACMA 3KHGA 1N33F 1H0HB 3BQ2A 3VAHA 2V8HA 1CSJA 1ASVA 2NUUG 2HS4A 2XEXA 3RYLA 2Q0RA 1GQEA 2A0FB 5C24B 1S3XA 4M5HA 1Q82T 1IR0A 4EZ6A 4LF7F 3C6TB 3Q83A 2PFUA 4WFNL 2B51A 3EL2A 1TL5A 2MB0B 2E5HA 3LP3A 3BJYA 1ZM3A 3CXCR 1QAYA 4BRMA 4K8RA 3AVBA 1R31A 1IQZA 3VAKA 1VI7A 2P9SA 2YPYA 2Z58B 3D54A 2LA6A 2AYGA 4ATNA 2DVIA 1WDDA 1WTFA 4NYZA 4U7UD 5LT5A 2VKRA 3MEGA 2RD5C 5DDQC 2ZH2A 3K89A 5J1NA 4MO5A 1VLOA 3BN4A 5CYJA 3S8SA 3Q2SC 3V81A 1I39A 2Q97A 2XNQA 3PIPQ 1UL3A 1JLFB 3PVXA 4CHZA 5GADP 3U6FA 1JKHA 1NZ8A 2KHDA 1OY6A 4TLQA 1K1QA 4CO2A 2AHOB 1H2TZ 1SC6A 1C1CB 2XY6A 1OY8A 4ER8A 2ADBA 1HYSA 2G8FA 2HBLA 2R8KA 1H2UX 5EX0A 1DLOB 2Z30B 3BH6B 3ZEUA 2D41A 4DCOB 1Q7YT 3PW0A 5SWMA 1WSJA 3LPEA 2R8IA 4FF3A 2QMWA 1NGBA 3HD2A 2NZTA 1AUSL 4OX8A 3UI3A 1UTAA 1F2GA 4N5SA 1RDRA 3IBCB 4WF9Q 5ADXH 2DHSA 1X8DA 4I2PB 2QA4G 1A5VA 2FQQB 2K06A 5B8HA 1OMSA 3C2PA 4X4VA 3N9UC 5D0HA 5MAOA 2R2UA 3WXIA 3Q86A 2ATCB 4Y2CA 4JK7A 5LXYA 2CPHA 1LW0A 1GH8A 1M5PC 2P5GA 4DR4F 5HOOA 4H4OA 4JBCA 2XTJP 2E1AA 1D9DA 1APSA 4JEPA 4K5SA 1YHQN 1R7IA 3VHQA 2Q6BA 2IDEA 4YR3A 1RI7A 2YH1A 4J9KA 1BIUA 4ZPBA 1JJ2M 4UZCA 3T7ZA 2ZH8A 3W9HA 3KD1E 1FRXA 4B3SJ 4JI6K 1BISA 4RW9B 3M8QB 4KV8A 1BHLA 1RQ0A 2IRXA 3TWHA 1JLCA 1OO0B 3R5DA 1RBAA 3CMES 4BACA 4E1JA 3BYRA 2Q31A 2HIYA 4FSVA 1M1HA 4HVZA 1Z25A 2FVRA 1RTZA 4YUDA 3PIPL 5KFUA 1XMQK 3R8EA 4OZ0A 2BKPA 8RUCA 3W9IA 5C25A 2LEBA 2VWBA 3U9DA 2DGWA 1N0UA 1N5YB 3OW2M 1RCOB 4DV5K 5C42B 3EGNA 5A6WA 4GC6A 3N0VA 3SSQA 2G8UA 2YKOA 4CT8A 3QEXA 3ZZOA 2B4JA 2QWMA 4BRIA 2PMWA 3GILA 2OEJA 3SQOP 1IWAA 3OTEA 1YVNA 5CZXA 4FJGA 1WSHA 3QJPA 2AMCB 4PL8A 3Q23A 4Z7YA 2HHPA 3VN5A 5D3GB 1Q16B 4JV1A 5CCLA 2A3ZA 5LL6Z 4JI2K 4WIIA 4WF9L 2FIUA 1GMWA 4HT5A 4NYFA 2QKKA 3NWGA 2F7TA 3FGVA 2Z2ZA 4EYHB 1VBYA 4AM7A 4BC9A 2QRRA 3MX2A 3S7RA 4K43A 3SDEB 3ZT2A 1S7IA 2B4VA 3L2RA 1SXLA 4X62J 4Z7CA 3R9LA 1VYAA 4TQSA 2CZ9A 1JJ4A 3MCOA 1J27A 4NA2A 1AW0A 1MDUB 3G6ES 5L38A 4DR1K 3MMCA 3V1RA 2AIRB 5KQDA 2MMYA 4DV3K 3HK2A 2P6TA 2H3EB 1XR6A 2M70A 2BOAA 3CQ8A 1MNEA 4P74A 3W65A 5I4MA 2OFGX 1UFLA 2QMUB 3CERA 3ATVA 5F8NA 2Q66A 1LW2B 4B3SF 3FBCA 4UQGA 2MKIA 2W41A 4V19X 1WKKA 2ZDOA 1TYQB 4KHMA 3KLGA 3BKTA 2P9KA 1J2VA 2PA8D 2FB0A 3WC0A 4NLCA 3BS9A 1WKJA 3MWTA 4HT7A 1TK0A 4X4TA 1QQMA 3NAIA 2KKHA 3Q8QB 3I96A 3TTFA 3LDOA 2VUGA 4LF8J 3VGKA 1T94A 2Z1GA 2ATQA 2UXBK 3VQCA 1REVA 1MLAA 2UUCK 1VQON 1X4BA 3GSDA 3TQEA 3CI5A 3BBBA 1BA1A 4TXSA 1HLWA 2I38A 4B9VA 2AF6A 2OSRA 3DRXA 4OI3A 4FNIA 3MEEB 1WDTA 2CXEA 4OX6A 3PO4A 5AQSA 1H74A 4HTJA 4ZVEA 3T1YJ 2JEJA 4QIVA 4P72A 3IMQJ 3FZKA 5EUHA 3ID8A 3K5OA 2IYGA 3Q8PB 3I6PA 4BDPA 4BS2A 4O8KA 4KJIA 4V19J 4AQYK 3A12A 4B9NA 2YQ0A 4X64J 3KYLA 2HRTA 3H8YA 3LP2A 2GQ2A 1XC3A 3S3NA 3IGNA 3O5TB 3UR3C 2XWYA 3QMLA 1FDAA 4URGA 3X3UA 3FK4A 1HW8A 1AB8A 4X66K 3IAS9 2VOPA 4BC7A 4M5IA 4PY5A 5D78A 4ED7A 1BDGA 2ZGYA 4OYWA 1KVJA 5KG1A 4X62F 4JI5J 1JJHA 3CIZA 1VRTB 3J81j 3GE1A 1TV6A 4C0BA 1S9EA 4H4MA 4U8VA 4ZOSA 3TOQA 1B92A 1HIYA 1RDCA 4YQWA 4I56A 5FPNA 3NGRA 4MAKA 1EKRA 4GVMA 1N8RT 1EAYC 4ZJLA 2WW4A 5DQGA 2IBKA 1QAXA 1WHVA 3T6JA 4ED2A 3NDKA 1G15A 1VQLN 2MQ8A 5IT9Y 4NLYA 2E1YA 3I87A 4WCEL 2X7IA 4IG3B 5C10A 4H0TB 3QICA 2VC0A 3P8BB 3THXA 3E2EA 3P49B 4JYAK 2MJNA 1PJ6A 2J6UA 2JX2A 1WUUA 2D7SA 2CJBA 4DL3A 4RBVA 1UWBA 3T3FA 4IOAQ 2W24A 4RW6A 1AA1B 1DZ5A 5EDWA 5B0EA 1ZTTA 1KLMB 4YNQA 1XEZA 4FWOA 4TLRA 2C1EB 4DPWA 1GTHA 3HOTA 4XAKA 3LPUA 4LF8F 4LRDA 1VHFA 4AM6A 3LTOA 2CPYA 5KFQA 4LF5K 3CQYA 4DPYA 2A42A 3EGZA 2FGCA 2FSKA 1D3WA 4IQXA 3EEQA 5LL6d 3AODA 4ECUA 2MEWA 2HB5A 4LR7A 1NO8A 1OWXA 2ZVIA 1HBUB 3DLGB 2YHBA 5IM0B 5TKYA 1ZS6A 3D68A 3DAWA 3MM9A 3MMBB 4H4KA 3T1YF 4JI8J 4BE1A 3D3BJ 1S1UB 2DNYA 3BZKA 5F8GA 5BN9A 3IRWP 2DNOA 1SUQA 3FSYA 1TL1A 3CD6N 1FXDA 4F3MA 1S1WA 3I0RA 3A8JA 2QM1A 3HM8A 2HZAA 1GLFO 4DU3A 4FW1A 4CEZA 4PG5A 4X64F 3SPYA 3LAMA 5DM6Q 4ZVQB 3HZGA 4YY3J 2B0GA 4FK4A 4A2AA 2BE9B 4DX8H 3QJLA 4OPJA 4ZJQA 1Y3KA 4Y1CA 4JAXA 4ECWA 3R1LA 3D4JA 3K2PA 3TRGA 3UN3A 2O4GA 5F2RA 2JGUA 4B3MJ 3RRGA 3SZ2A 4ITSA 2ZHAA 5HJYA 2RS2A 3BKFA 3L0QA 3OYHA 4FWLA 5K8NA 4A8MP 3BSAA 2MZRA 2GX8A 1UAXA 3A4TA 4A5AA 4PWWA 1QVFR 4JI5F 3PSFA 3DRRB 1I6JA 3K57A 2R7VA 4CIGA 1C0TB 1IBKJ 2IOCA 2MYFA 4O0NA 1MROA 1RBLA 5AZIB 4G1IA 3QIDA 2I9SA 3ICLA 2XS5A 5BJRA 2RNEA 5KOXA 4KRFA 4XH1A 2VONA 4NCGA 1WSFA 1TL3A 2UVVA 1KVKA 4DL0C 1OSDA 4B8CA 1T9YA 2JRSA 2FHJA 4B1ZA 4I68A 2QA2A 2DH9A 1RSCA 4NB4A 4JI0K 4E0DA 3UFCX 4DI6A 3I5AA 1HPZA 3A5LC 4BC4A 3IG1A 4E1MA 4X65K 3JXUA 4UOHA 5D8HB 2HF3A 3DXKA 3VAIA 3K58A 2HHWA 1IJJA 2R42A 4EU0A 2PEBA 4AYBD 1B0PA 4K7QA 1QY7A 1UVJA 4JV5J 4IO8A 4KT0C 3GOIA 2LP4A 3QT5A 4UZBA 3OHAA 3O8MA 2E5LJ 4KHNA 1IBLJ 3A8YA 5D4LA 2YWHA 5AE2A 1C2PA 4J9MA 3PIOQ 4MYUA 2W40A 2HPUA 2CJQA 5M1PA 4CFBA 1LOTB 4O3OA 4RU9A 4BC3A 1UJ4A 3MCMA 2LMIA 4N77A 4ZTJA 3UIQA 4EHTA 1RZMA 1TU0B 4JI8F 2ASPA 4CHOA 1KTQA 2GBZA 2YWKA 4LY7A 3SSRA 1WAJA 2HRUA 3KWIA 1CJUB 3QLHA 2ZE2B 1EZZB 5DM6L 1XJWB 1GOBA 2OI2A 3W63A 1FNXH 1KHVA 4I9LA 5KTQA 4MLHA 4FCYA 2CGLA 4YY3F 5FRMA 1RWPB 3BGFA 2AQ4A 4WFXA 2IC3A 1NGEA 3O5BA 1QAJA 3H3OB 1VR6A 4ID1A 2W25A 1GFWB 2OPQA 2ZD1A 4B3MF 2O8EA 2FVPA 1DAXA 3JSMA 5IV4A 4IRDA 3AY9A 4OI2A 1JXLA 2AJ2A 3VAMA 1C4AA 3BSOA 1QM9A 4PG4A 5M1FA 2D0OA 4UY8T 1BQMA 4O44A 2KYZA 4CJQA 3QWPA 2HNZA 1IBKF 4HTIA 3JTNA 1OYEA 3NGTA 4MK8A 3MCSA 5ITHA 3O9SA 4NA3A 3AGRA 1SH0A 3CJ1A 2FSJA 3L2VA 3VAFA 1RBRA 1N56A 2P9SB 1Q8IA 1PJ7A 4DQPA 2HFUA 1T3VA 4AUKA 2E20A 2L9NA 3R1XA 4CF2A 2DR6A 2FZCB 3IC1A 1DTTA 3MEGB 3PUFA 4OZ2A 3AB4B 2M9KA 2YPZA 4C0HA 3V81B 3M2VA 3B4MA 3K5MA 4DV6K 4G6VB 3MMJA 3E1YA 3IAYA 2R2TA 4BRCA 3PYEA 1ROFA 3TZXA 1JKHB 2HEKA 3N5BA 1HA1A 3Q0AA 4IUFA 4JV5F 1V3ZA 3NGIA 4CHQA 3TTCA 3CC7N 4Z4GA 3D6FB 3TVYA 3T6BA 1HYSB 1XQSC 2C2KB 2E5LF 5I42A 3KLEB 1B7YB 4HEA9 1IBLF 1SH3A 5LSLA 2JC0A 3CJKA 3ZEUB 1RT3B 1YBUA 2EKNA 4USHA 2UUWA 1QE1A 3HX9A 2PDAA 3OXLA 4CD3A 4I69A 4AHTA 5AXMA 2RPIA 4AILC 3LAKA 5GAEU 4N41A 1YI2N 3CF5Q 1VJWA 3PYDA 3RVCA 4DPXA 2MY8A 3K5PA 3MUTP 3VQDA 2ZZTA 3NF7A 3W8PA 1LW0B 3MM8A 2D9OA 3GWCA 2K1RA 3DLLQ 4H4OB 1FWPA 2RS8A 3D7SB 5GAEI 3AVGA 3EDRB 4OJ3A 3HF5A 2HHQA 1S9GA 3AVFA 4Q45A 3MN6A 4KGKA 3EM1A 3CQXA 2NYHA 4BCAA 3VR1A 3HHNB 2QG9B 2AZ3A 4KQZA 2NQPA 1EHWA 2GELA 4CECA 1UVIA 3TWZA 1N36K 3NS7B 3TSPA 4KV8B 3FZLA 3MOZA 3C65A 3AFGA 1JLCB 1OQ3A 1E6VB 4QW9A 2KG1A 3UE5A 3ADAC 4ILJA 1UAWA 1P9YA 4LF9J 3F2KA 2HYIB 1GXLA 4MKYA 2JEFA 4QJVA 1QD1A 3CCSS 1YTAA 4XO0A 2J8SA 4WK3A 5C25B 4JOUA 3OYNA 1HNIA 4GC7A 3MR7A 3V6KA 4P2FA 1FWLA 2PE8A 3R2CJ 1WHYA 2YTCA 3HJFA 1YJWN 1OVYA 4DR2J 3BEXA 3MFHA 2IM1A 3NF9A 1CVJA 2BYCA 5HVGA 5LM7E 4U67Q 4M5LA 3MR2A 1LWFA 4C48A 1WAFA 5KFKA 1Q9YA 1WOPA 5IT4A 3KTQA 2C2MB 3OBIA 5FDLA 4IZ9A 3QT8A 3FCHA 4E1NA 5BPNA 1F9HA 4C1NK 2EPIA 1FKPA 4C8NA 3VZHA 3MAHA 2VHGA