3T1CA

Crystal structure of nak channel d66y mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
b'DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 36
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3t1cA00
3AG4C 2W0FC 3ZRSA 4RUEA 2Q68A 1G4YB 4MW3A 1ZWIC 5KUMA 4MVRA 3UKMA 3SPHA 1OCCC 3K06A 2HVKC 3RW0A 3F5WC 3TETA 4MTGA 4PA9A 5EBLC 3ABLC 2AHYA 2EIKC 3E89A 3SPGA 5EK0A 3SYPA 5CBFA 5EC1C 3AG1C 4MVSA 4PDLA 4H37A 5EBWC 4LCUC 2QKSA 3RVZA 2Y69C 2HFEC 2HG5C 4R7CA 4I9WA 3SYAA 3LDEA 3OR6C 1V55C 2YEVA 4P2ZA 3T4ZA 3AG2C 3E83A 5E1AC 3ZJZA 2A79B 4PA4A 4RO2A 2ITDC 3GB7C 4KFMA 2H8PC 3K0GA 3LNMB 2X6CA 5BZBA 2OCCC 4XDJA 4JTCB 4EKWA 5CBHA 2WLKA 2DYSC 4P30A 1ORQC 1S5HC 2Q69A 4MVMA 4UUJC 4MTOA 3K04A 2EIMC 1LNQA 4PDRA 1OCRC 3OUSA 4DXWA 3R65A 3PJSK 4J9YB 3FB6C 3OR7C 2JK5C 2NLJC 1KKDA 2EINC 4R50A 1V54C 3JYCA 2DYRC 3FB5C 3SJQC 4MVZA 3SPJA 4BW5A 3E8GA 2Q6AA 2KB1A 2Q67A 2K1EA 4MTFA 3SYQA 5J9PC 4P9OA 3E86A 4HZ3A 3KG2A 3OGCC 4H33A 4XDLA 5EBMC 2WLLA 4LBEC 3SPCA 3STLC 3E8HA 4CBCA 1R3IC 4PA7A 4WFFA 1JVMA 4WFEA 3RBZA 3T4DA 1M56C 2BOCC 4MVQA 3IFXA 3STZC 4PDMA 2WLHA 4PA6A 4OXSA 2WLLB 2HVJC 2X6BA 1R3KC 2AHZA 2IH1C 2EILC 3RVYA 1XL6A 4TWKA 4X88A 3AG3C 5EC2C 4J9ZB 4PA3A 5KUKA 2IH3C 1OCZC 3OUFA 4RUFA 4PDVA 3TCUA 2A0LA 2ITCC 2WLMA 4WFHA 4X8AA 4F4LA 2BOBC 3T1CA 3UM7A 2WLIA 1R3LC 3HPLC 3F7VC 4G27B 2HJFC 2DWEC 2DWDC 3FB7C 3IGAC 3LDCA 1P7BA 3ASNC 3K08A 1OCOC 3E8BA 3X2QC 2EIJC 2QTOA 4R8CA 2WLIB 4QE7A 1QLEC 4MVOA 4ZBMA 1BL8A 1M57C 5IY5C 4JTAB 4MS2A 3SPIA 1J95A 2WLJA 2ZXWC 4WFGA 4RAIA 3VOUA 4XDKA 3FB8C 3ABMC 4JTDB 4LP8A 2ATKC 5B1AC 2R9RB 4QE9A 4X89A 5CBGA 3SYCA 2A9HA 1K4CC 3ASOC 2WLNA 3BEHA 4GX5A 4HYOA 4MW8A 5B1BC 2P7TC 3K0DA 4MVUA 4GX2A 1XL4A 3LUTB 3SYOA 3WG7C 2ZD9A 1K4DC 3ABKC 4GX0A 5B3SC 4P9PA 4G28B 4GX1A 3T2MA 2X6AA 4MSWC 4R6ZA 3F7YC 4QNHB 3E8FA 3LDDA 1R3JC 3EFFK 3K03A
chains in the Genus database with same CATH superfamily
4O4JA 4CH6A 1PL4A 3U11A 4JV5O 3QG5A 4MVRA 1I0HA 5DN6G 2ZDIA 4DR5O 1HW7A 3IJ4A 2ADQB 3E89A 1IBKB 3SYPA 5EK0A 1I7FA 5BR8O 4MVSA 2P4VA 1BQ0A 2B1IA 3CHXA 1VIBA 3N27A 3FFQA 3SJBC 1W2BU 3HKBB 3C90A 3ZJZA 1RFYA 1V55B 4X20A 1TUBB 2Q0AA 3L70H 4X1IB 5ITZA 3GWKC 2YEVB 1DLBA 1FXKC 1OZ0A 3Q4HB 1JFFB 2Q69A 1PKXA 2OYQA 3QO7A 1Y76A 4DV0B 1VP7A 4X1KB 4TSFG 1GMGA 4K3AA 4LBEC 5BMVA 2B1GA 1QHTA 1B3QA 4QPKA 2PI4A 1KQSU 4I0XB 1FXKA 3DC6A 4PDMA 1MG1A 4JV5B 3CS5A 3DTUB 4DR5B 1VQ4V 2JIZG 1VQ7V 2JGDA 5LXTA 1NTKH 3FB7C 3IGAC 2BSKB 5BR8B 4DK0A 1MABG 4JAVA 2QTOA 3ASNB 4JI6O 4J42A 1XNRO 2NN4A 3H01A 2XASA 2ZNJA 2VQEO 4O4JB 4JI3O 2LFSA 3A0BZ 4F6RA 4CS3A 3AK2A 4MW8A 3WU2Z 4UV9A 4JI5O 3CC4V 4I55A 1HNXO 3K9AA 3K9SA 4Z1MG 1BHAA 1P49A 3OMAB 2GBOA 3LDDA 3J7AU 1QBZA 2CAZC 3G6EV 2XAFA 3ZRWA 1ZWIC 1Q5OA 2AZ0A 5KAFZ 2X7RB 2DQ0A 4WBNA 3BY6A 2RCVA 4LF9O 1I08A 2Y69C 3OR6C 2B5UA 4FJCC 4ABMA 1Y76B 3JAWA 3RYIB 1FS0G 1XNQO 4PA4A 3N2KB 5LA6A 2ZIMA 4ZIBA 5BMVB 4DR3O 5L3GA 1AB3A 4JI6B 1XNRB 1FXKB 1KD1W 1EZVH 5JH7B 3PJSK 3ZRXA 4DK1A 1AP5A 3OR7C 2VS0A 4ZI7A 1KKDA 4JI3B 2Q67A 3OGIB 1XUQA 4JI5B 2WLLA 2EZOA 2QA4V 1HNXB 4WFEA 2JGDB 5LXTB 1SQQH 3CEIA 1N0JA 5FLXN 3OD4A 5IYCO 1Y67A 2A06H 2WLHA 2XAJA 1FXVA 2AHZA 3RVYA 1A32A 1XL6A 3AG3C 5LMNO 3APQA 3FD9A 5JVDB 5IYDO 2EJ7A 4HNAB 3TXQA 5BY1A 2QWNB 3JD4A 4F6RB 5IDJA 5KLVH 4LF5O 1TGOA 4LF9B 3LSQA 4HAMA 3AEIA 4X62O 4RAIA 4CS4A 4JTDB 4AHCA 3SGIA 1W0KG 3ZRWB 1SETA 3K0DA 4MVUA 3ZMUA 4OX9B 3JD2A 2Q7HA 3M7MX 2DOSA 4FFBA 1YZBA 3K03A 2YIDA 3HKCB 1IBLO 5KHIA 2QWRB 1ZL8A 3EVKA 1AJQA 5LA6B 3ABLC 4FFKA 4LFAO 1U96A 1GAXA 2CTWA 4NTXA 4FIPC 3FYEB 1YJWV 1IVSA 5LMNB 3CX5F 2Y69B 1XMQO 3SJAC 1YDXA 4LF5B 3LNMB 5BZBA 5LHGA 5B1NA 5CBHA 1ORQC 4MTOA 1LNQA 4X62B 1MZFA 1E79G 3JAKB 3CMAV 4R50A 1RSOA 4NXMO 4PI2A 1XEQA 4LF7B 1K7DA 4PA7A 4WFFA 3IFXA 2ZR2A 2E3CA 4JI4B 4FLZA 5LBQA 4TQDA 4NKGB 1BS3A 1IBLB 5FPOA 3AG3B 4PDVA 1RPOA 3BCCH 3UM7A 4YIPA 1WPXA 4LFAB 4LF8O 2CH7A 3MHSC 4DRXA 1JCHA 2OT5A 4WFGA 3OTOO 1NVPD 5L3BA 1XMQB 4XDKA 4O2BA 1ZL8B 3LUTB 2OTLV 2P06A 2JJ2G 5B3SC 3H1HH 1R3JC 4NXMB 5E79Z 1H2GA 1IXMA 3NXSA 1FKAO 2F95B 4JI7O 2Q7EA 5FNVA 2YIAA 1KC8W 3ABLB 3CCLV 4CS2A 3CJHB 3CPWU 3RVZA 3EHBB 4I9WA 2OWOA 4DR2O 1RSOB 1H2KA 3SJCC 2ZNIA 2BTOA 2YXYA 4TOIA 1AILA 2GDSA 4XDJA 4LF8B 3L75H 2YS8A 1BT8A 1VF6C 2RJZA 4DR6O 2HEPA 3JASA 1MMMA 1F4NA 2YUAA 3HKDA 1V54C 1L1FA 3QF7A 2QDOA 2QWQB 1XILA 2QM7A 4TUYA 3STLC 4CBCA 3S3XA 1R3IC 5H9CA 5H6QA 1E1QG 4YXWG 2IJJA 4JI2O 2XAQA 2X0LA 2ETNA 2H94A 2FB5A 1R3KC 2IH1C 4JZ2A 1ROPA 4OPAA 1EZJA 3TCUA 4F4LA 4ZKIA 4LWSB 4JI7B 3OMIB 4H44B 1MOFA 4UCVA 4X1YB 4LNUB 3F7VC 2UUAO 1UJWB 5LOVA 3E8BA 1N34B 1FAFA 2WLIB 4DYLA 2E74B 4JTAB 2E76B 4PD4F 2IJHA 4IT5A 4DR2B 3CSXA 4Z1VA 1FXHA 4NTYA 2ATKC 3WB2A 1XHXA 2A9HA 5B1BC 5FNVB 4DUYO 3VQVA 4K0KO 1Q7YW 3T2MA 5B3SB 4QNHB 3QO8A 2QR4A 3THOA 1BZKA 4MW3A 3D3QA 3K06A 1HNZB 1GM7A 2AHYA 4UCUA 1AP6A 4JI2B 5D5QA 3RYHA 5C8YA 2HFEC 1S76D 4RQEA 3JASB 3ZHRA 3HKDB 4NTWA 1H2NA 2A79B 1B06A 4ZOLB 3AK1A 3CCEV 2Y4UA 3K0GA 4TV8B 1NTMH 4KHPO 1X4TA 3VBBA 2F4VO 5EZYA 5FPRA 4DW1A 5B66Z 1WNSA 3CCSV 1S72V 1SF9A 5H6RA 5L3EA 2JVDA 3BVOA 4K8XA 2R70A 1CEZA 1V54B 2UU9O 3KCXA 4K0KB 3O65A 3OEEG 5JJNB 4D7SA 1KKCA 3W7UA 3NR7A 4PA6A 4NXNO 2C2AA 1EN6A 4X88A 3QNEA 4FPPA 2B9ZA 2A0LA 2PYJA 2RDCA 2HJFC 1VQKV 5DECA 4FZ1A 1P7BA 1HR0O 3GVMA 1OV9A 4MVOA 1VARA 3U0ZA 1S5LZ 3G4SV 3RT3C 1VQ9V 1GN6A 2F1MA 3H1KH 1IBKO 4X89A 5CBGA 1VQ8V 5EIBC 4KHPB 4JZGA 2F4VB 5B1BB 4UCSA 5IJ0B 1WLEA 2JJ1G 4G28B 5HFMA 4AQYO 1AJPA 5CA0A 1QCEA 3ZRSA 1NJIW 4KUMA 2FMLA 3OM3B 5EYPA 3L72H 2DJVA 4DV2B 3N2GB 2EIKC 4U7NA 2ZDIC 2AGAA 3K5OA 4NXNB 2YXLA 4DO2A 5EZYB 2GUZA 4CC6A 2HG5C 3SYAA 3LNNA 3QVNA 5LGTA 4IHJB 3R66A 4BIZA 2W6IG 3DSQA 2ILMA 2ITDC 1VQMV 2H8PC 1QR8A 3CXCU 1HR0B 2WLKA 2ZKOA 4YJ2B 2ZE5A 1S5HC 1YF2A 3JATB 3FB6C 5J2UA 2EINC 1VMGA 5KHKA 1JPXA 1Q90D 4X9QA 3ZHSA 2ZE8A 1KP3A 4LH6A 2E75B 4JI8O 4LFBO 2EZPA 3CMEV 4ZHQB 5F2VO 1YIJV 5KX5A 3AG2B 3RWRD 4AQYB 3WB0A 3A0RA 1UFIA 4IGGA 1MA1A 5JJJB 4DV4B 1OCZC 4G2KA 4YJ3B 4PELA 2JS3A 2HLDG 3JAMN 3CB2A 1NKDA 3VOUA 3ABMC 4J7JA 1K34A 1EN5A 3ASOC 4K8ZA 2KQXA 2DN9A 2HR3A 1XL4A 4PI0A 2ZD9A 2JRIA 1J5EB 4J41A 4GX1A 1GK9A 1N0NA 3B4SA 1SQGA 5DEDA 2LQTA 3MDSA 4I4TA 4GLXA 4JI8B 1NH2D 4LFBB 2MK3A 1OCCC 3SPHA 2ODMA 4PA9A 3CC7V 2UUBB 2VWKA 3RFRA 5CBFA 2EIKB 1YSCA 1ZUQA 3LDEA 2FL4A 5J2UB 1JJOA 5E1AC 4DV5O 4X64O 2JEXA 1URFA 2PZSA 2Q5ZA 5KX5B 4X20B 5ITZB 4I5SA 3W7TA 1F4MA 4Q6GA 3SJQC 3FB5C 4H0LB 2EINB 4P9OA 4E2LA 4HZ3A 4XDLA 4QJFB 5CB4A 3CRQA 3UT5A 3ZEDA 2BOCC 2QM4A 2HVJC 3O9OA 4FZ0A 4OX9O 3BAAA 3H1IH 2BOBC 1XDCA 1R3LC 2ADPA 2Y0PA 4I50A 1M9NA 5GONA 4UVCA 1BE3H 3W7WA 1EFRG 4ZBMA 5IY5C 4AILC 4QGPA 3CE2A 4J80A 3LSUA 4DV5B 4X64B 3SYCA 1K4CC 1Z5WA 3ABMB 3ASOB 3WG7C 4DV7O 1K4DC 2Q4PA 1WB8A 2X6AA 4KXRA 2GTSA 2L6LA 4I55B 3OT7A 1K73W 2YC0A 3RYCA 1E1RG 2NR5A 3L71H 4RUEA 1G4YB 5H5NA 3RN4A 1SS3A 1X59A 5C93A 1VEWA 2VQFB 1OCCB 3FAVA 4LF7O 3AG1C 2KG7A 4R7CA 1SQXH 4WBNB 2HKOA 5H2FZ 4JI4O 1YTFD 2M6YA 1WA8A 1SQFA 2X6CA 2FKXA 2ZR3A 3JAWB 2OCCC 3A8TA 1WB7A 5CB4B 3K5NA 1NTZH 1AJNA 4MVMA 1DGSA 4B08A 1K97A 2XAGA 1AI5A 4MVZA 1SZXA 1P7GA 4DV7B 1EBOA 4ZI7B 2P22C 3STZC 3CYOA 4HBNA 5LGUA 4YHHO 2WLLB 4B3RO 4J9ZB 2HP8A 1F23A 2M7WA 2F43G 4U7OA 2ZINA 1N36O 1N33O 3HPLC 4B3TO 4G27B 4UB8Z 2G38A 4DV1O 1WAZA 1OCOC 2EIJC 3K58A 4JGSA 2IM9A 4RQFA 2XNDG 2LP7A 5IY5B 4RWUA 3H1JH 1MSDA 5B1AC 1NT2B 3ZS8C 1K5QA 2P7TC 3SYOA 1AROP 3WG7B 4LH7A 3FAVB 3IC9A 1NH2B 3BPZA 3MHHC 4GUNA 2P4KA 3CCUV 3B77A 4F6EA 3ETGA 4LFCO 2FYUH 1SQPH 5LP6A 3ZHUA 2ZCEA 3UKMA 2XUMA 4FFBB 1WA8B 2HHHB 2Q0OC 5KMGA 5HFLA 1AR5A 3H9VA 1ZAUA 4GYCB 4YHHB 1P4RA 3K5MA 1YVWA 1PD3A 4GKJB 1S3JA 1JR9A 4B3RB 4PJ0Z 3AG1B 3ML0A 3P3PA 5CMUA 1JMKC 3JD1A 1BGYH 3D3IA 1N36B 2PYLA 1N33B 3E83A 2P90A 2W6JG 3TK1A 4DR1O 4B3TB 4FM1A 3RYFA 1JOYA 4DV1B 4C7UA 5TISZ 2LJ2A 4JYAO 1K5SA 5JCOC 4E4EA 1FFXA 4IL6Z 4P30A 2OCCB 1L0NH 3CRMA 1SERA 3QTCA 5IWAO 1D5NA 3ABTA 4J9YB 4KP4A 2WWWA 1PNKA 4LF6O 3SPJA 4GT1A 1RP3B 3J81N 1N34O 1Z5VA 4DR4O 2K1EA 4MTFA 3MD0A 4IIJA 1K9MW 3DGEA 3K3WA 1KYOF 5JCOA 2N74A 4LR3A 4NYKA 1GN4A 3B09A 5EC2C 4MT8A 4LFCB 2LGWA 4PHZA 1DF4A 3CP1A 1P84F 1BSMA 1KB9F 1H2LA 3T1CA 1IXBA 1K92A 1OCOB 1HNZO 2EIJB 2V4DA 4DR1B 2CH7B 4QE9A 5AG2A 4DRXB 1YXBA 5B1AB 3ZMTA 4JYAB 4O2BB 3AG7A 2WAMA 5IWAB 3IC7A 2W0XA 2YICA 4R6ZA 3F7YC 4JAUA 2V1DA 3WFVA 4LF6B 4EB6A 4DR4B 2W0FC 1SA0A 2OIGA 1XBLA 2WPDG 2PGGA 3W7XA 4MTGA 5FL7G 3RYFB 1KP2A 1PM9A 3P3NA 1O9HA 3APOA 1FFXB 2PTMA 2QKSA 4YIOA 3P30A 1Y74A 1GRJA 5A9GA 5K1PA 4ICGA 2CTPA 2AXTZ 4FLUA 2EBOA 3FYIB 3R65A 3CXHF 3A0HZ 1O9GA 2Z5UA 1GTOA 4BWAA 1US6A 2F66C 2IW5A 2CGOA 4FVMA 1H8EG 1G1XB 4TUYB 4GCZA 2YI9A 4OXSA 1F7YA 2GV9A 1HWYA 4NB5A 5KA5A 4KL1A 3ABUA 3AK3A 4DR7O 1BHBA 4B3SB 1M93A 4BIUA 1UPGA 2BTQA 1PPJH 1PL0A 2QM8A 4GZRB 4Q20A 5KHJA 1QNMA 2QE7G 1BL8A 5DM6V 3JCUZ 3E22A 3SPIA 2WLJA 2ZXWC 4DV2O 4JPRA 2QEXV 4EB6B 3FKSG 5LOVB 3D36C 4DV3B 2WLNA 4GX5A 5LYJA 1PP9H 1YI2V 4GX0A 4J7KA 2GSMB 3BRCA 2OTJV 1S5JA 4UFZA 3OMNB 4B7KA 1NVPB 2XOKG 3OTFA 3T1HO 2MW2B 5LMUO 1NR1A 3D36A 2DE0X 4BW9A 4O2AA 4BR6A 4XBFA 1EN4A 4FMTA 3CCRV 4PDLA 4H37A 3I55V 1FD9A 4CC5A 4X1IA 5CA1A 4DR7B 2LFRA 3OFNG 3RYHB 2YEVA 4FM2A 3T4ZA 2PI5A 1W0JG 5C8YB 2QGNA 1JFFA 1I5YA 2ZIOA 4WFAV 3ZHQA 2ZQMA 1AR1B 4N21A 4DV4O 1YEWA 2P5OA 4JTCB 2DYSC 2EIMC 2PY5A 5L3CA 1Q8IA 3M8AA 2JK5C 2NLJC 2DYRC 1Y6XA 2Q6AA 4I0XA 5GTHZ 3FX7A 1RPRA 5J9PC 5EBMC 3E8HA 1NR7A 1Q6IA 3UO3A 3E35A 3TGUH 4K35A 4WFBV 4TWKA 3CC2V 3J80N 4IYHA 3T1HB 2Z0AA 3E22B 1J5EO 4PA3A 5LMUB 3VQYA 2ITCC 1GKFA 1XHZA 3CCMV 5J2TA 4D7TA 2DQ3A 3G67A 3K08A 4FK5C 3UCSC 2UUCO 1AVMA 2CK3G 4MS2A 4CH5A 5IT9N 4FLVA 2R9AA 2A7WA 2UUBO 2ZXWB 1VQ5V 4TQFA 1GO3F 2VRZA 4O2AB 3CD6V 4Z2WA 5JWPA 3ABKC 5IJ9A 4P9PA 1ZSPA 1JJ2U 1GN3A 4EFEA 5CA1B 4JI1O 3B40A 2Q68A 1QQCA 2CE4A 5CA0B 1F51A 4A5UB 3OW2U 3F5WC 4WCEV 1SZTA 2P6JA 1R6KA 5EYPB 3RYIA 2D2CB 3N2KA 4LCUC 5BXZA 2QTSA 4U3FH 1SESA 1NU1H 4RO2A 3PN1A 4EEQA 3GB7C 4KFMA 2GUZB 4QIWF 1LUWA 5JH7A 1MNGA 1GN2A 2UUCB 1BMFG 2YDEA 2UXDO 3M99B 4CH3A 2DYSB 1D2DA 2EIMB 2ARHA 3TJTA 1GM8A 2O57A 1H38A 2KSDA 1VQPV 3SYQA 2IJIA 2DYRB 3E86A 1R6TA 4ASUG 3OEHG 5J2TB 3RBZA 1KU9A 3T4DA 1IBMO 4JYYA 2JS5A 2BE3A 5JVDA 1XMOO 2IU3A 4HNAA 1QVFU 1KUQA 4JI1B 1S0VA 1CP9A 4CZZA 2QWOB 2IH3C 3OUFA 1FFTB 2LO1A 1KMIZ 2DWEC 2DWDC 3QO5A 4WF9V 2Q73A 3ZHTA 5IJ9B 3JD0A 1HP8A 1Q6UA 3JSNA 2VQFO 1J95A 1SC5B 2K9PA 2AZ2A 1IDSA 2QKCA 1SQBH 1G6UA 2XHBA 2CDYA 3D8CA 1NI8A 1TVKA 1V9PA 3B8NA 4DUZO 2UXDB 1R73A 1OCZB 1ZTEA 1ZLZA 3HKCA 3ABKB 4MSWC 5CA3A 1VQNV 4X66O 2ZT9B 3E8FA 3AG4C 1LR1A 4I7ZB 2LW7A 5KHGA 5KUMA 4X65O 3HB3B 3ICXA 3F5TA 1AI4A 4L87A 3RW0A 2NNUA 2YSUB 1YJNV 5EBLC 4I4TB 4B3MO 1CXZB 1IBMB 1XMOB 1DF5A 1RM1C 3KCYA 4U3JA 2VQEB 3JD3A 2IJKA 5EBWC 1QR9A 1T5EA 1XOUA 5GW7A 4TT3G 3I5DA 1LUVA 3U10A 4O4LA 3ZRVA 4DW0A 4PV1B 3JAKA 3UQ8A 2L35A 2ZM6O 3B2EE 2OCHA 3ZN0A 4QPJA 1M4UA 1OCRC 3OUSA 4DXWA 4JYCA 2Z3YA 2HJDA 4BW5A 1Q86W 3WB1A 4H33A 4DUZB 5KA6A 1M56C 4MVQA 4I9QA 5LL6Y 4X66B 2RMKB 1XNQB 4J7ZA 2XT9A 1QLNA 3UT5B 1MSWD 3L74H 4DR3B 4JF3A 5KUKA 4X65B 2QSAA 4RUFA 3K79A 4UB6Z 4B3MB 1HDJA 1Y66A 2BCCH 1TAEA 4AI8A 1TVKB 1Q3EA 1FPOA 1K8AW 3LDCA 1Q43A 3OAAG 1GM9A 1WJZA 3X2QC 4GKKO 1M90W 2EJRA 1QLEC 4NR1A 2WA4A 3S3WA 4I50B 2HHHO 1QU7A 4FLYA 5GONB 3RGBA 5KHHA 3FB8C 2R9RB 3CRRA 4GKJO 2V7QG 3VQWA 1IZ3A 2ZM6B 2EX3A 2F93B 1PV0A 4U3JB 2QJ1A 4IYIA 4UVAA 1D5AA 3EFFK 3HKEA 3L9DA 4YY3O 1SQVH 3C3TA 3G80A 1SKVA 3AG4B 2LW1A 4O4LB 1Z2GA 3CJHA 2YIBD 3JCZA 4UCRA 1L8DA 3HR0A 3ZN1A 3RYCB 5LP6C 2IU0A 5JQGA 2OIEA 1YCIA 5B5EZ 3JALA 2GHYA 1RM1B 4NVPA 3K59A 2PF4E 4FLWA 1OJHA 2QWPB 2KG7B 2RQ6A 3MAQA 1ZX3A 2ZE7A 3ETQA 4JAAA 4GKKB 4B7EA 2QKAA 4UUJC 1THZA 3K04A 4FLXA 4DV6O 1OCRB 3G6BA 1CPYA 3EXAA 3E8GA 1U97A 1JX9A 3UO2A 3KG2A 2CTQA 5L3FA 1JVMA 2RNBA 5KAIZ 1B6QA 4BAYA 1NZ6A 2UXBO 1M56B 1YITV 5LGNA 1AR4A 3A2FA 4LWSA 2X6BA 3BA9A 4YY3B 4X1YA 4LNUA 4J11A 4OPHA 4X8AA 2DMXA 2WLIA 1VF7A 3CRCA 1PNLA 3ZX6A 5LHIA 4FM0A 4QE7A 3X2QB 1QLEB 1JQ0A 2N04A 1DK1A 5K1XA 3HKEB 3GWOA 1FJGO 1S77D 1TA8A 4W4LA 5JQGB 4DV6B 1I94O 3JALB 4JASA 1AI6A 3ZCCA 3ZHVA 2Q7GA 2Y4TA 3W7SA 2YXHA 2XTAA 1VF5B 2Y48A 4CH4A 2D3OW 2Q8VA 4H13B 5CN0A 1R6NA 3TETA 1EM1A 2UXBB 3OTOB 1HNWO 5LHHA 3SPGA 5EC1C 5LP6B 2GTAA 1N4CA 4O4IA 2Q9LA 4ZOLA 2JGUA 1ENVA 4LC1A 5KMGB 4TV8A 2YIBA 1JA8A 2JDIG 2WSSG 2PUSA 2Y0IA 3ETEA 3ZMVA 2WA3A 1WPBA 2R9IA 1H8HG 2EULA 4JYBA 1AI7A 1WP7A 1VF6A 4B3SO 1VQOV 4MTXA 4O4HA 2UXXA 3DXRA 3K5LA 4OGQB 2R72A 1NBMG 5IYZA 3CCVV 3JYCA 1YTFB 2KB1A 3C3SA 1Y4MA 3OGCC 1BCCH 3SPCA 2JEUA 3H1LH 1FJGB 2FTKA 4FLTA 1I94B 3ZMZA 1K33A 3SDLA 4IIJB 4DV3O 1VQLV 2EILC 1COWG 5IYBO 1OHHG 2E5LO 1IURA 3JARA 3ZBHA 2WLMA 3IAYA 3KZIZ 1WP8A 2CTRA 4DR6B 2A3QA 1HNWB 1K3EA 5EIBD 1VQ6V 1N8RW 1M1KW 1SRYA 1N32O 1M57C 3ZMSA 4UVBA 1YHQV 4LP8A 5IJ0A 1I5XA 2UXCO 3BEHA 2LGQA 1KECA 3VQXA 2KKWA 1XQ8A 3BHPA 3SR2C 3P32A 1QVGU 4L8JA 1XREA 2CUGA 4TV9A 4UV8A 3BA8A 4LF4O 4O4IB 2UUAB 3ZIAG 3N2GA 5B1OA 2HVKC 2RN9A 2AW9A 3I56V 1SA0B 4IHJA 2VWJA 3T1YO 4N23A 4O4HB 5L3DA 2E5LB 3DXRB 4UXNA 4EFBA 1Q81W 3BFRA 3B8MA 4DUYB 1V55C 4P2ZA 5JJEB 3AG2C 5IYZB 1XI1A 4YJ2A 2CGNA 4JI0O 1WN7A 2F23A 2H3OA 3JATA 1Y74B 3CRAA 5A2QN 4EKWA 3KKYA 2XAHA 1N32B 3OE7G 3ETDA 4PDRA 1MZEA 1DTOA 1R1BA 1L0LH 3DC5A 3HKBA 4W4KA 4ZHQA 2UXCB 3JARB 1TUBA 1H2MA 1M5IA 1G8MA 1NQTA 2YI8A 1Q82W 3Q4HA 4UCOA 4D6TH 3JSLA 3CCJV 4LF4B 1NS1A 4J10A 4YJ3A 3L73H 4X1KA 2EILB 1YJ9V 4BIOA 5GTIZ 5IE9A 1W59A 3BABA 4WFHA 2DW4A 3LSSA 1TUEB 3TXSA 1FYJA 2UXNA 2IBZH 3ASNC 3T1YB 3CCQV 1Q6HA 2P67A 4R8CA 2BTQB 2UU9B 4TV9B 1M57B 4UCTA 1IX9A 1H2SB 4DV0O 4JI0B 4HYOA 3G71V 1KBHA 2N05A 4GX2A 2BSKA 1GH6A 1PNMA 5D5PA 3K57A 3CWBH 1BQZA 3E2EA 2ZE6A 5LYJB 1B04A
chains in the Genus database with same CATH topology
3AG4C 3B77A 3ETGA 4MW3A 5KUMA 4MVRA 3HB3B 4L87A 3UKMA 1AI4A 3K06A 2ZDIA 3RW0A 5DN6G 2NNUA 1GM7A 2YSUB 1YJNV 5EBLC 2AHYA 5HFLA 1DF5A 3E89A 1RM1C 3SYPA 5EK0A 1P4RA 3JD3A 4MVSA 1PD3A 1S3JA 2IJKA 5EBWC 1QR9A 3AG1B 3ML0A 2B1IA 2HFEC 5CMUA 5GW7A 1S76D 4RQEA 3JD1A 3D3IA 4TT3G 1W2BU 3E83A 2P90A 2W6JG 3TK1A 3ZJZA 2A79B 1V55B 3ZRVA 3CCEV 1JOYA 3K0GA 2YEVB 1K5SA 1DLBA 1FXKC 3VBBA 1OZ0A 4P30A 3ZN0A 2OCCB 2Q69A 4QPJA 1PKXA 1SERA 3QO7A 1OCRC 3OUSA 4DXWA 3CCSV 3ABTA 1S72V 4J9YB 5H6RA 4KP4A 4JYCA 2WWWA 5L3EA 1PNKA 2Z3YA 3SPJA 4GT1A 4BW5A 4TSFG 2K1EA 4MTFA 1CEZA 1V54B 3MD0A 1Q86W 4H33A 1GMGA 1K9MW 4LBEC 2B1GA 3OEEG 4QPKA 5KA6A 2PI4A 1KQSU 3DGEA 1M56C 3K3WA 4MVQA 1FXKA 3W7UA 4PDMA 4PA6A 2C2AA 1QLNA 4X88A 3QNEA 1MG1A 5EC2C 1MSWD 4MT8A 4FPPA 1DF4A 4JF3A 3CP1A 5KUKA 4RUFA 3DTUB 3K79A 2A0LA 3T1CA 1VQ4V 2JIZG 1Y66A 1VQ7V 2HJFC 1VQKV 1K8AW 3FB7C 3IGAC 3LDCA 1P7BA 3OAAG 1K92A 1GM9A 1MABG 4JAVA 3X2QC 2QTOA 1M90W 2EJRA 3ASNB 1QLEC 4MVOA 3G4SV 1OCOB 2EIJB 3H01A 2XASA 1VQ9V 3FB8C 2R9RB 4QE9A 4X89A 2LFSA 5CBGA 1VQ8V 4MW8A 5B1AB 2V7QG 3ZMTA 4UV9A 5B1BB 3CC4V 2WAMA 3IC7A 1WLEA 2JJ1G 4G28B 3K9AA 5HFMA 4Z1MG 1BHAA 4R6ZA 3OMAB 3F7YC 4JAUA 1AJPA 2V1DA 1QCEA 3LDDA 4UVAA 3WFVA 1QBZA 3EFFK 3G6EV 3ZRSA 2W0FC 2XAFA 1NJIW 4KUMA 3OM3B 1ZWIC 3ZRWA 3AG4B 2WPDG 3W7XA 4MTGA 5FL7G 1KP2A 2X7RB 3JCZA 3ZN1A 2EIKC 2IU0A 2DQ0A 4U7NA 2ZDIC 3BY6A 2GHYA 4DO2A 1RM1B 2QKSA 2Y69C 3P30A 2HG5C 3SYAA 3OR6C 2B5UA 4FJCC 5LGTA 1FS0G 4BIZA 2W6IG 4PA4A 2ITDC 1VQMV 2H8PC 1QR8A 3CXCU 5L3GA 2WLKA 2EBOA 1S5HC 4UUJC 1THZA 1FXKB 3K04A 1KD1W 3FYIB 3R65A 3PJSK 3ZRXA 3FB6C 3OR7C 1KKDA 1OCRB 2EINC 2Z5UA 1CPYA 1JPXA 1GTOA 3E8GA 2Q67A 1JX9A 1KP3A 3KG2A 2WLLA 2EZOA 2QA4V 2EZPA 2IW5A 5L3FA 1JVMA 4WFEA 3CMEV 1YIJV 1B6QA 4BAYA 3AG2B 1H8EG 1M56B 5IYCO 1YITV 4GCZA 5LGNA 2WLHA 3A0RA 4OXSA 2XAJA 2X6BA 1FXVA 2AHZA 3RVYA 1HWYA 1XL6A 3AG3C 5KA5A 3ABUA 1BHBA 4BIUA 1OCZC 4G2KA 5IYDO 4X8AA 3JD4A 2WLIA 5IDJA 4PELA 2HLDG 1PL0A 1PNLA 2QM8A 5LHIA 4Q20A 2QE7G 3LSQA 4QE7A 4HAMA 1BL8A 3AEIA 5DM6V 3X2QB 3SPIA 2WLJA 2ZXWC 1QLEB 1JQ0A 4JPRA 2QEXV 1NKDA 4RAIA 3VOUA 3FKSG 3ABMC 4JTDB 1K34A 1W0KG 3ASOC 2WLNA 4GX5A 3ZRWB 1SETA 3K0DA 2HR3A 4MVUA 3ZMUA 1XL4A 1YI2V 2ZD9A 3GWOA 3JD2A 4GX0A 1S77D 4GX1A 2GSMB 2OTJV 4JASA 1GK9A 1AI6A 3OMNB 3ZCCA 1NVPB 2XOKG 3K03A 3W7SA 1NH2D 1NR1A 3D36A 2Y48A 2MK3A 1OCCC 3SPHA 2D3OW 5CN0A 1AJQA 1R6NA 3TETA 4PA9A 3ABLC 3CC7V 4XBFA 5LHHA 3SPGA 5CBFA 2EIKB 5EC1C 4FMTA 4FIPC 3CCRV 3FYEB 4PDLA 1YSCA 4H37A 3I55V 1YJWV 1ENVA 4LC1A 2LFRA 3OFNG 3LDEA 2JDIG 2YEVA 2Y69B 3T4ZA 2PI5A 1W0JG 2WSSG 5E1AC 3ETEA 1I5YA 3ZMVA 4WFAV 2ZQMA 2R9IA 1AR1B 1H8HG 3LNMB 4N21A 4JYBA 1AI7A 5BZBA 5LHGA 2JEXA 4JTCB 5B1NA 5CBHA 4MTXA 1VQOV 2DYSC 1ORQC 2UXXA 4MTOA 2EIMC 1LNQA 4I5SA 3W7TA 1F4MA 1E79G 3CMAV 5L3CA 2JK5C 2NLJC 1NBMG 3CCVV 4R50A 3JYCA 2DYRC 3FB5C 3SJQC 2Q6AA 2KB1A 1YTFB 1RPRA 2EINB 5J9PC 1Y4MA 4P9OA 4E2LA 4HZ3A 3OGCC 5EBMC 4XDLA 3SPCA 2JEUA 4QJFB 1K7DA 3E8HA 4PA7A 1NR7A 2FTKA 4WFFA 2BOCC 3IFXA 3ZMZA 1K33A 2ZR2A 3E35A 4WFBV 5LBQA 1VQLV 2HVJC 2EILC 4TWKA 3CC2V 1COWG 5IYBO 1OHHG 4PA3A 3AG3B 4PDVA 2ITCC 2WLMA 1GKFA 2BOBC 3CCMV 1RPOA 3UM7A 1R3LC 1WPXA 2DQ3A 1M9NA 1K3EA 3K08A 1VQ6V 4FK5C 4UVCA 1N8RW 1M1KW 1SRYA 3W7WA 2CK3G 1EFRG 3MHSC 4ZBMA 1JCHA 5IY5C 1M57C 4MS2A 2OT5A 4UVBA 4WFGA 3ZMSA 1YHQV 1NVPD 5L3BA 4XDKA 4LP8A 2ZXWB 1I5XA 1VQ5V 3SYCA 1K4CC 3ABMB 3BEHA 1GO3F 1KECA 3ASOB 3LUTB 3WG7C 2OTLV 3CD6V 1K4DC 2JJ2G 3ABKC 5B3SC 3P32A 4P9PA 2X6AA 1QVGU 4UV8A 1R3JC 1JJ2U 1K73W 3ZIAG 1E1RG 1H2GA 4RUEA 2Q68A 1G4YB 1IXMA 5B1OA 3NXSA 1F51A 5C93A 2HVKC 3OW2U 3F5WC 4WCEV 1OCCB 3I56V 1SZTA 2P6JA 1KC8W 3ABLB 1R6KA 3CCLV 3AG1C 4N23A 3CPWU 4LCUC 5L3DA 3RVZA 3EHBB 4UXNA 1Q81W 4R7CA 3B8MA 4I9WA 1SESA 1V55C 4P2ZA 2HKOA 3AG2C 1YTFD 4RO2A 3GB7C 4KFMA 4QIWF 2X6CA 2ZR3A 2OCCC 4XDJA 4EKWA 2XAHA 1AJNA 1BMFG 3OE7G 4MVMA 3ETDA 3M99B 1K97A 2DYSB 4PDRA 2XAGA 1DTOA 2EIMB 1AI5A 1F4NA 1V54C 1GM8A 1L1FA 1H38A 4MVZA 1VQPV 3SYQA 2IJIA 2QM7A 2DYRB 1G8MA 3E86A 4ASUG 1EBOA 3STLC 1NQTA 4CBCA 3OEHG 1R3IC 5H9CA 3RBZA 5H6QA 1E1QG 4YXWG 3T4DA 1Q82W 3STZC 3CYOA 2IJJA 2IU3A 2XAQA 3CCJV 2X0LA 5LGUA 1QVFU 2H94A 2WLLB 1R3KC 2IH1C 1S0VA 1CP9A 4CZZA 4J9ZB 2EILB 1YJ9V 1F23A 1ROPA 2IH3C 2M7WA 1EZJA 1FFTB 2F43G 3OUFA 4WFHA 3TCUA 4U7OA 2DW4A 3LSSA 1TUEB 4F4LA 4ZKIA 3OMIB 1MOFA 3HPLC 3F7VC 4G27B 1UJWB 2UXNA 2DWEC 2DWDC 3QO5A 3ASNC 4WF9V 3CCQV 1OCOC 3E8BA 2EIJC 2P67A 4JGSA 4R8CA 2WLIB 3JD0A 4RQFA 2XNDG 4JTAB 2LP7A 1J95A 2IJHA 5IY5B 1M57B 1FXHA 2ATKC 5B1AC 2A9HA 4HYOA 5B1BC 1K5QA 3G71V 2P7TC 4GX2A 3SYOA 3B8NA 1PNMA 1AROP 1R73A 3WG7B 1OCZB 1Q7YW 3T2MA 3E2EA 3ABKB 4MSWC 5CA3A 1VQNV 5B3SB 4QNHB 3QO8A 3E8FA 1NH2B 3MHHC 3CCUV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG4 C;  2W0F C;  3ZRS A;  4RUE A;  2Q68 A;  1G4Y B;  4MW3 A;  1ZWI C;  5KUM A;  4MVR A;  3UKM A;  3SPH A;  1OCC C;  3K06 A;  2HVK C;  3RW0 A;  3F5W C;  3TET A;  4MTG A;  4PA9 A;  5EBL C;  3ABL C;  2AHY A;  2EIK C;  3E89 A;  3SPG A;  5EK0 A;  3SYP A;  5CBF A;  5EC1 C;  3AG1 C;  4MVS A;  4PDL A;  4H37 A;  5EBW C;  4LCU C;  2QKS A;  3RVZ A;  2Y69 C;  2HFE C;  2HG5 C;  4R7C A;  4I9W A;  3SYA A;  3LDE A;  3OR6 C;  1V55 C;  2YEV A;  4P2Z A;  3T4Z A;  3AG2 C;  3E83 A;  5E1A C;  3ZJZ A;  2A79 B;  4PA4 A;  4RO2 A;  2ITD C;  3GB7 C;  4KFM A;  2H8P C;  3K0G A;  3LNM B;  2X6C A;  5BZB A;  2OCC C;  4XDJ A;  4JTC B;  4EKW A;  5CBH A;  2WLK A;  2DYS C;  4P30 A;  1ORQ C;  1S5H C;  2Q69 A;  4MVM A;  4UUJ C;  4MTO A;  3K04 A;  2EIM C;  1LNQ A;  4PDR A;  1OCR C;  3OUS A;  4DXW A;  3R65 A;  3PJS K;  4J9Y B;  3FB6 C;  3OR7 C;  2JK5 C;  2NLJ C;  1KKD A;  2EIN C;  4R50 A;  1V54 C;  3JYC A;  2DYR C;  3FB5 C;  3SJQ C;  4MVZ A;  3SPJ A;  4BW5 A;  3E8G A;  2Q6A A;  2KB1 A;  2Q67 A;  2K1E A;  4MTF A;  3SYQ A;  5J9P C;  4P9O A;  3E86 A;  4HZ3 A;  3KG2 A;  3OGC C;  4H33 A;  4XDL A;  5EBM C;  2WLL A;  4LBE C;  3SPC A;  3STL C;  3E8H A;  4CBC A;  1R3I C;  4PA7 A;  4WFF A;  1JVM A;  4WFE A;  3RBZ A;  3T4D A;  1M56 C;  2BOC C;  4MVQ A;  3IFX A;  3STZ C;  4PDM A;  2WLH A;  4PA6 A;  4OXS A;  2WLL B;  2HVJ C;  2X6B A;  1R3K C;  2AHZ A;  2IH1 C;  2EIL C;  3RVY A;  1XL6 A;  4TWK A;  4X88 A;  3AG3 C;  5EC2 C;  4J9Z B;  4PA3 A;  5KUK A;  2IH3 C;  1OCZ C;  3OUF A;  4RUF A;  4PDV A;  3TCU A;  2A0L A;  2ITC C;  2WLM A;  4WFH A;  4X8A A;  4F4L A;  2BOB C;  3T1C A;  3UM7 A;  2WLI A;  1R3L C;  3HPL C;  3F7V C;  4G27 B;  2HJF C;  2DWE C;  2DWD C;  3FB7 C;  3IGA C;  3LDC A;  1P7B A;  3ASN C;  3K08 A;  1OCO C;  3E8B A;  3X2Q C;  2EIJ C;  2QTO A;  4R8C A;  2WLI B;  4QE7 A;  1QLE C;  4MVO A;  4ZBM A;  1BL8 A;  1M57 C;  5IY5 C;  4JTA B;  4MS2 A;  3SPI A;  1J95 A;  2WLJ A;  2ZXW C;  4WFG A;  4RAI A;  3VOU A;  4XDK A;  3FB8 C;  3ABM C;  4JTD B;  4LP8 A;  2ATK C;  5B1A C;  2R9R B;  4QE9 A;  4X89 A;  5CBG A;  3SYC A;  2A9H A;  1K4C C;  3ASO C;  2WLN A;  3BEH A;  4GX5 A;  4HYO A;  4MW8 A;  5B1B C;  2P7T C;  3K0D A;  4MVU A;  4GX2 A;  1XL4 A;  3LUT B;  3SYO A;  3WG7 C;  2ZD9 A;  1K4D C;  3ABK C;  4GX0 A;  5B3S C;  4P9P A;  4G28 B;  4GX1 A;  3T2M A;  2X6A A;  4MSW C;  4R6Z A;  3F7Y C;  4QNH B;  3E8F A;  3LDD A;  1R3J C;  3EFF K;  3K03 A; 
#chains in the Genus database with same CATH topology
 4O4J A;  4CH6 A;  1PL4 A;  3U11 A;  4JV5 O;  3QG5 A;  4MVR A;  1I0H A;  5DN6 G;  2ZDI A;  4DR5 O;  1HW7 A;  3IJ4 A;  2ADQ B;  3E89 A;  1IBK B;  3SYP A;  5EK0 A;  1I7F A;  5BR8 O;  4MVS A;  2P4V A;  1BQ0 A;  2B1I A;  3CHX A;  1VIB A;  3N27 A;  3FFQ A;  3SJB C;  1W2B U;  3HKB B;  3C90 A;  3ZJZ A;  1RFY A;  1V55 B;  4X20 A;  1TUB B;  2Q0A A;  3L70 H;  4X1I B;  5ITZ A;  3GWK C;  2YEV B;  1DLB A;  1FXK C;  1OZ0 A;  3Q4H B;  1JFF B;  2Q69 A;  1PKX A;  2OYQ A;  3QO7 A;  1Y76 A;  4DV0 B;  1VP7 A;  4X1K B;  4TSF G;  1GMG A;  4K3A A;  4LBE C;  5BMV A;  2B1G A;  1QHT A;  1B3Q A;  4QPK A;  2PI4 A;  1KQS U;  4I0X B;  1FXK A;  3DC6 A;  4PDM A;  1MG1 A;  4JV5 B;  3CS5 A;  3DTU B;  4DR5 B;  1VQ4 V;  2JIZ G;  1VQ7 V;  2JGD A;  5LXT A;  1NTK H;  3FB7 C;  3IGA C;  2BSK B;  5BR8 B;  4DK0 A;  1MAB G;  4JAV A;  2QTO A;  3ASN B;  4JI6 O;  4J42 A;  1XNR O;  2NN4 A;  3H01 A;  2XAS A;  2ZNJ A;  2VQE O;  4O4J B;  4JI3 O;  2LFS A;  3A0B Z;  4F6R A;  4CS3 A;  3AK2 A;  4MW8 A;  3WU2 Z;  4UV9 A;  4JI5 O;  3CC4 V;  4I55 A;  1HNX O;  3K9A A;  3K9S A;  4Z1M G;  1BHA A;  1P49 A;  3OMA B;  2GBO A;  3LDD A;  3J7A U;  1QBZ A;  2CAZ C;  3G6E V;  2XAF A;  3ZRW A;  1ZWI C;  1Q5O A;  2AZ0 A;  5KAF Z;  2X7R B;  2DQ0 A;  4WBN A;  3BY6 A;  2RCV A;  4LF9 O;  1I08 A;  2Y69 C;  3OR6 C;  2B5U A;  4FJC C;  4ABM A;  1Y76 B;  3JAW A;  3RYI B;  1FS0 G;  1XNQ O;  4PA4 A;  3N2K B;  5LA6 A;  2ZIM A;  4ZIB A;  5BMV B;  4DR3 O;  5L3G A;  1AB3 A;  4JI6 B;  1XNR B;  1FXK B;  1KD1 W;  1EZV H;  5JH7 B;  3PJS K;  3ZRX A;  4DK1 A;  1AP5 A;  3OR7 C;  2VS0 A;  4ZI7 A;  1KKD A;  4JI3 B;  2Q67 A;  3OGI B;  1XUQ A;  4JI5 B;  2WLL A;  2EZO A;  2QA4 V;  1HNX B;  4WFE A;  2JGD B;  5LXT B;  1SQQ H;  3CEI A;  1N0J A;  5FLX N;  3OD4 A;  5IYC O;  1Y67 A;  2A06 H;  2WLH A;  2XAJ A;  1FXV A;  2AHZ A;  3RVY A;  1A32 A;  1XL6 A;  3AG3 C;  5LMN O;  3APQ A;  3FD9 A;  5JVD B;  5IYD O;  2EJ7 A;  4HNA B;  3TXQ A;  5BY1 A;  2QWN B;  3JD4 A;  4F6R B;  5IDJ A;  5KLV H;  4LF5 O;  1TGO A;  4LF9 B;  3LSQ A;  4HAM A;  3AEI A;  4X62 O;  4RAI A;  4CS4 A;  4JTD B;  4AHC A;  3SGI A;  1W0K G;  3ZRW B;  1SET A;  3K0D A;  4MVU A;  3ZMU A;  4OX9 B;  3JD2 A;  2Q7H A;  3M7M X;  2DOS A;  4FFB A;  1YZB A;  3K03 A;  2YID A;  3HKC B;  1IBL O;  5KHI A;  2QWR B;  1ZL8 A;  3EVK A;  1AJQ A;  5LA6 B;  3ABL C;  4FFK A;  4LFA O;  1U96 A;  1GAX A;  2CTW A;  4NTX A;  4FIP C;  3FYE B;  1YJW V;  1IVS A;  5LMN B;  3CX5 F;  2Y69 B;  1XMQ O;  3SJA C;  1YDX A;  4LF5 B;  3LNM B;  5BZB A;  5LHG A;  5B1N A;  5CBH A;  1ORQ C;  4MTO A;  1LNQ A;  4X62 B;  1MZF A;  1E79 G;  3JAK B;  3CMA V;  4R50 A;  1RSO A;  4NXM O;  4PI2 A;  1XEQ A;  4LF7 B;  1K7D A;  4PA7 A;  4WFF A;  3IFX A;  2ZR2 A;  2E3C A;  4JI4 B;  4FLZ A;  5LBQ A;  4TQD A;  4NKG B;  1BS3 A;  1IBL B;  5FPO A;  3AG3 B;  4PDV A;  1RPO A;  3BCC H;  3UM7 A;  4YIP A;  1WPX A;  4LFA B;  4LF8 O;  2CH7 A;  3MHS C;  4DRX A;  1JCH A;  2OT5 A;  4WFG A;  3OTO O;  1NVP D;  5L3B A;  1XMQ B;  4XDK A;  4O2B A;  1ZL8 B;  3LUT B;  2OTL V;  2P06 A;  2JJ2 G;  5B3S C;  3H1H H;  1R3J C;  4NXM B;  5E79 Z;  1H2G A;  1IXM A;  3NXS A;  1FKA O;  2F95 B;  4JI7 O;  2Q7E A;  5FNV A;  2YIA A;  1KC8 W;  3ABL B;  3CCL V;  4CS2 A;  3CJH B;  3CPW U;  3RVZ A;  3EHB B;  4I9W A;  2OWO A;  4DR2 O;  1RSO B;  1H2K A;  3SJC C;  2ZNI A;  2BTO A;  2YXY A;  4TOI A;  1AIL A;  2GDS A;  4XDJ A;  4LF8 B;  3L75 H;  2YS8 A;  1BT8 A;  1VF6 C;  2RJZ A;  4DR6 O;  2HEP A;  3JAS A;  1MMM A;  1F4N A;  2YUA A;  3HKD A;  1V54 C;  1L1F A;  3QF7 A;  2QDO A;  2QWQ B;  1XIL A;  2QM7 A;  4TUY A;  3STL C;  4CBC A;  3S3X A;  1R3I C;  5H9C A;  5H6Q A;  1E1Q G;  4YXW G;  2IJJ A;  4JI2 O;  2XAQ A;  2X0L A;  2ETN A;  2H94 A;  2FB5 A;  1R3K C;  2IH1 C;  4JZ2 A;  1ROP A;  4OPA A;  1EZJ A;  3TCU A;  4F4L A;  4ZKI A;  4LWS B;  4JI7 B;  3OMI B;  4H44 B;  1MOF A;  4UCV A;  4X1Y B;  4LNU B;  3F7V C;  2UUA O;  1UJW B;  5LOV A;  3E8B A;  1N34 B;  1FAF A;  2WLI B;  4DYL A;  2E74 B;  4JTA B;  2E76 B;  4PD4 F;  2IJH A;  4IT5 A;  4DR2 B;  3CSX A;  4Z1V A;  1FXH A;  4NTY A;  2ATK C;  3WB2 A;  1XHX A;  2A9H A;  5B1B C;  5FNV B;  4DUY O;  3VQV A;  4K0K O;  1Q7Y W;  3T2M A;  5B3S B;  4QNH B;  3QO8 A;  2QR4 A;  3THO A;  1BZK A;  4MW3 A;  3D3Q A;  3K06 A;  1HNZ B;  1GM7 A;  2AHY A;  4UCU A;  1AP6 A;  4JI2 B;  5D5Q A;  3RYH A;  5C8Y A;  2HFE C;  1S76 D;  4RQE A;  3JAS B;  3ZHR A;  3HKD B;  4NTW A;  1H2N A;  2A79 B;  1B06 A;  4ZOL B;  3AK1 A;  3CCE V;  2Y4U A;  3K0G A;  4TV8 B;  1NTM H;  4KHP O;  1X4T A;  3VBB A;  2F4V O;  5EZY A;  5FPR A;  4DW1 A;  5B66 Z;  1WNS A;  3CCS V;  1S72 V;  1SF9 A;  5H6R A;  5L3E A;  2JVD A;  3BVO A;  4K8X A;  2R70 A;  1CEZ A;  1V54 B;  2UU9 O;  3KCX A;  4K0K B;  3O65 A;  3OEE G;  5JJN B;  4D7S A;  1KKC A;  3W7U A;  3NR7 A;  4PA6 A;  4NXN O;  2C2A A;  1EN6 A;  4X88 A;  3QNE A;  4FPP A;  2B9Z A;  2A0L A;  2PYJ A;  2RDC A;  2HJF C;  1VQK V;  5DEC A;  4FZ1 A;  1P7B A;  1HR0 O;  3GVM A;  1OV9 A;  4MVO A;  1VAR A;  3U0Z A;  1S5L Z;  3G4S V;  3RT3 C;  1VQ9 V;  1GN6 A;  2F1M A;  3H1K H;  1IBK O;  4X89 A;  5CBG A;  1VQ8 V;  5EIB C;  4KHP B;  4JZG A;  2F4V B;  5B1B B;  4UCS A;  5IJ0 B;  1WLE A;  2JJ1 G;  4G28 B;  5HFM A;  4AQY O;  1AJP A;  5CA0 A;  1QCE A;  3ZRS A;  1NJI W;  4KUM A;  2FML A;  3OM3 B;  5EYP A;  3L72 H;  2DJV A;  4DV2 B;  3N2G B;  2EIK C;  4U7N A;  2ZDI C;  2AGA A;  3K5O A;  4NXN B;  2YXL A;  4DO2 A;  5EZY B;  2GUZ A;  4CC6 A;  2HG5 C;  3SYA A;  3LNN A;  3QVN A;  5LGT A;  4IHJ B;  3R66 A;  4BIZ A;  2W6I G;  3DSQ A;  2ILM A;  2ITD C;  1VQM V;  2H8P C;  1QR8 A;  3CXC U;  1HR0 B;  2WLK A;  2ZKO A;  4YJ2 B;  2ZE5 A;  1S5H C;  1YF2 A;  3JAT B;  3FB6 C;  5J2U A;  2EIN C;  1VMG A;  5KHK A;  1JPX A;  1Q90 D;  4X9Q A;  3ZHS A;  2ZE8 A;  1KP3 A;  4LH6 A;  2E75 B;  4JI8 O;  4LFB O;  2EZP A;  3CME V;  4ZHQ B;  5F2V O;  1YIJ V;  5KX5 A;  3AG2 B;  3RWR D;  4AQY B;  3WB0 A;  3A0R A;  1UFI A;  4IGG A;  1MA1 A;  5JJJ B;  4DV4 B;  1OCZ C;  4G2K A;  4YJ3 B;  4PEL A;  2JS3 A;  2HLD G;  3JAM N;  3CB2 A;  1NKD A;  3VOU A;  3ABM C;  4J7J A;  1K34 A;  1EN5 A;  3ASO C;  4K8Z A;  2KQX A;  2DN9 A;  2HR3 A;  1XL4 A;  4PI0 A;  2ZD9 A;  2JRI A;  1J5E B;  4J41 A;  4GX1 A;  1GK9 A;  1N0N A;  3B4S A;  1SQG A;  5DED A;  2LQT A;  3MDS A;  4I4T A;  4GLX A;  4JI8 B;  1NH2 D;  4LFB B;  2MK3 A;  1OCC C;  3SPH A;  2ODM A;  4PA9 A;  3CC7 V;  2UUB B;  2VWK A;  3RFR A;  5CBF A;  2EIK B;  1YSC A;  1ZUQ A;  3LDE A;  2FL4 A;  5J2U B;  1JJO A;  5E1A C;  4DV5 O;  4X64 O;  2JEX A;  1URF A;  2PZS A;  2Q5Z A;  5KX5 B;  4X20 B;  5ITZ B;  4I5S A;  3W7T A;  1F4M A;  4Q6G A;  3SJQ C;  3FB5 C;  4H0L B;  2EIN B;  4P9O A;  4E2L A;  4HZ3 A;  4XDL A;  4QJF B;  5CB4 A;  3CRQ A;  3UT5 A;  3ZED A;  2BOC C;  2QM4 A;  2HVJ C;  3O9O A;  4FZ0 A;  4OX9 O;  3BAA A;  3H1I H;  2BOB C;  1XDC A;  1R3L C;  2ADP A;  2Y0P A;  4I50 A;  1M9N A;  5GON A;  4UVC A;  1BE3 H;  3W7W A;  1EFR G;  4ZBM A;  5IY5 C;  4AIL C;  4QGP A;  3CE2 A;  4J80 A;  3LSU A;  4DV5 B;  4X64 B;  3SYC A;  1K4C C;  1Z5W A;  3ABM B;  3ASO B;  3WG7 C;  4DV7 O;  1K4D C;  2Q4P A;  1WB8 A;  2X6A A;  4KXR A;  2GTS A;  2L6L A;  4I55 B;  3OT7 A;  1K73 W;  2YC0 A;  3RYC A;  1E1R G;  2NR5 A;  3L71 H;  4RUE A;  1G4Y B;  5H5N A;  3RN4 A;  1SS3 A;  1X59 A;  5C93 A;  1VEW A;  2VQF B;  1OCC B;  3FAV A;  4LF7 O;  3AG1 C;  2KG7 A;  4R7C A;  1SQX H;  4WBN B;  2HKO A;  5H2F Z;  4JI4 O;  1YTF D;  2M6Y A;  1WA8 A;  1SQF A;  2X6C A;  2FKX A;  2ZR3 A;  3JAW B;  2OCC C;  3A8T A;  1WB7 A;  5CB4 B;  3K5N A;  1NTZ H;  1AJN A;  4MVM A;  1DGS A;  4B08 A;  1K97 A;  2XAG A;  1AI5 A;  4MVZ A;  1SZX A;  1P7G A;  4DV7 B;  1EBO A;  4ZI7 B;  2P22 C;  3STZ C;  3CYO A;  4HBN A;  5LGU A;  4YHH O;  2WLL B;  4B3R O;  4J9Z B;  2HP8 A;  1F23 A;  2M7W A;  2F43 G;  4U7O A;  2ZIN A;  1N36 O;  1N33 O;  3HPL C;  4B3T O;  4G27 B;  4UB8 Z;  2G38 A;  4DV1 O;  1WAZ A;  1OCO C;  2EIJ C;  3K58 A;  4JGS A;  2IM9 A;  4RQF A;  2XND G;  2LP7 A;  5IY5 B;  4RWU A;  3H1J H;  1MSD A;  5B1A C;  1NT2 B;  3ZS8 C;  1K5Q A;  2P7T C;  3SYO A;  1ARO P;  3WG7 B;  4LH7 A;  3FAV B;  3IC9 A;  1NH2 B;  3BPZ A;  3MHH C;  4GUN A;  2P4K A;  3CCU V;  3B77 A;  4F6E A;  3ETG A;  4LFC O;  2FYU H;  1SQP H;  5LP6 A;  3ZHU A;  2ZCE A;  3UKM A;  2XUM A;  4FFB B;  1WA8 B;  2HHH B;  2Q0O C;  5KMG A;  5HFL A;  1AR5 A;  3H9V A;  1ZAU A;  4GYC B;  4YHH B;  1P4R A;  3K5M A;  1YVW A;  1PD3 A;  4GKJ B;  1S3J A;  1JR9 A;  4B3R B;  4PJ0 Z;  3AG1 B;  3ML0 A;  3P3P A;  5CMU A;  1JMK C;  3JD1 A;  1BGY H;  3D3I A;  1N36 B;  2PYL A;  1N33 B;  3E83 A;  2P90 A;  2W6J G;  3TK1 A;  4DR1 O;  4B3T B;  4FM1 A;  3RYF A;  1JOY A;  4DV1 B;  4C7U A;  5TIS Z;  2LJ2 A;  4JYA O;  1K5S A;  5JCO C;  4E4E A;  1FFX A;  4IL6 Z;  4P30 A;  2OCC B;  1L0N H;  3CRM A;  1SER A;  3QTC A;  5IWA O;  1D5N A;  3ABT A;  4J9Y B;  4KP4 A;  2WWW A;  1PNK A;  4LF6 O;  3SPJ A;  4GT1 A;  1RP3 B;  3J81 N;  1N34 O;  1Z5V A;  4DR4 O;  2K1E A;  4MTF A;  3MD0 A;  4IIJ A;  1K9M W;  3DGE A;  3K3W A;  1KYO F;  5JCO A;  2N74 A;  4LR3 A;  4NYK A;  1GN4 A;  3B09 A;  5EC2 C;  4MT8 A;  4LFC B;  2LGW A;  4PHZ A;  1DF4 A;  3CP1 A;  1P84 F;  1BSM A;  1KB9 F;  1H2L A;  3T1C A;  1IXB A;  1K92 A;  1OCO B;  1HNZ O;  2EIJ B;  2V4D A;  4DR1 B;  2CH7 B;  4QE9 A;  5AG2 A;  4DRX B;  1YXB A;  5B1A B;  3ZMT A;  4JYA B;  4O2B B;  3AG7 A;  2WAM A;  5IWA B;  3IC7 A;  2W0X A;  2YIC A;  4R6Z A;  3F7Y C;  4JAU A;  2V1D A;  3WFV A;  4LF6 B;  4EB6 A;  4DR4 B;  2W0F C;  1SA0 A;  2OIG A;  1XBL A;  2WPD G;  2PGG A;  3W7X A;  4MTG A;  5FL7 G;  3RYF B;  1KP2 A;  1PM9 A;  3P3N A;  1O9H A;  3APO A;  1FFX B;  2PTM A;  2QKS A;  4YIO A;  3P30 A;  1Y74 A;  1GRJ A;  5A9G A;  5K1P A;  4ICG A;  2CTP A;  2AXT Z;  4FLU A;  2EBO A;  3FYI B;  3R65 A;  3CXH F;  3A0H Z;  1O9G A;  2Z5U A;  1GTO A;  4BWA A;  1US6 A;  2F66 C;  2IW5 A;  2CGO A;  4FVM A;  1H8E G;  1G1X B;  4TUY B;  4GCZ A;  2YI9 A;  4OXS A;  1F7Y A;  2GV9 A;  1HWY A;  4NB5 A;  5KA5 A;  4KL1 A;  3ABU A;  3AK3 A;  4DR7 O;  1BHB A;  4B3S B;  1M93 A;  4BIU A;  1UPG A;  2BTQ A;  1PPJ H;  1PL0 A;  2QM8 A;  4GZR B;  4Q20 A;  5KHJ A;  1QNM A;  2QE7 G;  1BL8 A;  5DM6 V;  3JCU Z;  3E22 A;  3SPI A;  2WLJ A;  2ZXW C;  4DV2 O;  4JPR A;  2QEX V;  4EB6 B;  3FKS G;  5LOV B;  3D36 C;  4DV3 B;  2WLN A;  4GX5 A;  5LYJ A;  1PP9 H;  1YI2 V;  4GX0 A;  4J7K A;  2GSM B;  3BRC A;  2OTJ V;  1S5J A;  4UFZ A;  3OMN B;  4B7K A;  1NVP B;  2XOK G;  3OTF A;  3T1H O;  2MW2 B;  5LMU O;  1NR1 A;  3D36 A;  2DE0 X;  4BW9 A;  4O2A A;  4BR6 A;  4XBF A;  1EN4 A;  4FMT A;  3CCR V;  4PDL A;  4H37 A;  3I55 V;  1FD9 A;  4CC5 A;  4X1I A;  5CA1 A;  4DR7 B;  2LFR A;  3OFN G;  3RYH B;  2YEV A;  4FM2 A;  3T4Z A;  2PI5 A;  1W0J G;  5C8Y B;  2QGN A;  1JFF A;  1I5Y A;  2ZIO A;  4WFA V;  3ZHQ A;  2ZQM A;  1AR1 B;  4N21 A;  4DV4 O;  1YEW A;  2P5O A;  4JTC B;  2DYS C;  2EIM C;  2PY5 A;  5L3C A;  1Q8I A;  3M8A A;  2JK5 C;  2NLJ C;  2DYR C;  1Y6X A;  2Q6A A;  4I0X A;  5GTH Z;  3FX7 A;  1RPR A;  5J9P C;  5EBM C;  3E8H A;  1NR7 A;  1Q6I A;  3UO3 A;  3E35 A;  3TGU H;  4K35 A;  4WFB V;  4TWK A;  3CC2 V;  3J80 N;  4IYH A;  3T1H B;  2Z0A A;  3E22 B;  1J5E O;  4PA3 A;  5LMU B;  3VQY A;  2ITC C;  1GKF A;  1XHZ A;  3CCM V;  5J2T A;  4D7T A;  2DQ3 A;  3G67 A;  3K08 A;  4FK5 C;  3UCS C;  2UUC O;  1AVM A;  2CK3 G;  4MS2 A;  4CH5 A;  5IT9 N;  4FLV A;  2R9A A;  2A7W A;  2UUB O;  2ZXW B;  1VQ5 V;  4TQF A;  1GO3 F;  2VRZ A;  4O2A B;  3CD6 V;  4Z2W A;  5JWP A;  3ABK C;  5IJ9 A;  4P9P A;  1ZSP A;  1JJ2 U;  1GN3 A;  4EFE A;  5CA1 B;  4JI1 O;  3B40 A;  2Q68 A;  1QQC A;  2CE4 A;  5CA0 B;  1F51 A;  4A5U B;  3OW2 U;  3F5W C;  4WCE V;  1SZT A;  2P6J A;  1R6K A;  5EYP B;  3RYI A;  2D2C B;  3N2K A;  4LCU C;  5BXZ A;  2QTS A;  4U3F H;  1SES A;  1NU1 H;  4RO2 A;  3PN1 A;  4EEQ A;  3GB7 C;  4KFM A;  2GUZ B;  4QIW F;  1LUW A;  5JH7 A;  1MNG A;  1GN2 A;  2UUC B;  1BMF G;  2YDE A;  2UXD O;  3M99 B;  4CH3 A;  2DYS B;  1D2D A;  2EIM B;  2ARH A;  3TJT A;  1GM8 A;  2O57 A;  1H38 A;  2KSD A;  1VQP V;  3SYQ A;  2IJI A;  2DYR B;  3E86 A;  1R6T A;  4ASU G;  3OEH G;  5J2T B;  3RBZ A;  1KU9 A;  3T4D A;  1IBM O;  4JYY A;  2JS5 A;  2BE3 A;  5JVD A;  1XMO O;  2IU3 A;  4HNA A;  1QVF U;  1KUQ A;  4JI1 B;  1S0V A;  1CP9 A;  4CZZ A;  2QWO B;  2IH3 C;  3OUF A;  1FFT B;  2LO1 A;  1KMI Z;  2DWE C;  2DWD C;  3QO5 A;  4WF9 V;  2Q73 A;  3ZHT A;  5IJ9 B;  3JD0 A;  1HP8 A;  1Q6U A;  3JSN A;  2VQF O;  1J95 A;  1SC5 B;  2K9P A;  2AZ2 A;  1IDS A;  2QKC A;  1SQB H;  1G6U A;  2XHB A;  2CDY A;  3D8C A;  1NI8 A;  1TVK A;  1V9P A;  3B8N A;  4DUZ O;  2UXD B;  1R73 A;  1OCZ B;  1ZTE A;  1ZLZ A;  3HKC A;  3ABK B;  4MSW C;  5CA3 A;  1VQN V;  4X66 O;  2ZT9 B;  3E8F A;  3AG4 C;  1LR1 A;  4I7Z B;  2LW7 A;  5KHG A;  5KUM A;  4X65 O;  3HB3 B;  3ICX A;  3F5T A;  1AI4 A;  4L87 A;  3RW0 A;  2NNU A;  2YSU B;  1YJN V;  5EBL C;  4I4T B;  4B3M O;  1CXZ B;  1IBM B;  1XMO B;  1DF5 A;  1RM1 C;  3KCY A;  4U3J A;  2VQE B;  3JD3 A;  2IJK A;  5EBW C;  1QR9 A;  1T5E A;  1XOU A;  5GW7 A;  4TT3 G;  3I5D A;  1LUV A;  3U10 A;  4O4L A;  3ZRV A;  4DW0 A;  4PV1 B;  3JAK A;  3UQ8 A;  2L35 A;  2ZM6 O;  3B2E E;  2OCH A;  3ZN0 A;  4QPJ A;  1M4U A;  1OCR C;  3OUS A;  4DXW A;  4JYC A;  2Z3Y A;  2HJD A;  4BW5 A;  1Q86 W;  3WB1 A;  4H33 A;  4DUZ B;  5KA6 A;  1M56 C;  4MVQ A;  4I9Q A;  5LL6 Y;  4X66 B;  2RMK B;  1XNQ B;  4J7Z A;  2XT9 A;  1QLN A;  3UT5 B;  1MSW D;  3L74 H;  4DR3 B;  4JF3 A;  5KUK A;  4X65 B;  2QSA A;  4RUF A;  3K79 A;  4UB6 Z;  4B3M B;  1HDJ A;  1Y66 A;  2BCC H;  1TAE A;  4AI8 A;  1TVK B;  1Q3E A;  1FPO A;  1K8A W;  3LDC A;  1Q43 A;  3OAA G;  1GM9 A;  1WJZ A;  3X2Q C;  4GKK O;  1M90 W;  2EJR A;  1QLE C;  4NR1 A;  2WA4 A;  3S3W A;  4I50 B;  2HHH O;  1QU7 A;  4FLY A;  5GON B;  3RGB A;  5KHH A;  3FB8 C;  2R9R B;  3CRR A;  4GKJ O;  2V7Q G;  3VQW A;  1IZ3 A;  2ZM6 B;  2EX3 A;  2F93 B;  1PV0 A;  4U3J B;  2QJ1 A;  4IYI A;  4UVA A;  1D5A A;  3EFF K;  3HKE A;  3L9D A;  4YY3 O;  1SQV H;  3C3T A;  3G80 A;  1SKV A;  3AG4 B;  2LW1 A;  4O4L B;  1Z2G A;  3CJH A;  2YIB D;  3JCZ A;  4UCR A;  1L8D A;  3HR0 A;  3ZN1 A;  3RYC B;  5LP6 C;  2IU0 A;  5JQG A;  2OIE A;  1YCI A;  5B5E Z;  3JAL A;  2GHY A;  1RM1 B;  4NVP A;  3K59 A;  2PF4 E;  4FLW A;  1OJH A;  2QWP B;  2KG7 B;  2RQ6 A;  3MAQ A;  1ZX3 A;  2ZE7 A;  3ETQ A;  4JAA A;  4GKK B;  4B7E A;  2QKA A;  4UUJ C;  1THZ A;  3K04 A;  4FLX A;  4DV6 O;  1OCR B;  3G6B A;  1CPY A;  3EXA A;  3E8G A;  1U97 A;  1JX9 A;  3UO2 A;  3KG2 A;  2CTQ A;  5L3F A;  1JVM A;  2RNB A;  5KAI Z;  1B6Q A;  4BAY A;  1NZ6 A;  2UXB O;  1M56 B;  1YIT V;  5LGN A;  1AR4 A;  3A2F A;  4LWS A;  2X6B A;  3BA9 A;  4YY3 B;  4X1Y A;  4LNU A;  4J11 A;  4OPH A;  4X8A A;  2DMX A;  2WLI A;  1VF7 A;  3CRC A;  1PNL A;  3ZX6 A;  5LHI A;  4FM0 A;  4QE7 A;  3X2Q B;  1QLE B;  1JQ0 A;  2N04 A;  1DK1 A;  5K1X A;  3HKE B;  3GWO A;  1FJG O;  1S77 D;  1TA8 A;  4W4L A;  5JQG B;  4DV6 B;  1I94 O;  3JAL B;  4JAS A;  1AI6 A;  3ZCC A;  3ZHV A;  2Q7G A;  2Y4T A;  3W7S A;  2YXH A;  2XTA A;  1VF5 B;  2Y48 A;  4CH4 A;  2D3O W;  2Q8V A;  4H13 B;  5CN0 A;  1R6N A;  3TET A;  1EM1 A;  2UXB B;  3OTO B;  1HNW O;  5LHH A;  3SPG A;  5EC1 C;  5LP6 B;  2GTA A;  1N4C A;  4O4I A;  2Q9L A;  4ZOL A;  2JGU A;  1ENV A;  4LC1 A;  5KMG B;  4TV8 A;  2YIB A;  1JA8 A;  2JDI G;  2WSS G;  2PUS A;  2Y0I A;  3ETE A;  3ZMV A;  2WA3 A;  1WPB A;  2R9I A;  1H8H G;  2EUL A;  4JYB A;  1AI7 A;  1WP7 A;  1VF6 A;  4B3S O;  1VQO V;  4MTX A;  4O4H A;  2UXX A;  3DXR A;  3K5L A;  4OGQ B;  2R72 A;  1NBM G;  5IYZ A;  3CCV V;  3JYC A;  1YTF B;  2KB1 A;  3C3S A;  1Y4M A;  3OGC C;  1BCC H;  3SPC A;  2JEU A;  3H1L H;  1FJG B;  2FTK A;  4FLT A;  1I94 B;  3ZMZ A;  1K33 A;  3SDL A;  4IIJ B;  4DV3 O;  1VQL V;  2EIL C;  1COW G;  5IYB O;  1OHH G;  2E5L O;  1IUR A;  3JAR A;  3ZBH A;  2WLM A;  3IAY A;  3KZI Z;  1WP8 A;  2CTR A;  4DR6 B;  2A3Q A;  1HNW B;  1K3E A;  5EIB D;  1VQ6 V;  1N8R W;  1M1K W;  1SRY A;  1N32 O;  1M57 C;  3ZMS A;  4UVB A;  1YHQ V;  4LP8 A;  5IJ0 A;  1I5X A;  2UXC O;  3BEH A;  2LGQ A;  1KEC A;  3VQX A;  2KKW A;  1XQ8 A;  3BHP A;  3SR2 C;  3P32 A;  1QVG U;  4L8J A;  1XRE A;  2CUG A;  4TV9 A;  4UV8 A;  3BA8 A;  4LF4 O;  4O4I B;  2UUA B;  3ZIA G;  3N2G A;  5B1O A;  2HVK C;  2RN9 A;  2AW9 A;  3I56 V;  1SA0 B;  4IHJ A;  2VWJ A;  3T1Y O;  4N23 A;  4O4H B;  5L3D A;  2E5L B;  3DXR B;  4UXN A;  4EFB A;  1Q81 W;  3BFR A;  3B8M A;  4DUY B;  1V55 C;  4P2Z A;  5JJE B;  3AG2 C;  5IYZ B;  1XI1 A;  4YJ2 A;  2CGN A;  4JI0 O;  1WN7 A;  2F23 A;  2H3O A;  3JAT A;  1Y74 B;  3CRA A;  5A2Q N;  4EKW A;  3KKY A;  2XAH A;  1N32 B;  3OE7 G;  3ETD A;  4PDR A;  1MZE A;  1DTO A;  1R1B A;  1L0L H;  3DC5 A;  3HKB A;  4W4K A;  4ZHQ A;  2UXC B;  3JAR B;  1TUB A;  1H2M A;  1M5I A;  1G8M A;  1NQT A;  2YI8 A;  1Q82 W;  3Q4H A;  4UCO A;  4D6T H;  3JSL A;  3CCJ V;  4LF4 B;  1NS1 A;  4J10 A;  4YJ3 A;  3L73 H;  4X1K A;  2EIL B;  1YJ9 V;  4BIO A;  5GTI Z;  5IE9 A;  1W59 A;  3BAB A;  4WFH A;  2DW4 A;  3LSS A;  1TUE B;  3TXS A;  1FYJ A;  2UXN A;  2IBZ H;  3ASN C;  3T1Y B;  3CCQ V;  1Q6H A;  2P67 A;  4R8C A;  2BTQ B;  2UU9 B;  4TV9 B;  1M57 B;  4UCT A;  1IX9 A;  1H2S B;  4DV0 O;  4JI0 B;  4HYO A;  3G71 V;  1KBH A;  2N05 A;  4GX2 A;  2BSK A;  1GH6 A;  1PNM A;  5D5P A;  3K57 A;  3CWB H;  1BQZ A;  3E2E A;  2ZE6 A;  5LYJ B;  1B04 A; 
#chains in the Genus database with same CATH homology
 3AG4 C;  3B77 A;  3ETG A;  4MW3 A;  5KUM A;  4MVR A;  3HB3 B;  4L87 A;  3UKM A;  1AI4 A;  3K06 A;  2ZDI A;  3RW0 A;  5DN6 G;  2NNU A;  1GM7 A;  2YSU B;  1YJN V;  5EBL C;  2AHY A;  5HFL A;  1DF5 A;  3E89 A;  1RM1 C;  3SYP A;  5EK0 A;  1P4R A;  3JD3 A;  4MVS A;  1PD3 A;  1S3J A;  2IJK A;  5EBW C;  1QR9 A;  3AG1 B;  3ML0 A;  2B1I A;  2HFE C;  5CMU A;  5GW7 A;  1S76 D;  4RQE A;  3JD1 A;  3D3I A;  4TT3 G;  1W2B U;  3E83 A;  2P90 A;  2W6J G;  3TK1 A;  3ZJZ A;  2A79 B;  1V55 B;  3ZRV A;  3CCE V;  1JOY A;  3K0G A;  2YEV B;  1K5S A;  1DLB A;  1FXK C;  3VBB A;  1OZ0 A;  4P30 A;  3ZN0 A;  2OCC B;  2Q69 A;  4QPJ A;  1PKX A;  1SER A;  3QO7 A;  1OCR C;  3OUS A;  4DXW A;  3CCS V;  3ABT A;  1S72 V;  4J9Y B;  5H6R A;  4KP4 A;  4JYC A;  2WWW A;  5L3E A;  1PNK A;  2Z3Y A;  3SPJ A;  4GT1 A;  4BW5 A;  4TSF G;  2K1E A;  4MTF A;  1CEZ A;  1V54 B;  3MD0 A;  1Q86 W;  4H33 A;  1GMG A;  1K9M W;  4LBE C;  2B1G A;  3OEE G;  4QPK A;  5KA6 A;  2PI4 A;  1KQS U;  3DGE A;  1M56 C;  3K3W A;  4MVQ A;  1FXK A;  3W7U A;  4PDM A;  4PA6 A;  2C2A A;  1QLN A;  4X88 A;  3QNE A;  1MG1 A;  5EC2 C;  1MSW D;  4MT8 A;  4FPP A;  1DF4 A;  4JF3 A;  3CP1 A;  5KUK A;  4RUF A;  3DTU B;  3K79 A;  2A0L A;  3T1C A;  1VQ4 V;  2JIZ G;  1Y66 A;  1VQ7 V;  2HJF C;  1VQK V;  1K8A W;  3FB7 C;  3IGA C;  3LDC A;  1P7B A;  3OAA G;  1K92 A;  1GM9 A;  1MAB G;  4JAV A;  3X2Q C;  2QTO A;  1M90 W;  2EJR A;  3ASN B;  1QLE C;  4MVO A;  3G4S V;  1OCO B;  2EIJ B;  3H01 A;  2XAS A;  1VQ9 V;  3FB8 C;  2R9R B;  4QE9 A;  4X89 A;  2LFS A;  5CBG A;  1VQ8 V;  4MW8 A;  5B1A B;  2V7Q G;  3ZMT A;  4UV9 A;  5B1B B;  3CC4 V;  2WAM A;  3IC7 A;  1WLE A;  2JJ1 G;  4G28 B;  3K9A A;  5HFM A;  4Z1M G;  1BHA A;  4R6Z A;  3OMA B;  3F7Y C;  4JAU A;  1AJP A;  2V1D A;  1QCE A;  3LDD A;  4UVA A;  3WFV A;  1QBZ A;  3EFF K;  3G6E V;  3ZRS A;  2W0F C;  2XAF A;  1NJI W;  4KUM A;  3OM3 B;  1ZWI C;  3ZRW A;  3AG4 B;  2WPD G;  3W7X A;  4MTG A;  5FL7 G;  1KP2 A;  2X7R B;  3JCZ A;  3ZN1 A;  2EIK C;  2IU0 A;  2DQ0 A;  4U7N A;  2ZDI C;  3BY6 A;  2GHY A;  4DO2 A;  1RM1 B;  2QKS A;  2Y69 C;  3P30 A;  2HG5 C;  3SYA A;  3OR6 C;  2B5U A;  4FJC C;  5LGT A;  1FS0 G;  4BIZ A;  2W6I G;  4PA4 A;  2ITD C;  1VQM V;  2H8P C;  1QR8 A;  3CXC U;  5L3G A;  2WLK A;  2EBO A;  1S5H C;  4UUJ C;  1THZ A;  1FXK B;  3K04 A;  1KD1 W;  3FYI B;  3R65 A;  3PJS K;  3ZRX A;  3FB6 C;  3OR7 C;  1KKD A;  1OCR B;  2EIN C;  2Z5U A;  1CPY A;  1JPX A;  1GTO A;  3E8G A;  2Q67 A;  1JX9 A;  1KP3 A;  3KG2 A;  2WLL A;  2EZO A;  2QA4 V;  2EZP A;  2IW5 A;  5L3F A;  1JVM A;  4WFE A;  3CME V;  1YIJ V;  1B6Q A;  4BAY A;  3AG2 B;  1H8E G;  1M56 B;  5IYC O;  1YIT V;  4GCZ A;  5LGN A;  2WLH A;  3A0R A;  4OXS A;  2XAJ A;  2X6B A;  1FXV A;  2AHZ A;  3RVY A;  1HWY A;  1XL6 A;  3AG3 C;  5KA5 A;  3ABU A;  1BHB A;  4BIU A;  1OCZ C;  4G2K A;  5IYD O;  4X8A A;  3JD4 A;  2WLI A;  5IDJ A;  4PEL A;  2HLD G;  1PL0 A;  1PNL A;  2QM8 A;  5LHI A;  4Q20 A;  2QE7 G;  3LSQ A;  4QE7 A;  4HAM A;  1BL8 A;  3AEI A;  5DM6 V;  3X2Q B;  3SPI A;  2WLJ A;  2ZXW C;  1QLE B;  1JQ0 A;  4JPR A;  2QEX V;  1NKD A;  4RAI A;  3VOU A;  3FKS G;  3ABM C;  4JTD B;  1K34 A;  1W0K G;  3ASO C;  2WLN A;  4GX5 A;  3ZRW B;  1SET A;  3K0D A;  2HR3 A;  4MVU A;  3ZMU A;  1XL4 A;  1YI2 V;  2ZD9 A;  3GWO A;  3JD2 A;  4GX0 A;  1S77 D;  4GX1 A;  2GSM B;  2OTJ V;  4JAS A;  1GK9 A;  1AI6 A;  3OMN B;  3ZCC A;  1NVP B;  2XOK G;  3K03 A;  3W7S A;  1NH2 D;  1NR1 A;  3D36 A;  2Y48 A;  2MK3 A;  1OCC C;  3SPH A;  2D3O W;  5CN0 A;  1AJQ A;  1R6N A;  3TET A;  4PA9 A;  3ABL C;  3CC7 V;  4XBF A;  5LHH A;  3SPG A;  5CBF A;  2EIK B;  5EC1 C;  4FMT A;  4FIP C;  3CCR V;  3FYE B;  4PDL A;  1YSC A;  4H37 A;  3I55 V;  1YJW V;  1ENV A;  4LC1 A;  2LFR A;  3OFN G;  3LDE A;  2JDI G;  2YEV A;  2Y69 B;  3T4Z A;  2PI5 A;  1W0J G;  2WSS G;  5E1A C;  3ETE A;  1I5Y A;  3ZMV A;  4WFA V;  2ZQM A;  2R9I A;  1AR1 B;  1H8H G;  3LNM B;  4N21 A;  4JYB A;  1AI7 A;  5BZB A;  5LHG A;  2JEX A;  4JTC B;  5B1N A;  5CBH A;  4MTX A;  1VQO V;  2DYS C;  1ORQ C;  2UXX A;  4MTO A;  2EIM C;  1LNQ A;  4I5S A;  3W7T A;  1F4M A;  1E79 G;  3CMA V;  5L3C A;  2JK5 C;  2NLJ C;  1NBM G;  3CCV V;  4R50 A;  3JYC A;  2DYR C;  3FB5 C;  3SJQ C;  2Q6A A;  2KB1 A;  1YTF B;  1RPR A;  2EIN B;  5J9P C;  1Y4M A;  4P9O A;  4E2L A;  4HZ3 A;  3OGC C;  5EBM C;  4XDL A;  3SPC A;  2JEU A;  4QJF B;  1K7D A;  3E8H A;  4PA7 A;  1NR7 A;  2FTK A;  4WFF A;  2BOC C;  3IFX A;  3ZMZ A;  1K33 A;  2ZR2 A;  3E35 A;  4WFB V;  5LBQ A;  1VQL V;  2HVJ C;  2EIL C;  4TWK A;  3CC2 V;  1COW G;  5IYB O;  1OHH G;  4PA3 A;  3AG3 B;  4PDV A;  2ITC C;  2WLM A;  1GKF A;  2BOB C;  3CCM V;  1RPO A;  3UM7 A;  1R3L C;  1WPX A;  2DQ3 A;  1M9N A;  1K3E A;  3K08 A;  1VQ6 V;  4FK5 C;  4UVC A;  1N8R W;  1M1K W;  1SRY A;  3W7W A;  2CK3 G;  1EFR G;  3MHS C;  4ZBM A;  1JCH A;  5IY5 C;  1M57 C;  4MS2 A;  2OT5 A;  4UVB A;  4WFG A;  3ZMS A;  1YHQ V;  1NVP D;  5L3B A;  4XDK A;  4LP8 A;  2ZXW B;  1I5X A;  1VQ5 V;  3SYC A;  1K4C C;  3ABM B;  3BEH A;  1GO3 F;  1KEC A;  3ASO B;  3LUT B;  3WG7 C;  2OTL V;  3CD6 V;  1K4D C;  2JJ2 G;  3ABK C;  5B3S C;  3P32 A;  4P9P A;  2X6A A;  1QVG U;  4UV8 A;  1R3J C;  1JJ2 U;  1K73 W;  3ZIA G;  1E1R G;  1H2G A;  4RUE A;  2Q68 A;  1G4Y B;  1IXM A;  5B1O A;  3NXS A;  1F51 A;  5C93 A;  2HVK C;  3OW2 U;  3F5W C;  4WCE V;  1OCC B;  3I56 V;  1SZT A;  2P6J A;  1KC8 W;  3ABL B;  1R6K A;  3CCL V;  3AG1 C;  4N23 A;  3CPW U;  4LCU C;  5L3D A;  3RVZ A;  3EHB B;  4UXN A;  1Q81 W;  4R7C A;  3B8M A;  4I9W A;  1SES A;  1V55 C;  4P2Z A;  2HKO A;  3AG2 C;  1YTF D;  4RO2 A;  3GB7 C;  4KFM A;  4QIW F;  2X6C A;  2ZR3 A;  2OCC C;  4XDJ A;  4EKW A;  2XAH A;  1AJN A;  1BMF G;  3OE7 G;  4MVM A;  3ETD A;  3M99 B;  1K97 A;  2DYS B;  4PDR A;  2XAG A;  1DTO A;  2EIM B;  1AI5 A;  1F4N A;  1V54 C;  1GM8 A;  1L1F A;  1H38 A;  4MVZ A;  1VQP V;  3SYQ A;  2IJI A;  2QM7 A;  2DYR B;  1G8M A;  3E86 A;  4ASU G;  1EBO A;  3STL C;  1NQT A;  4CBC A;  3OEH G;  1R3I C;  5H9C A;  3RBZ A;  5H6Q A;  1E1Q G;  4YXW G;  3T4D A;  1Q82 W;  3STZ C;  3CYO A;  2IJJ A;  2IU3 A;  2XAQ A;  3CCJ V;  2X0L A;  5LGU A;  1QVF U;  2H94 A;  2WLL B;  1R3K C;  2IH1 C;  1S0V A;  1CP9 A;  4CZZ A;  4J9Z B;  2EIL B;  1YJ9 V;  1F23 A;  1ROP A;  2IH3 C;  2M7W A;  1EZJ A;  1FFT B;  2F43 G;  3OUF A;  4WFH A;  3TCU A;  4U7O A;  2DW4 A;  3LSS A;  1TUE B;  4F4L A;  4ZKI A;  3OMI B;  1MOF A;  3HPL C;  3F7V C;  4G27 B;  1UJW B;  2UXN A;  2DWE C;  2DWD C;  3QO5 A;  3ASN C;  4WF9 V;  3CCQ V;  1OCO C;  3E8B A;  2EIJ C;  2P67 A;  4JGS A;  4R8C A;  2WLI B;  3JD0 A;  4RQF A;  2XND G;  4JTA B;  2LP7 A;  1J95 A;  2IJH A;  5IY5 B;  1M57 B;  1FXH A;  2ATK C;  5B1A C;  2A9H A;  4HYO A;  5B1B C;  1K5Q A;  3G71 V;  2P7T C;  4GX2 A;  3SYO A;  3B8N A;  1PNM A;  1ARO P;  1R73 A;  3WG7 B;  1OCZ B;  1Q7Y W;  3T2M A;  3E2E A;  3ABK B;  4MSW C;  5CA3 A;  1VQN V;  5B3S B;  4QNH B;  3QO8 A;  3E8F A;  1NH2 B;  3MHH C;  3CCU V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...