3T1CA

Crystal structure of nak channel d66y mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 36
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3t1cA00
4PA4A 4XDJA 3HPLC 3BEHA 3FB5C 3VOUA 3SPCA 3K04A 3E8GA 3K08A 3E83A 4BW5A 3SPJA 2EIKC 1ORQC 4PA3A 2K1EA 3STLC 3AG2C 2WLIB 2A79B 4WFEA 3E89A 3RW0A 1G4YB 3RVZA 3SPHA 5CBFA 5EK0A 3SYPA 3AG1C 3UKMA 2IH3C 3UM7A 4F4LA 3T4DA 3E86A 4J9YB 3E8FA 4UUJC 4HZ3A 4HYOA 4RAIA 2WLMA 2Q67A 2A0LA 3LNMB 3AG4C 3T4ZA 3SJQC 2HVKC 3ABKC 3ASNC 4MS2A 4GX5A 4PDRA 2Q68A 3SPGA 2WLKA 2DYSC 4JTDB 3KG2A 4P2ZA 2IH1C 3LDCA 4MTOA 1M56C 3LDDA 4H37A 2WLIA 4MVOA 1J95A 4PDLA 1R3JC 4MSWC 2Q6AA 1ZWIC 4MVSA 4CBCA 3AG3C 2KB1A 4DXWA 4P9PA 2H8PC 4J9ZB 1R3IC 1XL6A 3K03A 4WFGA 1R3KC 3STZC 5E1AC 1OCOC 2A9HA 2HJFC 1OCCC 4GX0A 2HVJC 5BZBA 3ABMC 3RBZA 3ASOC 3PJSK 4I9WA 4RUEA 5EBWC 4MTFA 5KUKA 4KFMA 2YEVA 3OR6C 4PA9A 2EIJC 4G28B 4R50A 2ZXWC 3TCUA 3FB6C 3FB7C 4PDVA 3LDEA 4LCUC 3SPIA 3SYOA 3T2MA 1KKDA 2EINC 4QE7A 4WFFA 2EIMC 3IGAC 3OUFA 2WLLB 3K0DA 4PA7A 4EKWA 3LUTB 4MVQA 2QKSA 3TETA 4XDKA 5EBLC 3OUSA 3JYCA 2HG5C 3SYCA 4R8CA 2DWEC 4TWKA 3EFFK 2BOBC 4PDMA 5EC2C 2P7TC 3K0GA 3R65A 4MTGA 3FB8C 4JTAB 4P9OA 5EBMC 2EILC 4X89A 4MW3A 4MVRA 4PA6A 4GX2A 2WLJA 4GX1A 3SYAA 4R6ZA 1XL4A 1K4DC 2ZD9A 3ZJZA 1QLEC 2BOCC 2Q69A 1LNQA 4RUFA 3RVYA 3F5WC 4P30A 5IY5C 2QTOA 4H33A 3F7VC 2WLNA 3F7YC 2X6BA 4MVUA 3T1CA 3OR7C 2Y69C 3ABLC 5B3SC 2AHZA 3IFXA 5CBGA 2ATKC 5B1AC 5B1BC 4WFHA 1M57C 2X6AA 1JVMA 2R9RB 2ITCC 1K4CC 4MVZA 4MW8A 1OCZC 3X2QC 4LP8A 2AHYA 2X6CA 4QNHB 4G27B 1P7BA 3E8BA 2W0FC 4JTCB 1V55C 1BL8A 4X88A 4MVMA 3K06A 3E8HA 4QE9A 4R7CA 3ZRSA 2NLJC 4X8AA 1V54C 2ITDC 2WLHA 2WLLA 4XDLA 1S5HC 2DYRC 3GB7C 2OCCC 4LBEC 5CBHA 5EC1C 1R3LC 2HFEC 4RO2A 2JK5C 4OXSA 2DWDC 3OGCC 3WG7C 1OCRC 3SYQA 4ZBMA 5J9PC 5KUMA
chains in the Genus database with same CATH superfamily
1H2KA 1D5AA 2BSKA 4FLWA 3RYHA 1PL0A 2LQTA 1ZAUA 3CMEV 5HFLA 4KUMA 4LF4B 5JH7B 2IH3C 4BIOA 2GTAA 4KHPO 2O57A 3TJTA 2CGNA 3JAKB 1IXBA 1M57B 3KG2A 4GLXA 2XTAA 4PDLA 4CZZA 1H2GA 3AG3C 4RQFA 2UUBO 1R3KC 3LSQA 1BT8A 1L8DA 2ZDIA 1YDXA 3BABA 4FK5C 3ZHTA 1TUEB 2OCCB 2N74A 3AK2A 3OFNG 4TQFA 5KLVH 4X64O 4DR4O 3J7AU 3FB7C 1NT2B 3CCRV 1GTOA 4LFBO 4JI5B 2ZT9B 3ZCCA 1BS3A 3CC7V 2ZM6B 1XOUA 2ZQMA 1FXKB 1ZTEA 5IE9A 3U10A 3W7WA 1U96A 4MVRA 1XREA 5IJ0B 1I5XA 3OW2U 1QBZA 1XHXA 2FMLA 1ZSPA 4X66O 4B3SB 1H38A 2Y0PA 4N21A 1RPOA 4PI0A 5KX5B 3BCCH 1XI1A 1VQNV 4CH4A 1YJWV 1M57C 2X6AA 4F6RB 1E1RG 2ITCC 5EZYA 2A7WA 1ZL8A 4D6TH 1J5EB 2BSKB 2L35A 2DMXA 1DF5A 2EINB 2Q0OC 4KXRA 3ZRSA 3G6EV 4JI3O 3JATB 2OCCC 2W6JG 1K33A 1XDCA 1YTFB 4BAYA 2JK5C 1KKCA 1OV9A 1BSMA 1VF7A 1BHAA 1JFFA 3JD4A 4PA4A 2A3QA 1EN6A 1I5YA 1L1FA 5JJEB 3M7MX 1GH6A 4JZGA 1K5QA 4FLUA 5J2TA 1VQPV 5CBFA 3OGIB 3CSXA 2UXBO 4HZ3A 3ABLB 4IIJB 2GUZA 1GRJA 4PI2A 1N0NA 1HNZB 3LDDA 4DV7O 4MSWC 4DXWA 1HNWB 1IBKO 5KA5A 2QM4A 3FAVA 1GMGA 3JD2A 3T1YB 1SESA 2EINC 1QCEA 3FFQA 3L75H 1E1QG 2MW2B 4DR6B 1XHZA 1RP3B 2HG5C 1R6KA 3OEHG 3OT7A 5A2QN 5JVDB 1SF9A 4JZ2A 1X59A 3TK1A 5BR8B 4PA6A 4IYHA 2HJDA 2V4DA 4K3AA 1ZL8B 1NTMH 5KHJA 2P4KA 1V9PA 4JYCA 3ABLC 2ATKC 4U7OA 4EB6A 3CP1A 1BZKA 4AILC 4JTCB 4UXNA 2X0LA 3K5OA 3RN4A 1BL8A 1VQKV 5J2TB 3QO5A 4TQDA 3CXCU 4X8AA 3CCLV 3ASNB 2KSDA 3OGCC 1P7GA 3N2GA 2XAJA 2Z0AA 2GV9A 3D3IA 2G38A 1XNRB 1FYJA 4FPPA 4H44B 4X1IA 4LF7O 2YS8A 2IJKA 1XEQA 2L6LA 5E79Z 1NTZH 2DQ3A 5AG2A 4KL1A 3FAVB 4GX5A 4H0LB 5H2FZ 3N2KB 1HP8A 3B40A 1NVPB 5JQGA 2X7RB 3QVNA 2KB1A 1EN5A 4ZOLA 3FYEB 3SJAC 2NNUA 3ZN0A 1QR9A 4UCRA 5GTIZ 1VQMV 3OUFA 3IGAC 2QM7A 3CEIA 4DV6B 2OT5A 3W7TA 1US6A 3VQWA 1HNXO 1Q8IA 3TXSA 1FJGO 2H3OA 4PELA 3ZHQA 4EB6B 4DR5B 2UUBB 1FFXB 1EZJA 4CH5A 5GTHZ 1A32A 2XAFA 3IJ4A 4LR3A 1RM1B 4DR4B 4X64B 3RVYA 2AW9A 1S5JA 3I55V 4GKJO 1H2LA 4ZIBA 4WBNA 1R6TA 4UVBA 2PYJA 1TVKB 2Q0AA 1VF6A 4BW9A 5L3GA 2CTRA 2YIDA 1KECA 2X6CA 3K9AA 1QVGU 3OM3B 5B1NA 4X1IB 2HR3A 4DR1B 2AGAA 4OX9B 3E2EA 3K06A 1FAFA 1OJHA 2P22C 3QO7A 1W2BU 1XNQB 4JI6B 4NB5A 4LBEC 4Z2WA 1SQQH 2DWDC 1CPYA 2JIZG 4UFZA 4N23A 1VQ5V 1JJOA 5KHGA 4GKKO 2JVDA 2E3CA 1VP7A 3RT3C 1H2SB 2KG7A 4CS3A 4K0KB 3E89A 3RW0A 3ZMZA 2UU9B 4WCEV 3MHHC 3MAQA 1W59A 5TISZ 4DYLA 1N33O 3H1JH 2CGOA 2UXCB 5LMUB 4JI3B 2E74B 3JASA 5C8YA 1VEWA 3CX5F 4O4JA 5CBHA 3L9DA 1NBMG 4X62O 3DC6A 2E5LB 1XL6A 4CS4A 4PHZA 4X1KB 2QWRB 2DJVA 1JR9A 4YIPA 1AVMA 2QGNA 3PJSK 4JI0O 3FYIB 3P30A 1EBOA 3OR6C 4DRXA 5LGNA 2ZNIA 3TCUA 5CA3A 1IURA 3SPIA 1KKDA 2R9IA 5CB4B 2XOKG 3ZMUA 2VWKA 3JAWA 5LHIA 3OAAG 4NXNB 4YHHO 2Q7HA 2XAGA 3FB8C 3QO8A 4G2KA 1JX9A 3KCXA 4GYCB 1AR4A 4NVPA 4DUZB 4DV5B 3JAMN 2FTKA 5LMNO 4JAVA 1YSCA 1YTFD 2YIBA 1DK1A 1WPBA 5LA6A 1TGOA 3CCMV 2XHBA 5CBGA 2RJZA 4UVAA 4BIZA 3K57A 4CH3A 1K4CC 3Q4HB 3U11A 3G71V 1AI5A 2QE7G 5JJJB 2BTQA 2MK3A 5D5PA 4J11A 2FB5A 3IC7A 4OPAA 3OE7G 1JCHA 1WP7A 2Q8VA 4CH6A 1G8MA 5J9PC 1JPXA 5LGTA 3VOUA 4O4IB 3K08A 4X9QA 4NKGB 3CWBH 1Y66A 4WFEA 1AR5A 1G4YB 3ZN1A 2ZKOA 5IYCO 4U3FH 4JF3A 3ZHUA 2Q7EA 3A8TA 4J9YB 3JCZA 3JD0A 2WLMA 4DRXB 4FMTA 5B3SB 2YUAA 4FFKA 4JI1O 1YITV 4LF9O 4FFBA 1SZXA 1KYOF 2KKWA 1ZWIC 1H2MA 4Z1VA 4NXMO 3DC5A 2HJFC 5BZBA 1KP2A 5IYBO 5JWPA 4JI4B 1GN3A 4KFMA 4ZHQB 4JI7O 3HKCA 4BR6A 4R50A 3L70H 1BCCH 3K5LA 4QE7A 2OIGA 4MTXA 1K3EA 4LF6O 3UT5B 2DWEC 5LA6B 1JJ2U 3JD3A 5EBMC 3AK3A 4FVMA 3EHBB 1W0JG 2UUCB 5JH7A 2ZD9A 3HKEB 2CK3G 1KU9A 1LR1A 1M56B 3H9VA 1SC5B 1URFA 3OMNB 4B3TB 2PY5A 1IBLB 5B3SC 4YJ3A 4AQYO 5IWAO 2F43G 1QVFU 2QJ1A 1S72V 4CS2A 3OEEG 3ML0A 3FKSG 5J2UA 3SDLA 3HKDA 4J42A 4TV8B 1S5LZ 1S5HC 1F51A 2LGWA 4RO2A 2HHHO 2ODMA 2Y0IA 2VQFB 1VQ6V 1NTKH 1NVPD 1N34O 2RMKB 1M93A 3NXSA 4FFBB 4DR7O 5IJ0A 3ETQA 3HB3B 2YICA 3CXHF 1Q3EA 3OTOB 1O9HA 2D2CB 1FS0G 1F7YA 2YDEA 2XUMA 3E8FA 5HFMA 5CMUA 2IU0A 1E79G 3LNMB 3C90A 1AJNA 2HVKC 5B1AB 5EYPB 1M56C 5IDJA 4O4HA 3T1HO 1KBHA 1EZVH 2E76B 1N32O 2HVJC 2QDOA 3ASOC 5LL6Y 4O2BA 1NJIW 4G28B 3JATA 3W7XA 4GUNA 2JEUA 1MABG 5DEDA 2QKSA 1K97A 1SA0A 3TETA 3OUSA 1KP3A 1PNKA 1ZLZA 1M5IA 4YJ3B 1HR0O 3AG1B 5BMVA 2LP7A 2QEXV 4UCVA 1K92A 3H01A 2K9PA 1XL4A 3ZJZA 3EXAA 1NQTA 2RNBA 3ZBHA 4IIJA 5J2UB 3F5WC 3HKDB 2W0XA 2B1GA 3PN1A 5C93A 3GVMA 2PZSA 4MVUA 1SZTA 3IFXA 5B1AC 4LH6A 5DECA 3S3XA 2UXDO 1GO3F 4X88A 1ZX3A 2EIMB 4I7ZB 2YEVB 3L74H 1KUQA 2Q4PA 2HFEC 1OHHG 5D5QA 5GW7A 1S3JA 4D7SA 4YY3O 4QGPA 4K8XA 1SERA 1AJQA 4BWAA 3JALB 3BEHA 3FB5C 5JVDA 3SPJA 1I94O 2BCCH 4DV4O 4O4HB 1QLEB 1MSWD 3AG1C 4IT5A 4A5UB 2M7WA 3T4DA 4O2BB 2LJ2A 2Q67A 1ENVA 2WWWA 4J80A 2DN9A 1VMGA 3DXRA 2EX3A 3WB2A 2YXHA 3X2QB 2AZ0A 1AP6A 3OMIB 5EIBC 2LO1A 1SA0B 4B3RO 4K35A 4PJ0Z 4J9ZB 4DV2O 2ZR3A 1XQ8A 1RFYA 3C3TA 4MTFA 5BMVB 3U0ZA 4L87A 2DE0X 2EIMC 2YIAA 1QNMA 2ZR2A 3BRCA 3CRMA 1Y74A 2CTPA 3APQA 4JI2O 4DR2B 1Q6HA 3EFFK 3CRAA 2P7TC 4P9OA 3VQYA 2XASA 5JCOC 1WNSA 2EJRA 1K4DC 1H8HG 1QLEC 2YI9A 2Q69A 3GWKC 1PNMA 4FLYA 3ZHVA 3OMAB 5L3CA 3N2KA 1SS3A 2PYLA 3F7VC 1Q43A 4LF6B 4UVCA 2CDYA 1X4TA 1N36B 4LF8O 2WSSG 3ABMB 3X2QC 3CCQV 2AHYA 3RYCB 3E8BA 2N05A 2JGDB 3K79A 2F4VO 1PD3A 1IBMO 3CRCA 1IX9A 2HKOA 4UB8Z 2ADQB 2LFSA 3ETGA 1VQLV 4DUYO 4B3MB 2UUAB 1NH2D 3LSUA 3CRQA 4C7UA 2ZIOA 3DXRB 1XMOB 4PA3A 1FFXA 2JGUA 4ZI7A 5LOVB 1AI4A 1NKDA 4DK1A 1QQCA 1AROP 5ITZB 5CA1A 4FLZA 4UCTA 3K59A 2LGQA 4DV1O 1WP8A 4LWSB 5H9CA 3SJQC 2YIBD 5L3EA 3CYOA 2CAZC 2WLKA 1TVKA 4IHJB 5H6QA 3G67A 4JV5O 4MTOA 1OCZB 5LGUA 1Y74B 2NR5A 1V55B 1NI8A 4DR3O 2GDSA 4YJ2A 3ABMC 4I9WA 1PPJH 2Z3YA 3ZX6A 1KD1W 5FPOA 1SRYA 3LDEA 3T2MA 4I9QA 3SYOA 4E2LA 2P5OA 3B09A 2WLLB 1KC8W 3CC4V 4MVQA 3UCSC 1T5EA 1P49A 4RWUA 5EC2C 4IYIA 1FD9A 3R65A 1L0NH 4JTAB 4TUYA 1CXZB 4IGGA 4I50A 4FJCC 1PNLA 3ZRXA 1YI2V 4KHPB 1HW7A 2VS0A 2YC0A 2QTOA 1Y76A 2ARHA 4Z1MG 1PP9H 3T1CA 3H1LH 2JEXA 3RYFB 4DV0O 2V1DA 1NR1A 3LSSA 1YIJV 5LYJB 4MW8A 1OCZC 3APOA 4X1KA 1FXVA 4TT3G 3G80A 3N27A 2EIJB 1V55C 2IBZH 1I0HA 4ZI7B 5CB4A 2DYRC 2ETNA 5EC1C 1R3LC 5CA1B 2EJ7A 4JPRA 4BIUA 4LFBB 1R6NA 2EILB 3HPLC 2P6JA 1IZ3A 3E8GA 1B06A 3DTUB 2K1EA 1DTOA 4WFBV 4LF5O 2ZE7A 5EK0A 3SYPA 2JJ2G 4NTXA 2ADPA 1EM1A 1F4MA 4YJ2B 2CE4A 3BAAA 1YJNV 3QF7A 4X66B 2A0LA 1L0LH 4I4TB 1B04A 3Q4HA 2PTMA 2H8PC 5E1AC 2QWPB 2DQ0A 3AEIA 4TUYB 4JYAO 2EIJC 4HAMA 4I50B 4LCUC 1QHTA 2Q7GA 5EIBD 1SQVH 1NZ6A 3LUTB 1VQ8V 2ZNJA 4O4IA 4TV9A 3A0HZ 1Y76B 3TGUH 1Q86W 2VQEO 4MTGA 4DW1A 2EILC 2OIEA 4LF4O 3QNEA 5KHIA 1XUQA 3B4SA 2UXBB 3CHXA 2F95B 2Y4TA 2EZOA 3OR7C 3CMAV 5L3BA 2OTJV 1MNGA 4JI2B 4U7NA 4DV7B 4LP8A 4X65O 3ZS8C 5CN0A 4ZHQA 4NYKA 1IBKB 1F4NA 1W0KG 2XAQA 4R7CA 3IC9A 3HKBB 4JI5O 3B2EE 1EN4A 1KB9F 2GSMB 3K58A 2ZM6O 2C2AA 3UT5A 2B9ZA 4Q20A 4I5SA 4TSFG 4F6EA 1RSOA 4LFCO 3BA9A 2ZE5A 3RYIB 4B7EA 3BVOA 3HKEA 5H6RA 3KZIZ 5IYDO 2QWOB 4B3SO 4O2AB 2F4VB 4DW0A 1YXBA 5LP6B 4FM1A 2QA4V 1EFRG 3BFRA 4LFAO 4NTWA 4MVOA 4CBCA 3MDSA 4TV9B 1VF5B 1J5EO 1S0VA 2EULA 5EBWC 5B5EZ 1I08A 4Q6GA 4TV8A 2ZXWC 1UJWB 3WG7B 3D36C 1N8RW 1WAZA 2PF4E 4UCUA 4DV1B 2IJJA 1Y4MA 4PA7A 4PV1B 2EIKB 1LUWA 2Q5ZA 3ETEA 3JYCA 4PDMA 4X89A 5L3DA 1SQPH 4LF7B 2ZE6A 1AP5A 3SYAA 1SETA 1GN6A 1GK9A 4JGSA 4P30A 5LP6C 1GM9A 1HNZO 5EYPA 5DN6G 1Q5OA 2X6BA 2QKAA 4AI8A 2AHZA 2OWOA 1HNWO 4WFHA 1RSOB 2CTWA 2P4VA 5BXZA 1WB7A 1GAXA 1HWYA 5GONA 5CA0B 5IJ9B 1KMIZ 3T1YO 4MVMA 3SGIA 4KP4A 1XMQO 2QSAA 2Y48A 2AZ2A 4DR6O 3B8MA 3WG7C 1FXHA 2VWJA 4QPJA 3I56V 2JJ1G 4DV0B 2EIKC 1ORQC 4LC1A 1UFIA 5JJNB 3STLC 5BR8O 2E75B 1HNXB 3ASOB 3WB1A 1CP9A 1FJGB 2VRZA 4F4LA 3QG5A 3UO2A 1B6QA 1YJ9V 2RN9A 4GKJB 4QPKA 2IH1C 3DGEA 2WLIA 2EZPA 4MVSA 3D3QA 2HEPA 1R3IC 3STZC 4FLTA 1Y6XA 1XILA 1V54B 5KA6A 2YEVA 3ZHRA 3RFRA 2FYUH 2B5UA 1TUBA 3CJHA 3JALA 5JCOA 2XNDG 4JYYA 4GKKB 4H13B 3A0RA 4O4LA 4FM0A 2GTSA 2PI5A 4GX1A 5B66Z 4NTYA 2AXTZ 3SJBC 5GONB 4HBNA 5LBQA 2GHYA 3HR0A 3CRRA 1N33B 5BY1A 2F1MA 3CS5A 1F23A 3P3NA 1JMKC 3H1HH 2Y69C 1KQSU 1FKAO 4X20B 2R70A 4ZKIA 2R9RB 3JCUZ 4EEQA 2VQEB 4QNHB 1BGYH 4X62B 1WJZA 3K5NA 3M8AA 2NN4A 3UQ8A 4JI0B 1MOFA 5FNVA 1V54C 1ROPA 2Y4UA 4DV6O 2P06A 1XBLA 4J41A 4I0XB 3ZEDA 4XDJA 2QR4A 3SPCA 2Q9LA 4GZRB 4DR5O 4YHHB 1JA8A 2V7QG 2WLIB 1D2DA 4X65B 3ZRWA 4DO2A 5IY5B 3E86A 4UUJC 4W4KA 4NR1A 1AR1B 2OYQA 4UB6Z 5LMNB 4JAAA 3J80N 2Q68A 4JTDB 4P2ZA 1TUBB 3CJHB 3H1IH 3RYCA 3RWRD 4LFCB 4LNUA 4WFAV 2JGDA 3WFVA 2PUSA 5LXTB 4DR1O 5KHKA 4OX9O 4UV8A 2YXLA 5KUKA 4JI8O 1JQ0A 4O4LB 1M90W 4PA9A 1XNQO 4JI6O 2IU3A 3FB6C 3UO3A 3ABTA 3IAYA 3K0DA 1MSDA 3CB2A 2JRIA 1RPRA 4XDKA 1Q6UA 3CC2V 4LFAB 4K0KO 4YXWG 2QKCA 1O9GA 3CCSV 1HDJA 5K1PA 4J7KA 2BTOA 5LOVA 2UU9O 3R66A 2QTSA 4GX2A 3RYHB 3TXQA 3BY6A 5ITZA 1COWG 1UPGA 2IJIA 2BOCC 3MD0A 2UXCO 4LWSA 5LMUO 4RUFA 5IY5C 5FNVB 4IHJA 2RDCA 2WLNA 1YEWA 3F7YC 4FLXA 4JI1B 4LF9B 2N04A 2E5LO 1BQ0A 2DOSA 1IVSA 1FXKC 1N4CA 4NXMB 1SKVA 4AHCA 3ZRWB 2FL4A 2JS3A 2NLJC 4JI7B 2WLLA 1FPOA 3OTFA 2RQ6A 3VQVA 4NXNO 1Q90D 3ABUA 4MT8A 4J7JA 2QWNB 3ZMSA 4DUZO 2Z5UA 1PV0A 2ZINA 4DV5O 4B08A 4LNUB 3SPHA 3VQXA 1AI7A 4UCSA 2PI4A 3ZRVA 5H5NA 4GCZA 3A2FA 4WF9V 1XMQB 1THZA 1R73A 1G6UA 4PDRA 3RYFA 3SPGA 2P67A 5LYJA 2F93B 2B1IA 5KHHA 1R3JC 2OTLV 2Q6AA 3L73H 1FFTB 5IWAB 4AQYB 2A9HA 3RBZA 2W6IG 5EZYB 3L71H 2OCHA 4PDVA 2ZDIC 1WB8A 4IL6Z 2YSUB 4X1YA 1BHBA 2HHHB 4DV3O 3SYCA 1Q7YW 1N34B 3DSQA 4TOIA 1JFFB 2JDIG 1DGSA 1TAEA 4DR7B 4MW3A 1LUVA 4J7ZA 2WLJA 3MHSC 3B77A 2DYRB 3O65A 2WAMA 1LNQA 2CH7A 2WA4A 1S76D 3CD6V 3LNNA 4I4TA 2GUZB 1K7DA 4U3JA 4JI4O 4G27B 3T1HB 4FLVA 5KMGA 1N32B 4JASA 3BA8A 2BE3A 4QE9A 4CC6A 1JOYA 1DLBA 1K9MW 2IW5A 3CCEV 1P4RA 4FM2A 2RCVA 3K04A 4BW5A 5FL7G 2UUCO 1Z5VA 1K5SA 1R1BA 5F2VO 1HR0B 1U97A 1G1XB 1TA8A 1P84F 4RAIA 3P32A 1QLNA 4B3TO 1Q82W 1IBLO 3ASNC 5L3FA 4MS2A 3L72H 4X1YB 3F5TA 3LDCA 4H37A 1H8EG 1D5NA 2M6YA 3SR2C 4RQEA 1SQXH 3D36A 4GX0A 3W7UA 4RUEA 3HKBA 1BE3H 2UXDB 1AI6A 3G4SV 2R72A 1OCRB 2VQFO 1VQ7V 1AILA 2CH7B 3N2GB 1GKFA 3RYIA 1Y67A 5FPRA 2BOBC 4YY3B 1NR7A 1WA8A 3OTOO 4O2AA 1I94B 4FIPC 5IYZA 4U3JB 5LP6A 4DV4B 1MG1A 3RGBA 4JI8B 5KMGB 4OPHA 3JD1A 1VQOV 1VIBA 1NU1H 3C3SA 2H94A 2EBOA 1S77D 1NS1A 3GWOA 3G6BA 4GT1A 1BMFG 1QU7A 4UCOA 3K3WA 5JQGB 4B3RB 2KQXA 2W0FC 2P90A 3P3PA 4ZOLB 3E35A 4DV2B 3SJCC 3ZIAG 3E8HA 2ITDC 2UXXA 4XDLA 1IXMA 1K73W 1RM1C 1MMMA 2FKXA 4OXSA 4LH7A 2F23A 3K5MA 1OCRC 4ABMA 4ZBMA 5B1OA 4FZ1A 2R9AA 1AB3A 3E83A 3AK1A 1Q81W 5KAIZ 3CCJV 2A79B 3E22A 2GBOA 5LHGA 3RVZA 3D8CA 4YIOA 3JSNA 4K8ZA 2ZXWB 3UKMA 2QM8A 2ILMA 3ICXA 2HLDG 1YVWA 4HYOA 3KKYA 3JARA 4W4LA 1YZBA 3ZMVA 3ZMTA 3T4ZA 5B1BB 3THOA 2ZCEA 4L8JA 3M99B 1M9NA 3A0BZ 4WBNB 3WU2Z 1K8AW 1GN2A 2LFRA 1GM7A 4LF8B 1GN4A 3K03A 5CA0A 5IJ9A 4EFBA 1WA8B 1MZFA 3H1KH 2YXYA 1Z2GA 1YCIA 5IYZB 4FZ0A 1IBMB 2WA3A 5IT9N 4QIWF 4WFFA 1DF4A 3NR7A 4EKWA 2D3OW 3FX7A 5EBLC 4ICGA 3AG2B 4R8CA 4DUYB 3I5DA 4HNAA 2IM9A 2KG7B 1N0JA 4JYBA 4R6ZA 1QR8A 4PD4F 3AG4B 2Q73A 3ABKB 2DYSB 1BQZA 1M1KW 2IJHA 4H33A 3JASB 5K1XA 4I55A 4J10A 4D7TA 4DV3B 5B1BC 2PGGA 5C8YB 4JV5B 1JVMA 1OCOB 1OCCB 4MVZA 2XT9A 4O4JB 1I7FA 1VF6C 4DR3B 5KAFZ 1WN7A 3E22B 1SQFA 2WLHA 2F66C 3JARB 4DR2O 5KUMA 3K9SA 1NH2B 3JAWB 2HP8A 1WLEA 1VQ4V 1M4UA 4QJFB 1IDSA 3AG2C 1MZEA 3CPWU 3B8NA 3VBBA 1K34A 3CCUV 3UM7A 4EFEA 1B3QA 2ZIMA 1PKXA 3AG4C 2QWQB 3ABKC 1SQGA 1WPXA 4X20A 1N36O 2DYSC 3OD4A 1J95A 3BPZA 2CTQA 4P9PA 3S3WA 4WFGA 1ZUQA 5LHHA 1OCOC 1OCCC 2XAHA 3W7SA 3JSLA 3WB0A 1OZ0A 4HNAB 2BTQB 1Q6IA 1YHQV 3JAKA 3CE2A 4XBFA 1PM9A 4B7KA 4B3MO 3BHPA 4I0XA 2Y69B 2UUAO 4E4EA 1XMOO 4TWKA 2UXNA 3K0GA 4I55B 1PL4A 1YF2A 4OGQB 2A06H 4DK0A 1CEZA 1VARA 3EVKA 4LF5B 2LW1A 3AG7A 3FD9A 2ZE8A 2LW7A 4JAUA 1FXKA 1XNRO 4CC5A 3AG3B 1AJPA 4UV9A 5LXTA 2DW4A 1P7BA 2YI8A 3KCYA 1MA1A 3ZHSA 4ASUG 3O9OA 2CUGA 1H2NA 2WPDG 3CCVV 5FLXN 5DM6V 1Z5WA 4JYAB 3ETDA 5KX5A 5A9GA 3HKCB 3GB7C 1SQBH 2JS5A 3QTCA 3J81N 1GM8A 4F6RA 1VQ9V 3SYQA
chains in the Genus database with same CATH topology
1JPXA 3ABUA 4MT8A 2EILB 3HPLC 5LGTA 3VOUA 2P6JA 3ZMSA 3E8GA 3K08A 1Y66A 3DTUB 2K1EA 1PL0A 1DTOA 2Z5UA 4WFEA 4WFBV 1G4YB 3ZN1A 5IYCO 3CMEV 3SPHA 5EK0A 5HFLA 4KUMA 3SYPA 1AI7A 2JJ2G 2PI4A 2IH3C 4JF3A 3ZRVA 1F4MA 4J9YB 4GCZA 3JCZA 1YJNV 3JD0A 4WF9V 2WLMA 4FMTA 2A0LA 1THZA 1R73A 5B3SB 4PDRA 1YITV 3SPGA 1M57B 2P67A 3KG2A 2B1IA 4PDLA 4CZZA 1R3JC 2OTLV 2Q6AA 1H2GA 1ZWIC 1FFTB 3AG3C 4RQFA 2H8PC 1R3KC 3LSQA 5E1AC 2A9HA 2HJFC 5BZBA 1KP2A 2ZDIA 3RBZA 5IYBO 2W6IG 2DQ0A 3AEIA 4KFMA 4FK5C 1TUEB 2OCCB 3OFNG 2EIJC 4R50A 4HAMA 3FB7C 4PDVA 4LCUC 2ZDIC 2YSUB 3CCRV 4QE7A 1GTOA 4MTXA 1K3EA 1BHBA 3LUTB 3ZCCA 1VQ8V 3CC7V 3SYCA 1Q7YW 2ZQMA 2DWEC 1FXKB 1Q86W 2JDIG 1JJ2U 4MTGA 3JD3A 5EBMC 3W7WA 2EILC 4MW3A 4MVRA 3EHBB 1W0JG 1I5XA 3QNEA 2WLJA 3OW2U 1QBZA 2ZD9A 3MHSC 3B77A 2DYRB 2WAMA 1LNQA 2CK3G 1H38A 4N21A 1S76D 3CD6V 1RPOA 1M56B 2EZOA 3OMNB 3OR7C 5B3SC 3CMAV 1VQNV 5L3BA 2OTJV 2F43G 1YJWV 1M57C 1K7DA 2X6AA 1S72V 1QVFU 1E1RG 2ITCC 4U7NA 3OEEG 4LP8A 4G27B 5CN0A 3ML0A 3FKSG 1F4NA 4JASA 1DF5A 1W0KG 2EINB 2XAQA 4QE9A 4R7CA 3ZRSA 3G6EV 1S5HC 1F51A 2OCCC 2GSMB 1K33A 2W6JG 4RO2A 4BAYA 2JK5C 1YTFB 1JOYA 1VQ6V 2C2AA 1DLBA 4Q20A 4I5SA 4TSFG 1NVPD 1BHAA 1K9MW 3JD4A 2IW5A 3CCEV 4PA4A 3NXSA 1P4RA 3K04A 4BW5A 5FL7G 1I5YA 1L1FA 3HB3B 1K5SA 5H6RA 1K5QA 1VQPV 5IYDO 5CBFA 1FS0G 3E8FA 4HZ3A 5CMUA 2IU0A 4RAIA 5HFMA 2QA4V 3P32A 1E79G 3LNMB 1QLNA 3ABLB 1AJNA 1EFRG 2HVKC 1Q82W 5B1AB 3ASNC 5L3FA 4MS2A 3LDCA 1M56C 3LDDA 4H37A 4MVOA 1H8EG 4CBCA 4MSWC 4DXWA 5IDJA 4RQEA 1S0VA 3D36A 4GX0A 2HVJC 5KA5A 3ASOC 5EBWC 4RUEA 3W7UA 1NJIW 1GMGA 3JD2A 4G28B 3W7XA 2ZXWC 1AI6A 2JEUA 3G4SV 1UJWB 1MABG 3WG7B 1SESA 1OCRB 1N8RW 2EINC 1VQ7V 1QCEA 2IJJA 1Y4MA 4PA7A 1E1QG 2QKSA 1K97A 3TETA 3OUSA 2EIKB 1GKFA 3ETEA 3JYCA 2HG5C 1R6KA 1KP3A 1PNKA 2BOBC 4PDMA 3OEHG 1NR7A 4X89A 3AG1B 5L3DA 3TK1A 2LP7A 4PA6A 2QEXV 4FIPC 1K92A 3H01A 3SYAA 1MG1A 1XL4A 1SETA 3ZJZA 1NQTA 1GK9A 3JD1A 3F5WC 4JGSA 4P30A 1VQOV 1GM9A 2H94A 2B1GA 5DN6G 4JYCA 5C93A 2EBOA 2X6BA 4MVUA 1SZTA 3ABLC 2AHZA 3IFXA 1S77D 2ATKC 5B1AC 3GWOA 4U7OA 4WFHA 4GT1A 3CP1A 1BMFG 3K3WA 2W0FC 4JTCB 4UXNA 2P90A 2X0LA 1HWYA 3E35A 1GO3F 3ZIAG 1BL8A 4X88A 4MVMA 1VQKV 3E8HA 2EIMB 3QO5A 4KP4A 3CXCU 2YEVB 2ITDC 2UXXA 2Y48A 1IXMA 4X8AA 4XDLA 3ASNB 3CCLV 1K73W 1RM1C 2HFEC 4OXSA 3B8MA 3OGCC 3WG7C 2XAJA 1FXHA 1OCRC 1OHHG 5GW7A 3D3IA 1S3JA 4ZBMA 5B1OA 4QPJA 3I56V 1SERA 1AJQA 2JJ1G 3BEHA 3FB5C 4FPPA 3E83A 3SPJA 2EIKC 1ORQC 4LC1A 1Q81W 3STLC 3CCJV 3ASOB 2A79B 2IJKA 5LHGA 1CP9A 1QLEB 3RVZA 1MSWD 2DQ3A 2ZXWB 3AG1C 3UKMA 2M7WA 4F4LA 3T4DA 2QM8A 2HLDG 4HYOA 1B6QA 1YJ9V 2Q67A 3ZMVA 3ZMTA 1ENVA 2WWWA 3T4ZA 5B1BB 4GX5A 4QPKA 2IH1C 3M99B 3DGEA 1M9NA 3X2QB 1NVPB 2WLIA 2EZPA 3OMIB 2X7RB 4MVSA 1K8AW 2LFRA 1GM7A 2KB1A 4J9ZB 1R3IC 3FYEB 3K03A 2ZR3A 3STZC 2NNUA 4MTFA 1V54B 3ZN0A 5KA6A 2YEVA 1QR9A 4QIWF 1VQMV 4L87A 4WFFA 2B5UA 1DF4A 2EIMC 3IGAC 2QM7A 3OUFA 4EKWA 2ZR2A 2D3OW 5EBLC 2OT5A 2XNDG 3W7TA 3AG2B 4R8CA 3EFFK 2P7TC 4P9OA 3A0RA 4PELA 2XASA 2EJRA 4JYBA 2PI5A 4GX1A 1EZJA 4R6ZA 1QR8A 1K4DC 1H8HG 1QLEC 2XAFA 2Q69A 5LBQA 3AG4B 1RM1B 2GHYA 1PNMA 3ABKB 3RVYA 3I55V 2DYSB 3OMAB 5L3CA 1M1KW 2IJHA 4H33A 1F23A 3F7VC 4UVCA 2Y69C 1KQSU 4UVBA 5B1BC 5L3GA 4ZKIA 1JVMA 1OCOB 2R9RB 1OCCB 4MVZA 2WSSG 3ABMB 3X2QC 3CCQV 2AHYA 1KECA 2X6CA 3K9AA 4QNHB 3E8BA 1QVGU 3OM3B 5B1NA 2HR3A 3K79A 1PD3A 3E2EA 3K06A 1MOFA 2HKOA 3QO7A 1V54C 2WLHA 1ROPA 1W2BU 4LBEC 2LFSA 3ETGA 2DWDC 1CPYA 2JIZG 4N23A 1VQLV 1VQ5V 1NH2D 5KUMA 4XDJA 1NH2B 3SPCA 1VQ4V 1WLEA 4QJFB 4PA3A 2V7QG 3AG2C 2WLIB 3E89A 3RW0A 3ZMZA 3ZRWA 1AI4A 1NKDA 4WCEV 3CPWU 3B8NA 3VBBA 1K34A 3MHHC 3CCUV 1AROP 3UM7A 4DO2A 5IY5B 3E86A 4UUJC 1AR1B 1PKXA 5H9CA 3AG4C 3SJQC 5L3EA 3ABKC 3CYOA 1WPXA 2Q68A 2WLKA 2DYSC 4JTDB 4P2ZA 5H6QA 4MTOA 1OCZB 1J95A 5CBHA 5LGUA 1NBMG 4P9PA 4WFAV 4WFGA 1V55B 1XL6A 3WFVA 5LHHA 1OCOC 1OCCC 2XAHA 3ABMC 4UV8A 3PJSK 4I9WA 3W7SA 3FYIB 2Z3YA 3P30A 1OZ0A 5KUKA 1EBOA 1JQ0A 3OR6C 5LGNA 1YHQV 4PA9A 1M90W 1KD1W 2IU3A 3FB6C 3TCUA 5CA3A 4XBFA 1SRYA 3SPIA 3LDEA 3ABTA 3T2MA 3SYOA 1KKDA 4E2LA 2R9IA 2WLLB 3K0DA 1KC8W 2XOKG 2Y69B 3CC4V 4MVQA 3ZMUA 1RPRA 4XDKA 5LHIA 3CC2V 3OAAG 4YXWG 4TWKA 3CCSV 5EC2C 2UXNA 2XAGA 3R65A 3K0GA 3FB8C 3QO8A 4JTAB 4G2KA 1JX9A 4GX2A 3BY6A 5J9PC 1COWG 1CEZA 2IJIA 4FJCC 2BOCC 3MD0A 2FTKA 1PNLA 4RUFA 4JAVA 3ZRXA 1YSCA 1YI2V 1YTFD 5IY5C 2QTOA 4JAUA 2WLNA 1FXKA 3F7YC 4Z1MG 3T1CA 3AG3B 3CCMV 1AJPA 2JEXA 5CBGA 4UV9A 2V1DA 1NR1A 3LSSA 4UVAA 1YIJV 4BIZA 1K4CC 3G71V 4MW8A 1OCZC 1FXKC 2DW4A 1AI5A 2QE7G 1FXVA 1P7BA 4TT3G 2EIJB 4ASUG 2MK3A 1V55C 2WPDG 3CCVV 3ZRWB 5DM6V 3IC7A 3ETDA 3OE7G 2NLJC 2WLLA 1JCHA 2DYRC 3GB7C 5EC1C 1R3LC 4JPRA 4BIUA 1GM8A 1VQ9V 1R6NA 3SYQA 1G8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PA4 A;  4XDJ A;  3HPL C;  3BEH A;  3FB5 C;  3VOU A;  3SPC A;  3K04 A;  3E8G A;  3K08 A;  3E83 A;  4BW5 A;  3SPJ A;  2EIK C;  1ORQ C;  4PA3 A;  2K1E A;  3STL C;  3AG2 C;  2WLI B;  2A79 B;  4WFE A;  3E89 A;  3RW0 A;  1G4Y B;  3RVZ A;  3SPH A;  5CBF A;  5EK0 A;  3SYP A;  3AG1 C;  3UKM A;  2IH3 C;  3UM7 A;  4F4L A;  3T4D A;  3E86 A;  4J9Y B;  3E8F A;  4UUJ C;  4HZ3 A;  4HYO A;  4RAI A;  2WLM A;  2Q67 A;  2A0L A;  3LNM B;  3AG4 C;  3T4Z A;  3SJQ C;  2HVK C;  3ABK C;  3ASN C;  4MS2 A;  4GX5 A;  4PDR A;  2Q68 A;  3SPG A;  2WLK A;  2DYS C;  4JTD B;  3KG2 A;  4P2Z A;  2IH1 C;  3LDC A;  4MTO A;  1M56 C;  3LDD A;  4H37 A;  2WLI A;  4MVO A;  1J95 A;  4PDL A;  1R3J C;  4MSW C;  2Q6A A;  1ZWI C;  4MVS A;  4CBC A;  3AG3 C;  2KB1 A;  4DXW A;  4P9P A;  2H8P C;  4J9Z B;  1R3I C;  1XL6 A;  3K03 A;  4WFG A;  1R3K C;  3STZ C;  5E1A C;  1OCO C;  2A9H A;  2HJF C;  1OCC C;  4GX0 A;  2HVJ C;  5BZB A;  3ABM C;  3RBZ A;  3ASO C;  3PJS K;  4I9W A;  4RUE A;  5EBW C;  4MTF A;  5KUK A;  4KFM A;  2YEV A;  3OR6 C;  4PA9 A;  2EIJ C;  4G28 B;  4R50 A;  2ZXW C;  3TCU A;  3FB6 C;  3FB7 C;  4PDV A;  3LDE A;  4LCU C;  3SPI A;  3SYO A;  3T2M A;  1KKD A;  2EIN C;  4QE7 A;  4WFF A;  2EIM C;  3IGA C;  3OUF A;  2WLL B;  3K0D A;  4PA7 A;  4EKW A;  3LUT B;  4MVQ A;  2QKS A;  3TET A;  4XDK A;  5EBL C;  3OUS A;  3JYC A;  2HG5 C;  3SYC A;  4R8C A;  2DWE C;  4TWK A;  3EFF K;  2BOB C;  4PDM A;  5EC2 C;  2P7T C;  3K0G A;  3R65 A;  4MTG A;  3FB8 C;  4JTA B;  4P9O A;  5EBM C;  2EIL C;  4X89 A;  4MW3 A;  4MVR A;  4PA6 A;  4GX2 A;  2WLJ A;  4GX1 A;  3SYA A;  4R6Z A;  1XL4 A;  1K4D C;  2ZD9 A;  3ZJZ A;  1QLE C;  2BOC C;  2Q69 A;  1LNQ A;  4RUF A;  3RVY A;  3F5W C;  4P30 A;  5IY5 C;  2QTO A;  4H33 A;  3F7V C;  2WLN A;  3F7Y C;  2X6B A;  4MVU A;  3T1C A;  3OR7 C;  2Y69 C;  3ABL C;  5B3S C;  2AHZ A;  3IFX A;  5CBG A;  2ATK C;  5B1A C;  5B1B C;  4WFH A;  1M57 C;  2X6A A;  1JVM A;  2R9R B;  2ITC C;  1K4C C;  4MVZ A;  4MW8 A;  1OCZ C;  3X2Q C;  4LP8 A;  2AHY A;  2X6C A;  4QNH B;  4G27 B;  1P7B A;  3E8B A;  2W0F C;  4JTC B;  1V55 C;  1BL8 A;  4X88 A;  4MVM A;  3K06 A;  3E8H A;  4QE9 A;  4R7C A;  3ZRS A;  2NLJ C;  4X8A A;  1V54 C;  2ITD C;  2WLH A;  2WLL A;  4XDL A;  1S5H C;  2DYR C;  3GB7 C;  2OCC C;  4LBE C;  5CBH A;  5EC1 C;  1R3L C;  2HFE C;  4RO2 A;  2JK5 C;  4OXS A;  2DWD C;  3OGC C;  3WG7 C;  1OCR C;  3SYQ A;  4ZBM A;  5J9P C;  5KUM A; 
#chains in the Genus database with same CATH topology
 1H2K A;  1D5A A;  2BSK A;  4FLW A;  3RYH A;  1PL0 A;  2LQT A;  1ZAU A;  3CME V;  5HFL A;  4KUM A;  4LF4 B;  5JH7 B;  2IH3 C;  4BIO A;  2GTA A;  4KHP O;  2O57 A;  3TJT A;  2CGN A;  3JAK B;  1IXB A;  1M57 B;  3KG2 A;  4GLX A;  2XTA A;  4PDL A;  4CZZ A;  1H2G A;  3AG3 C;  4RQF A;  2UUB O;  1R3K C;  3LSQ A;  1BT8 A;  1L8D A;  2ZDI A;  1YDX A;  3BAB A;  4FK5 C;  3ZHT A;  1TUE B;  2OCC B;  2N74 A;  3AK2 A;  3OFN G;  4TQF A;  5KLV H;  4X64 O;  4DR4 O;  3J7A U;  3FB7 C;  1NT2 B;  3CCR V;  1GTO A;  4LFB O;  4JI5 B;  2ZT9 B;  3ZCC A;  1BS3 A;  3CC7 V;  2ZM6 B;  1XOU A;  2ZQM A;  1FXK B;  1ZTE A;  5IE9 A;  3U10 A;  3W7W A;  1U96 A;  4MVR A;  1XRE A;  5IJ0 B;  1I5X A;  3OW2 U;  1QBZ A;  1XHX A;  2FML A;  1ZSP A;  4X66 O;  4B3S B;  1H38 A;  2Y0P A;  4N21 A;  1RPO A;  4PI0 A;  5KX5 B;  3BCC H;  1XI1 A;  1VQN V;  4CH4 A;  1YJW V;  1M57 C;  2X6A A;  4F6R B;  1E1R G;  2ITC C;  5EZY A;  2A7W A;  1ZL8 A;  4D6T H;  1J5E B;  2BSK B;  2L35 A;  2DMX A;  1DF5 A;  2EIN B;  2Q0O C;  4KXR A;  3ZRS A;  3G6E V;  4JI3 O;  3JAT B;  2OCC C;  2W6J G;  1K33 A;  1XDC A;  1YTF B;  4BAY A;  2JK5 C;  1KKC A;  1OV9 A;  1BSM A;  1VF7 A;  1BHA A;  1JFF A;  3JD4 A;  4PA4 A;  2A3Q A;  1EN6 A;  1I5Y A;  1L1F A;  5JJE B;  3M7M X;  1GH6 A;  4JZG A;  1K5Q A;  4FLU A;  5J2T A;  1VQP V;  5CBF A;  3OGI B;  3CSX A;  2UXB O;  4HZ3 A;  3ABL B;  4IIJ B;  2GUZ A;  1GRJ A;  4PI2 A;  1N0N A;  1HNZ B;  3LDD A;  4DV7 O;  4MSW C;  4DXW A;  1HNW B;  1IBK O;  5KA5 A;  2QM4 A;  3FAV A;  1GMG A;  3JD2 A;  3T1Y B;  1SES A;  2EIN C;  1QCE A;  3FFQ A;  3L75 H;  1E1Q G;  2MW2 B;  4DR6 B;  1XHZ A;  1RP3 B;  2HG5 C;  1R6K A;  3OEH G;  3OT7 A;  5A2Q N;  5JVD B;  1SF9 A;  4JZ2 A;  1X59 A;  3TK1 A;  5BR8 B;  4PA6 A;  4IYH A;  2HJD A;  2V4D A;  4K3A A;  1ZL8 B;  1NTM H;  5KHJ A;  2P4K A;  1V9P A;  4JYC A;  3ABL C;  2ATK C;  4U7O A;  4EB6 A;  3CP1 A;  1BZK A;  4AIL C;  4JTC B;  4UXN A;  2X0L A;  3K5O A;  3RN4 A;  1BL8 A;  1VQK V;  5J2T B;  3QO5 A;  4TQD A;  3CXC U;  4X8A A;  3CCL V;  3ASN B;  2KSD A;  3OGC C;  1P7G A;  3N2G A;  2XAJ A;  2Z0A A;  2GV9 A;  3D3I A;  2G38 A;  1XNR B;  1FYJ A;  4FPP A;  4H44 B;  4X1I A;  4LF7 O;  2YS8 A;  2IJK A;  1XEQ A;  2L6L A;  5E79 Z;  1NTZ H;  2DQ3 A;  5AG2 A;  4KL1 A;  3FAV B;  4GX5 A;  4H0L B;  5H2F Z;  3N2K B;  1HP8 A;  3B40 A;  1NVP B;  5JQG A;  2X7R B;  3QVN A;  2KB1 A;  1EN5 A;  4ZOL A;  3FYE B;  3SJA C;  2NNU A;  3ZN0 A;  1QR9 A;  4UCR A;  5GTI Z;  1VQM V;  3OUF A;  3IGA C;  2QM7 A;  3CEI A;  4DV6 B;  2OT5 A;  3W7T A;  1US6 A;  3VQW A;  1HNX O;  1Q8I A;  3TXS A;  1FJG O;  2H3O A;  4PEL A;  3ZHQ A;  4EB6 B;  4DR5 B;  2UUB B;  1FFX B;  1EZJ A;  4CH5 A;  5GTH Z;  1A32 A;  2XAF A;  3IJ4 A;  4LR3 A;  1RM1 B;  4DR4 B;  4X64 B;  3RVY A;  2AW9 A;  1S5J A;  3I55 V;  4GKJ O;  1H2L A;  4ZIB A;  4WBN A;  1R6T A;  4UVB A;  2PYJ A;  1TVK B;  2Q0A A;  1VF6 A;  4BW9 A;  5L3G A;  2CTR A;  2YID A;  1KEC A;  2X6C A;  3K9A A;  1QVG U;  3OM3 B;  5B1N A;  4X1I B;  2HR3 A;  4DR1 B;  2AGA A;  4OX9 B;  3E2E A;  3K06 A;  1FAF A;  1OJH A;  2P22 C;  3QO7 A;  1W2B U;  1XNQ B;  4JI6 B;  4NB5 A;  4LBE C;  4Z2W A;  1SQQ H;  2DWD C;  1CPY A;  2JIZ G;  4UFZ A;  4N23 A;  1VQ5 V;  1JJO A;  5KHG A;  4GKK O;  2JVD A;  2E3C A;  1VP7 A;  3RT3 C;  1H2S B;  2KG7 A;  4CS3 A;  4K0K B;  3E89 A;  3RW0 A;  3ZMZ A;  2UU9 B;  4WCE V;  3MHH C;  3MAQ A;  1W59 A;  5TIS Z;  4DYL A;  1N33 O;  3H1J H;  2CGO A;  2UXC B;  5LMU B;  4JI3 B;  2E74 B;  3JAS A;  5C8Y A;  1VEW A;  3CX5 F;  4O4J A;  5CBH A;  3L9D A;  1NBM G;  4X62 O;  3DC6 A;  2E5L B;  1XL6 A;  4CS4 A;  4PHZ A;  4X1K B;  2QWR B;  2DJV A;  1JR9 A;  4YIP A;  1AVM A;  2QGN A;  3PJS K;  4JI0 O;  3FYI B;  3P30 A;  1EBO A;  3OR6 C;  4DRX A;  5LGN A;  2ZNI A;  3TCU A;  5CA3 A;  1IUR A;  3SPI A;  1KKD A;  2R9I A;  5CB4 B;  2XOK G;  3ZMU A;  2VWK A;  3JAW A;  5LHI A;  3OAA G;  4NXN B;  4YHH O;  2Q7H A;  2XAG A;  3FB8 C;  3QO8 A;  4G2K A;  1JX9 A;  3KCX A;  4GYC B;  1AR4 A;  4NVP A;  4DUZ B;  4DV5 B;  3JAM N;  2FTK A;  5LMN O;  4JAV A;  1YSC A;  1YTF D;  2YIB A;  1DK1 A;  1WPB A;  5LA6 A;  1TGO A;  3CCM V;  2XHB A;  5CBG A;  2RJZ A;  4UVA A;  4BIZ A;  3K57 A;  4CH3 A;  1K4C C;  3Q4H B;  3U11 A;  3G71 V;  1AI5 A;  2QE7 G;  5JJJ B;  2BTQ A;  2MK3 A;  5D5P A;  4J11 A;  2FB5 A;  3IC7 A;  4OPA A;  3OE7 G;  1JCH A;  1WP7 A;  2Q8V A;  4CH6 A;  1G8M A;  5J9P C;  1JPX A;  5LGT A;  3VOU A;  4O4I B;  3K08 A;  4X9Q A;  4NKG B;  3CWB H;  1Y66 A;  4WFE A;  1AR5 A;  1G4Y B;  3ZN1 A;  2ZKO A;  5IYC O;  4U3F H;  4JF3 A;  3ZHU A;  2Q7E A;  3A8T A;  4J9Y B;  3JCZ A;  3JD0 A;  2WLM A;  4DRX B;  4FMT A;  5B3S B;  2YUA A;  4FFK A;  4JI1 O;  1YIT V;  4LF9 O;  4FFB A;  1SZX A;  1KYO F;  2KKW A;  1ZWI C;  1H2M A;  4Z1V A;  4NXM O;  3DC5 A;  2HJF C;  5BZB A;  1KP2 A;  5IYB O;  5JWP A;  4JI4 B;  1GN3 A;  4KFM A;  4ZHQ B;  4JI7 O;  3HKC A;  4BR6 A;  4R50 A;  3L70 H;  1BCC H;  3K5L A;  4QE7 A;  2OIG A;  4MTX A;  1K3E A;  4LF6 O;  3UT5 B;  2DWE C;  5LA6 B;  1JJ2 U;  3JD3 A;  5EBM C;  3AK3 A;  4FVM A;  3EHB B;  1W0J G;  2UUC B;  5JH7 A;  2ZD9 A;  3HKE B;  2CK3 G;  1KU9 A;  1LR1 A;  1M56 B;  3H9V A;  1SC5 B;  1URF A;  3OMN B;  4B3T B;  2PY5 A;  1IBL B;  5B3S C;  4YJ3 A;  4AQY O;  5IWA O;  2F43 G;  1QVF U;  2QJ1 A;  1S72 V;  4CS2 A;  3OEE G;  3ML0 A;  3FKS G;  5J2U A;  3SDL A;  3HKD A;  4J42 A;  4TV8 B;  1S5L Z;  1S5H C;  1F51 A;  2LGW A;  4RO2 A;  2HHH O;  2ODM A;  2Y0I A;  2VQF B;  1VQ6 V;  1NTK H;  1NVP D;  1N34 O;  2RMK B;  1M93 A;  3NXS A;  4FFB B;  4DR7 O;  5IJ0 A;  3ETQ A;  3HB3 B;  2YIC A;  3CXH F;  1Q3E A;  3OTO B;  1O9H A;  2D2C B;  1FS0 G;  1F7Y A;  2YDE A;  2XUM A;  3E8F A;  5HFM A;  5CMU A;  2IU0 A;  1E79 G;  3LNM B;  3C90 A;  1AJN A;  2HVK C;  5B1A B;  5EYP B;  1M56 C;  5IDJ A;  4O4H A;  3T1H O;  1KBH A;  1EZV H;  2E76 B;  1N32 O;  2HVJ C;  2QDO A;  3ASO C;  5LL6 Y;  4O2B A;  1NJI W;  4G28 B;  3JAT A;  3W7X A;  4GUN A;  2JEU A;  1MAB G;  5DED A;  2QKS A;  1K97 A;  1SA0 A;  3TET A;  3OUS A;  1KP3 A;  1PNK A;  1ZLZ A;  1M5I A;  4YJ3 B;  1HR0 O;  3AG1 B;  5BMV A;  2LP7 A;  2QEX V;  4UCV A;  1K92 A;  3H01 A;  2K9P A;  1XL4 A;  3ZJZ A;  3EXA A;  1NQT A;  2RNB A;  3ZBH A;  4IIJ A;  5J2U B;  3F5W C;  3HKD B;  2W0X A;  2B1G A;  3PN1 A;  5C93 A;  3GVM A;  2PZS A;  4MVU A;  1SZT A;  3IFX A;  5B1A C;  4LH6 A;  5DEC A;  3S3X A;  2UXD O;  1GO3 F;  4X88 A;  1ZX3 A;  2EIM B;  4I7Z B;  2YEV B;  3L74 H;  1KUQ A;  2Q4P A;  2HFE C;  1OHH G;  5D5Q A;  5GW7 A;  1S3J A;  4D7S A;  4YY3 O;  4QGP A;  4K8X A;  1SER A;  1AJQ A;  4BWA A;  3JAL B;  3BEH A;  3FB5 C;  5JVD A;  3SPJ A;  1I94 O;  2BCC H;  4DV4 O;  4O4H B;  1QLE B;  1MSW D;  3AG1 C;  4IT5 A;  4A5U B;  2M7W A;  3T4D A;  4O2B B;  2LJ2 A;  2Q67 A;  1ENV A;  2WWW A;  4J80 A;  2DN9 A;  1VMG A;  3DXR A;  2EX3 A;  3WB2 A;  2YXH A;  3X2Q B;  2AZ0 A;  1AP6 A;  3OMI B;  5EIB C;  2LO1 A;  1SA0 B;  4B3R O;  4K35 A;  4PJ0 Z;  4J9Z B;  4DV2 O;  2ZR3 A;  1XQ8 A;  1RFY A;  3C3T A;  4MTF A;  5BMV B;  3U0Z A;  4L87 A;  2DE0 X;  2EIM C;  2YIA A;  1QNM A;  2ZR2 A;  3BRC A;  3CRM A;  1Y74 A;  2CTP A;  3APQ A;  4JI2 O;  4DR2 B;  1Q6H A;  3EFF K;  3CRA A;  2P7T C;  4P9O A;  3VQY A;  2XAS A;  5JCO C;  1WNS A;  2EJR A;  1K4D C;  1H8H G;  1QLE C;  2YI9 A;  2Q69 A;  3GWK C;  1PNM A;  4FLY A;  3ZHV A;  3OMA B;  5L3C A;  3N2K A;  1SS3 A;  2PYL A;  3F7V C;  1Q43 A;  4LF6 B;  4UVC A;  2CDY A;  1X4T A;  1N36 B;  4LF8 O;  2WSS G;  3ABM B;  3X2Q C;  3CCQ V;  2AHY A;  3RYC B;  3E8B A;  2N05 A;  2JGD B;  3K79 A;  2F4V O;  1PD3 A;  1IBM O;  3CRC A;  1IX9 A;  2HKO A;  4UB8 Z;  2ADQ B;  2LFS A;  3ETG A;  1VQL V;  4DUY O;  4B3M B;  2UUA B;  1NH2 D;  3LSU A;  3CRQ A;  4C7U A;  2ZIO A;  3DXR B;  1XMO B;  4PA3 A;  1FFX A;  2JGU A;  4ZI7 A;  5LOV B;  1AI4 A;  1NKD A;  4DK1 A;  1QQC A;  1ARO P;  5ITZ B;  5CA1 A;  4FLZ A;  4UCT A;  3K59 A;  2LGQ A;  4DV1 O;  1WP8 A;  4LWS B;  5H9C A;  3SJQ C;  2YIB D;  5L3E A;  3CYO A;  2CAZ C;  2WLK A;  1TVK A;  4IHJ B;  5H6Q A;  3G67 A;  4JV5 O;  4MTO A;  1OCZ B;  5LGU A;  1Y74 B;  2NR5 A;  1V55 B;  1NI8 A;  4DR3 O;  2GDS A;  4YJ2 A;  3ABM C;  4I9W A;  1PPJ H;  2Z3Y A;  3ZX6 A;  1KD1 W;  5FPO A;  1SRY A;  3LDE A;  3T2M A;  4I9Q A;  3SYO A;  4E2L A;  2P5O A;  3B09 A;  2WLL B;  1KC8 W;  3CC4 V;  4MVQ A;  3UCS C;  1T5E A;  1P49 A;  4RWU A;  5EC2 C;  4IYI A;  1FD9 A;  3R65 A;  1L0N H;  4JTA B;  4TUY A;  1CXZ B;  4IGG A;  4I50 A;  4FJC C;  1PNL A;  3ZRX A;  1YI2 V;  4KHP B;  1HW7 A;  2VS0 A;  2YC0 A;  2QTO A;  1Y76 A;  2ARH A;  4Z1M G;  1PP9 H;  3T1C A;  3H1L H;  2JEX A;  3RYF B;  4DV0 O;  2V1D A;  1NR1 A;  3LSS A;  1YIJ V;  5LYJ B;  4MW8 A;  1OCZ C;  3APO A;  4X1K A;  1FXV A;  4TT3 G;  3G80 A;  3N27 A;  2EIJ B;  1V55 C;  2IBZ H;  1I0H A;  4ZI7 B;  5CB4 A;  2DYR C;  2ETN A;  5EC1 C;  1R3L C;  5CA1 B;  2EJ7 A;  4JPR A;  4BIU A;  4LFB B;  1R6N A;  2EIL B;  3HPL C;  2P6J A;  1IZ3 A;  3E8G A;  1B06 A;  3DTU B;  2K1E A;  1DTO A;  4WFB V;  4LF5 O;  2ZE7 A;  5EK0 A;  3SYP A;  2JJ2 G;  4NTX A;  2ADP A;  1EM1 A;  1F4M A;  4YJ2 B;  2CE4 A;  3BAA A;  1YJN V;  3QF7 A;  4X66 B;  2A0L A;  1L0L H;  4I4T B;  1B04 A;  3Q4H A;  2PTM A;  2H8P C;  5E1A C;  2QWP B;  2DQ0 A;  3AEI A;  4TUY B;  4JYA O;  2EIJ C;  4HAM A;  4I50 B;  4LCU C;  1QHT A;  2Q7G A;  5EIB D;  1SQV H;  1NZ6 A;  3LUT B;  1VQ8 V;  2ZNJ A;  4O4I A;  4TV9 A;  3A0H Z;  1Y76 B;  3TGU H;  1Q86 W;  2VQE O;  4MTG A;  4DW1 A;  2EIL C;  2OIE A;  4LF4 O;  3QNE A;  5KHI A;  1XUQ A;  3B4S A;  2UXB B;  3CHX A;  2F95 B;  2Y4T A;  2EZO A;  3OR7 C;  3CMA V;  5L3B A;  2OTJ V;  1MNG A;  4JI2 B;  4U7N A;  4DV7 B;  4LP8 A;  4X65 O;  3ZS8 C;  5CN0 A;  4ZHQ A;  4NYK A;  1IBK B;  1F4N A;  1W0K G;  2XAQ A;  4R7C A;  3IC9 A;  3HKB B;  4JI5 O;  3B2E E;  1EN4 A;  1KB9 F;  2GSM B;  3K58 A;  2ZM6 O;  2C2A A;  3UT5 A;  2B9Z A;  4Q20 A;  4I5S A;  4TSF G;  4F6E A;  1RSO A;  4LFC O;  3BA9 A;  2ZE5 A;  3RYI B;  4B7E A;  3BVO A;  3HKE A;  5H6R A;  3KZI Z;  5IYD O;  2QWO B;  4B3S O;  4O2A B;  2F4V B;  4DW0 A;  1YXB A;  5LP6 B;  4FM1 A;  2QA4 V;  1EFR G;  3BFR A;  4LFA O;  4NTW A;  4MVO A;  4CBC A;  3MDS A;  4TV9 B;  1VF5 B;  1J5E O;  1S0V A;  2EUL A;  5EBW C;  5B5E Z;  1I08 A;  4Q6G A;  4TV8 A;  2ZXW C;  1UJW B;  3WG7 B;  3D36 C;  1N8R W;  1WAZ A;  2PF4 E;  4UCU A;  4DV1 B;  2IJJ A;  1Y4M A;  4PA7 A;  4PV1 B;  2EIK B;  1LUW A;  2Q5Z A;  3ETE A;  3JYC A;  4PDM A;  4X89 A;  5L3D A;  1SQP H;  4LF7 B;  2ZE6 A;  1AP5 A;  3SYA A;  1SET A;  1GN6 A;  1GK9 A;  4JGS A;  4P30 A;  5LP6 C;  1GM9 A;  1HNZ O;  5EYP A;  5DN6 G;  1Q5O A;  2X6B A;  2QKA A;  4AI8 A;  2AHZ A;  2OWO A;  1HNW O;  4WFH A;  1RSO B;  2CTW A;  2P4V A;  5BXZ A;  1WB7 A;  1GAX A;  1HWY A;  5GON A;  5CA0 B;  5IJ9 B;  1KMI Z;  3T1Y O;  4MVM A;  3SGI A;  4KP4 A;  1XMQ O;  2QSA A;  2Y48 A;  2AZ2 A;  4DR6 O;  3B8M A;  3WG7 C;  1FXH A;  2VWJ A;  4QPJ A;  3I56 V;  2JJ1 G;  4DV0 B;  2EIK C;  1ORQ C;  4LC1 A;  1UFI A;  5JJN B;  3STL C;  5BR8 O;  2E75 B;  1HNX B;  3ASO B;  3WB1 A;  1CP9 A;  1FJG B;  2VRZ A;  4F4L A;  3QG5 A;  3UO2 A;  1B6Q A;  1YJ9 V;  2RN9 A;  4GKJ B;  4QPK A;  2IH1 C;  3DGE A;  2WLI A;  2EZP A;  4MVS A;  3D3Q A;  2HEP A;  1R3I C;  3STZ C;  4FLT A;  1Y6X A;  1XIL A;  1V54 B;  5KA6 A;  2YEV A;  3ZHR A;  3RFR A;  2FYU H;  2B5U A;  1TUB A;  3CJH A;  3JAL A;  5JCO A;  2XND G;  4JYY A;  4GKK B;  4H13 B;  3A0R A;  4O4L A;  4FM0 A;  2GTS A;  2PI5 A;  4GX1 A;  5B66 Z;  4NTY A;  2AXT Z;  3SJB C;  5GON B;  4HBN A;  5LBQ A;  2GHY A;  3HR0 A;  3CRR A;  1N33 B;  5BY1 A;  2F1M A;  3CS5 A;  1F23 A;  3P3N A;  1JMK C;  3H1H H;  2Y69 C;  1KQS U;  1FKA O;  4X20 B;  2R70 A;  4ZKI A;  2R9R B;  3JCU Z;  4EEQ A;  2VQE B;  4QNH B;  1BGY H;  4X62 B;  1WJZ A;  3K5N A;  3M8A A;  2NN4 A;  3UQ8 A;  4JI0 B;  1MOF A;  5FNV A;  1V54 C;  1ROP A;  2Y4U A;  4DV6 O;  2P06 A;  1XBL A;  4J41 A;  4I0X B;  3ZED A;  4XDJ A;  2QR4 A;  3SPC A;  2Q9L A;  4GZR B;  4DR5 O;  4YHH B;  1JA8 A;  2V7Q G;  2WLI B;  1D2D A;  4X65 B;  3ZRW A;  4DO2 A;  5IY5 B;  3E86 A;  4UUJ C;  4W4K A;  4NR1 A;  1AR1 B;  2OYQ A;  4UB6 Z;  5LMN B;  4JAA A;  3J80 N;  2Q68 A;  4JTD B;  4P2Z A;  1TUB B;  3CJH B;  3H1I H;  3RYC A;  3RWR D;  4LFC B;  4LNU A;  4WFA V;  2JGD A;  3WFV A;  2PUS A;  5LXT B;  4DR1 O;  5KHK A;  4OX9 O;  4UV8 A;  2YXL A;  5KUK A;  4JI8 O;  1JQ0 A;  4O4L B;  1M90 W;  4PA9 A;  1XNQ O;  4JI6 O;  2IU3 A;  3FB6 C;  3UO3 A;  3ABT A;  3IAY A;  3K0D A;  1MSD A;  3CB2 A;  2JRI A;  1RPR A;  4XDK A;  1Q6U A;  3CC2 V;  4LFA B;  4K0K O;  4YXW G;  2QKC A;  1O9G A;  3CCS V;  1HDJ A;  5K1P A;  4J7K A;  2BTO A;  5LOV A;  2UU9 O;  3R66 A;  2QTS A;  4GX2 A;  3RYH B;  3TXQ A;  3BY6 A;  5ITZ A;  1COW G;  1UPG A;  2IJI A;  2BOC C;  3MD0 A;  2UXC O;  4LWS A;  5LMU O;  4RUF A;  5IY5 C;  5FNV B;  4IHJ A;  2RDC A;  2WLN A;  1YEW A;  3F7Y C;  4FLX A;  4JI1 B;  4LF9 B;  2N04 A;  2E5L O;  1BQ0 A;  2DOS A;  1IVS A;  1FXK C;  1N4C A;  4NXM B;  1SKV A;  4AHC A;  3ZRW B;  2FL4 A;  2JS3 A;  2NLJ C;  4JI7 B;  2WLL A;  1FPO A;  3OTF A;  2RQ6 A;  3VQV A;  4NXN O;  1Q90 D;  3ABU A;  4MT8 A;  4J7J A;  2QWN B;  3ZMS A;  4DUZ O;  2Z5U A;  1PV0 A;  2ZIN A;  4DV5 O;  4B08 A;  4LNU B;  3SPH A;  3VQX A;  1AI7 A;  4UCS A;  2PI4 A;  3ZRV A;  5H5N A;  4GCZ A;  3A2F A;  4WF9 V;  1XMQ B;  1THZ A;  1R73 A;  1G6U A;  4PDR A;  3RYF A;  3SPG A;  2P67 A;  5LYJ A;  2F93 B;  2B1I A;  5KHH A;  1R3J C;  2OTL V;  2Q6A A;  3L73 H;  1FFT B;  5IWA B;  4AQY B;  2A9H A;  3RBZ A;  2W6I G;  5EZY B;  3L71 H;  2OCH A;  4PDV A;  2ZDI C;  1WB8 A;  4IL6 Z;  2YSU B;  4X1Y A;  1BHB A;  2HHH B;  4DV3 O;  3SYC A;  1Q7Y W;  1N34 B;  3DSQ A;  4TOI A;  1JFF B;  2JDI G;  1DGS A;  1TAE A;  4DR7 B;  4MW3 A;  1LUV A;  4J7Z A;  2WLJ A;  3MHS C;  3B77 A;  2DYR B;  3O65 A;  2WAM A;  1LNQ A;  2CH7 A;  2WA4 A;  1S76 D;  3CD6 V;  3LNN A;  4I4T A;  2GUZ B;  1K7D A;  4U3J A;  4JI4 O;  4G27 B;  3T1H B;  4FLV A;  5KMG A;  1N32 B;  4JAS A;  3BA8 A;  2BE3 A;  4QE9 A;  4CC6 A;  1JOY A;  1DLB A;  1K9M W;  2IW5 A;  3CCE V;  1P4R A;  4FM2 A;  2RCV A;  3K04 A;  4BW5 A;  5FL7 G;  2UUC O;  1Z5V A;  1K5S A;  1R1B A;  5F2V O;  1HR0 B;  1U97 A;  1G1X B;  1TA8 A;  1P84 F;  4RAI A;  3P32 A;  1QLN A;  4B3T O;  1Q82 W;  1IBL O;  3ASN C;  5L3F A;  4MS2 A;  3L72 H;  4X1Y B;  3F5T A;  3LDC A;  4H37 A;  1H8E G;  1D5N A;  2M6Y A;  3SR2 C;  4RQE A;  1SQX H;  3D36 A;  4GX0 A;  3W7U A;  4RUE A;  3HKB A;  1BE3 H;  2UXD B;  1AI6 A;  3G4S V;  2R72 A;  1OCR B;  2VQF O;  1VQ7 V;  1AIL A;  2CH7 B;  3N2G B;  1GKF A;  3RYI A;  1Y67 A;  5FPR A;  2BOB C;  4YY3 B;  1NR7 A;  1WA8 A;  3OTO O;  4O2A A;  1I94 B;  4FIP C;  5IYZ A;  4U3J B;  5LP6 A;  4DV4 B;  1MG1 A;  3RGB A;  4JI8 B;  5KMG B;  4OPH A;  3JD1 A;  1VQO V;  1VIB A;  1NU1 H;  3C3S A;  2H94 A;  2EBO A;  1S77 D;  1NS1 A;  3GWO A;  3G6B A;  4GT1 A;  1BMF G;  1QU7 A;  4UCO A;  3K3W A;  5JQG B;  4B3R B;  2KQX A;  2W0F C;  2P90 A;  3P3P A;  4ZOL B;  3E35 A;  4DV2 B;  3SJC C;  3ZIA G;  3E8H A;  2ITD C;  2UXX A;  4XDL A;  1IXM A;  1K73 W;  1RM1 C;  1MMM A;  2FKX A;  4OXS A;  4LH7 A;  2F23 A;  3K5M A;  1OCR C;  4ABM A;  4ZBM A;  5B1O A;  4FZ1 A;  2R9A A;  1AB3 A;  3E83 A;  3AK1 A;  1Q81 W;  5KAI Z;  3CCJ V;  2A79 B;  3E22 A;  2GBO A;  5LHG A;  3RVZ A;  3D8C A;  4YIO A;  3JSN A;  4K8Z A;  2ZXW B;  3UKM A;  2QM8 A;  2ILM A;  3ICX A;  2HLD G;  1YVW A;  4HYO A;  3KKY A;  3JAR A;  4W4L A;  1YZB A;  3ZMV A;  3ZMT A;  3T4Z A;  5B1B B;  3THO A;  2ZCE A;  4L8J A;  3M99 B;  1M9N A;  3A0B Z;  4WBN B;  3WU2 Z;  1K8A W;  1GN2 A;  2LFR A;  1GM7 A;  4LF8 B;  1GN4 A;  3K03 A;  5CA0 A;  5IJ9 A;  4EFB A;  1WA8 B;  1MZF A;  3H1K H;  2YXY A;  1Z2G A;  1YCI A;  5IYZ B;  4FZ0 A;  1IBM B;  2WA3 A;  5IT9 N;  4QIW F;  4WFF A;  1DF4 A;  3NR7 A;  4EKW A;  2D3O W;  3FX7 A;  5EBL C;  4ICG A;  3AG2 B;  4R8C A;  4DUY B;  3I5D A;  4HNA A;  2IM9 A;  2KG7 B;  1N0J A;  4JYB A;  4R6Z A;  1QR8 A;  4PD4 F;  3AG4 B;  2Q73 A;  3ABK B;  2DYS B;  1BQZ A;  1M1K W;  2IJH A;  4H33 A;  3JAS B;  5K1X A;  4I55 A;  4J10 A;  4D7T A;  4DV3 B;  5B1B C;  2PGG A;  5C8Y B;  4JV5 B;  1JVM A;  1OCO B;  1OCC B;  4MVZ A;  2XT9 A;  4O4J B;  1I7F A;  1VF6 C;  4DR3 B;  5KAF Z;  1WN7 A;  3E22 B;  1SQF A;  2WLH A;  2F66 C;  3JAR B;  4DR2 O;  5KUM A;  3K9S A;  1NH2 B;  3JAW B;  2HP8 A;  1WLE A;  1VQ4 V;  1M4U A;  4QJF B;  1IDS A;  3AG2 C;  1MZE A;  3CPW U;  3B8N A;  3VBB A;  1K34 A;  3CCU V;  3UM7 A;  4EFE A;  1B3Q A;  2ZIM A;  1PKX A;  3AG4 C;  2QWQ B;  3ABK C;  1SQG A;  1WPX A;  4X20 A;  1N36 O;  2DYS C;  3OD4 A;  1J95 A;  3BPZ A;  2CTQ A;  4P9P A;  3S3W A;  4WFG A;  1ZUQ A;  5LHH A;  1OCO C;  1OCC C;  2XAH A;  3W7S A;  3JSL A;  3WB0 A;  1OZ0 A;  4HNA B;  2BTQ B;  1Q6I A;  1YHQ V;  3JAK A;  3CE2 A;  4XBF A;  1PM9 A;  4B7K A;  4B3M O;  3BHP A;  4I0X A;  2Y69 B;  2UUA O;  4E4E A;  1XMO O;  4TWK A;  2UXN A;  3K0G A;  4I55 B;  1PL4 A;  1YF2 A;  4OGQ B;  2A06 H;  4DK0 A;  1CEZ A;  1VAR A;  3EVK A;  4LF5 B;  2LW1 A;  3AG7 A;  3FD9 A;  2ZE8 A;  2LW7 A;  4JAU A;  1FXK A;  1XNR O;  4CC5 A;  3AG3 B;  1AJP A;  4UV9 A;  5LXT A;  2DW4 A;  1P7B A;  2YI8 A;  3KCY A;  1MA1 A;  3ZHS A;  4ASU G;  3O9O A;  2CUG A;  1H2N A;  2WPD G;  3CCV V;  5FLX N;  5DM6 V;  1Z5W A;  4JYA B;  3ETD A;  5KX5 A;  5A9G A;  3HKC B;  3GB7 C;  1SQB H;  2JS5 A;  3QTC A;  3J81 N;  1GM8 A;  4F6R A;  1VQ9 V;  3SYQ A; 
#chains in the Genus database with same CATH homology
 1JPX A;  3ABU A;  4MT8 A;  2EIL B;  3HPL C;  5LGT A;  3VOU A;  2P6J A;  3ZMS A;  3E8G A;  3K08 A;  1Y66 A;  3DTU B;  2K1E A;  1PL0 A;  1DTO A;  2Z5U A;  4WFE A;  4WFB V;  1G4Y B;  3ZN1 A;  5IYC O;  3CME V;  3SPH A;  5EK0 A;  5HFL A;  4KUM A;  3SYP A;  1AI7 A;  2JJ2 G;  2PI4 A;  2IH3 C;  4JF3 A;  3ZRV A;  1F4M A;  4J9Y B;  4GCZ A;  3JCZ A;  1YJN V;  3JD0 A;  4WF9 V;  2WLM A;  4FMT A;  2A0L A;  1THZ A;  1R73 A;  5B3S B;  4PDR A;  1YIT V;  3SPG A;  1M57 B;  2P67 A;  3KG2 A;  2B1I A;  4PDL A;  4CZZ A;  1R3J C;  2OTL V;  2Q6A A;  1H2G A;  1ZWI C;  1FFT B;  3AG3 C;  4RQF A;  2H8P C;  1R3K C;  3LSQ A;  5E1A C;  2A9H A;  2HJF C;  5BZB A;  1KP2 A;  2ZDI A;  3RBZ A;  5IYB O;  2W6I G;  2DQ0 A;  3AEI A;  4KFM A;  4FK5 C;  1TUE B;  2OCC B;  3OFN G;  2EIJ C;  4R50 A;  4HAM A;  3FB7 C;  4PDV A;  4LCU C;  2ZDI C;  2YSU B;  3CCR V;  4QE7 A;  1GTO A;  4MTX A;  1K3E A;  1BHB A;  3LUT B;  3ZCC A;  1VQ8 V;  3CC7 V;  3SYC A;  1Q7Y W;  2ZQM A;  2DWE C;  1FXK B;  1Q86 W;  2JDI G;  1JJ2 U;  4MTG A;  3JD3 A;  5EBM C;  3W7W A;  2EIL C;  4MW3 A;  4MVR A;  3EHB B;  1W0J G;  1I5X A;  3QNE A;  2WLJ A;  3OW2 U;  1QBZ A;  2ZD9 A;  3MHS C;  3B77 A;  2DYR B;  2WAM A;  1LNQ A;  2CK3 G;  1H38 A;  4N21 A;  1S76 D;  3CD6 V;  1RPO A;  1M56 B;  2EZO A;  3OMN B;  3OR7 C;  5B3S C;  3CMA V;  1VQN V;  5L3B A;  2OTJ V;  2F43 G;  1YJW V;  1M57 C;  1K7D A;  2X6A A;  1S72 V;  1QVF U;  1E1R G;  2ITC C;  4U7N A;  3OEE G;  4LP8 A;  4G27 B;  5CN0 A;  3ML0 A;  3FKS G;  1F4N A;  4JAS A;  1DF5 A;  1W0K G;  2EIN B;  2XAQ A;  4QE9 A;  4R7C A;  3ZRS A;  3G6E V;  1S5H C;  1F51 A;  2OCC C;  2GSM B;  1K33 A;  2W6J G;  4RO2 A;  4BAY A;  2JK5 C;  1YTF B;  1JOY A;  1VQ6 V;  2C2A A;  1DLB A;  4Q20 A;  4I5S A;  4TSF G;  1NVP D;  1BHA A;  1K9M W;  3JD4 A;  2IW5 A;  3CCE V;  4PA4 A;  3NXS A;  1P4R A;  3K04 A;  4BW5 A;  5FL7 G;  1I5Y A;  1L1F A;  3HB3 B;  1K5S A;  5H6R A;  1K5Q A;  1VQP V;  5IYD O;  5CBF A;  1FS0 G;  3E8F A;  4HZ3 A;  5CMU A;  2IU0 A;  4RAI A;  5HFM A;  2QA4 V;  3P32 A;  1E79 G;  3LNM B;  1QLN A;  3ABL B;  1AJN A;  1EFR G;  2HVK C;  1Q82 W;  5B1A B;  3ASN C;  5L3F A;  4MS2 A;  3LDC A;  1M56 C;  3LDD A;  4H37 A;  4MVO A;  1H8E G;  4CBC A;  4MSW C;  4DXW A;  5IDJ A;  4RQE A;  1S0V A;  3D36 A;  4GX0 A;  2HVJ C;  5KA5 A;  3ASO C;  5EBW C;  4RUE A;  3W7U A;  1NJI W;  1GMG A;  3JD2 A;  4G28 B;  3W7X A;  2ZXW C;  1AI6 A;  2JEU A;  3G4S V;  1UJW B;  1MAB G;  3WG7 B;  1SES A;  1OCR B;  1N8R W;  2EIN C;  1VQ7 V;  1QCE A;  2IJJ A;  1Y4M A;  4PA7 A;  1E1Q G;  2QKS A;  1K97 A;  3TET A;  3OUS A;  2EIK B;  1GKF A;  3ETE A;  3JYC A;  2HG5 C;  1R6K A;  1KP3 A;  1PNK A;  2BOB C;  4PDM A;  3OEH G;  1NR7 A;  4X89 A;  3AG1 B;  5L3D A;  3TK1 A;  2LP7 A;  4PA6 A;  2QEX V;  4FIP C;  1K92 A;  3H01 A;  3SYA A;  1MG1 A;  1XL4 A;  1SET A;  3ZJZ A;  1NQT A;  1GK9 A;  3JD1 A;  3F5W C;  4JGS A;  4P30 A;  1VQO V;  1GM9 A;  2H94 A;  2B1G A;  5DN6 G;  4JYC A;  5C93 A;  2EBO A;  2X6B A;  4MVU A;  1SZT A;  3ABL C;  2AHZ A;  3IFX A;  1S77 D;  2ATK C;  5B1A C;  3GWO A;  4U7O A;  4WFH A;  4GT1 A;  3CP1 A;  1BMF G;  3K3W A;  2W0F C;  4JTC B;  4UXN A;  2P90 A;  2X0L A;  1HWY A;  3E35 A;  1GO3 F;  3ZIA G;  1BL8 A;  4X88 A;  4MVM A;  1VQK V;  3E8H A;  2EIM B;  3QO5 A;  4KP4 A;  3CXC U;  2YEV B;  2ITD C;  2UXX A;  2Y48 A;  1IXM A;  4X8A A;  4XDL A;  3ASN B;  3CCL V;  1K73 W;  1RM1 C;  2HFE C;  4OXS A;  3B8M A;  3OGC C;  3WG7 C;  2XAJ A;  1FXH A;  1OCR C;  1OHH G;  5GW7 A;  3D3I A;  1S3J A;  4ZBM A;  5B1O A;  4QPJ A;  3I56 V;  1SER A;  1AJQ A;  2JJ1 G;  3BEH A;  3FB5 C;  4FPP A;  3E83 A;  3SPJ A;  2EIK C;  1ORQ C;  4LC1 A;  1Q81 W;  3STL C;  3CCJ V;  3ASO B;  2A79 B;  2IJK A;  5LHG A;  1CP9 A;  1QLE B;  3RVZ A;  1MSW D;  2DQ3 A;  2ZXW B;  3AG1 C;  3UKM A;  2M7W A;  4F4L A;  3T4D A;  2QM8 A;  2HLD G;  4HYO A;  1B6Q A;  1YJ9 V;  2Q67 A;  3ZMV A;  3ZMT A;  1ENV A;  2WWW A;  3T4Z A;  5B1B B;  4GX5 A;  4QPK A;  2IH1 C;  3M99 B;  3DGE A;  1M9N A;  3X2Q B;  1NVP B;  2WLI A;  2EZP A;  3OMI B;  2X7R B;  4MVS A;  1K8A W;  2LFR A;  1GM7 A;  2KB1 A;  4J9Z B;  1R3I C;  3FYE B;  3K03 A;  2ZR3 A;  3STZ C;  2NNU A;  4MTF A;  1V54 B;  3ZN0 A;  5KA6 A;  2YEV A;  1QR9 A;  4QIW F;  1VQM V;  4L87 A;  4WFF A;  2B5U A;  1DF4 A;  2EIM C;  3IGA C;  2QM7 A;  3OUF A;  4EKW A;  2ZR2 A;  2D3O W;  5EBL C;  2OT5 A;  2XND G;  3W7T A;  3AG2 B;  4R8C A;  3EFF K;  2P7T C;  4P9O A;  3A0R A;  4PEL A;  2XAS A;  2EJR A;  4JYB A;  2PI5 A;  4GX1 A;  1EZJ A;  4R6Z A;  1QR8 A;  1K4D C;  1H8H G;  1QLE C;  2XAF A;  2Q69 A;  5LBQ A;  3AG4 B;  1RM1 B;  2GHY A;  1PNM A;  3ABK B;  3RVY A;  3I55 V;  2DYS B;  3OMA B;  5L3C A;  1M1K W;  2IJH A;  4H33 A;  1F23 A;  3F7V C;  4UVC A;  2Y69 C;  1KQS U;  4UVB A;  5B1B C;  5L3G A;  4ZKI A;  1JVM A;  1OCO B;  2R9R B;  1OCC B;  4MVZ A;  2WSS G;  3ABM B;  3X2Q C;  3CCQ V;  2AHY A;  1KEC A;  2X6C A;  3K9A A;  4QNH B;  3E8B A;  1QVG U;  3OM3 B;  5B1N A;  2HR3 A;  3K79 A;  1PD3 A;  3E2E A;  3K06 A;  1MOF A;  2HKO A;  3QO7 A;  1V54 C;  2WLH A;  1ROP A;  1W2B U;  4LBE C;  2LFS A;  3ETG A;  2DWD C;  1CPY A;  2JIZ G;  4N23 A;  1VQL V;  1VQ5 V;  1NH2 D;  5KUM A;  4XDJ A;  1NH2 B;  3SPC A;  1VQ4 V;  1WLE A;  4QJF B;  4PA3 A;  2V7Q G;  3AG2 C;  2WLI B;  3E89 A;  3RW0 A;  3ZMZ A;  3ZRW A;  1AI4 A;  1NKD A;  4WCE V;  3CPW U;  3B8N A;  3VBB A;  1K34 A;  3MHH C;  3CCU V;  1ARO P;  3UM7 A;  4DO2 A;  5IY5 B;  3E86 A;  4UUJ C;  1AR1 B;  1PKX A;  5H9C A;  3AG4 C;  3SJQ C;  5L3E A;  3ABK C;  3CYO A;  1WPX A;  2Q68 A;  2WLK A;  2DYS C;  4JTD B;  4P2Z A;  5H6Q A;  4MTO A;  1OCZ B;  1J95 A;  5CBH A;  5LGU A;  1NBM G;  4P9P A;  4WFA V;  4WFG A;  1V55 B;  1XL6 A;  3WFV A;  5LHH A;  1OCO C;  1OCC C;  2XAH A;  3ABM C;  4UV8 A;  3PJS K;  4I9W A;  3W7S A;  3FYI B;  2Z3Y A;  3P30 A;  1OZ0 A;  5KUK A;  1EBO A;  1JQ0 A;  3OR6 C;  5LGN A;  1YHQ V;  4PA9 A;  1M90 W;  1KD1 W;  2IU3 A;  3FB6 C;  3TCU A;  5CA3 A;  4XBF A;  1SRY A;  3SPI A;  3LDE A;  3ABT A;  3T2M A;  3SYO A;  1KKD A;  4E2L A;  2R9I A;  2WLL B;  3K0D A;  1KC8 W;  2XOK G;  2Y69 B;  3CC4 V;  4MVQ A;  3ZMU A;  1RPR A;  4XDK A;  5LHI A;  3CC2 V;  3OAA G;  4YXW G;  4TWK A;  3CCS V;  5EC2 C;  2UXN A;  2XAG A;  3R65 A;  3K0G A;  3FB8 C;  3QO8 A;  4JTA B;  4G2K A;  1JX9 A;  4GX2 A;  3BY6 A;  5J9P C;  1COW G;  1CEZ A;  2IJI A;  4FJC C;  2BOC C;  3MD0 A;  2FTK A;  1PNL A;  4RUF A;  4JAV A;  3ZRX A;  1YSC A;  1YI2 V;  1YTF D;  5IY5 C;  2QTO A;  4JAU A;  2WLN A;  1FXK A;  3F7Y C;  4Z1M G;  3T1C A;  3AG3 B;  3CCM V;  1AJP A;  2JEX A;  5CBG A;  4UV9 A;  2V1D A;  1NR1 A;  3LSS A;  4UVA A;  1YIJ V;  4BIZ A;  1K4C C;  3G71 V;  4MW8 A;  1OCZ C;  1FXK C;  2DW4 A;  1AI5 A;  2QE7 G;  1FXV A;  1P7B A;  4TT3 G;  2EIJ B;  4ASU G;  2MK3 A;  1V55 C;  2WPD G;  3CCV V;  3ZRW B;  5DM6 V;  3IC7 A;  3ETD A;  3OE7 G;  2NLJ C;  2WLL A;  1JCH A;  2DYR C;  3GB7 C;  5EC1 C;  1R3L C;  4JPR A;  4BIU A;  1GM8 A;  1VQ9 V;  1R6N A;  3SYQ A;  1G8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...