3T1HJ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 8
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 3t1hJ00
4DV3J 1XNRJ 1N36J 4JI4J 4LF7J 4DV7J 3W1YC 1N32J 3R2DJ 2F4VJ 4DV6J 2KVQE 4KYZA 2UUCJ 1IBLJ 4KHPJ 1XMOJ 4K0KJ 1IBMJ 1HR0J 4DR2J 3J81U 4JV5J 4V1Ak 3JAMU 4X65J 4LF5J 4DR6J 1HNXJ 4LF9J 4X62J 1N34J 2VQFJ 4JI3J 4DR5J 2HHHJ 4B3SJ 1HNWJ 4X66J 4GKJJ 4DR1J 4DV0J 2UUBJ 2VQEJ 3IMQJ 4HHUA 1I94J 1HNZJ 4DR3J 5FLXU 4LFBJ 4DUYJ 4NEYA 4YY3J 5LMUJ 4X64J 4JI0J 4NXMJ 4RJVA 2ZM6J 4NXNJ 4YHHJ 4DV1J 2KL8A 2MEWA 3D3CJ 3R2CJ 1IBKJ 4JI1J 2MQ8A 4LF4J 4JI7J 4JYAJ 2UXCJ 4DR7J 4B3TJ 5AJ3J 4DV5J 4DUZJ 4DV4J 4OX9J 3J80U 4GKKJ 2MTLA 4DR4J 4AQYJ 3T1HJ 4JI2J 4LFCJ 5BR8J 4NEZA 1J5EJ 5LMNJ 4JI6J 1XNQJ 1XMQJ 2UUAJ 4LFAJ 2UU9J 4JI8J 5LM7E 1N33J 4LF8J 3T1YJ 5IWAJ 2UXDJ 4JI5J 2UXBJ 4B3RJ 3D3BJ 5IT9U 4PWWA 3J7AN 4DV2J 4KY3A 3OTOJ 2E5LJ 5A2QU 4LF6J 4B3MJ 1FJGJ
chains in the Genus database with same CATH superfamily
1NU4A 4F4KA 3AODA 2PI4A 4XAKA 4LR7A 5KFGA 5CH7B 4YHHF 3BGUA 3MD1A 3GTYX 1ZH5A 2HFSA 9RUBA 8ATCB 3M32A 3BGLA 1FKOA 4BCAA 1IWAA 3TARA 2J0QD 3EXCX 4URQU 4LSNA 3TR5A 2HNYA 1U0SA 4AL6A 4X66J 1O51A 3IS9A 2GQ2A 4USKA 2VV5A 4DR3J 2XGQA 3N6LA 1T3NA 1X4FA 1GMWD 2D3O1 2RSQA 4DSLA 2J0XA 4L72B 3ZTSA 1UAWA 4TVAB 2M8HA 3KLVA 4BHQA 1HBOB 1YSJA 1Q79A 3DOKA 1N5TA 1Y9OA 2YWWA 1HQUB 4IRDA 4PQUB 4CH1A 4ZS6A 4AQYJ 4YB6A 2IFXA 5BR8J 4F3QA 2XLJA 3T6BA 2ROEA 1KN6A 1TL1B 4N56A 4IG3B 3CO9A 3IM8A 1U09A 2AYEA 2RMLA 2QTWA 1H98A 2HHSA 1KLMA 1KHVA 1RAFB 1BQNA 2JDJA 1FXRA 4RU2A 3DRPB 4RZRA 4A8OA 2A1BA 2ZE2A 2CQ2A 4GVBB 4LIRA 5FDLB 1IR1A 4CLYA 2CZ4A 5D8HB 2XTJP 2X1BA 5KFRA 1DURA 2WVDA 4TYAA 3J7YU 2HQGA 4FPRA 4DPXA 1TUWA 1KTQA 3ENAA 1YJ9S 2VPZB 1TR0A 4U8VA 4WTOB 3CMQA 2B4UA 4L75A 2L9WA 4JI0F 3IMQJ 4Q0BA 4I4BA 2KB2A 2YNFA 3Q24A 5LMNF 2HK2A 1EKRA 3L95X 4ETXA 2JC1A 3AHPA 2HHQA 5G0RA 4CLZA 1S1UA 5AE1A 1YVFA 1FRIA 5CZVA 4A47A 3N79A 1Y5NB 1OWXA 2ERRA 1RTDB 2V8PA 3CXCR 2AGQA 1PO6A 1N32F 1ZAWA 4F04B 2G0CA 3OD2A 3E51A 3QIDA 2RVJA 1UA0A 3HZEA 4WF9Q 2RU3A 1C0TA 4FPIA 3GIMA 2DEJA 1RWOB 2P9CA 2V50A 2JNJA 2WHOA 2WONB 1JK9B 4F2SA 1JLAA 1UTAA 3KJFB 2HWTA 4C8LA 4HL9A 4DLEA 2CJQA 2O1PA 3H2UB 2UXCF 4TXSA 3KFWX 4WE1B 5B0EA 1LWFA 4KFBB 4QIGA 3NAHA 1J5EF 4KPCA 3OTCA 1ICEB 2DRBA 5KG4A 1NB2A 1SC4B 3G6VA 1JLFB 5KT6A 3T1YF 2OPRB 1P1LA 1S77D 4FKYA 3MF5A 1C2PA 2DO4A 4XDDA 4RNOA 2DNLA 3T6JA 5KFTA 3TEHB 4I67A 4B3MF 3RU0A 2H1YA 4OV6A 2F8EX 1MN9A 3R8YA 3D0HE 4YOEA 3DNCA 4F36A 3EX7B 3G2XA 2E1MC 4PAAA 2DY9A 3MTJA 2IYIA 2Q6BA 1KQFB 2K8GA 1WDTA 3MUTP 1FWPA 2OSQA 3D0IE 4K4YA 1F2HA 3DOLA 1FVQA 2HHHF 2R7QA 2FJXA 3OR1A 2OMLA 2QLBB 2RIJA 1AROP 4ECVA 1RYSA 3BPDA 1NK4A 4WXOA 2RHQB 4L3KA 1TQLA 3QO9B 3OJSA 1LXNA 4RWXA 3O44A 1R0BG 3R7BB 3D7SB 3H5XA 2ACYA 2ZNZA 5HBMB 3KK2A 1HNZJ 1UPMB 1FI4A 4QCLA 3LP2A 1YBTA 2ZBRA 4A8MP 3FJ2A 2BJ8A 1VQ9S 3HHLC 5EN1A 4NMXA 1MG7A 2Q1LA 4IH7A 1FVSA 1AYEA 2ZVIA 2Z57B 4WPAA 1AUDA 2JL9A 4QOTA 4B3RJ 2FJAB 2NPIA 4DV2J 3B78A 1Q0NA 3PX0A 2DEIA 2FHMA 2MQMA 3VALA 5E0OA 2WW4A 1VC0A 1MLAA 3MD3A 1GQEA 1OPZA 3I6PA 4YY3F 3KDNA 4KYZA 2WOMA 1RE1B 1HI0P 4I2QA 3C19A 4ZVQB 1Q5YA 3ZO7A 2DYAA 4XO0A 1SB6A 3TJAA 4PXBA 4OQJA 4C11B 2DGXA 3R1HA 2UVUA 4OI4A 1VQKS 4KV8A 1V9OA 4OX6A 3FUYA 3KLHB 2OD6A 2Z4PA 1N5YB 2NYIA 2C2ZB 4LJMA 2VBYA 2MSTA 2ZKUA 4DUZJ 4GKKJ 1T9TA 3C16B 1SXLA 1ZAVA 4K8RA 1RT2B 4KT0C 4C3KA 5ETRA 4KKOA 1OPIA 1S4FA 2G0JA 2IBKA 1HKAA 5B0BA 1M5KC 3WX8A 3GG0A 1VLYA 1X9WA 1AT1B 4PCQA 5D4PA 5DQIA 3DRRA 3GONA 3K59A 2NS1B 3MDFA 1RWWB 2XG8A 3B8HA 4J7CA 1ULRA 4KSEB 1S76D 4X2BA 4IFVB 2G9OA 1LWXA 1V3ZA 1TV6B 4DFJA 1HNVA 1YJ7A 2B6AA 2DBBA 1VGYA 1A9NB 4P7VA 2PT0A 4ZCKA 2DIVA 3AOCA 4DV4F 2ZWPA 1JIHA 2ZEJA 1PAEX 3OFFA 5LJ5Y 3TRGA 4ZKAA 2QN6B 1RDRA 4MKBA 2HWIA 3UPFA 3QT5A 1WOPA 3GYNA 3S01A 1R89A 3MAHA 1SKWA 3L7PA 1H72C 1FKPB 3DC2A 1OY6A 1PKUA 5B0GA 1T05B 2IA6A 3Q8SB 2UUAJ 3PACA 1LK5A 4O4GA 2RKIA 3UD3P 1CJVA 3D68A 2OO4A 3PZPA 5KFPA 2F8MA 3VHQA 1RWXB 4S0MA 2WVEA 4DDFA 3LOUA 3RYLA 1K8AT 2L9DA 1QSLA 1OYDA 3GIIA 3W62A 4ELUA 3TA0A 4ILRA 4ZVRB 5CA5A 2JHEA 5IV3A 5DG8A 5DDPC 2FHJD 2CPZA 1EB0A 2QRRA 2B7BB 3PW4A 5CHCB 3MMAA 3KUGA 1ZZNA 4P9SA 4CT8A 1WKLA 4F4AA 3IAM9 2W01A 4K4UA 2XMUA 1M5OC 4JYAJ 1SJRA 4IO9Q 5D6GA 3PIOQ 2HKEA 4ZHRB 2QA1A 4ECUA 6FDRA 4CIOA 3UD4P 1U2CA 4ZPTR 4NLSA 4C3LA 1HR0F 3LP0B 4HI2A 1RAHB 1FHTA 2DR8A 2B4OA 4B3RF 1LV5A 3TYTA 3K5MA 2HBQB 1HNWF 5HVFA 3A3NB 3HHNB 1UFLA 2FTRA 4KRWA 3A8KA 1RT3A 5EWGA 1Z1ZA 2GQCA 2MLZA 5DM6Q 4ZPDA 4ZIVA 5KT7A 1FXLA 2UVRA 1RT7A 5KG0A 3D4JA 3BREA 1T02A 4Q2MA 2AIRB 3CJ3A 4PRFA 4F50A 2KZMA 1HWUA 5KFXA 2ASJA 1NUEA 4X4TA 2M70A 1DLOA 4WYWA 3W65A 3I82A 1W7WA 2MQOA 1B3TA 1GTEA 1T7PA 5K5MA 2YX4A 3RW7A 3FGVA 3OTDA 4X4VA 3QRPA 2OUGA 3IXQA 3W9IA 5KT3A 4TU9A 4Y28C 3L09A 3RB0A 2XCPA 3SYZA 1NHKL 2HNDA 1C4CA 1D3WA 2NXEA 5T14A 3PX4A 1KTVA 4PYDA 4C4WA 1RCXB 2DNQA 2RHSB 2MQPA 1JLQA 3N0VA 2GNKA 1WG1A 5IZHA 4A8QA 3MFIA 1R43A 1R8CA 1U1QA 1R6VA 3W9JA 2V67A 4DV7J 1KVIA 2OPSB 3IBWA 3NGDA 1S0VA 4QW8A 2AU0A 1RBAA 4HDGA 1FK9A 4DEZA 2HIQA 4G1PA 4OYXA 4DR7F 1EETB 1WWHA 1U48A 3CVKA 3RB6A 2R7OA 4EU0A 1FERA 5C2CA 8AT1B 4H4KA 3MM9A 4YB7A 5E5NA 1CPZA 3TJ9A 3NBPB 1WSVA 1U7LA 2B9XA 2QT7A 1UWBB 3MUVP 2MZRA 2MZTA 3OLAA 1VLOA 2XYGB 3W61A 3FEYB 5F8IA 2E5IA 2IRYA 3HD2A 4P71A 4LF6F 2I6WA 1JX4A 4DV3F 5CD4H 1UVNA 2EC2A 3HFKA 1HD1A 2OP5A 2UUAF 2Y0BB 4DL3A 3T5JA 2M2BA 3CGIA 1K73T 5ETLA 1URRA 3G6XA 2HS0A 3PW2A 3HLUA 4NYPA 4CTAA 2JH3A 3VAHA 4IR9A 1Y3KA 4DXLA 4OHXA 2W2PP 4HT5A 1M0SA 1TUGB 3RB4A 1F2GA 4LF4F 1RAOA 2FIUA 2JFKA 3BZQA 3HJVA 4WK3A 1WG5A 3QFWA 2LVWA 2AGOA 3MMCB 1KDNA 5JMNA 4EBCA 5ETQA 3OPKA 5IT9Y 2HAFA 5CYQA 3SSRA 2W9CB 3PW5A 2K06A 1PCAA 1TFYA 4TU7A 2YY3A 4JYAF 3AB2B 3MPWA 1CJKB 1JLGB 5HP1A 4AUKA 2F4FA 3AQPA 2NZ4A 4K50A 1JXLA 2CWXA 1RLCL 2HAIA 1FDNA 4OI3A 5AXLA 2MHEA 2CKWA 3MM6A 4I1TA 4LBIA 2IVYA 1T94A 3RB3A 3MPUB 4LSLA 2CQ3A 2WB4A 1YJWS 1NHVA 3UCZP 2O01C 4ZPCA 3MOZA 4ECYA 2BKPA 5L9NA 4O0IA 4M5LA 2PMZD 3KK3A 3P6YC 4B9TA 4M5MA 2FVQA 2XB2D 1I6JA 4WP8A 1MWQA 2DNNA 5HMZA 1NPPA 4KHPJ 4KGXB 3PR5B 5FLXY 1X5TA 5GADI 3QRRA 3WHIA 1WG4A 3BYPA 2A2CA 2HLUA 3UN3A 3QJPA 3T9NA 2COLA 4UOCA 3LWMA 4IRCA 4RNMA 2RDDA 2KRBA 4CO2A 3CDAA 1FWKA 4OZ2A 3C6UA 1KONA 4Q43A 2ABYA 3ZXWA 4KO0B 1F5BA 3ETOA 3RRHA 3I0RA 3OXFA 2R7UA 2HQFA 3I4HX 4NI2A 3H0PA 1QSSA 2FHJA 3OTBA 1RT4A 3IWNC 1X7VA 4K2XA 4GVLA 4OZ1A 4LFCJ 2HHXA 3QIPA 4FNHA 2WK4A 1MWZA 1VFJA 2FC8A 3MM8A 3H8YA 4DR6F 3PG9A 4FYXB 3G82B 1L3SA 3CCUS 2KU7A 1IKXB 2JEGA 1YDLA 1ZTTA 2J6TA 2QG9B 4FN5A 2QLFB 3H25A 3CJ8A 1N5VA 4OHWA 1KHWA 2VG5B 4QWEA 3PO5A 2J9CA 1F6TA 1BLUA 2NQPA 4ANDA 1KQGB 3IC1A 3S1TA 3SMZA 1HNXJ 3IN5A 3IRXA 2JEJA 1IJFB 1HQ2A 3QGGA 2EFNA 1V3SA 4CO3A 4H54A 1DHMA 3Q23A 3DXSX 3SDEB 2CPJA 2QA2A 3KJQB 2HQCA 1ZA1B 1Z2LA 2CQ4A 2ZDPA 1K9MT 3QLHA 3OVAA 5C5JA 2QLWA 1L3VA 2CPYA 4DR4J 2HFUA 4M8LA 1EKSA 4OJHA 1K1SA 3ZTRA 3FDSA 1X4GA 5K8PA 2OEKA 5IT0A 2LLZA 4CLUA 4DX7A 3TUPA 2FUG9 2W9BA 3B4DA 2DHGA 3LTOA 1TAQA 1GXLA 2XEXA 1VQPS 3J7YI 1TL5A 4NLWA 4QPXA 1R31A 5E3PA 3CJQA 3BEGB 1T11A 5CD4A 4NXMF 3M2UA 1IBLJ 2YKPA 1LFPA 5DQGA 1FKAF 2HHVA 1SIWB 5C25B 1REGX 3LQVA 4UF4A 2XNQA 2GJIA 2MKHA 5KFCA 2ZH2A 3ZFVA 2NYHA 1CC8A 5KFJA 1KNZA 1UMJA 2AWZA 1E6VA 3TZYA 1S6UA 2MZQA 2GAHC 2ZDOA 5HMWA 1Q81T 3I0SB 2QIFA 2GIQA 3ZTQA 2DHAA 1QE1B 1UETA 1TK5A 5A76A 1AFIA 5J2QA 4LVOP 3F44A 4ZPAA 3TOQA 1N56A 3SIPB 2DGVA 3ICLA 4JV5F 1SCJB 4B08A 2BANA 1B7FA 1SJQA 1GT8A 2PA3A 2YH1A 4DFMA 3D5MA 2ROPA 1HBMB 4EBDA 4YDXA 3CC4S 2XS5A 4AL5A 2FVSA 3JSMB 4O44B 5KFAA 5DZ7A 4F4ZA 3TUIC 3E8OA 1NLKL 3GP9A 2CFXA 4OZ0A 1TTHB 3T41A 2IJRA 4NLPA 1F9FA 5L1LA 4IOAQ 4ZJLA 1XQIA 4OYOA 3DLKA 1UJ4A 1U2FA 4LBPA 3BGRA 3TZZA 1YX2A 4DQIA 1TKZB 1RAIB 5LSOA 1NH8A 4FF1A 2UUCF 3R1LA 4Y2MA 2QYCA 4DPUA 3NMAA 2UXBJ 3B54A 4DSJA 3M8QA 2Y9HA 1B0TA 4HTIA 5AXMA 1TL3B 1UZHA 3TA2A 2Q79A 1XNRJ 4PXDA 3VQSA 4KAIA 1OMSA 2KT3A 3HHLA 4FS2A 5E7OB 3N6NA 2R7SA 5JXSA 3BR9A 2PMWA 4PPDA 1JLBA 1SJ1A 1YJRA 1QM9A 2HSEB 5GVQA 3MEGA 5EHHA 1YZ6A 2EC0A 5KFYA 1RT6A 3O8WA 3G96A 5HVGA 3U7JA 1NDLA 5KG7A 3J7ZT 1JJ2R 3A1YG 3RTVA 2GVDA 3BR8A 3QGHA 5KFEA 4DUTA 2V9WA 4C48A 1XC9A 1U25A 3VZIA 1U1OA 4IG0B 3ILJA 3OSPA 3UDCA 1SVDA 2D74B 2O3DA 3MECA 2VONA 2FB0A 1TL7A 3KLFA 4Y2AA 2HVHA 4HACA 3PNIA 3BO3A 3BN7A 4ZLPA 1U02A 5A0YA 3C3LA 2F40A 4M5GA 1IBMF 3BQ2A 2NREA 2EG2A 1KD1T 1QTMA 3FK4A 1RACB 2LA4A 4NRUA 3MM7B 3W2VA 2XY7A 5KFVA 4J9PA 3U02A 2J7KA 1GEHA 1U1MA 1IBLF 1RZMA 3U1LA 4DV1F 1VQ4S 4DR2J 4LR9A 3M2RB 1UZDA 1CS4B 5L1JA 3AXMA 1BXNA 1OJ4A 2DNRA 1DY3A 1S72S 2C1EB 5ETTA 2C42A 3LGHA 3ELHA 2VFSA 1NJZA 1YK9A 3H5SA 4X4OA 1VQSA 3VGUA 5KFMA 2WRMA 5K14A 4DN9A 2MHNA 3R5JB 1NKBA 2WAQD 1EX8A 1FTRA 4Z37A 1NJIT 1F1BB 4A8YA 2R8IA 2V4RA 3DOMB 1SQFA 2MJNA 3OR2B 3M8SA 1ZETA 2HQDA 2CIMA 4OYZA 4C0BA 4HKQA 1PILA 2YNGA 5A8KA 1EHWA 1J5OA 1X4EA 1TUVA 3HDSA 2YKOA 4OZ3A 2VPYB 1VRTA 2VOOA 3KJVA 3NGUA 5D0EA 1VQ6S 3QWPA 4DV6J 1WSRA 1FKOB 2WBRA 4Y2IA 4TU8A 2W4DA 4LSNB 2HNYB 4LF5J 1RLDA 5HMXA 3MR5A 3IS9B 1JXEA 3EZ5A 2HG4A 2B9WA 4B3SJ 4O3OA 2KI2A 3KMQA 2VFVA 4M5IA 4DUYJ 3BQ1A 4RW8B 2CG8A 3KDOA 1HYSA 4TY9A 3IRWP 2JVOA 3SSSA 2N4CA 4EGLA 1RKIA 4OHZA 1EJ7L 1BD6A 4NA1A 4OZLA 4WU3A 5F3ZA 1WOSA 5F8LA 2DH8A 2GCFA 2AEFA 2AT1B 4EZ6A 4BC9A 2RILA 4W92B 5D4LA 2UXBF 4I6WA 3DYAA 2W2MP 1KLMB 1CG2A 2MZJA 4TLQA 2KM8B 1VQ7S 4GC7A 1B99A 1WNEA 1FRXA 2ZE2B 3A13A 1LNQA 4PABA 4DCPB 3K5PA 4AD6A 1C1BA 2KXHA 2M5YA 3X1LB 8RUCA 3ULHA 4JI3J 3I96A 3F0NA 4NLDA 3H90A 5EX3A 1ZA2B 4WXWA 4Q0BB 2YNFB 1SBRA 1R0CB 3QGIA 4JI2F 4HHUA 2LECA 4DL5A 5EGYA 3MM5A 3CC7S 3G9CA 2YNIA 3KOAA 2GMLA 3CDWA 1HL6A 4LF8F 1U0HA 5D77A 2GAGC 2UXDF 5A2QY 4C7QA 3TI0A 3IG1A 2HZAA 2SXLA 3P96A 4OZNA 2HBRB 2PE8A 1Y3JA 2VJVA 1N0VC 2W25A 1EP4B 5BJRA 4M63A 4HT7A 3V4IA 1WC1A 1CJTA 1NSQA 1FX4A 3IAS9 5GAGU 3ZZ0A 2GIRA 2K1RA 1X5PA 2J9EA 4ANEA 3M2VA 1C0TB 4R5PA 2NPFA 1KSPA 4LF9F 1YJTA 1UL3A 1FCAA 3D67A 2LU2A 5SUHA 1JLAB 1X5SA 4ICLA 4K7QA 1D9DA 5D3GA 3ISND 2WBMA 4Q5VA 2G4BA 1TZ0A 1N52B 2OTJS 2IMOA 1OO0B 1IUJA 4CYUA 2RRAA 6AT1B 4FXVA 2R2SA 4GMKA 1LWFB 4DSIA 3P8BB 2P2CB 2YWFA 3OBIA 1X4AA 4KR0B 3RBDA 4NEYA 2FJEB 5F8HA 3VGVA 3Q22A 1SJ3P 2HVDA 2IAJA 4FYWB 2BBEA 1A6LA 1S7IA 5HN0A 3SQGA 2I5JA 4GO5X 3W8GA 1QVFR 2W7OA 4ENOA 5ETNA 1YLXA 3VZHA 1G6BA 3NKYA 3T1HJ 3MUMP 1RTJA 5H9EJ 4OYPA 2BA9A 5BYSA 2V69A 1WI6A 3JQMA 2X7IA 3DOLB 2GA7A 2GW8A 3VVTA 4WBFA 3OR1B 2HLTA 2XULA 2Y8YA 2KT2A 2GHVC 1S48A 5B09A 2ZJQQ 2LEPA 2VBWA 2QA4S 3TZWA 2HMIA 2OD4A 1VK3A 1VRQC 4JI1F 3T5LA 1RHQB 3KNAA 3RAXA 2V2KA 4X62J 1T0TV 4C0OC 2G2OA 4FXWA 2LDYA 3IA0A 3CJKA 1N0UA 3NOCA 5B0AA 4F67A 4OX9F 3HPOA 3LH2S 1YJNS 5C7PA 4ECWA 1X8DA 3QRQA 4A8WA 4OIXA 5H9EK 4LUBA 4JI7J 2R7VA 1JLEA 4B3TJ 2X1FA 3GCXP 2V5HG 3FQKA 1GAOA 1DZ5A 3NP5A 4PWDB 4WFNQ 3RBZA 2Y0SD 4LSZB 5ETSA 1HBNA 4ZA1A 5L9XA 4WFBQ 4F2RA 3DHXA 2FLLA 4PWWA 2IRXA 1REVA 1B0PA 1H38A 1I94F 4C8OA 1CSJA 3MEEA 3JYTA 3PRDA 1MMNA 3NGKA 2WOMB 1DJ0A 2B4PA 3EJMA 2W8KA 4I2QB 3TVKA 2LQ5A 3K8VA 3J81U 3BDPA 4R25A 1HQEA 2MLYA 2XI2A 1V5VA 4B9UA 4DR5J 3W60A 4Q45A 4OI2A 2YXLA 3SFGA 4JI6F 2GX8A 1SC1B 2DK2A 1TKDA 4YR3A 2XZWA 3LUYA 2IC3A 4KV8B 2RRNA 4E8UA 1NSKL 1RU2A 3W5ZA 2OEJA 3RRGA 1PGZA 4M5KA 3BBCA 4KKOB 3UDEA 1ZM9A 3RW6A 4LRCA 5GMDA 1SV5A 4LREA 1IM6A 1JNZB 1NK9A 4UOGA 3HT3A 1U49A 2V63A 3DRRB 2NUHA 2DITA 2I0XA 1FJGJ 3Q8QB 2GO8A 3I32A 4ER8A 1HNVB 5E33A 2B6AB 5U47A 4ALZA 5KFHA 1HMVA 3NNAA 2IYGA 4ES2A 3OL7A 1NCLA 4LR8A 5DGBA 2WW8A 2GVZA 1UVJA 3HCXA 1S10A 3CJ4A 2OKQA 4C2MA 1O6XA 1T03A 4DPOA 5LSRA 1MSWD 1RP5A 5LL6d 2R7WA 1JJCB 1Q7LB 4KH1B 2IM3A 1QAJA 3UQSA 1VISA 3UDLA 3NGRA 1FNMA 4RX6A 4DL4A 4Y0FA 3HHEA 3OHAA 2E9ZA 3K5NA 4WP3A 1FF2A 3DLEA 2ZHAA 3FSIA 2QSWA 3TQEA 2HHPA 1ZM3A 4QIEA 5G4DA 2EKYA 3DHWC 4PYAA 3MEKA 4X4RA 2ZVSA 4X4PA 3SCLE 3KLIA 4ANCA 1AW0A 4X4UA 2CDRB 1XMOF 2BKNA 1H2TZ 1U8WA 5CQGA 2RKIB 2BQRA 2QE5A 4CP5A 1CJVB 1HBOA 5T41A 1PAUB 3NY0A 4DOZA 4FYVB 3EPIA 1AZSA 1N36J 4DSFA 2KG0A 2ZH1A 3Q86A 4UOHA 3HK2A 3FQLA 2B56A 3JAMU 3GB0A 1MWYA 2ZJRQ 4ZK7M 2JEFA 2CWKA 1IM4A 2ZUGA 4IRKA 3MMAB 2EK1A 1EQ0A 1NDCA 3GWCA 2WTFA 4EMDA 4BBYA 5M2PA 4NL5A 1JLCA 1SL2A 1T9WA 1YRUA 3JSRA 1PC4A 4USHA 3K57A 1JWWA 2J8SA 4K4SA 3A8JA 3RJMB 1OQ6A 3A12A 3ETMA 1BMQB 4J9QA 4WTYA 1F9HA 1JKHA 3KG4A 3M8WA 4LT6A 4DJBA 3SV3A 1XR6A 1S6QA 3M8ZA 2FVCA 1EARA 2LEAA 2RJZA 4KE5A 4G1QA 4Q8FA 1GK8A 5I3UA 1RT3B 3ZC4A 3HX9A 4ERDA 2C2KB 5A8WA 2V4JA 2LYVA 2BRLA 1S57A 4IYQA 4P2XA 3TVYA 4ECZA 1NKEA 1QUPA 2YWGA 4F4WA 1ZPWX 3L4BC 5AJ3F 3NGSA 2YWHA 4KGZB 2IA0A 1NJWA 4ATNA 1DLOB 3MGJA 1PYTA 3C66A 2ZM6J 3MWBA 2OSRA 3K89A 3BQ0A 4KH0B 2EFPA 3TNVA 1I1GA 2KG1A 4F7VA 3BGFA 4YB1P 1T3OA 4HEA9 2IIHA 2P6SA 4YR2A 5KT2A 3RAQA 1WOOA 3BGOP 1S1VB 1GMVA 3QGPA 2BV3A 2ZBPA 2PIIA 1FNOA 2HNDB 2DCUB 3IGNA 3IWXA 1VIXA 5KOWA 5LJ3Y 4UY8T 4JI5J 2CQPA 2ZJPQ 1JLQB 4K5RA 4NLRA 4NLQA 2HZCA 4C8KA 5GAEI 2VG6B 4USVA 5CYMA 2OGUA 2KJVA 3FEXB 1HIYA 1L3KA 1FK9B 1M1KT 2ZH3A 4PG8A 2P6TA 2V8DA 5ETMA 1H74A 5JJBA 2MDAA 2DVIA 4CLFA 3MEDA 1DTQA 2PGCA 4A4JA 2PFFB 1N34J 2XZTB 2J76E 4QWBA 3MM9B 1U47A 2XMMA 3T3FA 2WVFA 4MTPA 4F4XA 1CLFA 4M1KA 4RU9A 3D1QA 4ED8A 2KYXA 2R8HA 3DI6A 2Z30B 5CCMA 4ED6A 3OL8A 4OJ3A 3C2PA 3AY0A 1UVMA 5HQLA 2QA4G 2VD3A 1EAYC 5KFBA 2J7WA 3TJ8A 4ECQA 1BWEA 1IKYA 1NAQA 3QATA 2PEBA 3MCMA 2EI5A 1S79A 1WTBA 3CSKA 5FD1A 3CD5A 1GH8A 2WVCA 5KFOA 4CTAB 2XZDB 2H51B 1X9MA 2FY8A 1CULA 4R0EA 1HW8A 1UFWA 2CUYA 4X64F 4MIWA 2W2QP 2E5GA 5D0RA 2N4DA 4J9NA 1H0HB 5EWEA 5D0GA 4AE5A 3PYFA 5C2GA 1HI8A 2CAJA 4DR1J 4DV0J 4N41A 5DJBA 3R5GA 3VR1A 5CYQB 2K7JA 2YQ1A 1VHFA 4NLXA 2OH2A 3W64A 2G13A 5HP1B 3W66A 2A18A 1XTZA 1H2UX 3I56S 3ZZOA 4AFFA 4IFYB 4P52A 4LF7F 1QAYA 2HFVA 4LFAJ 1WF1A 5HVHA 3GR0A 1FFSB 3CJRA 4ELVA 2IM2A 2VA3A 1IBCB 4UZCA 2VQFF 1F3FA 3KK3B 2D9OA 4CM0A 2DB1A 1N8RT 1VQ8S 4Z7CA 2V9KA 2CNNB 2EFOA 1IKVA 2IJFA 5GADU 2E1RA 2YKMA 1DRZA 2B5JA 3R7SB 1DQ8A 3PRVA 3OUYA 4C8YA 4P72A 1OYEA 4CLLA 3C6UB 3CO0P 2B43A 3QPIA 2DNPA 1TV6A 2W1BA 4OX8A 3TW0A 3I0RB 1TMJA 2LXUA 4ECSA 1HPZB 1FDBA 2BOPA 2LCWA 4NI2B 2X1AA 2MQNA 4MIBA 1RT4B 1RB0A 3D6MB 3QIPB 2MTLA 4RNHA 3ZNJ1 1UW4A 2I8EA 4NLOA 3NLCA 2B4VA 4EO8A 3D1HA 4JI8J 3MM8B 2VFUA 3EVMA 2VJUA 2QO3A 2B3TB 3ILLA 2AJ0A 2DNYA 5KFNA 4I69A 1I5OB 4B9VA 4Z2XA 4DN0A 1LW2A 2RUGA 5IS2A 2F4VJ 2QLJB 1M90T 3H4BA 4ZCLA 4ZCIA 5CXTA 1P9QC 3OL9A 3IRXB 4YB5A 1TVRA 1NH7A 4IH6A 1IQTA 4EEYA 3RG6A 4A8XA 2QEXS 1RT5A 1JJHA 2CJBA 1RABB 1XR5A 2JJ4D 4WYLA 2OI2A 5HK4A 1PYSB 3EXYA 4NLYA 2E29A 3L3CA 3QLHB 4HH1A 2VDHA 1VJWA 2O66A 4DV5J 2KM8C 1FFGB 4LF1A 2FLOA 2DNKA 2VC1A 1HNIA 4ZP9A 2H9ZA 1TKXA 2W9BB 2EFGA 2MMYA 4RO0A 4FNIA 3MURP 2QMUB 3L7UA 2GJFA 4F0HA 2VFRA 4C8ZA 3Q8VA 5B0FA 3BB5A 2C2RA 3MPYA 3M2UB 3PCOB 2PMHA 2E1CA 3DDNA 2V34A 5I42A 2DXFA 2C28A 1QUVA 4DR1F 4USJC 5E3AA 1WKKA 2NXUA 2NXCA 4J37A 4RLEA 2R2RA 7AT1B 5CABA 2B0GA 2OFGX 1KFDA 2QGFB 4RW9A 1E6VB 3R6LB 3UNGC 2ATCB 4DBQA 3JQKA 4CLSA 2OPQA 2AQ4A 4L74A 5ETVA 2DPIA 2ZNYA 5GAGI 1Q8KA 4ED3A 5J2QB 2HFNA 3RGIA 1U24A 1DTTA 1NK6A 1HWKA 2ZD1A 2F1FA 2DGOA 4MAKA 2E1PA 2BANB 2W7AA 3EUNA 2HHWA 3OFGA 3V81A 5GMKa 1K0VA 2GV1A 1V5IB 1BWVA 2U2FA 4U7UK 4NLUA 2JLGA 1KC8T 5J2PA 1X31C 1Y11A 1IBKF 1YQHA 3EZUA 4K4TA 1R8HA 4MK7A 3N4WA 2APOA 3HFVA 3CDBA 2M88A 1WD6A 2XI3A 2XNRA 4Y2KA 2XGPA 3GR1A 2CXEA 2UUBJ 3MHYA 1Q8IA 1C0UA 3TQ1A 2OPSA 2JSXA 3T19A 4CCHA 1U1PA 2QYGA 2MPUA 1U26A 3GSIA 4LRAA 5K8OA 2ZH8A 3MAAA 3TO8A 3AB4B 2D3ZA 3QT7A 1W25A 3BGRB 3D66A 2E5LF 4QIFA 1FRJA 2HZVA 5IM0A 1UEVA 3HKZD 4RL1A 3WIVA 2FYXA 1GTHA 4M95A 3CCWA 3M8QB 1NBEB 3A4TA 1PJ6A 2CJAA 1GXUA 2I2YA 4DG1A 2WB1D 4X66F 4RR5A 4G1IA 3FNNA 4DR3F 1RT1A 4JI4J 2QFIA 1CQMA 3P3DA 1WHVA 2XHWA 2XLKA 4HDHA 3CC2S 2CNKB 5IC6B 2XLIA 1JLBB 4OHVA 2ZH5A 3MEGB 3LW5C 1F9EB 5HATA 5HL7Q 3I5BA 3A8IA 2AZ3A 3BSNA 4O3RA 4AQYF 3CCSS 3EDRB 5BR8F 2GVDB 4YDDB 2B9YA 4RJVA 4J9MA 4I2PB 1HFEL 3ENVA 4WIQA 2LQJA 5J1PA 2ZOGA 1Q8BA 2CJYB 1B0VA 3MECB 2OFHX 1N6QA 2H5EA 1TL7B 2F3JA 3CD0A 3J81j 5DGAA 5HLFA 1N54B 2RS8A 5A0YB 4IR1A 4J91A 4CLPA 2PO4A 3EICA 3M05A 1YJUA 3C6TA 2UUWA 3BJYA 2IM0A 1WC0A 1WHYA 4A46A 3W2VB 3QT6A 2CVIA 3D3BJ 1YITS 1O8BA 3HFZB 5C42A 2IBOA 3OVBA 2ZZNA 4L6V3 4DL2A 4ZCMA 3BYRA 4XPEA 3U1MA 3J80Y 1RA6A 4IQXA 2XWYA 1FA0A 5HJXA 3UVJA 4IUFA 2AJQA 4K4ZA 2K3KA 4ZVEA 3RBXA 1KOHA 4BLGA 2VQEJ 5KFQA 5KFLA 4U7CA 3D1OA 5K14B 4USIA 4C3MA 4CZCA 1FDAA 3GFYA 4PG7A 3CUNA 2YNHA 1S6PA 3BO4A 3D28A 2XMWA 4EYHB 5DO2A 4CDIA 2G2YA 1WEYA 2YQ3A 3PW0A 2VG7A 3CDEA 3G4SS 2OPPA 4NEZA 4DPWA 1V6HA 2YNGB 5A8KB 1J5OB 1E6YA 3HZGA 2PI5A 1N33J 1MMDA 3JTNA 1LWCA 1MROA 3OXGA 3HULA 1VRTB 2CPHA 3G6YA 1G2EA 2R7TA 4ZP7A 2UV8G 1VMBA 4RW7A 2QMWA 1DBDA 3HVWA 3DLJA 2NCKL 5LXYA 3I55S 3NNHA 4QR1A 4DI6A 2MZ1A 3K5LA 3CD6S 2QLXA 3AJ1A 4YS2A 3NS6A 1P6TA 3CCZA 2FJWA 3ADAC 2AV5A 3G82A 4NX9A 4KHRA 1KRPA 5DRKA 1IKWA 1ZPVA 5HANA 4QWCA 5DDOC 3CCES 2KXNB 3PYEA 2R42A 1HYSB 4KIAA 4OYAA 3UN2A 3U27A 1YJVA 2VA2A 3AA9A 5IXUA 4I7FA 1RBLA 3KMSA 4ETZA 4O23A 3FFIA 2C3MA 2LXIA 2BJDA 1S1WA 1S1TA 4D3GA 1KWMA 3KNGA 3GV7B 1YZ7A 1BQMA 5IT9U 3D6FB 1NM2A 2RQ4A 3R7NB 1RQ0A 4FBUA 1S9EA 4U96A 1U1LA 4JI4F 4HI1A 2DISA 3OTOJ 2HRUA 3EGNA 1WEXA 1HNZF 3PR4A 4MKVA 2ROGA 4HHHA 1RU1A 1IR0A 4QIWD 5F8NA 3WX4A 4ZLJA 4ZPBA 3GIJA 4X65J 1TL4A 2M3DA 3US5A 3P49B 2CA9A 3CJSA 5M2UA 4Y65A 4IQMA 3MM5B 2YNIB 3LA0A 3AXKA 1U0HB 3PKYA 1N5QA 4ZMMA 2PEHA 1VBZA 1XN9A 3IG1B 1QD1A 1OS5A 3ITHA 1YWXA 1CEZA 1KBRA 2V6AA 4PZVA 4DV2F 2XSFA 2M52A 3GG1A 1UCNA 4HYKA 3KK1A 3V4IB 1CJTB 2DHXA 2GMHA 2K1RB 2DGUA 3M2VB 4R5PB 4DZDA 1UEUA 2Q66A 3J7Z5 4Q7AA 2ZHBA 2E7VA 3M8PA 2QFJA 3MPVA 2VU5A 3J81Y 3FBBA 4ICLB 2ALYB 4WJBA 5D3GB 2VFTA 3R2DJ 2V2QA 3OQ2A 3TWZA 4CYUB 3C14A 3SCKE 2EW9A 3CCJS 2OELA 3VV2B 4RW6B 1S7HA 3A8EA 4KGVB 3V5RA 4DUZF 4GKKF 4WZMA 1RWNB 4IDKB 2XS2A 3L9ZA 2VUGA 4CLTA 1B64A 4YHHJ 4OYIA 1U4BA 2IAJB 6FD1A 2WSFC 3RR7A 3SQGB 2OLWA 2I5JB 3H7HB 4LMZA 3R5AA 3MR7A 3M30A 4FBTA 2XS7A 3P4UB 5J1NA 1BY9A 3V2UC 1RTJB 2JVRA 3AJ2A 2P9GA 4XPCA 3EGWB 1N33F 4M5DA 4PKDB 1LEOA 1SJFA 3CT9A 2BM1A 2XCAA 2QX0A 3W8PA 4PG5A 3DRSA 5THWA 3ZZRA 2M0GB 4CO4A 1TKZA 4N7TA 2FHKA 4ILLA 4UZBA 3W9HA 4QW9A 4H4KC 2HMIB 4P2FA 2HVEA 3Q8PB 1ZTWA 3PO4A 2IJNA 3MTKA 2FC9A 4OHYA 4XK8C 2YQ0A 4RUHA 5AXNA 1HA1A 4QYZJ 4OJ1A 3CJKB 1H7WA 3M6WA 1XBWA 1AUSL 1QTNB 1H73A 2C2MB 1BQXA 3LPEA 4ZN1A 1S1XA 3P5TL 4EFAC 1VBKA 1VBXA 2V94A 1JLEB 1VCTA 4FDFA 4C8MA 4EK2A 1JMTA 4J9SA 4LQ9A 4K4WA 4J9KA 1RHUB 1VR6A 3VTIA 4CNZA 5LMNJ 3FKBA 1HBNB 3Q83A 3PJ9A 1FWLA 2FZKB 5KFSA 1RAEB 2H54B 3KUEA 3GIKA 2AJFE 1GXTA 4IG0A 1REVB 3SZ2A 4G6VB 1IN0A 3D6TB 5DG7A 4TYBA 2Q43A 4QYZK 1J2VA 3TA1A 3LGMA 2NXNA 3UN5A 2CPFA 4EI2A 4U6PA 3W7BA 1N32J 4Y6IA 4X65F 1HQEB 4ECRA 4JV1A 4I64A 2HRTA 4FF2A 1RAGB 2E66A 5IV4A 3OL6A 2D69A 1K44A 1P1TA 4M5HA 3THPA 3C46A 3EVOA 3MMBB 2IC3B 3TEGA 2KL8A 4B9SA 3GSDA 1R0AA 1SH0A 2XBPA 2VIHA 4DF4A 3HHLD 2R2TA 2UXCJ 1URNA 2ZHOA 1UVLA 4PUOA 4NZ7A 3DGPA 2POKA 3TX8A 1Q78A 1M5PC 3QZ8A 2CQ0A 1S9GA 2EK6A 1KQKA 3HO1A 1J5EJ 3ENWA 2IVFB 4QYRA 2F63A 2NUUG 3V4MA 1SV5B 2PD1A 3T1YJ 2HNZA 4GRSA 1MW7A 3FC9A 2MQQA 1WC6A 4ES1A 3EGVA 1QY7A 2HS4A 4CM2A 1S0OA 4B3MJ 1VQOS 3UR3C 3AD9C 2PFDA 4U95A 3OFHA 4CNYA 1HMVB 4IKAA 4ZVFA 3S8SA 2GVZB 1VQNS 2ASDA 2KVIA 5I3QA 3FSXA 4CH7A 5E2QA 4PWUA 2Z2YB 3HSDA 2HHHJ 2G1HA 3MCSA 2ADCA 1NSPA 4WK1A 5IQ6A 2J6UA 3HJFA 2UVWA 3VAFA 1P9YA 1CQNA 2DH9A 1RYRA 2DCLA 3AOBA 3DLEB 4NPOA 1M5VC 5CYJA 2X3DA 3ILOA 4ZLNA 5F8MA 4YFUA 3ZZUA 4WCEQ 3A3OB 4DQSA 2MY8A 1XMBA 5D15A 3KLIB 1LWEA 5AT1B 3M1VA 4DV7F 2CNLB 2XQCA 3FBCA 4RW8A 1XMQJ 3TZXA 2D3OR 2ACMA 4G3IA 2Z56B 1Z2ZA 4P7TA 2MB0B 3WIUA 2CG4A 2J6SA 2C2EA 3MZIA 2P5VA 1X9SA 4V19X 1AZSB 5KFKA 4O4RA 3PYDA 4DQRA 2MKSA 2PA8D 3NWGA 4F26A 3I5CA 3A3PB 3V6KA 2ZOMA 3FVYA 3MAQA 2V8VA 4NCAA 4WKYA 2LP4A 3N9UC 3UW1A 3DLGB 2BE2A 4K5SA 1KFSA 1ZS6A 3IBCB 1VDHA 3NMRA 3KXDA 2AEMA 4YY3J 1X5OA 2EG1A 3R97A 4MH8A 2KT5A 1JLCB 4ID5A 3EM1A 4PEOA 2MQ8A 4ED2A 3QJLA 5DLGA 1JKHB 5AE2A 2D41A 5KG5A 2Z0GA 2AKWB 1VS3A 2C22A 1S6QB 3NEKA 2XYPB 1D0EA 4KTQA 3K2YA 3HSJA 1R8AA 4B9NA 4I56A 2GC8A 4G1QB 4C0HA 2BJ9A 5I3UB 5F41A 5A8WB 2V4JB 2H65B 3EPGA 2GJ2A 1EP4A 4DPYA 3H59A 4X4SA 1U1KA 2DPJA 3WDOA 1X4CA 3DMJA 4Y00A 1D09B 4YN3B 4OI6A 1RWVB 3AQOA 4RW4A 5RUBA 2N82B 3AT1B 4GKJJ 4BWMA 1JQGA 2KZZA 4EZ9A 2JRSA 1Q95G 5LMUJ 1I3OB 4UW2A 3D3CJ 2MKKA 3BPSP 1VQMS 2VOPA 4CWBA 3POTB 4NLVA 1Y10A 2HIYA 4ZP6A 4OLOA 4DV4J 2JWNA 3GFXA 3AH6A 1UEKA 4KHPF 4R8UA 1WELA 3W2WA 3G71S 2BDPA 3N5BA 4BS2A 5GAEU 1OSDA 2KH9A 4WFZA 1NZAA 5CYMB 4B9MA 3UE2A 1R8PA 3S6EA 5F9NA 2FJVA 3M6UA 5B0CA 4PG6A 3VGTA 3NXZA 3SXLA 2XSJA 3MEDB 1DTQB 4JV2A 1RXOB 4ZJOA 2HW3A 2BM0A 1H2VZ 2D3UA 4LFCF 3H42A 1S5ZA 4BWJA 3TUZC 2MKJA 4U8YA 1RI7A 3G8TA 3DI6B 1NJXA 3FSYA 3GYXB 5B0DA 1WJ9A 3W5XA 4DZ6A 2Z58B 2RDIA 3DGVA 3ISZA 3Q8UA 2VBXA 5AXKA 2BX6A 4DFKA 4MKYA 4IOCQ 3CCLS 1XMQF 3ENQA 3BBBA 2ILZA 3FBFA 2J7UA 1IKYB 3M4XA 4O3PA 5HSPA 4WZQA 3PKMA 3I9V9 3KYLA 3M6XA 5IOLA 2Y1IA 1HNXF 4NWBA 1YI2S 2MQLA 1HBUA 2W2OP 5A2QU 1CULB 4DMZA 3KG1A 1M1GA 4PWDA 2RQCA 5T7LA 4MMOA 2Q3PA 2KVQE 3TAPA 2RD5C 1I51B 1HR0J 1SH3A 1KS2A 4FVCA 4I6AA 1YBAA 3VAJA 3FCVA 2AJ4A 3PEHA 4GC6A 1HNWJ 4TNOA 1M5SA 2DD8S 4DR4F 1S0MA 1CJUA 3CB4A 2VKZG 5KFIA 3N5FA 2AEJA 2W24A 3GYGA 4FYDA 3CEDA 4DX5A 2DR5A 3M9MB 3BM7A 3KTQA 3NS5A 1MU2A 3IR6B 2D1CA 1HI1A 1ZBTA 1RHJB 2FVPA 4M5NA 1B7YB 1X4HA 2G2ZA 4DF8A 4KGMA 4C8NA 1A7GE 3OT9A 2LQ8A 4TY8A 1NK0A 2YKAA 4OI0A 4Q2LA 1SC6A 4DX8H 3NG8A 3G8QA 1G1XA 2WZ1A 2AYGA 2N3LA 1R27B 1F5CA 4F3OA 1UW9A 4DWIA 2NXJA 1LK7A 3NWRA 3PYGA 2MXYA 4K2JA 2ZOFA 3BS9A 1IKVB 1BUXA 1GMWA 2JOQA 3CIMA 3TX0A 1YHQS 1FJCA 2IM1A 3JQJA 3CWJA 3THVA 2YKMB 5A6PA 5J1EA 2B5JB 4V1Ak 1JNRB 1SJ4P 3OUYB 5EDWA 4GKJF 3BV8A 4V19J 1VRUA 2GQQA 2RF2A 3OV7A 2E44A 1O5JA 5LMUF 4NE9C 2BUNA 4E2FB 1DQ9A 1WDDA 4X84A 2U1AA 3DM2A 3F41A 3JSYA 1VQLS 3KLGA 3KWMA 3V6DB 1SUQA 4DR7J 1IR2A 3O1LA 3GJRB 2F65A 2QZ8A 3PDNA 4A8FA 1OY8A 1P27B 4B17A 2YKNA 3M32B 5DDQC 5KT5A 1U1RA 3CDUA 3E3XA 5D4NA 2AW0A 1N4LA 5E3RA 3UR0A 3KHRA 1Q86T 4LF6J 3FCWA 1LW2B 3GV5B 4DV3J 3O6QA 1CVJA 3E01A 2KTQA 4QBUA 2BQUA 2AGPA 1J27A 1WC3A 1WC5A 1WUUA 3Q8RB 2GIFA 3H5YA 3GCWP 4LBHA 4FXDA 5L1KA 1TVRB 3GIRA 2IVMA 1D1UA 3AJDA 4PPZA 2BE9B 4X4QA 1FRKA 1RT5B 3DOKB 1RBOB 4UY85 4PXCA 5EUHA 1QLNA 2DR9A 2NZCA 3PHTA 3UCUP 1H7XA 4USUA 1FTCA 4DL7A 1PBUA 2I9SA 3WC0A 3MPDA 2FDNA 2MKIA 5D78A 4LF4J 1LW0A 2PC6A 4DS4A 1R3NA 3PVXA 4ZP8A 5B08A 4MIAA 3LWLA 2MYFA 5HMYA 2RS2A 1XNRF 1BQNB 1HNIB 5HROA 4K4VA 4DCOB 4N8OA 1TKXB 4W98A 4C9DA 2UU9J 1NB7A 1JJ4A 2GFFA 2E9TA 2ZH4A 4A8KA 2DGSA 1K47A 3MXHP 1S4EA 1FRHA 2XHCA 5ETKA 3TAMA 3JSBA 4ZVGA 3Q2SC 4B9LA 4DS5A 2JFDA 2YPYA 2QL5B 3O5TB 5DM7Q 5HQMA 3BH7B 2AJ1A 5I42B 5G0RB 2C2OB 3PTWA 5C24A 2CQGA 5J2MA 1S1UB 4XIUA 1RTHA 1KVKA 4M5JA 1Y00A 4ED1A 4P6QA 4RW9B 1YIJS 3D54A 3EYZA 4FVMA 2FHOB 2F9DA 3E2EA 1DARA 2CADA 4Y34A 1D8ZA 1YTYA 1HWLA 5H1SV 2ZH9A 3CW2C 2OPQB 7FD1A 5H9FJ 3DN9A 2EEYA 1T9VA 4P2MA 3SCIE 1XR7A 2KFNA 4DSKA 1Y0HA 4QU7A 1RTIA 4NASA 1PSDA 2CJXB 1DTTB 2HEKA 3CULA 1AFJA 2ZD1B 1HWIA 1BHNA 1VQYA 2HK3A 2MGZA 4DR2F 2RNEA 1C1CA 2LDIA 4ZDNA 3V81B 3RUBL 1KLNA 1D9AA 3DRXA 2AMCB 3BSAA 2A6MA 1S1VA 1Q4RA 2MY7A 1TELA 5J2PB 3C15A 2V68A 2C3PA 4QJVA 4MJKA 1SH2A 5KFWA 3IM9A 4BDPA 1WKJA 4K59A 5A8RA 4DR6J 1KKHA 1FT8A 1M5HA 3HVTA 5H9FK 3M9NB 1C0UB 3Q89A 3QNWB 2VG6A 4Y2CA 1TKTA 3KHLA 3UWTA 4YP3A 3MAAB 2KKHA 2MEWA 4NCGA 4H4MA 4MK9A 4MT1A 4F0MA 1QDUB 1TAUA 2BOAA 4RPFA 5KAKA 5IM0B 5J2NA 3CMAS 2V2ZA 1GX5A 2ZBCA 4DV6F 4ED0A 2ILYA 2GGPA 4MFBA 2B51A 2J0WA 5D4OA 3CPWR 3R5CA 4LF5F 4DG1B 3DKDA 1MN7A 3HHKA 3QWUA 3LP1A 3I31A 4B3SF 3EE3A 1RT1B 2IY5B 3HD1A 2BQ3A 3CJ0A 2BE7D 1UJ5A 4J90A 1T95A 3KK2B 4DUYF 1Y4ZB 3BKUA 1V3RA 3W1YC 3M8YA 3LP2B 1NPKA 3GILA 5HJYA 4O0NA 1D8YA 2R8GA 2CZVC 1UA1A 4P2SA 1PBAA 2BACA 3ET6A 2GS8A 2CDQA 5GAHI 4USTA 5M2RA 2ADBA 3DCAA 1SPBP 3IFEA 4DL0C 4KBIA 3T5KA 3BF4A 1VHIA 4LRFA 4NXMJ 1SQEA 2FQQB 4E0DA 1N6QB 3PFEA 1SKSA 3VGSA 2K2PA 2XY6A 4H4OA 5KG2A 3V6HA 4Q44A 5HLFB 2OJ3A 3VAGA 3H2VE 3H5UA 3I9ZA 2QMXA 2UU9F 4RNNA 1LXJA 3ZNUA 3C6TB 4ILMA 1L3UA 5KFFA 2DH7A 5CAAA 3CF5Q 2L41A 3GMGA 2N3OA 4URGA 1ZZFA 5C42B 4JI3F 2H3EB 2FJBB 2LKZA 1UPPA 4IFYA 2A6OA 2N7YA 1XEZA 1KVJA 3ZZZA 2YBVA 2E7WA 3VVUA 4I68A 4JV5J 2CQDA 4Y3CA 1PYOB 3UVJB 1K1QA 1NK8A 5DS7A 4DL6A 2EFVA 5HI7A 1IJEB 1ITPA 3X3UA 3KLEA 3J7A1 2C3YA 4ZPVR 2PSZA 2YNHB 1KR4A 1S6PB 3MR2A 4JB8B 4B3OA 2DNOA 4YEAA 3HVRA 3AAWB 4P74A 2VG7B 2OPPB 1T9UA 3HKWA 2HFOA 4WWSA 5CCLA 3FMBA 2VHGA 1Y5LB 1Q16B 1QJHA 1E6YB 2QL7B 2BW7A 2LA6A 3GU0A 5JVGQ 2ZBIA 3QSYB 2BYCA 2CPDA 4CH0S 3Q0AA 2A3JA 1HPZA 2JLEA 1LWCB 2FVRA 1MROB 3DU6A 2FLNA 1FESA 1WF2A 4KPYA 4RW7B 4N47A 3EWGA 3GJTB 4IO1A 2KO1A 3TUJC 4N76A 2DXEA 2UUCJ 2DR7A 2RT3A 3B4MA 4KGKA 1F0XA 1WF0A 2J8AA 4DQQA 5L38A 1PG5B 4IOBA 3ZZTA 3EMTA 4ZVUB 1IKWB 2V4QA 1IXKA 3QAEA 3HT0A 3T1HF 3NS7B 2UZAA 1FRMA 1NSAA 4RUAA 2WSCC 3I87A 2PDAA 3AD8C 1RHMB 4O4GB 4I7FB 2QL9B 3H98A 5KTQA 3KHHA 4J9UE 3W3SA 3HSZA 3CCQS 4FF4A 1WC4A 3WC2A 4HVZA 3FFIB 2HFZA 3BSOA 1HQUA 2HBYB 3RZAA 2RUSA 4PQUA 3CJ5A 1S1WB 1JXVA 1S1TB 3B6BA 1TL1A 1WI8A 2QSFA 4IG3A 1BQMB 2MKCA 4RUBA 1S9EB 3GJQB 4X62F 3BH6B 2XY5A 3N28A 2YKQA 3D9BA 2JEIA 5SZTA 4Q8EA 3O2IA 2ZBQA 3ISNC 3DRPA 2H5IB 4GVBA 5FDLA 1IBMJ 2XMAA 2L9NA 2ZZTA 1OIAA 4J9VA 4JI7F 4B3TF 1TK8A 3C8YA 4RUCA 4P75A 3G8SA 3BO2A 4CO0A 1HLWA 4OI1A 2JZ5A 5BXIA 2JLFA 5BYRA 1HWJA 2Z8QA 4QIVA 4DV1J 3ITHB 5DG9A 1RCOB 3DDIA 5DQHA 1GFWB 4NLTA 5L8RC 4HR2A 2VZ9A 3KK1B 2YWEA 1RTDA 2FPHX 3O3LA 1RISA 4L76A 5KG6A 4MYTA 2B7CB 2Y1LB 3H4DA 1FRLA 3M8PB 4WFAQ 1RT7B 2A0FB 4ITSA 4DR5F 4O3QA 1KOOA 1TK0A 2FD2A 3R5BA 3CE8A 2IDLA 4G65A 3C14B 3FEZA 2WONA 4DHVA 2CQHA 1ROFA 3JTOA 3NGTA 2XO7A 1VQ5S 2AYMA 1RA7A 1NKCA 3QAUA 1EIYB 2YTCA 1TP7A 1G4CA 4UUWA 2L08A 3QQCD 4OLPA 1SIZA 4ZLLA 4YR0A 4WE1A 1X0PA 1UKUA 4KFBA 1BE4A 3LALA 2BR0A 3F73A 2B8QA 2W2NP 3L7OA 1FD2A 4AL7A 1DAXA 1JLFA 1G7CB 1U6FA 2OPRA 5LSLA 3M30B 3MOJB 2KYZA 1OSCA 3MMJA 4DSEA 1FJGF 2GMJA 3BKFA 4ZVOB 4M5DB 3SV4A 2BKOA 5BYQA 2DO0A 4N8NA 2J9DA 5LM7E 2YWKA 2OAUA 4D3HA 4TKTA 3DRSB 4MKAA 3SSQA 3DLHA 3PJWA 1X4BA 2W9AA 3HHDA 4XDCA 4PXEA 3GV8B 4URSA 5DDRC 5LT5A 4L3NA 2WVBA 4QZVB 5CZXA 2ZFHA 1RJJA 3OSNA 3Q8YA 3UO0A 1UWAA 3LAMA 3HM9A 3QO9A 2I1RA 2DGWA 4ES3A 1RK8A 2AJ2A 7FDRA 1RWMB 4QR2A 3R9LA 4ED7A 1NK5A 5ITHA 4FS1A 4W4MA 3CCMS 3OJUA 4LFBJ 5HBMA 4P10A 1U45A 1S1XB 2BABA 2DNHA 3GZ7A 3TVZA 4OZJA 2DXDA 1N48A 2BW2A 5AE3A 3CCVS 1HHSA 3GLJA 4N5SA 1RWKB 2AHOB 4DLGA 4DQPA 2M7SA 2AYBA 3TANA 2FZGB 1N36F 4JI2J 5KFZA 3K58A 1XNQJ 3D0GE 3BN4A 4I2PA 1M1HA 4EWTA 4LF8J 5L46A 5IWAJ 2UXDJ 4F25A 4EO6A 3CCTA 1TMMA 2Q6CA 4LRDA 1SL0A 2HGLA 3CMES 2PN6A 3NRBA 5FIIA 3QZ7A 3IP0A 4TN2A 3UDVA 4MK8A 2GO9A 2YX7A 3OLBA 2CPEA 4LF9J 4WU2A 3EDQB 2WCXA 1WEZA 3G86A 4C11A 4YQWA 3MM6B 2AX1A 4ZOSA 2N7CA 2RB7A 3OW2R 3Q2TC 1OQ3A 2EXUA 4LSLB 4RBVA 1R0AB 3D6HB 2B8PA 3MR3A 2D9PA 4PUOB 2DIUA 3DGPB 1VC6A 2UUTA 2Y1JA 1KQSR 4RKUC 4CRJA 2HVZA 3KLHA 1S9GB 2R8KA 1N5YA 4K4XA 2P8IA 3DFEA 2E5JA 2NSBA 3PIPQ 4UQGA 3C16A 5ADZA 2LMIA 1YG0A 2HNZB 1RT2A 4BC7A 4PR6A 2XMVA 4I0WA 1PC5A 3GE9A 3SFUA 4O3SA 3ZZYA 1AXQA 2VODA 2DR6A 3PEJA 5MLCV 4OMFG 2YH0A 2ZM6F 4WP9A 3K17A 4IFVA 2E5HA 2CVEA 2V2VA 1VC5A 2LQBA 1RSCA 1VK8A 1WTFA 1Q7YT 3EGZA 5F0WA 3T5HA 3M6VA 3R27A 5F3TA 5KFUA 3MFHA 3K5OA 2F7VA 1S0NA 1DFDA 2CJ9A 1P8GA 4WIIA 4J9OA 2W4PA 4ELTA 4HHJA 3ZTOA 2VC0A 1A0OB 3P45B 4JP8A 4AXIA 1UFKA 1SI9A 3R2CJ 4RWWA 4JI1J 4JI5F 5KG3A 9ATCB 3QBCA 1PJ5A 1X4DA 2A2DA 1LWEB 5IQQA 3M1VB 4OX9J 4ZVPB 3GFHA 2R9LA 4FZVA 2E9RX 2XWXA 3PJXA 1FNXH 3RR8A 1FKPA 1FX2A 3DDKA 3IO1A 4QWAA 1LQ9A 1T8EA 3BBFA 1T05A 3MCOA 3OFEA 1TU0B 4OV1A 5KG1A 3JB9k 1W2IA 4YMEA 1N34F 2XC9A 2ZZMA 3DRYA 1NRKA 2F8HA 4TQSA 3M8RA 2BJ7A 5I3PA 4FKXA 3CTRA 4AYBD 1QAIA 2VDIA 4F02A 4B02A 3R6GB 1XERA 4GO7X 3DLBA 1WORA 3OXLA 1WHXA 3OHBA 4ZVHA 2BE2B 4LVNP 3GQCA 4LFBF 5I4MA 1KP6A 1NO8A 1NPRA 3TAQA 1I94J 3GJSB 2HQIA 4LIWA 2FGOA 4ID5B 3QJJA 2V8HA 2H4WB 4NZ6A 4CO1A 4ID8A 4RBUA 1CBKA 2AD9A 4QWDA 1RGVA 1XNQF 3AOAA 3J80U 2HBZB 4ZHRA 2QC3A 4USMA 3FBEA 4C6AA 1HW9A 4JI6J 1SKUB 3H40A 2IRUA 1ZYQA 5IWAF 4NYZA 4XTTA 1VBYA 4DFPA 3LP0A 2H48B 5KOXA 3CIZA 2VPWB 4QPTA 1RWUA 2DKOB 3FCHA 2ZWOA 2RU9A 3LF0A 3IWLA 4DV0F 5D0HA 3D2WA 4FYYB 5EWFA 1HD0A 2C2NA 3RAMA 3DMJB 4ECTA 4EBEA 2JC0A 2V0NA 2RDJA 2W4CA 3AD7C 4P73A 4RW4B 2ZH7A 1S12A 1QVGR 1WACA 2AZ1A 2HGMA 1ZM2A 2NLWA 2FZCB 4JBCA 2KRRA 4RNFA 3HMJG 4LFAF 5F0UA 3G6ES 2KFZA 1NXIA 2HHTA 2WSEC 4RW6A 3KJNB 1RUSA 2DNMA 3SEOA 1SKRA 4C98A 1IVZA 1R8BA 1SL1A 2M9KA 4IDKA 3VCDA 4R8UB 3W2WB 4KJIA 4OX7A 1XJWB 2J5AA 4NCBA 1H6KX 2D7SA 3R5DA 2LEBA 2KDOA 2GZOA 3CD7A 3M7VA 4WKRA 3GFZA 5HO4A 4NZ0A 3J7AN 1IWGA 2MKYA 3UI3A 3QFHA 3UNYA 3THTA 4KB7A 1NHUA 1X0FA 4EUVA 1SQGA 2BZ2A 2MZSA 1XMOJ 2XSJB 2GHPA 3IBFB 2DJWA 5LOQA 4AXJA 2UV8A 5L39A 2EWHA 4NRTA 3N01A 4CO5A 4ZVSB 3DLKB 1EETA 2HVIA 2VICA 1UP1A 5E41A 4WFXA 4CQ1A 2VPXB 3ONQA 2RE1A 2KFYA 2ZKTA 1ACMB 3BKTA 2KHCA 4JI8F 3NBPA 2OHDA 2MSSA 2ZITA 2C3OA 3DU5A 4LF2A 1B70B 1VI7A 1UWBA 1FDDA 1BGXT 1O0PA 2F4VF 4IH5A 2AP6A 4FF3A 4U67Q 3HHLB 2OIHA 2A10A 1Z4UA 4QQBA 2L48A 2E7XA 1HBUB 2XO6A 1G3OA 1U8SA 5KFDA 5JUMA 2LU1A 1U2RA 1RT6B 5T7LB 3K7RA 1SC3B 2FJDB 2DNZA 1XIQA 3DLLQ 4JV0A 1EZZB 2CJKA 5F8GA 4X4NA 1UVIA 4DPTA 3CCRS 3M9OB 1NZ8A 2DTJA 3HI9A 1Y7PA 1PJ7A 5LXRA 2VL1A 4DV5F 1OY9A 2CQBA 2MJUA 4NMLA 1CJUB 2XM3A 3HXMA 3KLFB 2DGQA 4HACB 3I4PA 3CJTA 2XMJA 3AFGA 3MMCA 3B82A 4PQAA 3H20A 2DGTA 1Q1KA 3FRZA 1MMLA 2W9CA 1Q82T 4HLBA 1MU2B 1CJKA 1JLGA 3RRKA 4HH0A 5AJ3J 4UT4A 2CYYA 3K0JA 3I5AA 3MMBA 2YX1A 4LRBA 4TY8B 2ZC3A 2M4MA 3CNQP 1T9XA 4I6YA 2ASLA 4CLWA 2UVVA 1GNKA 3SBMA 3WBZA 2C3UA 5B7WA 3KUHA 4JUZA 1RKJA 2EKNA 2FLPA 2F9JA 4F8RA 5J1EB 1L3TA 1S97A 1NDKA 3BSCA 4CT9A 4OL8A 1HHTP 4DCJB 2YPZA 1GMUA 3VWSA 3T1AA 1VRUB 2RF2B 2K7KA 4N77A 3AA8A 1Y5IB 3TP2A 1LKZA 2IPOB 4ECXA 3LO3A 3GPAA 4NOHA 1Q5VA 3DM2B 1HARA 5ETPA 4NXNJ 1RADB 3W5YA 3KLGB 4JOUA 2VKRA 1SUQB 4KO0A 5JVHQ 5DETA 3LAKA 3IGVA 4TQRA 3K8WA 2VH7A 2DY1A 3PX6A 3R3TA 2BXJA 1QSYA 2DRDA 3KJVB 1S99A 3EZOA 5IFMA 1UVKA 2YKNB 4U7UD 4QU6A 2RAQA 2DT9A 3NAIA 1DQAA 2DRAA 3JS9A 3SI8A 5ETOA 5K20B 2DNGA 1PIEA 1NDPA 3E01B 3PM9A 3OVSA 2UUBF 2CRLA 2X51A 2C2DA 4USWA 1IKXA 2OTLS 3LPYA 1S9FA 4K0KJ 2CZ9A 3DXBA 3VAIA 1FE0A 2O67A 3IR5B 4Z7YA 1RWPB 1WHWA 5K9FA 2HHUA 1AA1B 2VG5A 3KKFA 2Z2MA 2LFVA 1YGYA 1X60A 4FP9A 2J9DE 1VJQA 1B4SA 2ZC4A 3U1NA 1NMEB 4F4YA 5F9LA 2W8LA 4OZ5A 2O5DA 2RH3A 4ZVTB 4OFZA 4X64J 5DLFA 3F56A 4A48A 1Q8LA 3SDEA 3PXGa 1LW0B 5K8MA 3DYAB 2BJ1A 1XWLA 3N6MA 3DLGA 2CNOB 4L73A 4ED4A 3PHEA 5HROB 4NA3A 2EPIA 1AB8A 4NYOA 2Z2LA 2VASA 2EVZA 1ZOTA 1F5AA 2IHR1 1C1BB 3KG0A 4ZPWR 1UJ6A 3TAMB 3RBEA 4PG4A 1LFWA 1F3VA 4J9LA 2X1GA 2BRKA 4LF7J 4OYMA 3MCNA 3FMWA 3UCGA 1U6BA 1W26A 1N88A 2G1DA 5C24B 5J2MB 2CQIA 2LXFA 1RTHB 1VIOA 1JB0C 2VQFJ 2OEMA 2CQ1A 5C25A 2ALZA 2NSCA 1RHKB 5FLXU 1FEEA 2V8GA 3UFCX 1FJ7A 2GHWA 2ATLA 3HF5A 2ASYA 4KC5A 2R2UA 3NCPA 1R7IA 5L1IA 1ZM4A 3OTEA 1APSA 3HP6A 2EBGA 2B9EA 1RTIB 2QJ3A 4CLKA 4E98A 2R4FA 2HWHA 3I0SA 3NCRA 4HTJA 2Y8WA 2W7PA 1QE1A 1YRXA 2MGZB 5KT4A 3JXOA 2L3MA 1RAAB 4ED5A 2ZUAA 4UTGA 3MR6A 3S7RA 5K8NA 3LGNA 1C1CB 2KJWA 4KQZA 2VB6A 3POTA 3QSIA 1U1NA 4UOFA 4KHMA 1R6YA 2RQMA 2VQEF 3WZ0A 3PY8A 3QMQA 3NL0A 2F5GA 3C15B 2FY1A 4W90B 1T9YA 3MI7X 5A8RB 1HBMA 1FJEB 2EFQA 3FZBA 4C97A 3HVTB 3BDEA 3H2LA 2XYHB 1TKTB 5HQ8A 2E1AA 3KHGA 4NXNF 4AT1B 4UQTA 3JSMA 2X3GA 1NK7A 1NNDA 4O44A 1RTZA 1YBUA 1FEHA 4CI0B 5EX0A 4NCGB 2AX0A 4H4MB 4MYUA 1MNEA 2H4YB 4ZN3A 3P5BP 5GMEA 4RBTA 5J2NB 5IC4B 1S59A 3VAKA 1FE4A 3QYYA 4ZJQA 4DU7A 4F3MA 2GGPB 4MFBB 2IDEA 3PW7A 4WFYA 2CPXA 2M8DB 2I38A 2UP1A 3LP1B 5A6WA 4O3NA 4QR0A 5FJ4A 1K0TA 3JTPA 2NR0A 5MAOA 5IT4A 1TL3A 2HQ3A 4K0KF 3WQPA 2R3VA 3W63A 4ZIWA 3G87A 4OYBA 1RAJA 3T9ZA 3IR7B 5GAHU 2KXFA 2LQ9A 3ET6B 5F8JA 3QT8A 3SCJE 3SQOP 1D9FA 2HGNA 2CQCA 3NNCA 3PV8A 1CC7A 2P9EA 4JI0J 2HRYA 4EYIB 1YRTA 2YVSA 2H5JB 3FZ2A 2IMWP 2RQKA 1VYAA 2BVZA 4H4OB 3ZTPA 2HURA 2FGCA 2BEFA 3UD5A 2EBEA 4NLGA 1FFWB 3OTOF 2HPUA 2R7RA 2Z2ZA 1W2BR 1LOUA 4DX6A 3CJ2A 1YKWA 1FXDA 2DHSA 3MEEB 3JAMY 2R8JA 3JYTB 1N5SA 1EQMA 2RRBA 2XMTA 4F0KA 3HVAA 2DHHA 3V6JA 2K3IA 1VOMA 2CPIA 1KEKA 5DZ6A 2VBZA 1S49A 3MM7A 3VQTA 1S6OA 5E3CA 2J0SD 3FRYA 2Y1RI 2QV6A 1NEEA 1F60B 3PFOA 2HYIB 1RHRB 4A8SA 3VF0B 2BJEA 1NJYA 1L5UA 3NOGA 2KN4A 3M2RA 2ZH6A 2JX2A 1CS4A 2HS3A 1H3DA 1ELOA 1ZAXA 3KLEB 4OJGA 1U6ZA 1HHQA 1Q53A 5HAOA 3ZZPA 4B3OB 4NA2A 4J9RA 1IBKJ 4U9RA 1TFWA 4J5OA 1FD8A 4ZITA 2KHDA 4M94A 4UUXA 4TLRA 2OMOA 3HSGA 2BJ3A 1XK8A 2Y3YA 1QAXA 4YUDA 4DU8A 2R7XA 1IQZA 3DOMA 1FO1A 2MLXA 3OR2A 1BC6A 2VF3A 4R0JA 3NCQA 5E3QA 3PRBA 1C4AA 2G0IA 2BMBA 3V6DA 4LQ3A 3VAMA 3ILIA 4OYWA 2XMKA 3EVWA 4KY3A 3LANA 2E5LJ 1GX6A 2AF6A 1T03B
chains in the Genus database with same CATH topology
4DV3J 1XNRJ 1N36J 4JI4J 4LF7J 4DV7J 3W1YC 1N32J 3R2DJ 2F4VJ 4DV6J 2KVQE 4KYZA 2UUCJ 1IBLJ 4KHPJ 1XMOJ 4K0KJ 1IBMJ 1HR0J 4DR2J 3J81U 4JV5J 4V1Ak 3JAMU 4X65J 4LF5J 4DR6J 1HNXJ 4LF9J 4X62J 1N34J 2VQFJ 4JI3J 4DR5J 2HHHJ 4B3SJ 1HNWJ 4X66J 4GKJJ 4DR1J 4DV0J 2UUBJ 2VQEJ 3IMQJ 4HHUA 1I94J 1HNZJ 4DR3J 5FLXU 4LFBJ 4DUYJ 4NEYA 4YY3J 5LMUJ 4X64J 4JI0J 4NXMJ 4RJVA 2ZM6J 4NXNJ 4YHHJ 4DV1J 2KL8A 2MEWA 3D3CJ 3R2CJ 1IBKJ 4JI1J 2MQ8A 4LF4J 4JI7J 4JYAJ 2UXCJ 4DR7J 4B3TJ 5AJ3J 4DV5J 4DUZJ 4DV4J 4OX9J 3J80U 4GKKJ 2MTLA 4DR4J 4AQYJ 3T1HJ 4JI2J 4LFCJ 5BR8J 4NEZA 1J5EJ 5LMNJ 4JI6J 1XNQJ 1XMQJ 2UUAJ 4LFAJ 2UU9J 4JI8J 5LM7E 1N33J 4LF8J 3T1YJ 5IWAJ 2UXDJ 4JI5J 2UXBJ 4B3RJ 3D3BJ 5IT9U 4PWWA 3J7AN 4DV2J 4KY3A 3OTOJ 2E5LJ 5A2QU 4LF6J 4B3MJ 1FJGJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 J;  1XNR J;  1N36 J;  4JI4 J;  4LF7 J;  4DV7 J;  3W1Y C;  1N32 J;  3R2D J;  2F4V J;  4DV6 J;  2KVQ E;  4KYZ A;  2UUC J;  1IBL J;  4KHP J;  1XMO J;  4K0K J;  1IBM J;  1HR0 J;  4DR2 J;  3J81 U;  4JV5 J;  4V1A k;  3JAM U;  4X65 J;  4LF5 J;  4DR6 J;  1HNX J;  4LF9 J;  4X62 J;  1N34 J;  2VQF J;  4JI3 J;  4DR5 J;  2HHH J;  4B3S J;  1HNW J;  4X66 J;  4GKJ J;  4DR1 J;  4DV0 J;  2UUB J;  2VQE J;  3IMQ J;  4HHU A;  1I94 J;  1HNZ J;  4DR3 J;  5FLX U;  4LFB J;  4DUY J;  4NEY A;  4YY3 J;  5LMU J;  4X64 J;  4JI0 J;  4NXM J;  4RJV A;  2ZM6 J;  4NXN J;  4YHH J;  4DV1 J;  2KL8 A;  2MEW A;  3D3C J;  3R2C J;  1IBK J;  4JI1 J;  2MQ8 A;  4LF4 J;  4JI7 J;  4JYA J;  2UXC J;  4DR7 J;  4B3T J;  5AJ3 J;  4DV5 J;  4DUZ J;  4DV4 J;  4OX9 J;  3J80 U;  4GKK J;  2MTL A;  4DR4 J;  4AQY J;  3T1H J;  4JI2 J;  4LFC J;  5BR8 J;  4NEZ A;  1J5E J;  5LMN J;  4JI6 J;  1XNQ J;  1XMQ J;  2UUA J;  4LFA J;  2UU9 J;  4JI8 J;  5LM7 E;  1N33 J;  4LF8 J;  3T1Y J;  5IWA J;  2UXD J;  4JI5 J;  2UXB J;  4B3R J;  3D3B J;  5IT9 U;  4PWW A;  3J7A N;  4DV2 J;  4KY3 A;  3OTO J;  2E5L J;  5A2Q U;  4LF6 J;  4B3M J;  1FJG J; 
#chains in the Genus database with same CATH topology
 1NU4 A;  4F4K A;  3AOD A;  2PI4 A;  4XAK A;  4LR7 A;  5KFG A;  5CH7 B;  4YHH F;  3BGU A;  3MD1 A;  3GTY X;  1ZH5 A;  2HFS A;  9RUB A;  8ATC B;  3M32 A;  3BGL A;  1FKO A;  4BCA A;  1IWA A;  3TAR A;  2J0Q D;  3EXC X;  4URQ U;  4LSN A;  3TR5 A;  2HNY A;  1U0S A;  4AL6 A;  4X66 J;  1O51 A;  3IS9 A;  2GQ2 A;  4USK A;  2VV5 A;  4DR3 J;  2XGQ A;  3N6L A;  1T3N A;  1X4F A;  1GMW D;  2D3O 1;  2RSQ A;  4DSL A;  2J0X A;  4L72 B;  3ZTS A;  1UAW A;  4TVA B;  2M8H A;  3KLV A;  4BHQ A;  1HBO B;  1YSJ A;  1Q79 A;  3DOK A;  1N5T A;  1Y9O A;  2YWW A;  1HQU B;  4IRD A;  4PQU B;  4CH1 A;  4ZS6 A;  4AQY J;  4YB6 A;  2IFX A;  5BR8 J;  4F3Q A;  2XLJ A;  3T6B A;  2ROE A;  1KN6 A;  1TL1 B;  4N56 A;  4IG3 B;  3CO9 A;  3IM8 A;  1U09 A;  2AYE A;  2RML A;  2QTW A;  1H98 A;  2HHS A;  1KLM A;  1KHV A;  1RAF B;  1BQN A;  2JDJ A;  1FXR A;  4RU2 A;  3DRP B;  4RZR A;  4A8O A;  2A1B A;  2ZE2 A;  2CQ2 A;  4GVB B;  4LIR A;  5FDL B;  1IR1 A;  4CLY A;  2CZ4 A;  5D8H B;  2XTJ P;  2X1B A;  5KFR A;  1DUR A;  2WVD A;  4TYA A;  3J7Y U;  2HQG A;  4FPR A;  4DPX A;  1TUW A;  1KTQ A;  3ENA A;  1YJ9 S;  2VPZ B;  1TR0 A;  4U8V A;  4WTO B;  3CMQ A;  2B4U A;  4L75 A;  2L9W A;  4JI0 F;  3IMQ J;  4Q0B A;  4I4B A;  2KB2 A;  2YNF A;  3Q24 A;  5LMN F;  2HK2 A;  1EKR A;  3L95 X;  4ETX A;  2JC1 A;  3AHP A;  2HHQ A;  5G0R A;  4CLZ A;  1S1U A;  5AE1 A;  1YVF A;  1FRI A;  5CZV A;  4A47 A;  3N79 A;  1Y5N B;  1OWX A;  2ERR A;  1RTD B;  2V8P A;  3CXC R;  2AGQ A;  1PO6 A;  1N32 F;  1ZAW A;  4F04 B;  2G0C A;  3OD2 A;  3E51 A;  3QID A;  2RVJ A;  1UA0 A;  3HZE A;  4WF9 Q;  2RU3 A;  1C0T A;  4FPI A;  3GIM A;  2DEJ A;  1RWO B;  2P9C A;  2V50 A;  2JNJ A;  2WHO A;  2WON B;  1JK9 B;  4F2S A;  1JLA A;  1UTA A;  3KJF B;  2HWT A;  4C8L A;  4HL9 A;  4DLE A;  2CJQ A;  2O1P A;  3H2U B;  2UXC F;  4TXS A;  3KFW X;  4WE1 B;  5B0E A;  1LWF A;  4KFB B;  4QIG A;  3NAH A;  1J5E F;  4KPC A;  3OTC A;  1ICE B;  2DRB A;  5KG4 A;  1NB2 A;  1SC4 B;  3G6V A;  1JLF B;  5KT6 A;  3T1Y F;  2OPR B;  1P1L A;  1S77 D;  4FKY A;  3MF5 A;  1C2P A;  2DO4 A;  4XDD A;  4RNO A;  2DNL A;  3T6J A;  5KFT A;  3TEH B;  4I67 A;  4B3M F;  3RU0 A;  2H1Y A;  4OV6 A;  2F8E X;  1MN9 A;  3R8Y A;  3D0H E;  4YOE A;  3DNC A;  4F36 A;  3EX7 B;  3G2X A;  2E1M C;  4PAA A;  2DY9 A;  3MTJ A;  2IYI A;  2Q6B A;  1KQF B;  2K8G A;  1WDT A;  3MUT P;  1FWP A;  2OSQ A;  3D0I E;  4K4Y A;  1F2H A;  3DOL A;  1FVQ A;  2HHH F;  2R7Q A;  2FJX A;  3OR1 A;  2OML A;  2QLB B;  2RIJ A;  1ARO P;  4ECV A;  1RYS A;  3BPD A;  1NK4 A;  4WXO A;  2RHQ B;  4L3K A;  1TQL A;  3QO9 B;  3OJS A;  1LXN A;  4RWX A;  3O44 A;  1R0B G;  3R7B B;  3D7S B;  3H5X A;  2ACY A;  2ZNZ A;  5HBM B;  3KK2 A;  1HNZ J;  1UPM B;  1FI4 A;  4QCL A;  3LP2 A;  1YBT A;  2ZBR A;  4A8M P;  3FJ2 A;  2BJ8 A;  1VQ9 S;  3HHL C;  5EN1 A;  4NMX A;  1MG7 A;  2Q1L A;  4IH7 A;  1FVS A;  1AYE A;  2ZVI A;  2Z57 B;  4WPA A;  1AUD A;  2JL9 A;  4QOT A;  4B3R J;  2FJA B;  2NPI A;  4DV2 J;  3B78 A;  1Q0N A;  3PX0 A;  2DEI A;  2FHM A;  2MQM A;  3VAL A;  5E0O A;  2WW4 A;  1VC0 A;  1MLA A;  3MD3 A;  1GQE A;  1OPZ A;  3I6P A;  4YY3 F;  3KDN A;  4KYZ A;  2WOM A;  1RE1 B;  1HI0 P;  4I2Q A;  3C19 A;  4ZVQ B;  1Q5Y A;  3ZO7 A;  2DYA A;  4XO0 A;  1SB6 A;  3TJA A;  4PXB A;  4OQJ A;  4C11 B;  2DGX A;  3R1H A;  2UVU A;  4OI4 A;  1VQK S;  4KV8 A;  1V9O A;  4OX6 A;  3FUY A;  3KLH B;  2OD6 A;  2Z4P A;  1N5Y B;  2NYI A;  2C2Z B;  4LJM A;  2VBY A;  2MST A;  2ZKU A;  4DUZ J;  4GKK J;  1T9T A;  3C16 B;  1SXL A;  1ZAV A;  4K8R A;  1RT2 B;  4KT0 C;  4C3K A;  5ETR A;  4KKO A;  1OPI A;  1S4F A;  2G0J A;  2IBK A;  1HKA A;  5B0B A;  1M5K C;  3WX8 A;  3GG0 A;  1VLY A;  1X9W A;  1AT1 B;  4PCQ A;  5D4P A;  5DQI A;  3DRR A;  3GON A;  3K59 A;  2NS1 B;  3MDF A;  1RWW B;  2XG8 A;  3B8H A;  4J7C A;  1ULR A;  4KSE B;  1S76 D;  4X2B A;  4IFV B;  2G9O A;  1LWX A;  1V3Z A;  1TV6 B;  4DFJ A;  1HNV A;  1YJ7 A;  2B6A A;  2DBB A;  1VGY A;  1A9N B;  4P7V A;  2PT0 A;  4ZCK A;  2DIV A;  3AOC A;  4DV4 F;  2ZWP A;  1JIH A;  2ZEJ A;  1PAE X;  3OFF A;  5LJ5 Y;  3TRG A;  4ZKA A;  2QN6 B;  1RDR A;  4MKB A;  2HWI A;  3UPF A;  3QT5 A;  1WOP A;  3GYN A;  3S01 A;  1R89 A;  3MAH A;  1SKW A;  3L7P A;  1H72 C;  1FKP B;  3DC2 A;  1OY6 A;  1PKU A;  5B0G A;  1T05 B;  2IA6 A;  3Q8S B;  2UUA J;  3PAC A;  1LK5 A;  4O4G A;  2RKI A;  3UD3 P;  1CJV A;  3D68 A;  2OO4 A;  3PZP A;  5KFP A;  2F8M A;  3VHQ A;  1RWX B;  4S0M A;  2WVE A;  4DDF A;  3LOU A;  3RYL A;  1K8A T;  2L9D A;  1QSL A;  1OYD A;  3GII A;  3W62 A;  4ELU A;  3TA0 A;  4ILR A;  4ZVR B;  5CA5 A;  2JHE A;  5IV3 A;  5DG8 A;  5DDP C;  2FHJ D;  2CPZ A;  1EB0 A;  2QRR A;  2B7B B;  3PW4 A;  5CHC B;  3MMA A;  3KUG A;  1ZZN A;  4P9S A;  4CT8 A;  1WKL A;  4F4A A;  3IAM 9;  2W01 A;  4K4U A;  2XMU A;  1M5O C;  4JYA J;  1SJR A;  4IO9 Q;  5D6G A;  3PIO Q;  2HKE A;  4ZHR B;  2QA1 A;  4ECU A;  6FDR A;  4CIO A;  3UD4 P;  1U2C A;  4ZPT R;  4NLS A;  4C3L A;  1HR0 F;  3LP0 B;  4HI2 A;  1RAH B;  1FHT A;  2DR8 A;  2B4O A;  4B3R F;  1LV5 A;  3TYT A;  3K5M A;  2HBQ B;  1HNW F;  5HVF A;  3A3N B;  3HHN B;  1UFL A;  2FTR A;  4KRW A;  3A8K A;  1RT3 A;  5EWG A;  1Z1Z A;  2GQC A;  2MLZ A;  5DM6 Q;  4ZPD A;  4ZIV A;  5KT7 A;  1FXL A;  2UVR A;  1RT7 A;  5KG0 A;  3D4J A;  3BRE A;  1T02 A;  4Q2M A;  2AIR B;  3CJ3 A;  4PRF A;  4F50 A;  2KZM A;  1HWU A;  5KFX A;  2ASJ A;  1NUE A;  4X4T A;  2M70 A;  1DLO A;  4WYW A;  3W65 A;  3I82 A;  1W7W A;  2MQO A;  1B3T A;  1GTE A;  1T7P A;  5K5M A;  2YX4 A;  3RW7 A;  3FGV A;  3OTD A;  4X4V A;  3QRP A;  2OUG A;  3IXQ A;  3W9I A;  5KT3 A;  4TU9 A;  4Y28 C;  3L09 A;  3RB0 A;  2XCP A;  3SYZ A;  1NHK L;  2HND A;  1C4C A;  1D3W A;  2NXE A;  5T14 A;  3PX4 A;  1KTV A;  4PYD A;  4C4W A;  1RCX B;  2DNQ A;  2RHS B;  2MQP A;  1JLQ A;  3N0V A;  2GNK A;  1WG1 A;  5IZH A;  4A8Q A;  3MFI A;  1R43 A;  1R8C A;  1U1Q A;  1R6V A;  3W9J A;  2V67 A;  4DV7 J;  1KVI A;  2OPS B;  3IBW A;  3NGD A;  1S0V A;  4QW8 A;  2AU0 A;  1RBA A;  4HDG A;  1FK9 A;  4DEZ A;  2HIQ A;  4G1P A;  4OYX A;  4DR7 F;  1EET B;  1WWH A;  1U48 A;  3CVK A;  3RB6 A;  2R7O A;  4EU0 A;  1FER A;  5C2C A;  8AT1 B;  4H4K A;  3MM9 A;  4YB7 A;  5E5N A;  1CPZ A;  3TJ9 A;  3NBP B;  1WSV A;  1U7L A;  2B9X A;  2QT7 A;  1UWB B;  3MUV P;  2MZR A;  2MZT A;  3OLA A;  1VLO A;  2XYG B;  3W61 A;  3FEY B;  5F8I A;  2E5I A;  2IRY A;  3HD2 A;  4P71 A;  4LF6 F;  2I6W A;  1JX4 A;  4DV3 F;  5CD4 H;  1UVN A;  2EC2 A;  3HFK A;  1HD1 A;  2OP5 A;  2UUA F;  2Y0B B;  4DL3 A;  3T5J A;  2M2B A;  3CGI A;  1K73 T;  5ETL A;  1URR A;  3G6X A;  2HS0 A;  3PW2 A;  3HLU A;  4NYP A;  4CTA A;  2JH3 A;  3VAH A;  4IR9 A;  1Y3K A;  4DXL A;  4OHX A;  2W2P P;  4HT5 A;  1M0S A;  1TUG B;  3RB4 A;  1F2G A;  4LF4 F;  1RAO A;  2FIU A;  2JFK A;  3BZQ A;  3HJV A;  4WK3 A;  1WG5 A;  3QFW A;  2LVW A;  2AGO A;  3MMC B;  1KDN A;  5JMN A;  4EBC A;  5ETQ A;  3OPK A;  5IT9 Y;  2HAF A;  5CYQ A;  3SSR A;  2W9C B;  3PW5 A;  2K06 A;  1PCA A;  1TFY A;  4TU7 A;  2YY3 A;  4JYA F;  3AB2 B;  3MPW A;  1CJK B;  1JLG B;  5HP1 A;  4AUK A;  2F4F A;  3AQP A;  2NZ4 A;  4K50 A;  1JXL A;  2CWX A;  1RLC L;  2HAI A;  1FDN A;  4OI3 A;  5AXL A;  2MHE A;  2CKW A;  3MM6 A;  4I1T A;  4LBI A;  2IVY A;  1T94 A;  3RB3 A;  3MPU B;  4LSL A;  2CQ3 A;  2WB4 A;  1YJW S;  1NHV A;  3UCZ P;  2O01 C;  4ZPC A;  3MOZ A;  4ECY A;  2BKP A;  5L9N A;  4O0I A;  4M5L A;  2PMZ D;  3KK3 A;  3P6Y C;  4B9T A;  4M5M A;  2FVQ A;  2XB2 D;  1I6J A;  4WP8 A;  1MWQ A;  2DNN A;  5HMZ A;  1NPP A;  4KHP J;  4KGX B;  3PR5 B;  5FLX Y;  1X5T A;  5GAD I;  3QRR A;  3WHI A;  1WG4 A;  3BYP A;  2A2C A;  2HLU A;  3UN3 A;  3QJP A;  3T9N A;  2COL A;  4UOC A;  3LWM A;  4IRC A;  4RNM A;  2RDD A;  2KRB A;  4CO2 A;  3CDA A;  1FWK A;  4OZ2 A;  3C6U A;  1KON A;  4Q43 A;  2ABY A;  3ZXW A;  4KO0 B;  1F5B A;  3ETO A;  3RRH A;  3I0R A;  3OXF A;  2R7U A;  2HQF A;  3I4H X;  4NI2 A;  3H0P A;  1QSS A;  2FHJ A;  3OTB A;  1RT4 A;  3IWN C;  1X7V A;  4K2X A;  4GVL A;  4OZ1 A;  4LFC J;  2HHX A;  3QIP A;  4FNH A;  2WK4 A;  1MWZ A;  1VFJ A;  2FC8 A;  3MM8 A;  3H8Y A;  4DR6 F;  3PG9 A;  4FYX B;  3G82 B;  1L3S A;  3CCU S;  2KU7 A;  1IKX B;  2JEG A;  1YDL A;  1ZTT A;  2J6T A;  2QG9 B;  4FN5 A;  2QLF B;  3H25 A;  3CJ8 A;  1N5V A;  4OHW A;  1KHW A;  2VG5 B;  4QWE A;  3PO5 A;  2J9C A;  1F6T A;  1BLU A;  2NQP A;  4AND A;  1KQG B;  3IC1 A;  3S1T A;  3SMZ A;  1HNX J;  3IN5 A;  3IRX A;  2JEJ A;  1IJF B;  1HQ2 A;  3QGG A;  2EFN A;  1V3S A;  4CO3 A;  4H54 A;  1DHM A;  3Q23 A;  3DXS X;  3SDE B;  2CPJ A;  2QA2 A;  3KJQ B;  2HQC A;  1ZA1 B;  1Z2L A;  2CQ4 A;  2ZDP A;  1K9M T;  3QLH A;  3OVA A;  5C5J A;  2QLW A;  1L3V A;  2CPY A;  4DR4 J;  2HFU A;  4M8L A;  1EKS A;  4OJH A;  1K1S A;  3ZTR A;  3FDS A;  1X4G A;  5K8P A;  2OEK A;  5IT0 A;  2LLZ A;  4CLU A;  4DX7 A;  3TUP A;  2FUG 9;  2W9B A;  3B4D A;  2DHG A;  3LTO A;  1TAQ A;  1GXL A;  2XEX A;  1VQP S;  3J7Y I;  1TL5 A;  4NLW A;  4QPX A;  1R31 A;  5E3P A;  3CJQ A;  3BEG B;  1T11 A;  5CD4 A;  4NXM F;  3M2U A;  1IBL J;  2YKP A;  1LFP A;  5DQG A;  1FKA F;  2HHV A;  1SIW B;  5C25 B;  1REG X;  3LQV A;  4UF4 A;  2XNQ A;  2GJI A;  2MKH A;  5KFC A;  2ZH2 A;  3ZFV A;  2NYH A;  1CC8 A;  5KFJ A;  1KNZ A;  1UMJ A;  2AWZ A;  1E6V A;  3TZY A;  1S6U A;  2MZQ A;  2GAH C;  2ZDO A;  5HMW A;  1Q81 T;  3I0S B;  2QIF A;  2GIQ A;  3ZTQ A;  2DHA A;  1QE1 B;  1UET A;  1TK5 A;  5A76 A;  1AFI A;  5J2Q A;  4LVO P;  3F44 A;  4ZPA A;  3TOQ A;  1N56 A;  3SIP B;  2DGV A;  3ICL A;  4JV5 F;  1SCJ B;  4B08 A;  2BAN A;  1B7F A;  1SJQ A;  1GT8 A;  2PA3 A;  2YH1 A;  4DFM A;  3D5M A;  2ROP A;  1HBM B;  4EBD A;  4YDX A;  3CC4 S;  2XS5 A;  4AL5 A;  2FVS A;  3JSM B;  4O44 B;  5KFA A;  5DZ7 A;  4F4Z A;  3TUI C;  3E8O A;  1NLK L;  3GP9 A;  2CFX A;  4OZ0 A;  1TTH B;  3T41 A;  2IJR A;  4NLP A;  1F9F A;  5L1L A;  4IOA Q;  4ZJL A;  1XQI A;  4OYO A;  3DLK A;  1UJ4 A;  1U2F A;  4LBP A;  3BGR A;  3TZZ A;  1YX2 A;  4DQI A;  1TKZ B;  1RAI B;  5LSO A;  1NH8 A;  4FF1 A;  2UUC F;  3R1L A;  4Y2M A;  2QYC A;  4DPU A;  3NMA A;  2UXB J;  3B54 A;  4DSJ A;  3M8Q A;  2Y9H A;  1B0T A;  4HTI A;  5AXM A;  1TL3 B;  1UZH A;  3TA2 A;  2Q79 A;  1XNR J;  4PXD A;  3VQS A;  4KAI A;  1OMS A;  2KT3 A;  3HHL A;  4FS2 A;  5E7O B;  3N6N A;  2R7S A;  5JXS A;  3BR9 A;  2PMW A;  4PPD A;  1JLB A;  1SJ1 A;  1YJR A;  1QM9 A;  2HSE B;  5GVQ A;  3MEG A;  5EHH A;  1YZ6 A;  2EC0 A;  5KFY A;  1RT6 A;  3O8W A;  3G96 A;  5HVG A;  3U7J A;  1NDL A;  5KG7 A;  3J7Z T;  1JJ2 R;  3A1Y G;  3RTV A;  2GVD A;  3BR8 A;  3QGH A;  5KFE A;  4DUT A;  2V9W A;  4C48 A;  1XC9 A;  1U25 A;  3VZI A;  1U1O A;  4IG0 B;  3ILJ A;  3OSP A;  3UDC A;  1SVD A;  2D74 B;  2O3D A;  3MEC A;  2VON A;  2FB0 A;  1TL7 A;  3KLF A;  4Y2A A;  2HVH A;  4HAC A;  3PNI A;  3BO3 A;  3BN7 A;  4ZLP A;  1U02 A;  5A0Y A;  3C3L A;  2F40 A;  4M5G A;  1IBM F;  3BQ2 A;  2NRE A;  2EG2 A;  1KD1 T;  1QTM A;  3FK4 A;  1RAC B;  2LA4 A;  4NRU A;  3MM7 B;  3W2V A;  2XY7 A;  5KFV A;  4J9P A;  3U02 A;  2J7K A;  1GEH A;  1U1M A;  1IBL F;  1RZM A;  3U1L A;  4DV1 F;  1VQ4 S;  4DR2 J;  4LR9 A;  3M2R B;  1UZD A;  1CS4 B;  5L1J A;  3AXM A;  1BXN A;  1OJ4 A;  2DNR A;  1DY3 A;  1S72 S;  2C1E B;  5ETT A;  2C42 A;  3LGH A;  3ELH A;  2VFS A;  1NJZ A;  1YK9 A;  3H5S A;  4X4O A;  1VQS A;  3VGU A;  5KFM A;  2WRM A;  5K14 A;  4DN9 A;  2MHN A;  3R5J B;  1NKB A;  2WAQ D;  1EX8 A;  1FTR A;  4Z37 A;  1NJI T;  1F1B B;  4A8Y A;  2R8I A;  2V4R A;  3DOM B;  1SQF A;  2MJN A;  3OR2 B;  3M8S A;  1ZET A;  2HQD A;  2CIM A;  4OYZ A;  4C0B A;  4HKQ A;  1PIL A;  2YNG A;  5A8K A;  1EHW A;  1J5O A;  1X4E A;  1TUV A;  3HDS A;  2YKO A;  4OZ3 A;  2VPY B;  1VRT A;  2VOO A;  3KJV A;  3NGU A;  5D0E A;  1VQ6 S;  3QWP A;  4DV6 J;  1WSR A;  1FKO B;  2WBR A;  4Y2I A;  4TU8 A;  2W4D A;  4LSN B;  2HNY B;  4LF5 J;  1RLD A;  5HMX A;  3MR5 A;  3IS9 B;  1JXE A;  3EZ5 A;  2HG4 A;  2B9W A;  4B3S J;  4O3O A;  2KI2 A;  3KMQ A;  2VFV A;  4M5I A;  4DUY J;  3BQ1 A;  4RW8 B;  2CG8 A;  3KDO A;  1HYS A;  4TY9 A;  3IRW P;  2JVO A;  3SSS A;  2N4C A;  4EGL A;  1RKI A;  4OHZ A;  1EJ7 L;  1BD6 A;  4NA1 A;  4OZL A;  4WU3 A;  5F3Z A;  1WOS A;  5F8L A;  2DH8 A;  2GCF A;  2AEF A;  2AT1 B;  4EZ6 A;  4BC9 A;  2RIL A;  4W92 B;  5D4L A;  2UXB F;  4I6W A;  3DYA A;  2W2M P;  1KLM B;  1CG2 A;  2MZJ A;  4TLQ A;  2KM8 B;  1VQ7 S;  4GC7 A;  1B99 A;  1WNE A;  1FRX A;  2ZE2 B;  3A13 A;  1LNQ A;  4PAB A;  4DCP B;  3K5P A;  4AD6 A;  1C1B A;  2KXH A;  2M5Y A;  3X1L B;  8RUC A;  3ULH A;  4JI3 J;  3I96 A;  3F0N A;  4NLD A;  3H90 A;  5EX3 A;  1ZA2 B;  4WXW A;  4Q0B B;  2YNF B;  1SBR A;  1R0C B;  3QGI A;  4JI2 F;  4HHU A;  2LEC A;  4DL5 A;  5EGY A;  3MM5 A;  3CC7 S;  3G9C A;  2YNI A;  3KOA A;  2GML A;  3CDW A;  1HL6 A;  4LF8 F;  1U0H A;  5D77 A;  2GAG C;  2UXD F;  5A2Q Y;  4C7Q A;  3TI0 A;  3IG1 A;  2HZA A;  2SXL A;  3P96 A;  4OZN A;  2HBR B;  2PE8 A;  1Y3J A;  2VJV A;  1N0V C;  2W25 A;  1EP4 B;  5BJR A;  4M63 A;  4HT7 A;  3V4I A;  1WC1 A;  1CJT A;  1NSQ A;  1FX4 A;  3IAS 9;  5GAG U;  3ZZ0 A;  2GIR A;  2K1R A;  1X5P A;  2J9E A;  4ANE A;  3M2V A;  1C0T B;  4R5P A;  2NPF A;  1KSP A;  4LF9 F;  1YJT A;  1UL3 A;  1FCA A;  3D67 A;  2LU2 A;  5SUH A;  1JLA B;  1X5S A;  4ICL A;  4K7Q A;  1D9D A;  5D3G A;  3ISN D;  2WBM A;  4Q5V A;  2G4B A;  1TZ0 A;  1N52 B;  2OTJ S;  2IMO A;  1OO0 B;  1IUJ A;  4CYU A;  2RRA A;  6AT1 B;  4FXV A;  2R2S A;  4GMK A;  1LWF B;  4DSI A;  3P8B B;  2P2C B;  2YWF A;  3OBI A;  1X4A A;  4KR0 B;  3RBD A;  4NEY A;  2FJE B;  5F8H A;  3VGV A;  3Q22 A;  1SJ3 P;  2HVD A;  2IAJ A;  4FYW B;  2BBE A;  1A6L A;  1S7I A;  5HN0 A;  3SQG A;  2I5J A;  4GO5 X;  3W8G A;  1QVF R;  2W7O A;  4ENO A;  5ETN A;  1YLX A;  3VZH A;  1G6B A;  3NKY A;  3T1H J;  3MUM P;  1RTJ A;  5H9E J;  4OYP A;  2BA9 A;  5BYS A;  2V69 A;  1WI6 A;  3JQM A;  2X7I A;  3DOL B;  2GA7 A;  2GW8 A;  3VVT A;  4WBF A;  3OR1 B;  2HLT A;  2XUL A;  2Y8Y A;  2KT2 A;  2GHV C;  1S48 A;  5B09 A;  2ZJQ Q;  2LEP A;  2VBW A;  2QA4 S;  3TZW A;  2HMI A;  2OD4 A;  1VK3 A;  1VRQ C;  4JI1 F;  3T5L A;  1RHQ B;  3KNA A;  3RAX A;  2V2K A;  4X62 J;  1T0T V;  4C0O C;  2G2O A;  4FXW A;  2LDY A;  3IA0 A;  3CJK A;  1N0U A;  3NOC A;  5B0A A;  4F67 A;  4OX9 F;  3HPO A;  3LH2 S;  1YJN S;  5C7P A;  4ECW A;  1X8D A;  3QRQ A;  4A8W A;  4OIX A;  5H9E K;  4LUB A;  4JI7 J;  2R7V A;  1JLE A;  4B3T J;  2X1F A;  3GCX P;  2V5H G;  3FQK A;  1GAO A;  1DZ5 A;  3NP5 A;  4PWD B;  4WFN Q;  3RBZ A;  2Y0S D;  4LSZ B;  5ETS A;  1HBN A;  4ZA1 A;  5L9X A;  4WFB Q;  4F2R A;  3DHX A;  2FLL A;  4PWW A;  2IRX A;  1REV A;  1B0P A;  1H38 A;  1I94 F;  4C8O A;  1CSJ A;  3MEE A;  3JYT A;  3PRD A;  1MMN A;  3NGK A;  2WOM B;  1DJ0 A;  2B4P A;  3EJM A;  2W8K A;  4I2Q B;  3TVK A;  2LQ5 A;  3K8V A;  3J81 U;  3BDP A;  4R25 A;  1HQE A;  2MLY A;  2XI2 A;  1V5V A;  4B9U A;  4DR5 J;  3W60 A;  4Q45 A;  4OI2 A;  2YXL A;  3SFG A;  4JI6 F;  2GX8 A;  1SC1 B;  2DK2 A;  1TKD A;  4YR3 A;  2XZW A;  3LUY A;  2IC3 A;  4KV8 B;  2RRN A;  4E8U A;  1NSK L;  1RU2 A;  3W5Z A;  2OEJ A;  3RRG A;  1PGZ A;  4M5K A;  3BBC A;  4KKO B;  3UDE A;  1ZM9 A;  3RW6 A;  4LRC A;  5GMD A;  1SV5 A;  4LRE A;  1IM6 A;  1JNZ B;  1NK9 A;  4UOG A;  3HT3 A;  1U49 A;  2V63 A;  3DRR B;  2NUH A;  2DIT A;  2I0X A;  1FJG J;  3Q8Q B;  2GO8 A;  3I32 A;  4ER8 A;  1HNV B;  5E33 A;  2B6A B;  5U47 A;  4ALZ A;  5KFH A;  1HMV A;  3NNA A;  2IYG A;  4ES2 A;  3OL7 A;  1NCL A;  4LR8 A;  5DGB A;  2WW8 A;  2GVZ A;  1UVJ A;  3HCX A;  1S10 A;  3CJ4 A;  2OKQ A;  4C2M A;  1O6X A;  1T03 A;  4DPO A;  5LSR A;  1MSW D;  1RP5 A;  5LL6 d;  2R7W A;  1JJC B;  1Q7L B;  4KH1 B;  2IM3 A;  1QAJ A;  3UQS A;  1VIS A;  3UDL A;  3NGR A;  1FNM A;  4RX6 A;  4DL4 A;  4Y0F A;  3HHE A;  3OHA A;  2E9Z A;  3K5N A;  4WP3 A;  1FF2 A;  3DLE A;  2ZHA A;  3FSI A;  2QSW A;  3TQE A;  2HHP A;  1ZM3 A;  4QIE A;  5G4D A;  2EKY A;  3DHW C;  4PYA A;  3MEK A;  4X4R A;  2ZVS A;  4X4P A;  3SCL E;  3KLI A;  4ANC A;  1AW0 A;  4X4U A;  2CDR B;  1XMO F;  2BKN A;  1H2T Z;  1U8W A;  5CQG A;  2RKI B;  2BQR A;  2QE5 A;  4CP5 A;  1CJV B;  1HBO A;  5T41 A;  1PAU B;  3NY0 A;  4DOZ A;  4FYV B;  3EPI A;  1AZS A;  1N36 J;  4DSF A;  2KG0 A;  2ZH1 A;  3Q86 A;  4UOH A;  3HK2 A;  3FQL A;  2B56 A;  3JAM U;  3GB0 A;  1MWY A;  2ZJR Q;  4ZK7 M;  2JEF A;  2CWK A;  1IM4 A;  2ZUG A;  4IRK A;  3MMA B;  2EK1 A;  1EQ0 A;  1NDC A;  3GWC A;  2WTF A;  4EMD A;  4BBY A;  5M2P A;  4NL5 A;  1JLC A;  1SL2 A;  1T9W A;  1YRU A;  3JSR A;  1PC4 A;  4USH A;  3K57 A;  1JWW A;  2J8S A;  4K4S A;  3A8J A;  3RJM B;  1OQ6 A;  3A12 A;  3ETM A;  1BMQ B;  4J9Q A;  4WTY A;  1F9H A;  1JKH A;  3KG4 A;  3M8W A;  4LT6 A;  4DJB A;  3SV3 A;  1XR6 A;  1S6Q A;  3M8Z A;  2FVC A;  1EAR A;  2LEA A;  2RJZ A;  4KE5 A;  4G1Q A;  4Q8F A;  1GK8 A;  5I3U A;  1RT3 B;  3ZC4 A;  3HX9 A;  4ERD A;  2C2K B;  5A8W A;  2V4J A;  2LYV A;  2BRL A;  1S57 A;  4IYQ A;  4P2X A;  3TVY A;  4ECZ A;  1NKE A;  1QUP A;  2YWG A;  4F4W A;  1ZPW X;  3L4B C;  5AJ3 F;  3NGS A;  2YWH A;  4KGZ B;  2IA0 A;  1NJW A;  4ATN A;  1DLO B;  3MGJ A;  1PYT A;  3C66 A;  2ZM6 J;  3MWB A;  2OSR A;  3K89 A;  3BQ0 A;  4KH0 B;  2EFP A;  3TNV A;  1I1G A;  2KG1 A;  4F7V A;  3BGF A;  4YB1 P;  1T3O A;  4HEA 9;  2IIH A;  2P6S A;  4YR2 A;  5KT2 A;  3RAQ A;  1WOO A;  3BGO P;  1S1V B;  1GMV A;  3QGP A;  2BV3 A;  2ZBP A;  2PII A;  1FNO A;  2HND B;  2DCU B;  3IGN A;  3IWX A;  1VIX A;  5KOW A;  5LJ3 Y;  4UY8 T;  4JI5 J;  2CQP A;  2ZJP Q;  1JLQ B;  4K5R A;  4NLR A;  4NLQ A;  2HZC A;  4C8K A;  5GAE I;  2VG6 B;  4USV A;  5CYM A;  2OGU A;  2KJV A;  3FEX B;  1HIY A;  1L3K A;  1FK9 B;  1M1K T;  2ZH3 A;  4PG8 A;  2P6T A;  2V8D A;  5ETM A;  1H74 A;  5JJB A;  2MDA A;  2DVI A;  4CLF A;  3MED A;  1DTQ A;  2PGC A;  4A4J A;  2PFF B;  1N34 J;  2XZT B;  2J76 E;  4QWB A;  3MM9 B;  1U47 A;  2XMM A;  3T3F A;  2WVF A;  4MTP A;  4F4X A;  1CLF A;  4M1K A;  4RU9 A;  3D1Q A;  4ED8 A;  2KYX A;  2R8H A;  3DI6 A;  2Z30 B;  5CCM A;  4ED6 A;  3OL8 A;  4OJ3 A;  3C2P A;  3AY0 A;  1UVM A;  5HQL A;  2QA4 G;  2VD3 A;  1EAY C;  5KFB A;  2J7W A;  3TJ8 A;  4ECQ A;  1BWE A;  1IKY A;  1NAQ A;  3QAT A;  2PEB A;  3MCM A;  2EI5 A;  1S79 A;  1WTB A;  3CSK A;  5FD1 A;  3CD5 A;  1GH8 A;  2WVC A;  5KFO A;  4CTA B;  2XZD B;  2H51 B;  1X9M A;  2FY8 A;  1CUL A;  4R0E A;  1HW8 A;  1UFW A;  2CUY A;  4X64 F;  4MIW A;  2W2Q P;  2E5G A;  5D0R A;  2N4D A;  4J9N A;  1H0H B;  5EWE A;  5D0G A;  4AE5 A;  3PYF A;  5C2G A;  1HI8 A;  2CAJ A;  4DR1 J;  4DV0 J;  4N41 A;  5DJB A;  3R5G A;  3VR1 A;  5CYQ B;  2K7J A;  2YQ1 A;  1VHF A;  4NLX A;  2OH2 A;  3W64 A;  2G13 A;  5HP1 B;  3W66 A;  2A18 A;  1XTZ A;  1H2U X;  3I56 S;  3ZZO A;  4AFF A;  4IFY B;  4P52 A;  4LF7 F;  1QAY A;  2HFV A;  4LFA J;  1WF1 A;  5HVH A;  3GR0 A;  1FFS B;  3CJR A;  4ELV A;  2IM2 A;  2VA3 A;  1IBC B;  4UZC A;  2VQF F;  1F3F A;  3KK3 B;  2D9O A;  4CM0 A;  2DB1 A;  1N8R T;  1VQ8 S;  4Z7C A;  2V9K A;  2CNN B;  2EFO A;  1IKV A;  2IJF A;  5GAD U;  2E1R A;  2YKM A;  1DRZ A;  2B5J A;  3R7S B;  1DQ8 A;  3PRV A;  3OUY A;  4C8Y A;  4P72 A;  1OYE A;  4CLL A;  3C6U B;  3CO0 P;  2B43 A;  3QPI A;  2DNP A;  1TV6 A;  2W1B A;  4OX8 A;  3TW0 A;  3I0R B;  1TMJ A;  2LXU A;  4ECS A;  1HPZ B;  1FDB A;  2BOP A;  2LCW A;  4NI2 B;  2X1A A;  2MQN A;  4MIB A;  1RT4 B;  1RB0 A;  3D6M B;  3QIP B;  2MTL A;  4RNH A;  3ZNJ 1;  1UW4 A;  2I8E A;  4NLO A;  3NLC A;  2B4V A;  4EO8 A;  3D1H A;  4JI8 J;  3MM8 B;  2VFU A;  3EVM A;  2VJU A;  2QO3 A;  2B3T B;  3ILL A;  2AJ0 A;  2DNY A;  5KFN A;  4I69 A;  1I5O B;  4B9V A;  4Z2X A;  4DN0 A;  1LW2 A;  2RUG A;  5IS2 A;  2F4V J;  2QLJ B;  1M90 T;  3H4B A;  4ZCL A;  4ZCI A;  5CXT A;  1P9Q C;  3OL9 A;  3IRX B;  4YB5 A;  1TVR A;  1NH7 A;  4IH6 A;  1IQT A;  4EEY A;  3RG6 A;  4A8X A;  2QEX S;  1RT5 A;  1JJH A;  2CJB A;  1RAB B;  1XR5 A;  2JJ4 D;  4WYL A;  2OI2 A;  5HK4 A;  1PYS B;  3EXY A;  4NLY A;  2E29 A;  3L3C A;  3QLH B;  4HH1 A;  2VDH A;  1VJW A;  2O66 A;  4DV5 J;  2KM8 C;  1FFG B;  4LF1 A;  2FLO A;  2DNK A;  2VC1 A;  1HNI A;  4ZP9 A;  2H9Z A;  1TKX A;  2W9B B;  2EFG A;  2MMY A;  4RO0 A;  4FNI A;  3MUR P;  2QMU B;  3L7U A;  2GJF A;  4F0H A;  2VFR A;  4C8Z A;  3Q8V A;  5B0F A;  3BB5 A;  2C2R A;  3MPY A;  3M2U B;  3PCO B;  2PMH A;  2E1C A;  3DDN A;  2V34 A;  5I42 A;  2DXF A;  2C28 A;  1QUV A;  4DR1 F;  4USJ C;  5E3A A;  1WKK A;  2NXU A;  2NXC A;  4J37 A;  4RLE A;  2R2R A;  7AT1 B;  5CAB A;  2B0G A;  2OFG X;  1KFD A;  2QGF B;  4RW9 A;  1E6V B;  3R6L B;  3UNG C;  2ATC B;  4DBQ A;  3JQK A;  4CLS A;  2OPQ A;  2AQ4 A;  4L74 A;  5ETV A;  2DPI A;  2ZNY A;  5GAG I;  1Q8K A;  4ED3 A;  5J2Q B;  2HFN A;  3RGI A;  1U24 A;  1DTT A;  1NK6 A;  1HWK A;  2ZD1 A;  2F1F A;  2DGO A;  4MAK A;  2E1P A;  2BAN B;  2W7A A;  3EUN A;  2HHW A;  3OFG A;  3V81 A;  5GMK a;  1K0V A;  2GV1 A;  1V5I B;  1BWV A;  2U2F A;  4U7U K;  4NLU A;  2JLG A;  1KC8 T;  5J2P A;  1X31 C;  1Y11 A;  1IBK F;  1YQH A;  3EZU A;  4K4T A;  1R8H A;  4MK7 A;  3N4W A;  2APO A;  3HFV A;  3CDB A;  2M88 A;  1WD6 A;  2XI3 A;  2XNR A;  4Y2K A;  2XGP A;  3GR1 A;  2CXE A;  2UUB J;  3MHY A;  1Q8I A;  1C0U A;  3TQ1 A;  2OPS A;  2JSX A;  3T19 A;  4CCH A;  1U1P A;  2QYG A;  2MPU A;  1U26 A;  3GSI A;  4LRA A;  5K8O A;  2ZH8 A;  3MAA A;  3TO8 A;  3AB4 B;  2D3Z A;  3QT7 A;  1W25 A;  3BGR B;  3D66 A;  2E5L F;  4QIF A;  1FRJ A;  2HZV A;  5IM0 A;  1UEV A;  3HKZ D;  4RL1 A;  3WIV A;  2FYX A;  1GTH A;  4M95 A;  3CCW A;  3M8Q B;  1NBE B;  3A4T A;  1PJ6 A;  2CJA A;  1GXU A;  2I2Y A;  4DG1 A;  2WB1 D;  4X66 F;  4RR5 A;  4G1I A;  3FNN A;  4DR3 F;  1RT1 A;  4JI4 J;  2QFI A;  1CQM A;  3P3D A;  1WHV A;  2XHW A;  2XLK A;  4HDH A;  3CC2 S;  2CNK B;  5IC6 B;  2XLI A;  1JLB B;  4OHV A;  2ZH5 A;  3MEG B;  3LW5 C;  1F9E B;  5HAT A;  5HL7 Q;  3I5B A;  3A8I A;  2AZ3 A;  3BSN A;  4O3R A;  4AQY F;  3CCS S;  3EDR B;  5BR8 F;  2GVD B;  4YDD B;  2B9Y A;  4RJV A;  4J9M A;  4I2P B;  1HFE L;  3ENV A;  4WIQ A;  2LQJ A;  5J1P A;  2ZOG A;  1Q8B A;  2CJY B;  1B0V A;  3MEC B;  2OFH X;  1N6Q A;  2H5E A;  1TL7 B;  2F3J A;  3CD0 A;  3J81 j;  5DGA A;  5HLF A;  1N54 B;  2RS8 A;  5A0Y B;  4IR1 A;  4J91 A;  4CLP A;  2PO4 A;  3EIC A;  3M05 A;  1YJU A;  3C6T A;  2UUW A;  3BJY A;  2IM0 A;  1WC0 A;  1WHY A;  4A46 A;  3W2V B;  3QT6 A;  2CVI A;  3D3B J;  1YIT S;  1O8B A;  3HFZ B;  5C42 A;  2IBO A;  3OVB A;  2ZZN A;  4L6V 3;  4DL2 A;  4ZCM A;  3BYR A;  4XPE A;  3U1M A;  3J80 Y;  1RA6 A;  4IQX A;  2XWY A;  1FA0 A;  5HJX A;  3UVJ A;  4IUF A;  2AJQ A;  4K4Z A;  2K3K A;  4ZVE A;  3RBX A;  1KOH A;  4BLG A;  2VQE J;  5KFQ A;  5KFL A;  4U7C A;  3D1O A;  5K14 B;  4USI A;  4C3M A;  4CZC A;  1FDA A;  3GFY A;  4PG7 A;  3CUN A;  2YNH A;  1S6P A;  3BO4 A;  3D28 A;  2XMW A;  4EYH B;  5DO2 A;  4CDI A;  2G2Y A;  1WEY A;  2YQ3 A;  3PW0 A;  2VG7 A;  3CDE A;  3G4S S;  2OPP A;  4NEZ A;  4DPW A;  1V6H A;  2YNG B;  5A8K B;  1J5O B;  1E6Y A;  3HZG A;  2PI5 A;  1N33 J;  1MMD A;  3JTN A;  1LWC A;  1MRO A;  3OXG A;  3HUL A;  1VRT B;  2CPH A;  3G6Y A;  1G2E A;  2R7T A;  4ZP7 A;  2UV8 G;  1VMB A;  4RW7 A;  2QMW A;  1DBD A;  3HVW A;  3DLJ A;  2NCK L;  5LXY A;  3I55 S;  3NNH A;  4QR1 A;  4DI6 A;  2MZ1 A;  3K5L A;  3CD6 S;  2QLX A;  3AJ1 A;  4YS2 A;  3NS6 A;  1P6T A;  3CCZ A;  2FJW A;  3ADA C;  2AV5 A;  3G82 A;  4NX9 A;  4KHR A;  1KRP A;  5DRK A;  1IKW A;  1ZPV A;  5HAN A;  4QWC A;  5DDO C;  3CCE S;  2KXN B;  3PYE A;  2R42 A;  1HYS B;  4KIA A;  4OYA A;  3UN2 A;  3U27 A;  1YJV A;  2VA2 A;  3AA9 A;  5IXU A;  4I7F A;  1RBL A;  3KMS A;  4ETZ A;  4O23 A;  3FFI A;  2C3M A;  2LXI A;  2BJD A;  1S1W A;  1S1T A;  4D3G A;  1KWM A;  3KNG A;  3GV7 B;  1YZ7 A;  1BQM A;  5IT9 U;  3D6F B;  1NM2 A;  2RQ4 A;  3R7N B;  1RQ0 A;  4FBU A;  1S9E A;  4U96 A;  1U1L A;  4JI4 F;  4HI1 A;  2DIS A;  3OTO J;  2HRU A;  3EGN A;  1WEX A;  1HNZ F;  3PR4 A;  4MKV A;  2ROG A;  4HHH A;  1RU1 A;  1IR0 A;  4QIW D;  5F8N A;  3WX4 A;  4ZLJ A;  4ZPB A;  3GIJ A;  4X65 J;  1TL4 A;  2M3D A;  3US5 A;  3P49 B;  2CA9 A;  3CJS A;  5M2U A;  4Y65 A;  4IQM A;  3MM5 B;  2YNI B;  3LA0 A;  3AXK A;  1U0H B;  3PKY A;  1N5Q A;  4ZMM A;  2PEH A;  1VBZ A;  1XN9 A;  3IG1 B;  1QD1 A;  1OS5 A;  3ITH A;  1YWX A;  1CEZ A;  1KBR A;  2V6A A;  4PZV A;  4DV2 F;  2XSF A;  2M52 A;  3GG1 A;  1UCN A;  4HYK A;  3KK1 A;  3V4I B;  1CJT B;  2DHX A;  2GMH A;  2K1R B;  2DGU A;  3M2V B;  4R5P B;  4DZD A;  1UEU A;  2Q66 A;  3J7Z 5;  4Q7A A;  2ZHB A;  2E7V A;  3M8P A;  2QFJ A;  3MPV A;  2VU5 A;  3J81 Y;  3FBB A;  4ICL B;  2ALY B;  4WJB A;  5D3G B;  2VFT A;  3R2D J;  2V2Q A;  3OQ2 A;  3TWZ A;  4CYU B;  3C14 A;  3SCK E;  2EW9 A;  3CCJ S;  2OEL A;  3VV2 B;  4RW6 B;  1S7H A;  3A8E A;  4KGV B;  3V5R A;  4DUZ F;  4GKK F;  4WZM A;  1RWN B;  4IDK B;  2XS2 A;  3L9Z A;  2VUG A;  4CLT A;  1B64 A;  4YHH J;  4OYI A;  1U4B A;  2IAJ B;  6FD1 A;  2WSF C;  3RR7 A;  3SQG B;  2OLW A;  2I5J B;  3H7H B;  4LMZ A;  3R5A A;  3MR7 A;  3M30 A;  4FBT A;  2XS7 A;  3P4U B;  5J1N A;  1BY9 A;  3V2U C;  1RTJ B;  2JVR A;  3AJ2 A;  2P9G A;  4XPC A;  3EGW B;  1N33 F;  4M5D A;  4PKD B;  1LEO A;  1SJF A;  3CT9 A;  2BM1 A;  2XCA A;  2QX0 A;  3W8P A;  4PG5 A;  3DRS A;  5THW A;  3ZZR A;  2M0G B;  4CO4 A;  1TKZ A;  4N7T A;  2FHK A;  4ILL A;  4UZB A;  3W9H A;  4QW9 A;  4H4K C;  2HMI B;  4P2F A;  2HVE A;  3Q8P B;  1ZTW A;  3PO4 A;  2IJN A;  3MTK A;  2FC9 A;  4OHY A;  4XK8 C;  2YQ0 A;  4RUH A;  5AXN A;  1HA1 A;  4QYZ J;  4OJ1 A;  3CJK B;  1H7W A;  3M6W A;  1XBW A;  1AUS L;  1QTN B;  1H73 A;  2C2M B;  1BQX A;  3LPE A;  4ZN1 A;  1S1X A;  3P5T L;  4EFA C;  1VBK A;  1VBX A;  2V94 A;  1JLE B;  1VCT A;  4FDF A;  4C8M A;  4EK2 A;  1JMT A;  4J9S A;  4LQ9 A;  4K4W A;  4J9K A;  1RHU B;  1VR6 A;  3VTI A;  4CNZ A;  5LMN J;  3FKB A;  1HBN B;  3Q83 A;  3PJ9 A;  1FWL A;  2FZK B;  5KFS A;  1RAE B;  2H54 B;  3KUE A;  3GIK A;  2AJF E;  1GXT A;  4IG0 A;  1REV B;  3SZ2 A;  4G6V B;  1IN0 A;  3D6T B;  5DG7 A;  4TYB A;  2Q43 A;  4QYZ K;  1J2V A;  3TA1 A;  3LGM A;  2NXN A;  3UN5 A;  2CPF A;  4EI2 A;  4U6P A;  3W7B A;  1N32 J;  4Y6I A;  4X65 F;  1HQE B;  4ECR A;  4JV1 A;  4I64 A;  2HRT A;  4FF2 A;  1RAG B;  2E66 A;  5IV4 A;  3OL6 A;  2D69 A;  1K44 A;  1P1T A;  4M5H A;  3THP A;  3C46 A;  3EVO A;  3MMB B;  2IC3 B;  3TEG A;  2KL8 A;  4B9S A;  3GSD A;  1R0A A;  1SH0 A;  2XBP A;  2VIH A;  4DF4 A;  3HHL D;  2R2T A;  2UXC J;  1URN A;  2ZHO A;  1UVL A;  4PUO A;  4NZ7 A;  3DGP A;  2POK A;  3TX8 A;  1Q78 A;  1M5P C;  3QZ8 A;  2CQ0 A;  1S9G A;  2EK6 A;  1KQK A;  3HO1 A;  1J5E J;  3ENW A;  2IVF B;  4QYR A;  2F63 A;  2NUU G;  3V4M A;  1SV5 B;  2PD1 A;  3T1Y J;  2HNZ A;  4GRS A;  1MW7 A;  3FC9 A;  2MQQ A;  1WC6 A;  4ES1 A;  3EGV A;  1QY7 A;  2HS4 A;  4CM2 A;  1S0O A;  4B3M J;  1VQO S;  3UR3 C;  3AD9 C;  2PFD A;  4U95 A;  3OFH A;  4CNY A;  1HMV B;  4IKA A;  4ZVF A;  3S8S A;  2GVZ B;  1VQN S;  2ASD A;  2KVI A;  5I3Q A;  3FSX A;  4CH7 A;  5E2Q A;  4PWU A;  2Z2Y B;  3HSD A;  2HHH J;  2G1H A;  3MCS A;  2ADC A;  1NSP A;  4WK1 A;  5IQ6 A;  2J6U A;  3HJF A;  2UVW A;  3VAF A;  1P9Y A;  1CQN A;  2DH9 A;  1RYR A;  2DCL A;  3AOB A;  3DLE B;  4NPO A;  1M5V C;  5CYJ A;  2X3D A;  3ILO A;  4ZLN A;  5F8M A;  4YFU A;  3ZZU A;  4WCE Q;  3A3O B;  4DQS A;  2MY8 A;  1XMB A;  5D15 A;  3KLI B;  1LWE A;  5AT1 B;  3M1V A;  4DV7 F;  2CNL B;  2XQC A;  3FBC A;  4RW8 A;  1XMQ J;  3TZX A;  2D3O R;  2ACM A;  4G3I A;  2Z56 B;  1Z2Z A;  4P7T A;  2MB0 B;  3WIU A;  2CG4 A;  2J6S A;  2C2E A;  3MZI A;  2P5V A;  1X9S A;  4V19 X;  1AZS B;  5KFK A;  4O4R A;  3PYD A;  4DQR A;  2MKS A;  2PA8 D;  3NWG A;  4F26 A;  3I5C A;  3A3P B;  3V6K A;  2ZOM A;  3FVY A;  3MAQ A;  2V8V A;  4NCA A;  4WKY A;  2LP4 A;  3N9U C;  3UW1 A;  3DLG B;  2BE2 A;  4K5S A;  1KFS A;  1ZS6 A;  3IBC B;  1VDH A;  3NMR A;  3KXD A;  2AEM A;  4YY3 J;  1X5O A;  2EG1 A;  3R97 A;  4MH8 A;  2KT5 A;  1JLC B;  4ID5 A;  3EM1 A;  4PEO A;  2MQ8 A;  4ED2 A;  3QJL A;  5DLG A;  1JKH B;  5AE2 A;  2D41 A;  5KG5 A;  2Z0G A;  2AKW B;  1VS3 A;  2C22 A;  1S6Q B;  3NEK A;  2XYP B;  1D0E A;  4KTQ A;  3K2Y A;  3HSJ A;  1R8A A;  4B9N A;  4I56 A;  2GC8 A;  4G1Q B;  4C0H A;  2BJ9 A;  5I3U B;  5F41 A;  5A8W B;  2V4J B;  2H65 B;  3EPG A;  2GJ2 A;  1EP4 A;  4DPY A;  3H59 A;  4X4S A;  1U1K A;  2DPJ A;  3WDO A;  1X4C A;  3DMJ A;  4Y00 A;  1D09 B;  4YN3 B;  4OI6 A;  1RWV B;  3AQO A;  4RW4 A;  5RUB A;  2N82 B;  3AT1 B;  4GKJ J;  4BWM A;  1JQG A;  2KZZ A;  4EZ9 A;  2JRS A;  1Q95 G;  5LMU J;  1I3O B;  4UW2 A;  3D3C J;  2MKK A;  3BPS P;  1VQM S;  2VOP A;  4CWB A;  3POT B;  4NLV A;  1Y10 A;  2HIY A;  4ZP6 A;  4OLO A;  4DV4 J;  2JWN A;  3GFX A;  3AH6 A;  1UEK A;  4KHP F;  4R8U A;  1WEL A;  3W2W A;  3G71 S;  2BDP A;  3N5B A;  4BS2 A;  5GAE U;  1OSD A;  2KH9 A;  4WFZ A;  1NZA A;  5CYM B;  4B9M A;  3UE2 A;  1R8P A;  3S6E A;  5F9N A;  2FJV A;  3M6U A;  5B0C A;  4PG6 A;  3VGT A;  3NXZ A;  3SXL A;  2XSJ A;  3MED B;  1DTQ B;  4JV2 A;  1RXO B;  4ZJO A;  2HW3 A;  2BM0 A;  1H2V Z;  2D3U A;  4LFC F;  3H42 A;  1S5Z A;  4BWJ A;  3TUZ C;  2MKJ A;  4U8Y A;  1RI7 A;  3G8T A;  3DI6 B;  1NJX A;  3FSY A;  3GYX B;  5B0D A;  1WJ9 A;  3W5X A;  4DZ6 A;  2Z58 B;  2RDI A;  3DGV A;  3ISZ A;  3Q8U A;  2VBX A;  5AXK A;  2BX6 A;  4DFK A;  4MKY A;  4IOC Q;  3CCL S;  1XMQ F;  3ENQ A;  3BBB A;  2ILZ A;  3FBF A;  2J7U A;  1IKY B;  3M4X A;  4O3P A;  5HSP A;  4WZQ A;  3PKM A;  3I9V 9;  3KYL A;  3M6X A;  5IOL A;  2Y1I A;  1HNX F;  4NWB A;  1YI2 S;  2MQL A;  1HBU A;  2W2O P;  5A2Q U;  1CUL B;  4DMZ A;  3KG1 A;  1M1G A;  4PWD A;  2RQC A;  5T7L A;  4MMO A;  2Q3P A;  2KVQ E;  3TAP A;  2RD5 C;  1I51 B;  1HR0 J;  1SH3 A;  1KS2 A;  4FVC A;  4I6A A;  1YBA A;  3VAJ A;  3FCV A;  2AJ4 A;  3PEH A;  4GC6 A;  1HNW J;  4TNO A;  1M5S A;  2DD8 S;  4DR4 F;  1S0M A;  1CJU A;  3CB4 A;  2VKZ G;  5KFI A;  3N5F A;  2AEJ A;  2W24 A;  3GYG A;  4FYD A;  3CED A;  4DX5 A;  2DR5 A;  3M9M B;  3BM7 A;  3KTQ A;  3NS5 A;  1MU2 A;  3IR6 B;  2D1C A;  1HI1 A;  1ZBT A;  1RHJ B;  2FVP A;  4M5N A;  1B7Y B;  1X4H A;  2G2Z A;  4DF8 A;  4KGM A;  4C8N A;  1A7G E;  3OT9 A;  2LQ8 A;  4TY8 A;  1NK0 A;  2YKA A;  4OI0 A;  4Q2L A;  1SC6 A;  4DX8 H;  3NG8 A;  3G8Q A;  1G1X A;  2WZ1 A;  2AYG A;  2N3L A;  1R27 B;  1F5C A;  4F3O A;  1UW9 A;  4DWI A;  2NXJ A;  1LK7 A;  3NWR A;  3PYG A;  2MXY A;  4K2J A;  2ZOF A;  3BS9 A;  1IKV B;  1BUX A;  1GMW A;  2JOQ A;  3CIM A;  3TX0 A;  1YHQ S;  1FJC A;  2IM1 A;  3JQJ A;  3CWJ A;  3THV A;  2YKM B;  5A6P A;  5J1E A;  2B5J B;  4V1A k;  1JNR B;  1SJ4 P;  3OUY B;  5EDW A;  4GKJ F;  3BV8 A;  4V19 J;  1VRU A;  2GQQ A;  2RF2 A;  3OV7 A;  2E44 A;  1O5J A;  5LMU F;  4NE9 C;  2BUN A;  4E2F B;  1DQ9 A;  1WDD A;  4X84 A;  2U1A A;  3DM2 A;  3F41 A;  3JSY A;  1VQL S;  3KLG A;  3KWM A;  3V6D B;  1SUQ A;  4DR7 J;  1IR2 A;  3O1L A;  3GJR B;  2F65 A;  2QZ8 A;  3PDN A;  4A8F A;  1OY8 A;  1P27 B;  4B17 A;  2YKN A;  3M32 B;  5DDQ C;  5KT5 A;  1U1R A;  3CDU A;  3E3X A;  5D4N A;  2AW0 A;  1N4L A;  5E3R A;  3UR0 A;  3KHR A;  1Q86 T;  4LF6 J;  3FCW A;  1LW2 B;  3GV5 B;  4DV3 J;  3O6Q A;  1CVJ A;  3E01 A;  2KTQ A;  4QBU A;  2BQU A;  2AGP A;  1J27 A;  1WC3 A;  1WC5 A;  1WUU A;  3Q8R B;  2GIF A;  3H5Y A;  3GCW P;  4LBH A;  4FXD A;  5L1K A;  1TVR B;  3GIR A;  2IVM A;  1D1U A;  3AJD A;  4PPZ A;  2BE9 B;  4X4Q A;  1FRK A;  1RT5 B;  3DOK B;  1RBO B;  4UY8 5;  4PXC A;  5EUH A;  1QLN A;  2DR9 A;  2NZC A;  3PHT A;  3UCU P;  1H7X A;  4USU A;  1FTC A;  4DL7 A;  1PBU A;  2I9S A;  3WC0 A;  3MPD A;  2FDN A;  2MKI A;  5D78 A;  4LF4 J;  1LW0 A;  2PC6 A;  4DS4 A;  1R3N A;  3PVX A;  4ZP8 A;  5B08 A;  4MIA A;  3LWL A;  2MYF A;  5HMY A;  2RS2 A;  1XNR F;  1BQN B;  1HNI B;  5HRO A;  4K4V A;  4DCO B;  4N8O A;  1TKX B;  4W98 A;  4C9D A;  2UU9 J;  1NB7 A;  1JJ4 A;  2GFF A;  2E9T A;  2ZH4 A;  4A8K A;  2DGS A;  1K47 A;  3MXH P;  1S4E A;  1FRH A;  2XHC A;  5ETK A;  3TAM A;  3JSB A;  4ZVG A;  3Q2S C;  4B9L A;  4DS5 A;  2JFD A;  2YPY A;  2QL5 B;  3O5T B;  5DM7 Q;  5HQM A;  3BH7 B;  2AJ1 A;  5I42 B;  5G0R B;  2C2O B;  3PTW A;  5C24 A;  2CQG A;  5J2M A;  1S1U B;  4XIU A;  1RTH A;  1KVK A;  4M5J A;  1Y00 A;  4ED1 A;  4P6Q A;  4RW9 B;  1YIJ S;  3D54 A;  3EYZ A;  4FVM A;  2FHO B;  2F9D A;  3E2E A;  1DAR A;  2CAD A;  4Y34 A;  1D8Z A;  1YTY A;  1HWL A;  5H1S V;  2ZH9 A;  3CW2 C;  2OPQ B;  7FD1 A;  5H9F J;  3DN9 A;  2EEY A;  1T9V A;  4P2M A;  3SCI E;  1XR7 A;  2KFN A;  4DSK A;  1Y0H A;  4QU7 A;  1RTI A;  4NAS A;  1PSD A;  2CJX B;  1DTT B;  2HEK A;  3CUL A;  1AFJ A;  2ZD1 B;  1HWI A;  1BHN A;  1VQY A;  2HK3 A;  2MGZ A;  4DR2 F;  2RNE A;  1C1C A;  2LDI A;  4ZDN A;  3V81 B;  3RUB L;  1KLN A;  1D9A A;  3DRX A;  2AMC B;  3BSA A;  2A6M A;  1S1V A;  1Q4R A;  2MY7 A;  1TEL A;  5J2P B;  3C15 A;  2V68 A;  2C3P A;  4QJV A;  4MJK A;  1SH2 A;  5KFW A;  3IM9 A;  4BDP A;  1WKJ A;  4K59 A;  5A8R A;  4DR6 J;  1KKH A;  1FT8 A;  1M5H A;  3HVT A;  5H9F K;  3M9N B;  1C0U B;  3Q89 A;  3QNW B;  2VG6 A;  4Y2C A;  1TKT A;  3KHL A;  3UWT A;  4YP3 A;  3MAA B;  2KKH A;  2MEW A;  4NCG A;  4H4M A;  4MK9 A;  4MT1 A;  4F0M A;  1QDU B;  1TAU A;  2BOA A;  4RPF A;  5KAK A;  5IM0 B;  5J2N A;  3CMA S;  2V2Z A;  1GX5 A;  2ZBC A;  4DV6 F;  4ED0 A;  2ILY A;  2GGP A;  4MFB A;  2B51 A;  2J0W A;  5D4O A;  3CPW R;  3R5C A;  4LF5 F;  4DG1 B;  3DKD A;  1MN7 A;  3HHK A;  3QWU A;  3LP1 A;  3I31 A;  4B3S F;  3EE3 A;  1RT1 B;  2IY5 B;  3HD1 A;  2BQ3 A;  3CJ0 A;  2BE7 D;  1UJ5 A;  4J90 A;  1T95 A;  3KK2 B;  4DUY F;  1Y4Z B;  3BKU A;  1V3R A;  3W1Y C;  3M8Y A;  3LP2 B;  1NPK A;  3GIL A;  5HJY A;  4O0N A;  1D8Y A;  2R8G A;  2CZV C;  1UA1 A;  4P2S A;  1PBA A;  2BAC A;  3ET6 A;  2GS8 A;  2CDQ A;  5GAH I;  4UST A;  5M2R A;  2ADB A;  3DCA A;  1SPB P;  3IFE A;  4DL0 C;  4KBI A;  3T5K A;  3BF4 A;  1VHI A;  4LRF A;  4NXM J;  1SQE A;  2FQQ B;  4E0D A;  1N6Q B;  3PFE A;  1SKS A;  3VGS A;  2K2P A;  2XY6 A;  4H4O A;  5KG2 A;  3V6H A;  4Q44 A;  5HLF B;  2OJ3 A;  3VAG A;  3H2V E;  3H5U A;  3I9Z A;  2QMX A;  2UU9 F;  4RNN A;  1LXJ A;  3ZNU A;  3C6T B;  4ILM A;  1L3U A;  5KFF A;  2DH7 A;  5CAA A;  3CF5 Q;  2L41 A;  3GMG A;  2N3O A;  4URG A;  1ZZF A;  5C42 B;  4JI3 F;  2H3E B;  2FJB B;  2LKZ A;  1UPP A;  4IFY A;  2A6O A;  2N7Y A;  1XEZ A;  1KVJ A;  3ZZZ A;  2YBV A;  2E7W A;  3VVU A;  4I68 A;  4JV5 J;  2CQD A;  4Y3C A;  1PYO B;  3UVJ B;  1K1Q A;  1NK8 A;  5DS7 A;  4DL6 A;  2EFV A;  5HI7 A;  1IJE B;  1ITP A;  3X3U A;  3KLE A;  3J7A 1;  2C3Y A;  4ZPV R;  2PSZ A;  2YNH B;  1KR4 A;  1S6P B;  3MR2 A;  4JB8 B;  4B3O A;  2DNO A;  4YEA A;  3HVR A;  3AAW B;  4P74 A;  2VG7 B;  2OPP B;  1T9U A;  3HKW A;  2HFO A;  4WWS A;  5CCL A;  3FMB A;  2VHG A;  1Y5L B;  1Q16 B;  1QJH A;  1E6Y B;  2QL7 B;  2BW7 A;  2LA6 A;  3GU0 A;  5JVG Q;  2ZBI A;  3QSY B;  2BYC A;  2CPD A;  4CH0 S;  3Q0A A;  2A3J A;  1HPZ A;  2JLE A;  1LWC B;  2FVR A;  1MRO B;  3DU6 A;  2FLN A;  1FES A;  1WF2 A;  4KPY A;  4RW7 B;  4N47 A;  3EWG A;  3GJT B;  4IO1 A;  2KO1 A;  3TUJ C;  4N76 A;  2DXE A;  2UUC J;  2DR7 A;  2RT3 A;  3B4M A;  4KGK A;  1F0X A;  1WF0 A;  2J8A A;  4DQQ A;  5L38 A;  1PG5 B;  4IOB A;  3ZZT A;  3EMT A;  4ZVU B;  1IKW B;  2V4Q A;  1IXK A;  3QAE A;  3HT0 A;  3T1H F;  3NS7 B;  2UZA A;  1FRM A;  1NSA A;  4RUA A;  2WSC C;  3I87 A;  2PDA A;  3AD8 C;  1RHM B;  4O4G B;  4I7F B;  2QL9 B;  3H98 A;  5KTQ A;  3KHH A;  4J9U E;  3W3S A;  3HSZ A;  3CCQ S;  4FF4 A;  1WC4 A;  3WC2 A;  4HVZ A;  3FFI B;  2HFZ A;  3BSO A;  1HQU A;  2HBY B;  3RZA A;  2RUS A;  4PQU A;  3CJ5 A;  1S1W B;  1JXV A;  1S1T B;  3B6B A;  1TL1 A;  1WI8 A;  2QSF A;  4IG3 A;  1BQM B;  2MKC A;  4RUB A;  1S9E B;  3GJQ B;  4X62 F;  3BH6 B;  2XY5 A;  3N28 A;  2YKQ A;  3D9B A;  2JEI A;  5SZT A;  4Q8E A;  3O2I A;  2ZBQ A;  3ISN C;  3DRP A;  2H5I B;  4GVB A;  5FDL A;  1IBM J;  2XMA A;  2L9N A;  2ZZT A;  1OIA A;  4J9V A;  4JI7 F;  4B3T F;  1TK8 A;  3C8Y A;  4RUC A;  4P75 A;  3G8S A;  3BO2 A;  4CO0 A;  1HLW A;  4OI1 A;  2JZ5 A;  5BXI A;  2JLF A;  5BYR A;  1HWJ A;  2Z8Q A;  4QIV A;  4DV1 J;  3ITH B;  5DG9 A;  1RCO B;  3DDI A;  5DQH A;  1GFW B;  4NLT A;  5L8R C;  4HR2 A;  2VZ9 A;  3KK1 B;  2YWE A;  1RTD A;  2FPH X;  3O3L A;  1RIS A;  4L76 A;  5KG6 A;  4MYT A;  2B7C B;  2Y1L B;  3H4D A;  1FRL A;  3M8P B;  4WFA Q;  1RT7 B;  2A0F B;  4ITS A;  4DR5 F;  4O3Q A;  1KOO A;  1TK0 A;  2FD2 A;  3R5B A;  3CE8 A;  2IDL A;  4G65 A;  3C14 B;  3FEZ A;  2WON A;  4DHV A;  2CQH A;  1ROF A;  3JTO A;  3NGT A;  2XO7 A;  1VQ5 S;  2AYM A;  1RA7 A;  1NKC A;  3QAU A;  1EIY B;  2YTC A;  1TP7 A;  1G4C A;  4UUW A;  2L08 A;  3QQC D;  4OLP A;  1SIZ A;  4ZLL A;  4YR0 A;  4WE1 A;  1X0P A;  1UKU A;  4KFB A;  1BE4 A;  3LAL A;  2BR0 A;  3F73 A;  2B8Q A;  2W2N P;  3L7O A;  1FD2 A;  4AL7 A;  1DAX A;  1JLF A;  1G7C B;  1U6F A;  2OPR A;  5LSL A;  3M30 B;  3MOJ B;  2KYZ A;  1OSC A;  3MMJ A;  4DSE A;  1FJG F;  2GMJ A;  3BKF A;  4ZVO B;  4M5D B;  3SV4 A;  2BKO A;  5BYQ A;  2DO0 A;  4N8N A;  2J9D A;  5LM7 E;  2YWK A;  2OAU A;  4D3H A;  4TKT A;  3DRS B;  4MKA A;  3SSQ A;  3DLH A;  3PJW A;  1X4B A;  2W9A A;  3HHD A;  4XDC A;  4PXE A;  3GV8 B;  4URS A;  5DDR C;  5LT5 A;  4L3N A;  2WVB A;  4QZV B;  5CZX A;  2ZFH A;  1RJJ A;  3OSN A;  3Q8Y A;  3UO0 A;  1UWA A;  3LAM A;  3HM9 A;  3QO9 A;  2I1R A;  2DGW A;  4ES3 A;  1RK8 A;  2AJ2 A;  7FDR A;  1RWM B;  4QR2 A;  3R9L A;  4ED7 A;  1NK5 A;  5ITH A;  4FS1 A;  4W4M A;  3CCM S;  3OJU A;  4LFB J;  5HBM A;  4P10 A;  1U45 A;  1S1X B;  2BAB A;  2DNH A;  3GZ7 A;  3TVZ A;  4OZJ A;  2DXD A;  1N48 A;  2BW2 A;  5AE3 A;  3CCV S;  1HHS A;  3GLJ A;  4N5S A;  1RWK B;  2AHO B;  4DLG A;  4DQP A;  2M7S A;  2AYB A;  3TAN A;  2FZG B;  1N36 F;  4JI2 J;  5KFZ A;  3K58 A;  1XNQ J;  3D0G E;  3BN4 A;  4I2P A;  1M1H A;  4EWT A;  4LF8 J;  5L46 A;  5IWA J;  2UXD J;  4F25 A;  4EO6 A;  3CCT A;  1TMM A;  2Q6C A;  4LRD A;  1SL0 A;  2HGL A;  3CME S;  2PN6 A;  3NRB A;  5FII A;  3QZ7 A;  3IP0 A;  4TN2 A;  3UDV A;  4MK8 A;  2GO9 A;  2YX7 A;  3OLB A;  2CPE A;  4LF9 J;  4WU2 A;  3EDQ B;  2WCX A;  1WEZ A;  3G86 A;  4C11 A;  4YQW A;  3MM6 B;  2AX1 A;  4ZOS A;  2N7C A;  2RB7 A;  3OW2 R;  3Q2T C;  1OQ3 A;  2EXU A;  4LSL B;  4RBV A;  1R0A B;  3D6H B;  2B8P A;  3MR3 A;  2D9P A;  4PUO B;  2DIU A;  3DGP B;  1VC6 A;  2UUT A;  2Y1J A;  1KQS R;  4RKU C;  4CRJ A;  2HVZ A;  3KLH A;  1S9G B;  2R8K A;  1N5Y A;  4K4X A;  2P8I A;  3DFE A;  2E5J A;  2NSB A;  3PIP Q;  4UQG A;  3C16 A;  5ADZ A;  2LMI A;  1YG0 A;  2HNZ B;  1RT2 A;  4BC7 A;  4PR6 A;  2XMV A;  4I0W A;  1PC5 A;  3GE9 A;  3SFU A;  4O3S A;  3ZZY A;  1AXQ A;  2VOD A;  2DR6 A;  3PEJ A;  5MLC V;  4OMF G;  2YH0 A;  2ZM6 F;  4WP9 A;  3K17 A;  4IFV A;  2E5H A;  2CVE A;  2V2V A;  1VC5 A;  2LQB A;  1RSC A;  1VK8 A;  1WTF A;  1Q7Y T;  3EGZ A;  5F0W A;  3T5H A;  3M6V A;  3R27 A;  5F3T A;  5KFU A;  3MFH A;  3K5O A;  2F7V A;  1S0N A;  1DFD A;  2CJ9 A;  1P8G A;  4WII A;  4J9O A;  2W4P A;  4ELT A;  4HHJ A;  3ZTO A;  2VC0 A;  1A0O B;  3P45 B;  4JP8 A;  4AXI A;  1UFK A;  1SI9 A;  3R2C J;  4RWW A;  4JI1 J;  4JI5 F;  5KG3 A;  9ATC B;  3QBC A;  1PJ5 A;  1X4D A;  2A2D A;  1LWE B;  5IQQ A;  3M1V B;  4OX9 J;  4ZVP B;  3GFH A;  2R9L A;  4FZV A;  2E9R X;  2XWX A;  3PJX A;  1FNX H;  3RR8 A;  1FKP A;  1FX2 A;  3DDK A;  3IO1 A;  4QWA A;  1LQ9 A;  1T8E A;  3BBF A;  1T05 A;  3MCO A;  3OFE A;  1TU0 B;  4OV1 A;  5KG1 A;  3JB9 k;  1W2I A;  4YME A;  1N34 F;  2XC9 A;  2ZZM A;  3DRY A;  1NRK A;  2F8H A;  4TQS A;  3M8R A;  2BJ7 A;  5I3P A;  4FKX A;  3CTR A;  4AYB D;  1QAI A;  2VDI A;  4F02 A;  4B02 A;  3R6G B;  1XER A;  4GO7 X;  3DLB A;  1WOR A;  3OXL A;  1WHX A;  3OHB A;  4ZVH A;  2BE2 B;  4LVN P;  3GQC A;  4LFB F;  5I4M A;  1KP6 A;  1NO8 A;  1NPR A;  3TAQ A;  1I94 J;  3GJS B;  2HQI A;  4LIW A;  2FGO A;  4ID5 B;  3QJJ A;  2V8H A;  2H4W B;  4NZ6 A;  4CO1 A;  4ID8 A;  4RBU A;  1CBK A;  2AD9 A;  4QWD A;  1RGV A;  1XNQ F;  3AOA A;  3J80 U;  2HBZ B;  4ZHR A;  2QC3 A;  4USM A;  3FBE A;  4C6A A;  1HW9 A;  4JI6 J;  1SKU B;  3H40 A;  2IRU A;  1ZYQ A;  5IWA F;  4NYZ A;  4XTT A;  1VBY A;  4DFP A;  3LP0 A;  2H48 B;  5KOX A;  3CIZ A;  2VPW B;  4QPT A;  1RWU A;  2DKO B;  3FCH A;  2ZWO A;  2RU9 A;  3LF0 A;  3IWL A;  4DV0 F;  5D0H A;  3D2W A;  4FYY B;  5EWF A;  1HD0 A;  2C2N A;  3RAM A;  3DMJ B;  4ECT A;  4EBE A;  2JC0 A;  2V0N A;  2RDJ A;  2W4C A;  3AD7 C;  4P73 A;  4RW4 B;  2ZH7 A;  1S12 A;  1QVG R;  1WAC A;  2AZ1 A;  2HGM A;  1ZM2 A;  2NLW A;  2FZC B;  4JBC A;  2KRR A;  4RNF A;  3HMJ G;  4LFA F;  5F0U A;  3G6E S;  2KFZ A;  1NXI A;  2HHT A;  2WSE C;  4RW6 A;  3KJN B;  1RUS A;  2DNM A;  3SEO A;  1SKR A;  4C98 A;  1IVZ A;  1R8B A;  1SL1 A;  2M9K A;  4IDK A;  3VCD A;  4R8U B;  3W2W B;  4KJI A;  4OX7 A;  1XJW B;  2J5A A;  4NCB A;  1H6K X;  2D7S A;  3R5D A;  2LEB A;  2KDO A;  2GZO A;  3CD7 A;  3M7V A;  4WKR A;  3GFZ A;  5HO4 A;  4NZ0 A;  3J7A N;  1IWG A;  2MKY A;  3UI3 A;  3QFH A;  3UNY A;  3THT A;  4KB7 A;  1NHU A;  1X0F A;  4EUV A;  1SQG A;  2BZ2 A;  2MZS A;  1XMO J;  2XSJ B;  2GHP A;  3IBF B;  2DJW A;  5LOQ A;  4AXJ A;  2UV8 A;  5L39 A;  2EWH A;  4NRT A;  3N01 A;  4CO5 A;  4ZVS B;  3DLK B;  1EET A;  2HVI A;  2VIC A;  1UP1 A;  5E41 A;  4WFX A;  4CQ1 A;  2VPX B;  3ONQ A;  2RE1 A;  2KFY A;  2ZKT A;  1ACM B;  3BKT A;  2KHC A;  4JI8 F;  3NBP A;  2OHD A;  2MSS A;  2ZIT A;  2C3O A;  3DU5 A;  4LF2 A;  1B70 B;  1VI7 A;  1UWB A;  1FDD A;  1BGX T;  1O0P A;  2F4V F;  4IH5 A;  2AP6 A;  4FF3 A;  4U67 Q;  3HHL B;  2OIH A;  2A10 A;  1Z4U A;  4QQB A;  2L48 A;  2E7X A;  1HBU B;  2XO6 A;  1G3O A;  1U8S A;  5KFD A;  5JUM A;  2LU1 A;  1U2R A;  1RT6 B;  5T7L B;  3K7R A;  1SC3 B;  2FJD B;  2DNZ A;  1XIQ A;  3DLL Q;  4JV0 A;  1EZZ B;  2CJK A;  5F8G A;  4X4N A;  1UVI A;  4DPT A;  3CCR S;  3M9O B;  1NZ8 A;  2DTJ A;  3HI9 A;  1Y7P A;  1PJ7 A;  5LXR A;  2VL1 A;  4DV5 F;  1OY9 A;  2CQB A;  2MJU A;  4NML A;  1CJU B;  2XM3 A;  3HXM A;  3KLF B;  2DGQ A;  4HAC B;  3I4P A;  3CJT A;  2XMJ A;  3AFG A;  3MMC A;  3B82 A;  4PQA A;  3H20 A;  2DGT A;  1Q1K A;  3FRZ A;  1MML A;  2W9C A;  1Q82 T;  4HLB A;  1MU2 B;  1CJK A;  1JLG A;  3RRK A;  4HH0 A;  5AJ3 J;  4UT4 A;  2CYY A;  3K0J A;  3I5A A;  3MMB A;  2YX1 A;  4LRB A;  4TY8 B;  2ZC3 A;  2M4M A;  3CNQ P;  1T9X A;  4I6Y A;  2ASL A;  4CLW A;  2UVV A;  1GNK A;  3SBM A;  3WBZ A;  2C3U A;  5B7W A;  3KUH A;  4JUZ A;  1RKJ A;  2EKN A;  2FLP A;  2F9J A;  4F8R A;  5J1E B;  1L3T A;  1S97 A;  1NDK A;  3BSC A;  4CT9 A;  4OL8 A;  1HHT P;  4DCJ B;  2YPZ A;  1GMU A;  3VWS A;  3T1A A;  1VRU B;  2RF2 B;  2K7K A;  4N77 A;  3AA8 A;  1Y5I B;  3TP2 A;  1LKZ A;  2IPO B;  4ECX A;  3LO3 A;  3GPA A;  4NOH A;  1Q5V A;  3DM2 B;  1HAR A;  5ETP A;  4NXN J;  1RAD B;  3W5Y A;  3KLG B;  4JOU A;  2VKR A;  1SUQ B;  4KO0 A;  5JVH Q;  5DET A;  3LAK A;  3IGV A;  4TQR A;  3K8W A;  2VH7 A;  2DY1 A;  3PX6 A;  3R3T A;  2BXJ A;  1QSY A;  2DRD A;  3KJV B;  1S99 A;  3EZO A;  5IFM A;  1UVK A;  2YKN B;  4U7U D;  4QU6 A;  2RAQ A;  2DT9 A;  3NAI A;  1DQA A;  2DRA A;  3JS9 A;  3SI8 A;  5ETO A;  5K20 B;  2DNG A;  1PIE A;  1NDP A;  3E01 B;  3PM9 A;  3OVS A;  2UUB F;  2CRL A;  2X51 A;  2C2D A;  4USW A;  1IKX A;  2OTL S;  3LPY A;  1S9F A;  4K0K J;  2CZ9 A;  3DXB A;  3VAI A;  1FE0 A;  2O67 A;  3IR5 B;  4Z7Y A;  1RWP B;  1WHW A;  5K9F A;  2HHU A;  1AA1 B;  2VG5 A;  3KKF A;  2Z2M A;  2LFV A;  1YGY A;  1X60 A;  4FP9 A;  2J9D E;  1VJQ A;  1B4S A;  2ZC4 A;  3U1N A;  1NME B;  4F4Y A;  5F9L A;  2W8L A;  4OZ5 A;  2O5D A;  2RH3 A;  4ZVT B;  4OFZ A;  4X64 J;  5DLF A;  3F56 A;  4A48 A;  1Q8L A;  3SDE A;  3PXG a;  1LW0 B;  5K8M A;  3DYA B;  2BJ1 A;  1XWL A;  3N6M A;  3DLG A;  2CNO B;  4L73 A;  4ED4 A;  3PHE A;  5HRO B;  4NA3 A;  2EPI A;  1AB8 A;  4NYO A;  2Z2L A;  2VAS A;  2EVZ A;  1ZOT A;  1F5A A;  2IHR 1;  1C1B B;  3KG0 A;  4ZPW R;  1UJ6 A;  3TAM B;  3RBE A;  4PG4 A;  1LFW A;  1F3V A;  4J9L A;  2X1G A;  2BRK A;  4LF7 J;  4OYM A;  3MCN A;  3FMW A;  3UCG A;  1U6B A;  1W26 A;  1N88 A;  2G1D A;  5C24 B;  5J2M B;  2CQI A;  2LXF A;  1RTH B;  1VIO A;  1JB0 C;  2VQF J;  2OEM A;  2CQ1 A;  5C25 A;  2ALZ A;  2NSC A;  1RHK B;  5FLX U;  1FEE A;  2V8G A;  3UFC X;  1FJ7 A;  2GHW A;  2ATL A;  3HF5 A;  2ASY A;  4KC5 A;  2R2U A;  3NCP A;  1R7I A;  5L1I A;  1ZM4 A;  3OTE A;  1APS A;  3HP6 A;  2EBG A;  2B9E A;  1RTI B;  2QJ3 A;  4CLK A;  4E98 A;  2R4F A;  2HWH A;  3I0S A;  3NCR A;  4HTJ A;  2Y8W A;  2W7P A;  1QE1 A;  1YRX A;  2MGZ B;  5KT4 A;  3JXO A;  2L3M A;  1RAA B;  4ED5 A;  2ZUA A;  4UTG A;  3MR6 A;  3S7R A;  5K8N A;  3LGN A;  1C1C B;  2KJW A;  4KQZ A;  2VB6 A;  3POT A;  3QSI A;  1U1N A;  4UOF A;  4KHM A;  1R6Y A;  2RQM A;  2VQE F;  3WZ0 A;  3PY8 A;  3QMQ A;  3NL0 A;  2F5G A;  3C15 B;  2FY1 A;  4W90 B;  1T9Y A;  3MI7 X;  5A8R B;  1HBM A;  1FJE B;  2EFQ A;  3FZB A;  4C97 A;  3HVT B;  3BDE A;  3H2L A;  2XYH B;  1TKT B;  5HQ8 A;  2E1A A;  3KHG A;  4NXN F;  4AT1 B;  4UQT A;  3JSM A;  2X3G A;  1NK7 A;  1NND A;  4O44 A;  1RTZ A;  1YBU A;  1FEH A;  4CI0 B;  5EX0 A;  4NCG B;  2AX0 A;  4H4M B;  4MYU A;  1MNE A;  2H4Y B;  4ZN3 A;  3P5B P;  5GME A;  4RBT A;  5J2N B;  5IC4 B;  1S59 A;  3VAK A;  1FE4 A;  3QYY A;  4ZJQ A;  4DU7 A;  4F3M A;  2GGP B;  4MFB B;  2IDE A;  3PW7 A;  4WFY A;  2CPX A;  2M8D B;  2I38 A;  2UP1 A;  3LP1 B;  5A6W A;  4O3N A;  4QR0 A;  5FJ4 A;  1K0T A;  3JTP A;  2NR0 A;  5MAO A;  5IT4 A;  1TL3 A;  2HQ3 A;  4K0K F;  3WQP A;  2R3V A;  3W63 A;  4ZIW A;  3G87 A;  4OYB A;  1RAJ A;  3T9Z A;  3IR7 B;  5GAH U;  2KXF A;  2LQ9 A;  3ET6 B;  5F8J A;  3QT8 A;  3SCJ E;  3SQO P;  1D9F A;  2HGN A;  2CQC A;  3NNC A;  3PV8 A;  1CC7 A;  2P9E A;  4JI0 J;  2HRY A;  4EYI B;  1YRT A;  2YVS A;  2H5J B;  3FZ2 A;  2IMW P;  2RQK A;  1VYA A;  2BVZ A;  4H4O B;  3ZTP A;  2HUR A;  2FGC A;  2BEF A;  3UD5 A;  2EBE A;  4NLG A;  1FFW B;  3OTO F;  2HPU A;  2R7R A;  2Z2Z A;  1W2B R;  1LOU A;  4DX6 A;  3CJ2 A;  1YKW A;  1FXD A;  2DHS A;  3MEE B;  3JAM Y;  2R8J A;  3JYT B;  1N5S A;  1EQM A;  2RRB A;  2XMT A;  4F0K A;  3HVA A;  2DHH A;  3V6J A;  2K3I A;  1VOM A;  2CPI A;  1KEK A;  5DZ6 A;  2VBZ A;  1S49 A;  3MM7 A;  3VQT A;  1S6O A;  5E3C A;  2J0S D;  3FRY A;  2Y1R I;  2QV6 A;  1NEE A;  1F60 B;  3PFO A;  2HYI B;  1RHR B;  4A8S A;  3VF0 B;  2BJE A;  1NJY A;  1L5U A;  3NOG A;  2KN4 A;  3M2R A;  2ZH6 A;  2JX2 A;  1CS4 A;  2HS3 A;  1H3D A;  1ELO A;  1ZAX A;  3KLE B;  4OJG A;  1U6Z A;  1HHQ A;  1Q53 A;  5HAO A;  3ZZP A;  4B3O B;  4NA2 A;  4J9R A;  1IBK J;  4U9R A;  1TFW A;  4J5O A;  1FD8 A;  4ZIT A;  2KHD A;  4M94 A;  4UUX A;  4TLR A;  2OMO A;  3HSG A;  2BJ3 A;  1XK8 A;  2Y3Y A;  1QAX A;  4YUD A;  4DU8 A;  2R7X A;  1IQZ A;  3DOM A;  1FO1 A;  2MLX A;  3OR2 A;  1BC6 A;  2VF3 A;  4R0J A;  3NCQ A;  5E3Q A;  3PRB A;  1C4A A;  2G0I A;  2BMB A;  3V6D A;  4LQ3 A;  3VAM A;  3ILI A;  4OYW A;  2XMK A;  3EVW A;  4KY3 A;  3LAN A;  2E5L J;  1GX6 A;  2AF6 A;  1T03 B; 
#chains in the Genus database with same CATH homology
 4DV3 J;  1XNR J;  1N36 J;  4JI4 J;  4LF7 J;  4DV7 J;  3W1Y C;  1N32 J;  3R2D J;  2F4V J;  4DV6 J;  2KVQ E;  4KYZ A;  2UUC J;  1IBL J;  4KHP J;  1XMO J;  4K0K J;  1IBM J;  1HR0 J;  4DR2 J;  3J81 U;  4JV5 J;  4V1A k;  3JAM U;  4X65 J;  4LF5 J;  4DR6 J;  1HNX J;  4LF9 J;  4X62 J;  1N34 J;  2VQF J;  4JI3 J;  4DR5 J;  2HHH J;  4B3S J;  1HNW J;  4X66 J;  4GKJ J;  4DR1 J;  4DV0 J;  2UUB J;  2VQE J;  3IMQ J;  4HHU A;  1I94 J;  1HNZ J;  4DR3 J;  5FLX U;  4LFB J;  4DUY J;  4NEY A;  4YY3 J;  5LMU J;  4X64 J;  4JI0 J;  4NXM J;  4RJV A;  2ZM6 J;  4NXN J;  4YHH J;  4DV1 J;  2KL8 A;  2MEW A;  3D3C J;  3R2C J;  1IBK J;  4JI1 J;  2MQ8 A;  4LF4 J;  4JI7 J;  4JYA J;  2UXC J;  4DR7 J;  4B3T J;  5AJ3 J;  4DV5 J;  4DUZ J;  4DV4 J;  4OX9 J;  3J80 U;  4GKK J;  2MTL A;  4DR4 J;  4AQY J;  3T1H J;  4JI2 J;  4LFC J;  5BR8 J;  4NEZ A;  1J5E J;  5LMN J;  4JI6 J;  1XNQ J;  1XMQ J;  2UUA J;  4LFA J;  2UU9 J;  4JI8 J;  5LM7 E;  1N33 J;  4LF8 J;  3T1Y J;  5IWA J;  2UXD J;  4JI5 J;  2UXB J;  4B3R J;  3D3B J;  5IT9 U;  4PWW A;  3J7A N;  4DV2 J;  4KY3 A;  3OTO J;  2E5L J;  5A2Q U;  4LF6 J;  4B3M J;  1FJG J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...