3T1HK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 3t1hK00
4LF8K 5IWAK 4JI7K 4LFAK 4X65K 2UUCK 4DR6K 4DV2K 5IT9O 4DV0K 4LF6K 4CVNE 2E5LK 3T1HK 2UU9K 2VQFK 4DR3K 4DR2K 2HHHK 4DUZK 1HR0K 1IBLK 5LL6Z 4B3SK 1XNQK 4JI0K 2ZM6K 1J5EK 4NXNK 5BR8K 4DV6K 4LFBK 4DR4K 4NXMK 4LFCK 4JI3K 5A2QO 1I94K 1XNRK 5AJ3K 4DR7K 3OTOK 4K0KK 4JI5K 3JAMO 4CW7B 2F4VK 4JI1K 1N32K 4LF5K 1XMOK 4DUYK 4B3RK 2UXDK 5LMUK 1IBKK 4LF9K 4JI8K 4B3MK 4DV7K 4GKJK 2VQEK 4X64K 3J7YP 5FLXO 4B3TK 3T1YK 4YY3K 5LMNK 4V19S 1XMQK 1IBMK 1HNXK 4DR1K 4JI4K 1N34K 4X66K 2UXCK 4X62K 4LF4K 4YHHK 4OX9K 4JI2K 4DV5K 1N33K 4JV5K 4DV1K 3J7AP 2UXBK 4KHPK 4JYAK 1HNZK 2UUBK 4DV4K 4AQYK 1FJGK 1N36K 4DV3K 3J81O 4LF7K 3J80O 2UUAK 4JI6K 4GKKK 4DR5K 1HNWK
chains in the Genus database with same CATH superfamily
2FSKA 4DSFA 4DSJA 4CGIA 1TYQB 4H0OA 4FJ7A 1HKBA 2PBDA 3OHRA 4CJVA 1Q82O 1WSEA 1W0HA 4IFEA 4XH4A 1NMNA 4H4OA 4W5NA 4HCCA 3AGKA 4IKFA 1P8ZA 2ZJQL 4DR2K 1A5XA 4EHTA 3V9XA 4JS4A 1E4GT 1QVGM 1C1CA 3QBWA 1BG3A 5LL6Z 1RDWX 4FLXA 3VQ8A 2ZM6K 3QMLA 3C7NB 1BQMA 4AF1A 1O13A 1Y97A 1LW0A 5JICA 1NOZA 3CCVN 4FVMA 3QB0A 4CHZA 4JS5A 1OH6A 4JRQA 1T3VA 4M3RA 2J4RA 4EZ6A 2UXDK 1J6ZA 1NJWA 3I0SA 4BGBA 3LZIA 4DKWA 3R8EA 1K6YA 2AP1A 2P9UA 4K42A 1VQNN 5M1QA 2HHTA 4YY3K 4V19S 3DM2A 4DQQA 3V1RA 1WOQA 4WFAL 1BIZA 1KQSM 3TWHA 1VQ4N 3PUFA 2QWPA 5HRNA 1U2VA 4IXCA 2ITGA 3PIPL 2HBJA 2W42A 4BRCA 3RSEA 5HLFA 3THYB 1WSHA 4GNIA 1IG8A 5I9EB 1WSFA 5DM7L 5BRFA 2XRIA 2E2NA 4B1ZA 1LAWA 4B08A 2LSNA 2O8CB 3IUCA 4JK9A 1QQOA 3TTFA 3UKUB 5AZJB 1HPMA 4I9QA 2WFBA 4IO8A 1KC8O 2OPQA 2DY4A 3SV4A 1VSKA 3O4NA 1GOBA 1BL3A 4Y1CA 4H0XB 3O8MA 4JD2B 1JLGA 3ZETB 4CESA 2OPRA 1W97L 3CD6N 3ASMA 1FK9A 3AO3A 3UE5A 2NRVA 2OTJN 5E41A 2PY5A 5BREA 1U47A 1HYVA 5C12A 3V9WA 1NGJA 3ID8A 1V4TA 4CGFA 1SUQA 1VQ7N 3CC7N 4OPJA 4GW6A 4ILJA 2JWKA 4EP4A 4FO0A 4FLYA 3SQ4A 5HRRA 3SBTA 4DV6K 2G8WA 1G99A 2UYTA 3AVHA 3DRPA 2NRWA 1ZC6A 2HB5A 3VTHA 5EXWA 2FBVA 3I56N 4I7FA 4FLVA 3AVLA 4KHUA 4DF8A 2P9NA 5AQNA 4DTJA 4XH5A 3MXMA 3DXMB 4H0YB 1W7AA 4DTRA 3LAKA 2IVNA 3HP9A 2QW9A 4CGHA 2G8KA 2QKKA 4OGCA 4BVOA 3G71N 3QIOA 4J2EA 4YOUA 5C0YA 3K5MA 1VQ5N 1SQKA 1WSGA 1RT1A 1A5WA 4BRGA 3TSUA 4HVJA 1IO2A 2O8BB 4MLEA 5BN8A 4FM2A 1VQON 2UUBK 4DLEA 4IOCL 4DG1A 4OPKA 4CZFA 1S1WA 3AO2A 4FYDA 3D2EA 3ZEUB 1VSFA 3OW2M 1NJIO 2O8CA 2ZD1A 5JS2A 5C15A 1XI1A 1JLCA 2UUAK 4JI6K 2P9IB 3ZSXA 3CJAA 5AFUA 1VRUA 1B9FA 2Z1GA 3VQCA 4CEQA 4CGGA 1WUAA 4LF8K 4Z4GA 1ATNA 4HWIA 4I9LA 1JXBA 4PL8A 1QTMA 3M3ZA 4ISEA 4B1XB 1VSIA 3HBTA 3Q7BA 4DB3A 1NK5A 1J53A 3K9KA 4E7LA 2P9LA 2E20A 4Z4IA 2VQFK 3HRGA 5LY3A 1RBUA 4IJNA 4BR4A 5CYMA 2A42A 2YNHA 3TPQA 1GLJO 4FJXA 3MX5A 1ASVA 3C0BA 3AA5X 1K8KB 4KHQA 1LAVA 1SZ2A 4ILGB 3ZT3A 3IG1A 4NXNK 4OKEA 3HT3A 4M63C 3CM6A 4E19A 4F8RA 5FPNA 4F2SA 2A1SA 4MO4A 5AJ3K 3ULEB 4FWQA 2Q31A 3CF5L 3O4WA 4CW7B 1KAXA 4PKHA 3SQ0A 3CCQN 3JXUA 4PKIA 1C1BA 3NGZA 1S1VA 1T6CA 3P39A 3KJVA 4LF5K 4DUYK 1MDUB 2XO7A 1NGCA 3F9KA 4BRHA 2XY7A 4LSLA 4ELUA 3TSQA 4FJKA 1IBKK 3ZSOA 4FJHA 3VN5A 4IFVA 3U8XA 5HRSA 2KHOA 4B3MK 2P5GA 2O4GA 2HHWA 1CXQA 1SS6A 3O4QA 5FLXO 3TABA 5AQQA 1Q86O 3UIQA 2OPPA 5CZ1A 2GV9A 4CBUA 5AQSA 3W3DA 3THYA 3FZMA 4CI6A 4X66K 4LF4K 3AVJA 1YXQA 3C6AA 4HCBA 2DFEA 2GTDA 5EOYA 1HNZK 1S9GA 4CJTA 4BRNA 3HSCA 1W9HA 3IAYA 3UKUA 4OVLA 5AZJA 4ZTJA 4RG8A 3SAFA 1YITN 1BUPA 4I2PA 3VEZA 2XHBA 3SK3A 4Z4EA 1U04A 3VMFB 3CCJN 1YJNN 1NMDA 2ZQBA 5E26A 3AVBA 2D0AA 4R79A 1P90A 4FWNA 1BISA 4W5QA 3RMAA 1K9MO 3GL1A 1VQ6N 3L6QA 2F8TA 3CFPA 4ELTA 4DSKA 3TU5A 3MMVA 4CK1A 2D1KA 4CFCA 3T7ZA 5KQ8A 3OYEA 4CHOA 1VSLA 3RRGA 2FBXA 3BY5A 3M8RA 1RTDA 2HHSA 4AHSA 5CE3A 3KHYA 1NNEA 4DUZK 1YIJN 3PSIA 4AHRA 3LWMA 3VQEA 4O5FA 4H0TB 1EX4A 2HSTA 1QSLA 2IVOA 4CCHA 3EN9A 3ATVA 4B9TA 3FZKA 3LPTA 2G8IA 3DXKA 2YNGA 3KK3A 3V9ZA 5FDLA 3G6EN 4E0DA 3MX2A 4XH1A 5AQVA 3AA4A 1S22A 3MN9A 1QZ5A 1TL1A 3LDLA 3WEEB 4QAGA 5EX5A 3O3GA 4LSNA 4N56A 3RTVA 1UWBA 4F3TA 4OLBA 3O6WA 4F9OA 4LF9K 2Z1JA 4KTWA 5J2PA 3T69A 1VAZA 3DYAA 2VGMA 1SKRA 5E84A 3MCAB 3G4SN 3LDOA 5B8HA 1XQSC 1BU6O 1U6ZA 3EE8A 3NBPA 4JKFA 3CJ9A 4G9ZA 3LDSA 4JYAK 3QIPA 3KLGA 3LDPA 3CFRA 1Y64A 3BGRA 3H3NO 4AHTA 2JGUA 3K57A 3AGRA 3SUNA 2NUBA 4GVMA 1KAZA 5M1OA 5JMVA 1N8RO 2NRZA 4FWSA 4F2RA 2Q36A 4FJNA 1LWFA 4C1NK 5CZ2A 1JL1A 3FFIA 5TKWA 3OYGA 4GKKK 2E2PA 3T1AA 3WUHA 5I3UA 1B92A 4WQ4C 1IH7A 2GWJA 3DOKA 1BGXT 4H8KA 3ITHA 3NGYA 2OA8A 2UUCK 5M1NA 1T8EA 2E2QA 2PFUA 1Z05A 2ZWHA 3VQ9A 1TKTA 3QEXA 1U2VB 3VQBA 2UU9K 4K25A 1L3UA 3SJJA 4QCLA 3DRSA 1KVCA 3NH2A 5C2FA 2YKMA 4KHSA 3ULEA 2VG7A 4YOYA 3E66A 4I2QA 1TAUA 1KTQA 3VQAA 3IFRA 3NAEA 4CEDA 5GAHP 3VEYA 4BR9A 2E1ZA 1NJZA 1QHAA 2BUPA 4B9UA 3EY1A 4Y0WA 4AHVA 4BR7A 1C0GA 3WXMB 5CR4A 2A5XA 2D5RA 1SL1A 4BR0A 3PX0A 3SNNA 2VG6A 1OVQA 3UKRB 3ZT2A 3OJSA 5BR9A 3AVIA 2X74A 4HUGA 3OJUA 5I42A 3EE9A 3CERA 1VQ9N 3AO4A 3C94A 3NDKA 1G15A 2VQEK 3THWA 4CJSA 3HPGA 3QERA 3KLFA 4KH5A 4BREA 2NRRA 4BWMA 3OYBA 3I33A 2Q3SA 1EO1A 4NCBA 3HK2A 1NK7A 3MN7A 4O8UA 2HHUA 2VWBA 3CHWA 1S5JA 3D45A 5AQTA 4FVUA 5AQJA 4N5SA 3TAFA 4RW6A 4KHPK 3AVFA 1TGOA 3WQUA 1NM1A 1BCMA 3SPYA 3OVNA 3CJ1A 3NVKA 2GUPA 2Q0UA 4M3UA 1ATSA 4CJPA 2EHGA 4JKBA 4RTFD 4PHTX 1YUWA 3ZX2A 1WSIA 1MWKA 1C0TA 1RT7A 4DQ8A 1RTJA 3I0RA 4BRQA 3ZSYA 1QS4A 3CQ8A 3M8QA 4JI7K 4X65K 4FM1A 1NOYA 3L2UA 5C10A 4KH4A 2B6AA 3VEVA 3CG7A 5BPLA 2V52B 4JKAA 1IJJA 3FZLA 3VF2A 2HHHK 3EZ5A 1BQNA 1VSDA 3NF7A 4B3SK 5AQWA 3CETA 2RN2A 4FCYA 2O8EA 1NGEA 1J5EK 4NB4A 4IDKA 4LFBK 4B9VA 4CIFA 3NF9A 3K58A 5GAGP 4AILC 5JS1A 4JKCA 3QLHA 4E1NA 2YI1A 4YNQA 3I55N 3MXJA 4CJEA 5EVZA 2F9WA 3PY8A 4K8ZA 2ITMA 1BHLA 2NZTA 2P9LB 1XMOK 5ELZA 1UA1A 1YF5L 1V4SA 1JL2A 4LY7A 3FGUA 3BEXA 3TAPA 2BTFA 2IOCA 4CJFA 3WXKA 1IKXA 3M5RA 4J2AA 4GKJK 4L8RB 4H5VA 3L0QA 4CZHA 3S41A 3SQ2A 3T1YK 4FJ8A 4E1MA 3TAEA 2QWNA 5BPMA 3HVRA 3QEWA 3TARA 2OZMA 5BN9A 3QEIA 3RMCA 3SAHA 4JI4K 5EY4A 3P1GA 3SUOA 2ZF5O 1N33K 2XY8A 4Z4HA 3V4IA 5AFUH 2A41A 2X6SA 4Z4FA 1KVAA 5GIOA 3DWLA 4RCHA 3UB5A 4M42A 2XY6A 1ITGA 1L5UA 4CEZA 3K0SA 3ALYA 3C6UA 4Z4CA 2IS3A 4BC3A 4EHUA 3H1VX 3H1QA 4ICLA 4CEEA 1Q9YA 1HX1A 1S3XA 2IVPA 3QESA 4MQ3A 2P9UB 4FOEA 4C8NA 3ZX3A 4E7IA 2A1RA 2NRXA 4FJJA 3PSFA 1RDUA 4WQ5C 3CMEN 3SAGA 4IWVA 3L3UA 3PV8A 2ASPA 1I39A 1FXXA 3THXB 2YHXA 3AAPA 1RCHA 5C24A 1T6DA 4B8AB 1NK4A 3P38A 4DTNA 2ZJRL 1KVBA 1NU0A 1YI2N 1NGBA 5AQZA 1GLEG 3HYFA 1C0UA 4A61A 5BRDA 5MLCQ 4DLGA 3PO4A 4PWDA 5SWMA 5AR0A 5ADXH 3O9QA 3SYZA 3VQ4A 4KRFA 1S6PA 3EKSA 4H0VB 1Q18A 2KLAA 1VQKN 4LFCK 5KRSA 1I94K 2HMPA 1XNRK 3F5TA 1IKVA 4BE1A 4CEBA 4YDUA 3THVA 5AZIB 4FPBA 1D9FA 4MLHA 3MK6A 1IV0A 3KVGA 5ADXA 4NYFA 4M3WA 4O0IA 1YVNA 5JVHL 1OH7A 1R0AA 2W6LA 5JLFA 1KAYA 2HBKA 4BRDA 4OKJA 4JI8K 4M3YA 1RILA 1BDGA 4H4MA 1C0MA 2FC0A 3R9PA 2FXUA 3J7YP 4J2BA 1RT6A 4FWLA 5HP1A 4A57A 3EO3A 2HOEA 1FW6A 2F96A 4CD1A 3OY9A 5HL7L 1WB9A 2Z1HA 1WBDA 4JKGB 2ZJPL 2P9SB 2HMIA 3DLLL 4WCEL 2CGLA 3HM9A 1Q8IA 2HVHA 2YHYA 4FK0A 3TTCA 5J1EA 4B9MA 4FZYA 3EYZA 4CJKA 4FJ9A 3ZLJA 4IEEA 3L2QA 2HF4A 3O1WA 4FOIA 2D0BA 4BRLA 1DLOA 3DLHA 4YORA 3WXLA 4M7YA 1J54A 2QWQA 3CJ7A 3K9JA 1TVRA 2YNIA 3R1XA 3LDNA 3R3LA 3HTVA 3OYFA 1RT3A 2E6MA 2E5LK 1D9DA 2Q1NA 5F0XA 3V9UA 2JLEA 1IKYA 3MDQA 1S72N 2O8BA 3OYKA 4FJIA 4U7BA 2CH6A 4B1YB 2E4LA 2QK9A 1K73O 3QNNA 4DFMA 1LWEA 1NGFA 3MXIA 5AZIA 5BR8K 1C1AA 1ZBFA 4NXMK 3OS0A 3P5JA 2E6LA 4BE2A 3WXJA 1U4BA 1X3NA 4JHDB 3EEQA 1X9WA 1E3MA 5KTQA 3SMPA 2E8AA 1OVYA 4IG0A 2NRTA 4J8FA 3K5LA 1Z6RA 1N32K 3AARA 5FPMA 4DQSA 1TK0A 2G8FA 5GAEP 4JKDA 3O80A 4BC4A 3PIOL 3L2RA 2OTLN 1U45A 3CQXA 4B1WB 4DS5A 3VGLA 4DV7K 4DFJA 5D3GA 3CPWM 4M3XA 3V9SA 3H3OB 4O55A 3AA3A 4H5WA 1XMQK 5DK5A 1HJRA 5AQOA 2Y1JA 3SUPA 5GADP 1BA1A 4OX9K 1RBRA 4W5TA 3GBTA 3H46O 3PO5A 4YOVA 3NVMA 4ZHRA 1QE1A 1GLAG 2P1JA 3U9ZA 2X6NA 4CIGA 2VYPA 4MFBA 5HOOA 3KKSA 4EIAA 3KLHA 2QEXN 1YTAA 4AM6A 1GOCA 4BRMA 3J80O 4IDHA 2ZGYA 1X9JA 1D5AA 4PA1A 1QQCA 1MWMA 1NJYA 1VSEA 3A8YA 3NGIA 2DFFA 1IKWA 3NF6A 4CFBA 1S1UA 1FKPA 4A5BA 1VSJA 2YV0X 4KHWA 1NKCA 1NK9A 4N41A 1S6QA 3A5NC 2GELA 4CFDA 3KK7A 4C8OA 1QSYA 1JLFA 4FZZA 1JCEA 1HR0K 3KIOA 1IBLK 3S3MA 3PX6A 1T03A 1VK0A 2VWKA 3P31A 1HYSA 1DT9A 2GWKA 3LZJA 3F73A 4AHCA 1CXUA 3DLBA 5AQPA 4GVEA 4JI3K 1TKXA 5JLHA 5AQRA 1ZBLA 2I7PA 3VA3A 1ILYA 4I6MA 3AVCA 4EAHD 2I7NA 2A6AA 1HUXA 3V6DA 2WC9A 3HXMA 1GLCG 2FBYA 4BDYA 3ZT4A 4OGEA 1EQYA 3QDKA 2RPIA 3IKMA 3NF8A 3IDHA 2KZZA 3V1OA 4CGJA 4HTLA 1OH8A 1XC3A 3VPZA 4JKHA 3M1FA 4YOWA 4BY9C 3A5OC 5C42A 2YJEA 2KW4A 3KD5E 3D2EB 3KKRA 3BF3A 3HOTA 3VA0A 4JV5K 4DV1K 2KFNA 3DXKB 5DMRA 2HNDA 3M8PA 1WAFA 4JK8A 4ZTFA 3BF1A 4BQZA 4BRAA 1ZBHA 4AQYK 1YT3A 4IO9L 3ZSWA 4KO0A 5M1KA 3WEEA 1HRHA 3SI6A 3N4QA 1S1TA 3VESA 1X9MA 1NK6A 1XHXA 3N4PA 4CJ4A 3SLCA 3OA9A 3VETA 3NMUA 3S3NA 3U3YA 4DTOA 4FL9A 2BDPA 5AQUA 2P5OA 1C0FA 4DV2K 4HUEA 4DV0K 1KFDA 3VQ5A 4LF6K 4GMJB 3T1HK 4CZMA 2GX9A 3L8BA 1S1XA 3ENHA 5SZTA 1HQEA 2OZSA 3EZWA 4CBWA 1M1KO 3FZFA 2YX6A 3LDQA 4OLAA 1KLMA 2FBTA 4O44A 4KTZA 1BWFO 1H1VA 4E89A 4A62A 1RBVA 3OYNA 1TYQA 5A2QO 4DR7K 3OTOK 2Y1IA 4JLHA 4Y1DA 1VQ8N 3HPOA 3WXIA 3CCMN 1ASWA 2V7YA 2I5JA 4ILHA 3MN6A 1EETA 1OKJA 4OJRA 3LWLA 5J2MA 3OYHA 2QTDA 3NCIA 2H3GX 1CLQA 4KH6A 1LV5A 4CJWA 3C7NA 1IBMK 5FPEA 2Z1IA 1HNXK 2HNZA 3V81A 4KTQA 4FLTA 5KPZA 5H1SQ 3LP1A 4BDZA 1BI4A 3B6OA 1HMVA 2NNWA 4RW4A 4JNEA 1NBWA 1ZBIA 3W0LA 3BZCA 5FRMA 4MO5A 3WT0A 1NGGA 1LCUA 4FWPA 3RR8A 3O08A 4BGAA 4DS4A 4OO1J 4FPAA 5HRPA 1YVUA 3UKRA 5AQGA 4M7XA 3TANA 1GLFO 1KFSA 4LF7K 5AQKA 3HL8A 4CF2A 1YJ9N 2KKZA 3DOLA 2WONA 3GG4A 1D8YA 4FK2A 3R6MA 2ZE2A 5CYQA 1TKDA 1K8KA 2P9IA 3WNGA 4FLZA 3AO1A 4DF4A 3VERA 1E4FT 1D4XA 1VQLN 3NFAA 4KPYA 2XY5A 1SKWA 4WF9L 5KRTA 4A2BA 1KD1O 1REVA 3CI5A 4N47A 3QETA 4XIUA 3CM5A 2P9PB 3QEPA 4CIEA 1XNQK 4I6MB 3O5BA 1SKSA 3TTDA 3HJFA 3OBYA 5J2QA 4C1NI 3MWPA 3TAMA 4DR4K 2JWLA 3K59A 3T19A 1BI4B 3KD1E 2GUIA 3B8AX 1W2BM 3VF4A 3CCSN 4K0KK 2V7ZA 4JI5K 1C6VA 4BRIA 2ASOA 4OPAA 3F9MA 2F9TA 3MN5A 4CFAA 4BACA 1MU2A 3ZETA 1YJWN 2AA4A 4CHPA 3MEEA 2RF2A 3ZSZA 5GIPA 2VGNA 3U3GA 3MAQA 2OYQA 4KBOA 5AQLA 3RMBA 2QM1A 3A2FA 4DTSA 3ZYYX 4CZKA 3PLAA 3HI0A 2O8DB 2W6KA 1GLLO 2IAJA 4AHUA 4O0JA 5HBMA 2UXCK 2P51A 2IC3A 3CQYA 3GDQA 1RTIA 4YHHK 1ZYQA 3KK1A 2RE2A 4QS7A 3RMDA 4KHYA 5M1FA 2FSJA 1VHXA 4IFYA 3TR8A 4LD0A 3QFPA 2G8VA 3KK2A 2D0CA 4DTMA 3DXMA 4DCHA 3J81O 2FF6A 3WNHA 3BUZB 2G8UA 4C8KA 4DU1A 4C8LA 3ENBA 3LM9A 2W40A 2HBMA 2YJFA 3OYLA 2QWLA 3FE1A 5EU7A 3O1BA 5IWAK 2X78A 1VQMN 1EKEA 3KWIA 4DHYA 4CK2A 3TI0A 1HJOA 1WN7A 4BQLA 1EWQA 4HTUA 3EL2A 3ZCMA 1DEJA 2OPSA 1O1WA 3L4QA 3LPUA 4UQGA 1QSSA 2HBLA 2W41A 4U67L 2ETJA 3A5MC 1VQPN 3ZEUA 4NLBA 3H45C 4IG3A 4B9QA 3DLRA 4E7HA 3NE6A 3C6TA 1X1PA 2ZGZA 3HSTB 4H0PA 2BANA 4BR2A 3OS1A 1J5OA 3SBGA 3RVCA 3I8DA 3KWGA 2E88A 3FFKB 1HNVA 2F7TA 1DTQA 3GE1A 3LALA 4NCAA 3D7EO 3VQQA 1QZ6A 1L3SA 3HOSA 4JI1K 2YHBA 4ELVA 3NH1A 4F4KA 3VQ6A 4L3QA 4FXDA 2YHAA 4PQUA 1N5YA 1HNIA 4FJLA 5TKYA 3DMJA 1TUUA 1L3TA 4CF9A 2O8FB 5LMUK 3OYDA 3DI6A 4BE0A 4CERA 2IIRA 2A40A 3IS9A 3OYCA 1K8AO 3HVTA 4FWRA 2ATQA 2WTUA 4B9SA 4CE9A 3U4LA 3L2WA 3E9PA 3V1QA 1HQUA 3WNFA 4EFHA 1RT4A 2QXFA 4K8XA 3VGKA 5GINA 3H6EA 1NWKA 3DLKA 3LP3A 3NH0A 3AO5A 3VTIA 3D2FB 1SAZA 1NJXA 4DV4K 2OCEA 1BO5O 2CGJA 4TSXA 5K14A 1UA0A 2IDOA 1Q7YO 1N36K 3BDPA 1BA0A 3CIPA 4NCGA 4CJLA 2E1YA 4CEFA 1DGKN 4FJMA 4W5OA 1NK8A 3FZHA 1RDDA 3AVAA 3CCLN 2BGGA 4K43A 4BRKA 1B9DA 2BE2A 3AVMA 1TAQA 4KB1A 3ZSVA 2RKIA 3IMXA 3DJCA 2YHWA 4C23A 4JKGA 4DQIA 3SCXA 3WNEA 4GV3A 3MEGA 1RT2A 3OBWA 3SZ2A 2P9KA 4BG9A 1YAGA 4A5AA 4B1UB 4CJRA 5LJVA 4M3ZA 4RWTA 4MDBA 4DQPA 3K5OA 1JLQA 1BOTO 2WUSA 1HKGA 2D4WA 1TK5A 4FW2A 3LM2A 4RW8A 4HHTA 2KTQA 5CHIA 3OS2A 4CGDA 4YFUA 4BC5A 3DLEA 4JAXA 5T7BA 3QBXA 1SL2A 1MA9B 3HM8A 3C65A 2DFHA 3CPEA 5KQDA 1RTHA 3KLIA 3OYJA 2PYLA 3JYTA 1JXEA 4CZGA 2PYJA 1F21A 3AVGA 5F1XA 4DU4A 4M3TA 1TL3A 4IZ9A 4CF0A 3TAQA 4X64K 4FLWA 3H08A 2QWRA 5LMNK 3ZSQA 3G10A 2B4JA 2HF3A 3O9SA 1JLEA 1ZXOA 4O8KA 4AH9A 3SQ1A 2HHQA 1TKZA 1XUPO 4PY5A 1RNHA 3THWB 4CECA 4WFNL 4JI2K 3RR7A 1LW2A 4DV5K 4YOTA 3A5LC 3J7AP 4ISFA 5J2NA 1RDCA 3KLEA 2QI2A 5KGXA 1JJ2M 4KI4A 1GLBG 1RDBA 5AQFA 3SV3A 3ULDA 5C2DA 3CJCA 3E9LA 3ID6A 3J8AA 1FJGK 4IJAA 2HHVA 3D6RA 3LAMA 3M6GA 1R59O 3JSMA 3ENOA 3O9UA 3E9OA 4CJQA 2QXLA 1WNSA 4CF1A 1HLUA 4CBXA 4DR5K 4H5TA 4FW1A 4M41A 3VEWA 3L3VA 3QO9A 1XHZA 4HUFA 4KB0A 1FKOA 4M45A 4GV6A 2YNFA 4LFAK 4PUOA 3L4IA 2QA4N 3QFUA 4C8MA 4DWIA 3S3OA 4KAZA 1Z25A 4BR5A 1M90O 4IBNA 4CVNE 1WAJA 2HNYA 4E3SA 3QICA 1NK0A 4OKKA 4DFPA 1NKBA 4O4GA 3O9RA 2IGIA 2GBZA 1SL0A 4QS8A 4IOAL 1X3MA 4B9LA 1S9EA 5F2RA 3T3FA 1ATRA 3P83D 3SPZA 3O3HA 2F8SA 4N76A 4YDUC 3VGMA 1NGHA 3S9HA 3CYMA 1RBSA 5KGWA 1GOAA 3CC2N 2A3ZA 2D0PA 3O3FA 5HROA 3ISNC 3U9DA 2VCPA 2P9SA 2HHXA 3LL3A 1NGAA 5M1PA 1WBBA 4CHQA 4PL7A 4XEIA 1BIUA 1QHTA 4WYBA 4BG8A 3NHGA 1HYZA 4JKEA 1BCOA 1VSHA 4CJ3A 4J2DA 4B3RK 4UY8O 1WLJA 3MEDA 1A5VA 2NLXA 4E7KA 1ASUA 1DKGD 1OH5A 3VEOA 2OANA 3DLGA 1KXPA 1NKEA 1EXQA 3KTQA 4DTXA 2P9PA 3GOIA 2QWMA 1CZ9A 4BC2A 3RRHA 3TAGA 1TUYA 3D2FA 4CZJA 4KI6A 5FPDA 3CFOA 1SV5A 1KRPA 3L2VA 4DSLA 3AY9A 4LC9B 1KSPA 2FLOA 4NO7A 4O5BA 2PZSA 4KHNA 4A2AA 5FRNA 4CJUA 1QVFM 4CF8A 4BRFA 2Q0RA 2D0OA 4JK7A 3ZX0A 4B9NA 4CD3A 4BROA 3G0ZA 4FLUA 4K41A 3EKUA 4CJ7A 1Q81O 2WBNA 4WFBL 1EWRA 2KZMA 3AVKA 3LP0A 2KFZA 4BRPA 3VF6A 3DAWA 3U6FA 1JCFA 4OPHA 2O4IA 4YOXA 1TK8A 1J9AA 5AQHA 3VOVA 3VQDA 3D0PA 1IG9A 1TV6A 4GV9A 4QS9A 2O8DA 2V51B 1NGDA 1LWCA 4FZXC 3CXCM 3HPHA 2P9KB 4CEAA 3AAQA 3AA2A 1HPZA 3AV9A 2P9NB 5C25A 2VWJA 4DR3K 1RGIA 4DU3A 4FJ5A 4Q0BA 3ZT1A 3TSPA 4Z94A 3LP2A 4FK4A 3CCEN 1ZBUA 4FM0A 1NLVA 3RWUA 4QOZB 4JHDA 4JI0K 4KV8A 3B6PA 2DTUA 1XC9A 1YTUA 4RW7A 1RBTA 4LH5A 5KPRA 4Z0UA 5KPTA 2Q97A 3ZSRA 4DTPA 4FJGA 4DTUA 2HW3A 2YKNA 4G1QA 2F4VK 3K2PA 5BRHA 1CZAN 2WOMA 3E1YA 1NGIA 1VRTA 2VG5A 4B1VA 3C95A 2HVIA 4BWJA 4WQ5A 2CH5A 1I3AA 4CHNA 3ATUA 5CY4A 5AQIA 3ZT0A 2QKBA 4B3TK 3DRRA 4CZIA 1VSMA 3I8BA 2R7YA 4KFBA 3PX4A 4X62K 4E1JA 4DFKA 4LH4A 1ESVA 2GEMA 4CZEA 4F3OA 3BP8A 2NRHA 2FF3B 3P4IA 3QNOA 5JVGL 3Q7CA 4EP5A 2O8FA 4JEPA 4FWKA 2KQ2A 3HZ6A 4IOXA 4DSIA 4FWMA 4BDPA 1Q9XA 1EP4A 4DSEA 2CGKA 3MCPA 4JRPA 1N6QA 1T7PA 4CZLA 4NLCA 4H5NA 4DMNA 2BH1A 4FSVA 1QQMA 4CHYA 1UAXA 4BVPA 3JS6A 4DR6K 5AQYA 3K5NA 4FWOA 5IT9O 5DM6L 3IRXA 4A59A 3CCUN 4R5PA 1DTTA 2PAVA 3SUQA 2QWOA 1GLDG 3A0IX 3O9TA 1XWLA 3THXA 4ID1A 5FROA 1JKHA 3OYMA 4JD2A 5AQXA 1CZBA 3C6HA 4B8CA 3QINA 1U48A 4B3OA 3AVNA 3WQTA 1RDAA 2Q2RA 1UOCA 4NYNA 5LJWA 2E2OA 5BPNA 4DQRA 4WE1A 3HP6A 3FLCO 1ZBSA 2AJQA 3JAMO 1U49A 1T05A 3CCRN 2EX3A 4Q5VA 3F2KA 4KKOA 1RT5A 3BZKA 1L3VA 1T44A 4IEIA 1WSJA 3J7ZO 1RFQA 3LANA 4ISGA 2DPNA 1HKCA 4KREA 2ASMA 4H03B 3M8SA 3KZBA 4RW9A 3MWTA 3OYIA 3VQPA 3MECA 1KLNA 5AQMA 4EZ9A 2G8HA 4W5RA 5KI6A 1Z26A 3E01A 1QQNA 4MDAA 4CEOA 4ID5A 2B5JA 2RHKA 3SJHA 4E7JA 4WQ4A 3CJBA 3QEVA 4DR1K 1N34K 3CC4N 3OYAA 2YCHA 3FR0A 4CJ5A 1LOTB 2FSNA 3G25A 2UXBK 4AM7A 4H5RA 3VENA 3VQ7A 3CMAN 1JLAA 1JCGA 2EWSA 3SMSA 1NG9A 4DV3K 3HO1A 1YHQN 2O8EB 4JN4A 4PKGA 4GY2B 3RSEB 1X9SA 1JLBA 1KCFA 1HNWK 4CK3A 3VEXA
chains in the Genus database with same CATH topology
4LF8K 5IWAK 4JI7K 4LFAK 4X65K 2UUCK 4DR6K 4DV2K 5IT9O 4DV0K 4LF6K 4CVNE 2E5LK 3T1HK 2UU9K 2VQFK 4DR3K 4DR2K 2HHHK 4DUZK 1HR0K 1IBLK 5LL6Z 4B3SK 1XNQK 4JI0K 2ZM6K 1J5EK 4NXNK 5BR8K 4DV6K 4LFBK 4DR4K 4NXMK 4LFCK 4JI3K 5A2QO 1I94K 1XNRK 5AJ3K 4DR7K 3OTOK 4K0KK 4JI5K 3JAMO 4CW7B 2F4VK 4JI1K 1N32K 4LF5K 1XMOK 4DUYK 4B3RK 2UXDK 5LMUK 1IBKK 4LF9K 4JI8K 4B3MK 4DV7K 4GKJK 2VQEK 4X64K 3J7YP 5FLXO 4B3TK 3T1YK 4YY3K 5LMNK 4V19S 1XMQK 1IBMK 1HNXK 4DR1K 4JI4K 1N34K 4X66K 2UXCK 4X62K 4LF4K 4YHHK 4OX9K 4JI2K 4DV5K 1N33K 4JV5K 4DV1K 3J7AP 2UXBK 4KHPK 4JYAK 1HNZK 2UUBK 4DV4K 4AQYK 1FJGK 1N36K 4DV3K 3J81O 4LF7K 3J80O 2UUAK 4JI6K 4GKKK 4DR5K 1HNWK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 K;  5IWA K;  4JI7 K;  4LFA K;  4X65 K;  2UUC K;  4DR6 K;  4DV2 K;  5IT9 O;  4DV0 K;  4LF6 K;  4CVN E;  2E5L K;  3T1H K;  2UU9 K;  2VQF K;  4DR3 K;  4DR2 K;  2HHH K;  4DUZ K;  1HR0 K;  1IBL K;  5LL6 Z;  4B3S K;  1XNQ K;  4JI0 K;  2ZM6 K;  1J5E K;  4NXN K;  5BR8 K;  4DV6 K;  4LFB K;  4DR4 K;  4NXM K;  4LFC K;  4JI3 K;  5A2Q O;  1I94 K;  1XNR K;  5AJ3 K;  4DR7 K;  3OTO K;  4K0K K;  4JI5 K;  3JAM O;  4CW7 B;  2F4V K;  4JI1 K;  1N32 K;  4LF5 K;  1XMO K;  4DUY K;  4B3R K;  2UXD K;  5LMU K;  1IBK K;  4LF9 K;  4JI8 K;  4B3M K;  4DV7 K;  4GKJ K;  2VQE K;  4X64 K;  3J7Y P;  5FLX O;  4B3T K;  3T1Y K;  4YY3 K;  5LMN K;  4V19 S;  1XMQ K;  1IBM K;  1HNX K;  4DR1 K;  4JI4 K;  1N34 K;  4X66 K;  2UXC K;  4X62 K;  4LF4 K;  4YHH K;  4OX9 K;  4JI2 K;  4DV5 K;  1N33 K;  4JV5 K;  4DV1 K;  3J7A P;  2UXB K;  4KHP K;  4JYA K;  1HNZ K;  2UUB K;  4DV4 K;  4AQY K;  1FJG K;  1N36 K;  4DV3 K;  3J81 O;  4LF7 K;  3J80 O;  2UUA K;  4JI6 K;  4GKK K;  4DR5 K;  1HNW K; 
#chains in the Genus database with same CATH topology
 2FSK A;  4DSF A;  4DSJ A;  4CGI A;  1TYQ B;  4H0O A;  4FJ7 A;  1HKB A;  2PBD A;  3OHR A;  4CJV A;  1Q82 O;  1WSE A;  1W0H A;  4IFE A;  4XH4 A;  1NMN A;  4H4O A;  4W5N A;  4HCC A;  3AGK A;  4IKF A;  1P8Z A;  2ZJQ L;  4DR2 K;  1A5X A;  4EHT A;  3V9X A;  4JS4 A;  1E4G T;  1QVG M;  1C1C A;  3QBW A;  1BG3 A;  5LL6 Z;  1RDW X;  4FLX A;  3VQ8 A;  2ZM6 K;  3QML A;  3C7N B;  1BQM A;  4AF1 A;  1O13 A;  1Y97 A;  1LW0 A;  5JIC A;  1NOZ A;  3CCV N;  4FVM A;  3QB0 A;  4CHZ A;  4JS5 A;  1OH6 A;  4JRQ A;  1T3V A;  4M3R A;  2J4R A;  4EZ6 A;  2UXD K;  1J6Z A;  1NJW A;  3I0S A;  4BGB A;  3LZI A;  4DKW A;  3R8E A;  1K6Y A;  2AP1 A;  2P9U A;  4K42 A;  1VQN N;  5M1Q A;  2HHT A;  4YY3 K;  4V19 S;  3DM2 A;  4DQQ A;  3V1R A;  1WOQ A;  4WFA L;  1BIZ A;  1KQS M;  3TWH A;  1VQ4 N;  3PUF A;  2QWP A;  5HRN A;  1U2V A;  4IXC A;  2ITG A;  3PIP L;  2HBJ A;  2W42 A;  4BRC A;  3RSE A;  5HLF A;  3THY B;  1WSH A;  4GNI A;  1IG8 A;  5I9E B;  1WSF A;  5DM7 L;  5BRF A;  2XRI A;  2E2N A;  4B1Z A;  1LAW A;  4B08 A;  2LSN A;  2O8C B;  3IUC A;  4JK9 A;  1QQO A;  3TTF A;  3UKU B;  5AZJ B;  1HPM A;  4I9Q A;  2WFB A;  4IO8 A;  1KC8 O;  2OPQ A;  2DY4 A;  3SV4 A;  1VSK A;  3O4N A;  1GOB A;  1BL3 A;  4Y1C A;  4H0X B;  3O8M A;  4JD2 B;  1JLG A;  3ZET B;  4CES A;  2OPR A;  1W97 L;  3CD6 N;  3ASM A;  1FK9 A;  3AO3 A;  3UE5 A;  2NRV A;  2OTJ N;  5E41 A;  2PY5 A;  5BRE A;  1U47 A;  1HYV A;  5C12 A;  3V9W A;  1NGJ A;  3ID8 A;  1V4T A;  4CGF A;  1SUQ A;  1VQ7 N;  3CC7 N;  4OPJ A;  4GW6 A;  4ILJ A;  2JWK A;  4EP4 A;  4FO0 A;  4FLY A;  3SQ4 A;  5HRR A;  3SBT A;  4DV6 K;  2G8W A;  1G99 A;  2UYT A;  3AVH A;  3DRP A;  2NRW A;  1ZC6 A;  2HB5 A;  3VTH A;  5EXW A;  2FBV A;  3I56 N;  4I7F A;  4FLV A;  3AVL A;  4KHU A;  4DF8 A;  2P9N A;  5AQN A;  4DTJ A;  4XH5 A;  3MXM A;  3DXM B;  4H0Y B;  1W7A A;  4DTR A;  3LAK A;  2IVN A;  3HP9 A;  2QW9 A;  4CGH A;  2G8K A;  2QKK A;  4OGC A;  4BVO A;  3G71 N;  3QIO A;  4J2E A;  4YOU A;  5C0Y A;  3K5M A;  1VQ5 N;  1SQK A;  1WSG A;  1RT1 A;  1A5W A;  4BRG A;  3TSU A;  4HVJ A;  1IO2 A;  2O8B B;  4MLE A;  5BN8 A;  4FM2 A;  1VQO N;  2UUB K;  4DLE A;  4IOC L;  4DG1 A;  4OPK A;  4CZF A;  1S1W A;  3AO2 A;  4FYD A;  3D2E A;  3ZEU B;  1VSF A;  3OW2 M;  1NJI O;  2O8C A;  2ZD1 A;  5JS2 A;  5C15 A;  1XI1 A;  1JLC A;  2UUA K;  4JI6 K;  2P9I B;  3ZSX A;  3CJA A;  5AFU A;  1VRU A;  1B9F A;  2Z1G A;  3VQC A;  4CEQ A;  4CGG A;  1WUA A;  4LF8 K;  4Z4G A;  1ATN A;  4HWI A;  4I9L A;  1JXB A;  4PL8 A;  1QTM A;  3M3Z A;  4ISE A;  4B1X B;  1VSI A;  3HBT A;  3Q7B A;  4DB3 A;  1NK5 A;  1J53 A;  3K9K A;  4E7L A;  2P9L A;  2E20 A;  4Z4I A;  2VQF K;  3HRG A;  5LY3 A;  1RBU A;  4IJN A;  4BR4 A;  5CYM A;  2A42 A;  2YNH A;  3TPQ A;  1GLJ O;  4FJX A;  3MX5 A;  1ASV A;  3C0B A;  3AA5 X;  1K8K B;  4KHQ A;  1LAV A;  1SZ2 A;  4ILG B;  3ZT3 A;  3IG1 A;  4NXN K;  4OKE A;  3HT3 A;  4M63 C;  3CM6 A;  4E19 A;  4F8R A;  5FPN A;  4F2S A;  2A1S A;  4MO4 A;  5AJ3 K;  3ULE B;  4FWQ A;  2Q31 A;  3CF5 L;  3O4W A;  4CW7 B;  1KAX A;  4PKH A;  3SQ0 A;  3CCQ N;  3JXU A;  4PKI A;  1C1B A;  3NGZ A;  1S1V A;  1T6C A;  3P39 A;  3KJV A;  4LF5 K;  4DUY K;  1MDU B;  2XO7 A;  1NGC A;  3F9K A;  4BRH A;  2XY7 A;  4LSL A;  4ELU A;  3TSQ A;  4FJK A;  1IBK K;  3ZSO A;  4FJH A;  3VN5 A;  4IFV A;  3U8X A;  5HRS A;  2KHO A;  4B3M K;  2P5G A;  2O4G A;  2HHW A;  1CXQ A;  1SS6 A;  3O4Q A;  5FLX O;  3TAB A;  5AQQ A;  1Q86 O;  3UIQ A;  2OPP A;  5CZ1 A;  2GV9 A;  4CBU A;  5AQS A;  3W3D A;  3THY A;  3FZM A;  4CI6 A;  4X66 K;  4LF4 K;  3AVJ A;  1YXQ A;  3C6A A;  4HCB A;  2DFE A;  2GTD A;  5EOY A;  1HNZ K;  1S9G A;  4CJT A;  4BRN A;  3HSC A;  1W9H A;  3IAY A;  3UKU A;  4OVL A;  5AZJ A;  4ZTJ A;  4RG8 A;  3SAF A;  1YIT N;  1BUP A;  4I2P A;  3VEZ A;  2XHB A;  3SK3 A;  4Z4E A;  1U04 A;  3VMF B;  3CCJ N;  1YJN N;  1NMD A;  2ZQB A;  5E26 A;  3AVB A;  2D0A A;  4R79 A;  1P90 A;  4FWN A;  1BIS A;  4W5Q A;  3RMA A;  1K9M O;  3GL1 A;  1VQ6 N;  3L6Q A;  2F8T A;  3CFP A;  4ELT A;  4DSK A;  3TU5 A;  3MMV A;  4CK1 A;  2D1K A;  4CFC A;  3T7Z A;  5KQ8 A;  3OYE A;  4CHO A;  1VSL A;  3RRG A;  2FBX A;  3BY5 A;  3M8R A;  1RTD A;  2HHS A;  4AHS A;  5CE3 A;  3KHY A;  1NNE A;  4DUZ K;  1YIJ N;  3PSI A;  4AHR A;  3LWM A;  3VQE A;  4O5F A;  4H0T B;  1EX4 A;  2HST A;  1QSL A;  2IVO A;  4CCH A;  3EN9 A;  3ATV A;  4B9T A;  3FZK A;  3LPT A;  2G8I A;  3DXK A;  2YNG A;  3KK3 A;  3V9Z A;  5FDL A;  3G6E N;  4E0D A;  3MX2 A;  4XH1 A;  5AQV A;  3AA4 A;  1S22 A;  3MN9 A;  1QZ5 A;  1TL1 A;  3LDL A;  3WEE B;  4QAG A;  5EX5 A;  3O3G A;  4LSN A;  4N56 A;  3RTV A;  1UWB A;  4F3T A;  4OLB A;  3O6W A;  4F9O A;  4LF9 K;  2Z1J A;  4KTW A;  5J2P A;  3T69 A;  1VAZ A;  3DYA A;  2VGM A;  1SKR A;  5E84 A;  3MCA B;  3G4S N;  3LDO A;  5B8H A;  1XQS C;  1BU6 O;  1U6Z A;  3EE8 A;  3NBP A;  4JKF A;  3CJ9 A;  4G9Z A;  3LDS A;  4JYA K;  3QIP A;  3KLG A;  3LDP A;  3CFR A;  1Y64 A;  3BGR A;  3H3N O;  4AHT A;  2JGU A;  3K57 A;  3AGR A;  3SUN A;  2NUB A;  4GVM A;  1KAZ A;  5M1O A;  5JMV A;  1N8R O;  2NRZ A;  4FWS A;  4F2R A;  2Q36 A;  4FJN A;  1LWF A;  4C1N K;  5CZ2 A;  1JL1 A;  3FFI A;  5TKW A;  3OYG A;  4GKK K;  2E2P A;  3T1A A;  3WUH A;  5I3U A;  1B92 A;  4WQ4 C;  1IH7 A;  2GWJ A;  3DOK A;  1BGX T;  4H8K A;  3ITH A;  3NGY A;  2OA8 A;  2UUC K;  5M1N A;  1T8E A;  2E2Q A;  2PFU A;  1Z05 A;  2ZWH A;  3VQ9 A;  1TKT A;  3QEX A;  1U2V B;  3VQB A;  2UU9 K;  4K25 A;  1L3U A;  3SJJ A;  4QCL A;  3DRS A;  1KVC A;  3NH2 A;  5C2F A;  2YKM A;  4KHS A;  3ULE A;  2VG7 A;  4YOY A;  3E66 A;  4I2Q A;  1TAU A;  1KTQ A;  3VQA A;  3IFR A;  3NAE A;  4CED A;  5GAH P;  3VEY A;  4BR9 A;  2E1Z A;  1NJZ A;  1QHA A;  2BUP A;  4B9U A;  3EY1 A;  4Y0W A;  4AHV A;  4BR7 A;  1C0G A;  3WXM B;  5CR4 A;  2A5X A;  2D5R A;  1SL1 A;  4BR0 A;  3PX0 A;  3SNN A;  2VG6 A;  1OVQ A;  3UKR B;  3ZT2 A;  3OJS A;  5BR9 A;  3AVI A;  2X74 A;  4HUG A;  3OJU A;  5I42 A;  3EE9 A;  3CER A;  1VQ9 N;  3AO4 A;  3C94 A;  3NDK A;  1G15 A;  2VQE K;  3THW A;  4CJS A;  3HPG A;  3QER A;  3KLF A;  4KH5 A;  4BRE A;  2NRR A;  4BWM A;  3OYB A;  3I33 A;  2Q3S A;  1EO1 A;  4NCB A;  3HK2 A;  1NK7 A;  3MN7 A;  4O8U A;  2HHU A;  2VWB A;  3CHW A;  1S5J A;  3D45 A;  5AQT A;  4FVU A;  5AQJ A;  4N5S A;  3TAF A;  4RW6 A;  4KHP K;  3AVF A;  1TGO A;  3WQU A;  1NM1 A;  1BCM A;  3SPY A;  3OVN A;  3CJ1 A;  3NVK A;  2GUP A;  2Q0U A;  4M3U A;  1ATS A;  4CJP A;  2EHG A;  4JKB A;  4RTF D;  4PHT X;  1YUW A;  3ZX2 A;  1WSI A;  1MWK A;  1C0T A;  1RT7 A;  4DQ8 A;  1RTJ A;  3I0R A;  4BRQ A;  3ZSY A;  1QS4 A;  3CQ8 A;  3M8Q A;  4JI7 K;  4X65 K;  4FM1 A;  1NOY A;  3L2U A;  5C10 A;  4KH4 A;  2B6A A;  3VEV A;  3CG7 A;  5BPL A;  2V52 B;  4JKA A;  1IJJ A;  3FZL A;  3VF2 A;  2HHH K;  3EZ5 A;  1BQN A;  1VSD A;  3NF7 A;  4B3S K;  5AQW A;  3CET A;  2RN2 A;  4FCY A;  2O8E A;  1NGE A;  1J5E K;  4NB4 A;  4IDK A;  4LFB K;  4B9V A;  4CIF A;  3NF9 A;  3K58 A;  5GAG P;  4AIL C;  5JS1 A;  4JKC A;  3QLH A;  4E1N A;  2YI1 A;  4YNQ A;  3I55 N;  3MXJ A;  4CJE A;  5EVZ A;  2F9W A;  3PY8 A;  4K8Z A;  2ITM A;  1BHL A;  2NZT A;  2P9L B;  1XMO K;  5ELZ A;  1UA1 A;  1YF5 L;  1V4S A;  1JL2 A;  4LY7 A;  3FGU A;  3BEX A;  3TAP A;  2BTF A;  2IOC A;  4CJF A;  3WXK A;  1IKX A;  3M5R A;  4J2A A;  4GKJ K;  4L8R B;  4H5V A;  3L0Q A;  4CZH A;  3S41 A;  3SQ2 A;  3T1Y K;  4FJ8 A;  4E1M A;  3TAE A;  2QWN A;  5BPM A;  3HVR A;  3QEW A;  3TAR A;  2OZM A;  5BN9 A;  3QEI A;  3RMC A;  3SAH A;  4JI4 K;  5EY4 A;  3P1G A;  3SUO A;  2ZF5 O;  1N33 K;  2XY8 A;  4Z4H A;  3V4I A;  5AFU H;  2A41 A;  2X6S A;  4Z4F A;  1KVA A;  5GIO A;  3DWL A;  4RCH A;  3UB5 A;  4M42 A;  2XY6 A;  1ITG A;  1L5U A;  4CEZ A;  3K0S A;  3ALY A;  3C6U A;  4Z4C A;  2IS3 A;  4BC3 A;  4EHU A;  3H1V X;  3H1Q A;  4ICL A;  4CEE A;  1Q9Y A;  1HX1 A;  1S3X A;  2IVP A;  3QES A;  4MQ3 A;  2P9U B;  4FOE A;  4C8N A;  3ZX3 A;  4E7I A;  2A1R A;  2NRX A;  4FJJ A;  3PSF A;  1RDU A;  4WQ5 C;  3CME N;  3SAG A;  4IWV A;  3L3U A;  3PV8 A;  2ASP A;  1I39 A;  1FXX A;  3THX B;  2YHX A;  3AAP A;  1RCH A;  5C24 A;  1T6D A;  4B8A B;  1NK4 A;  3P38 A;  4DTN A;  2ZJR L;  1KVB A;  1NU0 A;  1YI2 N;  1NGB A;  5AQZ A;  1GLE G;  3HYF A;  1C0U A;  4A61 A;  5BRD A;  5MLC Q;  4DLG A;  3PO4 A;  4PWD A;  5SWM A;  5AR0 A;  5ADX H;  3O9Q A;  3SYZ A;  3VQ4 A;  4KRF A;  1S6P A;  3EKS A;  4H0V B;  1Q18 A;  2KLA A;  1VQK N;  4LFC K;  5KRS A;  1I94 K;  2HMP A;  1XNR K;  3F5T A;  1IKV A;  4BE1 A;  4CEB A;  4YDU A;  3THV A;  5AZI B;  4FPB A;  1D9F A;  4MLH A;  3MK6 A;  1IV0 A;  3KVG A;  5ADX A;  4NYF A;  4M3W A;  4O0I A;  1YVN A;  5JVH L;  1OH7 A;  1R0A A;  2W6L A;  5JLF A;  1KAY A;  2HBK A;  4BRD A;  4OKJ A;  4JI8 K;  4M3Y A;  1RIL A;  1BDG A;  4H4M A;  1C0M A;  2FC0 A;  3R9P A;  2FXU A;  3J7Y P;  4J2B A;  1RT6 A;  4FWL A;  5HP1 A;  4A57 A;  3EO3 A;  2HOE A;  1FW6 A;  2F96 A;  4CD1 A;  3OY9 A;  5HL7 L;  1WB9 A;  2Z1H A;  1WBD A;  4JKG B;  2ZJP L;  2P9S B;  2HMI A;  3DLL L;  4WCE L;  2CGL A;  3HM9 A;  1Q8I A;  2HVH A;  2YHY A;  4FK0 A;  3TTC A;  5J1E A;  4B9M A;  4FZY A;  3EYZ A;  4CJK A;  4FJ9 A;  3ZLJ A;  4IEE A;  3L2Q A;  2HF4 A;  3O1W A;  4FOI A;  2D0B A;  4BRL A;  1DLO A;  3DLH A;  4YOR A;  3WXL A;  4M7Y A;  1J54 A;  2QWQ A;  3CJ7 A;  3K9J A;  1TVR A;  2YNI A;  3R1X A;  3LDN A;  3R3L A;  3HTV A;  3OYF A;  1RT3 A;  2E6M A;  2E5L K;  1D9D A;  2Q1N A;  5F0X A;  3V9U A;  2JLE A;  1IKY A;  3MDQ A;  1S72 N;  2O8B A;  3OYK A;  4FJI A;  4U7B A;  2CH6 A;  4B1Y B;  2E4L A;  2QK9 A;  1K73 O;  3QNN A;  4DFM A;  1LWE A;  1NGF A;  3MXI A;  5AZI A;  5BR8 K;  1C1A A;  1ZBF A;  4NXM K;  3OS0 A;  3P5J A;  2E6L A;  4BE2 A;  3WXJ A;  1U4B A;  1X3N A;  4JHD B;  3EEQ A;  1X9W A;  1E3M A;  5KTQ A;  3SMP A;  2E8A A;  1OVY A;  4IG0 A;  2NRT A;  4J8F A;  3K5L A;  1Z6R A;  1N32 K;  3AAR A;  5FPM A;  4DQS A;  1TK0 A;  2G8F A;  5GAE P;  4JKD A;  3O80 A;  4BC4 A;  3PIO L;  3L2R A;  2OTL N;  1U45 A;  3CQX A;  4B1W B;  4DS5 A;  3VGL A;  4DV7 K;  4DFJ A;  5D3G A;  3CPW M;  4M3X A;  3V9S A;  3H3O B;  4O55 A;  3AA3 A;  4H5W A;  1XMQ K;  5DK5 A;  1HJR A;  5AQO A;  2Y1J A;  3SUP A;  5GAD P;  1BA1 A;  4OX9 K;  1RBR A;  4W5T A;  3GBT A;  3H46 O;  3PO5 A;  4YOV A;  3NVM A;  4ZHR A;  1QE1 A;  1GLA G;  2P1J A;  3U9Z A;  2X6N A;  4CIG A;  2VYP A;  4MFB A;  5HOO A;  3KKS A;  4EIA A;  3KLH A;  2QEX N;  1YTA A;  4AM6 A;  1GOC A;  4BRM A;  3J80 O;  4IDH A;  2ZGY A;  1X9J A;  1D5A A;  4PA1 A;  1QQC A;  1MWM A;  1NJY A;  1VSE A;  3A8Y A;  3NGI A;  2DFF A;  1IKW A;  3NF6 A;  4CFB A;  1S1U A;  1FKP A;  4A5B A;  1VSJ A;  2YV0 X;  4KHW A;  1NKC A;  1NK9 A;  4N41 A;  1S6Q A;  3A5N C;  2GEL A;  4CFD A;  3KK7 A;  4C8O A;  1QSY A;  1JLF A;  4FZZ A;  1JCE A;  1HR0 K;  3KIO A;  1IBL K;  3S3M A;  3PX6 A;  1T03 A;  1VK0 A;  2VWK A;  3P31 A;  1HYS A;  1DT9 A;  2GWK A;  3LZJ A;  3F73 A;  4AHC A;  1CXU A;  3DLB A;  5AQP A;  4GVE A;  4JI3 K;  1TKX A;  5JLH A;  5AQR A;  1ZBL A;  2I7P A;  3VA3 A;  1ILY A;  4I6M A;  3AVC A;  4EAH D;  2I7N A;  2A6A A;  1HUX A;  3V6D A;  2WC9 A;  3HXM A;  1GLC G;  2FBY A;  4BDY A;  3ZT4 A;  4OGE A;  1EQY A;  3QDK A;  2RPI A;  3IKM A;  3NF8 A;  3IDH A;  2KZZ A;  3V1O A;  4CGJ A;  4HTL A;  1OH8 A;  1XC3 A;  3VPZ A;  4JKH A;  3M1F A;  4YOW A;  4BY9 C;  3A5O C;  5C42 A;  2YJE A;  2KW4 A;  3KD5 E;  3D2E B;  3KKR A;  3BF3 A;  3HOT A;  3VA0 A;  4JV5 K;  4DV1 K;  2KFN A;  3DXK B;  5DMR A;  2HND A;  3M8P A;  1WAF A;  4JK8 A;  4ZTF A;  3BF1 A;  4BQZ A;  4BRA A;  1ZBH A;  4AQY K;  1YT3 A;  4IO9 L;  3ZSW A;  4KO0 A;  5M1K A;  3WEE A;  1HRH A;  3SI6 A;  3N4Q A;  1S1T A;  3VES A;  1X9M A;  1NK6 A;  1XHX A;  3N4P A;  4CJ4 A;  3SLC A;  3OA9 A;  3VET A;  3NMU A;  3S3N A;  3U3Y A;  4DTO A;  4FL9 A;  2BDP A;  5AQU A;  2P5O A;  1C0F A;  4DV2 K;  4HUE A;  4DV0 K;  1KFD A;  3VQ5 A;  4LF6 K;  4GMJ B;  3T1H K;  4CZM A;  2GX9 A;  3L8B A;  1S1X A;  3ENH A;  5SZT A;  1HQE A;  2OZS A;  3EZW A;  4CBW A;  1M1K O;  3FZF A;  2YX6 A;  3LDQ A;  4OLA A;  1KLM A;  2FBT A;  4O44 A;  4KTZ A;  1BWF O;  1H1V A;  4E89 A;  4A62 A;  1RBV A;  3OYN A;  1TYQ A;  5A2Q O;  4DR7 K;  3OTO K;  2Y1I A;  4JLH A;  4Y1D A;  1VQ8 N;  3HPO A;  3WXI A;  3CCM N;  1ASW A;  2V7Y A;  2I5J A;  4ILH A;  3MN6 A;  1EET A;  1OKJ A;  4OJR A;  3LWL A;  5J2M A;  3OYH A;  2QTD A;  3NCI A;  2H3G X;  1CLQ A;  4KH6 A;  1LV5 A;  4CJW A;  3C7N A;  1IBM K;  5FPE A;  2Z1I A;  1HNX K;  2HNZ A;  3V81 A;  4KTQ A;  4FLT A;  5KPZ A;  5H1S Q;  3LP1 A;  4BDZ A;  1BI4 A;  3B6O A;  1HMV A;  2NNW A;  4RW4 A;  4JNE A;  1NBW A;  1ZBI A;  3W0L A;  3BZC A;  5FRM A;  4MO5 A;  3WT0 A;  1NGG A;  1LCU A;  4FWP A;  3RR8 A;  3O08 A;  4BGA A;  4DS4 A;  4OO1 J;  4FPA A;  5HRP A;  1YVU A;  3UKR A;  5AQG A;  4M7X A;  3TAN A;  1GLF O;  1KFS A;  4LF7 K;  5AQK A;  3HL8 A;  4CF2 A;  1YJ9 N;  2KKZ A;  3DOL A;  2WON A;  3GG4 A;  1D8Y A;  4FK2 A;  3R6M A;  2ZE2 A;  5CYQ A;  1TKD A;  1K8K A;  2P9I A;  3WNG A;  4FLZ A;  3AO1 A;  4DF4 A;  3VER A;  1E4F T;  1D4X A;  1VQL N;  3NFA A;  4KPY A;  2XY5 A;  1SKW A;  4WF9 L;  5KRT A;  4A2B A;  1KD1 O;  1REV A;  3CI5 A;  4N47 A;  3QET A;  4XIU A;  3CM5 A;  2P9P B;  3QEP A;  4CIE A;  1XNQ K;  4I6M B;  3O5B A;  1SKS A;  3TTD A;  3HJF A;  3OBY A;  5J2Q A;  4C1N I;  3MWP A;  3TAM A;  4DR4 K;  2JWL A;  3K59 A;  3T19 A;  1BI4 B;  3KD1 E;  2GUI A;  3B8A X;  1W2B M;  3VF4 A;  3CCS N;  4K0K K;  2V7Z A;  4JI5 K;  1C6V A;  4BRI A;  2ASO A;  4OPA A;  3F9M A;  2F9T A;  3MN5 A;  4CFA A;  4BAC A;  1MU2 A;  3ZET A;  1YJW N;  2AA4 A;  4CHP A;  3MEE A;  2RF2 A;  3ZSZ A;  5GIP A;  2VGN A;  3U3G A;  3MAQ A;  2OYQ A;  4KBO A;  5AQL A;  3RMB A;  2QM1 A;  3A2F A;  4DTS A;  3ZYY X;  4CZK A;  3PLA A;  3HI0 A;  2O8D B;  2W6K A;  1GLL O;  2IAJ A;  4AHU A;  4O0J A;  5HBM A;  2UXC K;  2P51 A;  2IC3 A;  3CQY A;  3GDQ A;  1RTI A;  4YHH K;  1ZYQ A;  3KK1 A;  2RE2 A;  4QS7 A;  3RMD A;  4KHY A;  5M1F A;  2FSJ A;  1VHX A;  4IFY A;  3TR8 A;  4LD0 A;  3QFP A;  2G8V A;  3KK2 A;  2D0C A;  4DTM A;  3DXM A;  4DCH A;  3J81 O;  2FF6 A;  3WNH A;  3BUZ B;  2G8U A;  4C8K A;  4DU1 A;  4C8L A;  3ENB A;  3LM9 A;  2W40 A;  2HBM A;  2YJF A;  3OYL A;  2QWL A;  3FE1 A;  5EU7 A;  3O1B A;  5IWA K;  2X78 A;  1VQM N;  1EKE A;  3KWI A;  4DHY A;  4CK2 A;  3TI0 A;  1HJO A;  1WN7 A;  4BQL A;  1EWQ A;  4HTU A;  3EL2 A;  3ZCM A;  1DEJ A;  2OPS A;  1O1W A;  3L4Q A;  3LPU A;  4UQG A;  1QSS A;  2HBL A;  2W41 A;  4U67 L;  2ETJ A;  3A5M C;  1VQP N;  3ZEU A;  4NLB A;  3H45 C;  4IG3 A;  4B9Q A;  3DLR A;  4E7H A;  3NE6 A;  3C6T A;  1X1P A;  2ZGZ A;  3HST B;  4H0P A;  2BAN A;  4BR2 A;  3OS1 A;  1J5O A;  3SBG A;  3RVC A;  3I8D A;  3KWG A;  2E88 A;  3FFK B;  1HNV A;  2F7T A;  1DTQ A;  3GE1 A;  3LAL A;  4NCA A;  3D7E O;  3VQQ A;  1QZ6 A;  1L3S A;  3HOS A;  4JI1 K;  2YHB A;  4ELV A;  3NH1 A;  4F4K A;  3VQ6 A;  4L3Q A;  4FXD A;  2YHA A;  4PQU A;  1N5Y A;  1HNI A;  4FJL A;  5TKY A;  3DMJ A;  1TUU A;  1L3T A;  4CF9 A;  2O8F B;  5LMU K;  3OYD A;  3DI6 A;  4BE0 A;  4CER A;  2IIR A;  2A40 A;  3IS9 A;  3OYC A;  1K8A O;  3HVT A;  4FWR A;  2ATQ A;  2WTU A;  4B9S A;  4CE9 A;  3U4L A;  3L2W A;  3E9P A;  3V1Q A;  1HQU A;  3WNF A;  4EFH A;  1RT4 A;  2QXF A;  4K8X A;  3VGK A;  5GIN A;  3H6E A;  1NWK A;  3DLK A;  3LP3 A;  3NH0 A;  3AO5 A;  3VTI A;  3D2F B;  1SAZ A;  1NJX A;  4DV4 K;  2OCE A;  1BO5 O;  2CGJ A;  4TSX A;  5K14 A;  1UA0 A;  2IDO A;  1Q7Y O;  1N36 K;  3BDP A;  1BA0 A;  3CIP A;  4NCG A;  4CJL A;  2E1Y A;  4CEF A;  1DGK N;  4FJM A;  4W5O A;  1NK8 A;  3FZH A;  1RDD A;  3AVA A;  3CCL N;  2BGG A;  4K43 A;  4BRK A;  1B9D A;  2BE2 A;  3AVM A;  1TAQ A;  4KB1 A;  3ZSV A;  2RKI A;  3IMX A;  3DJC A;  2YHW A;  4C23 A;  4JKG A;  4DQI A;  3SCX A;  3WNE A;  4GV3 A;  3MEG A;  1RT2 A;  3OBW A;  3SZ2 A;  2P9K A;  4BG9 A;  1YAG A;  4A5A A;  4B1U B;  4CJR A;  5LJV A;  4M3Z A;  4RWT A;  4MDB A;  4DQP A;  3K5O A;  1JLQ A;  1BOT O;  2WUS A;  1HKG A;  2D4W A;  1TK5 A;  4FW2 A;  3LM2 A;  4RW8 A;  4HHT A;  2KTQ A;  5CHI A;  3OS2 A;  4CGD A;  4YFU A;  4BC5 A;  3DLE A;  4JAX A;  5T7B A;  3QBX A;  1SL2 A;  1MA9 B;  3HM8 A;  3C65 A;  2DFH A;  3CPE A;  5KQD A;  1RTH A;  3KLI A;  3OYJ A;  2PYL A;  3JYT A;  1JXE A;  4CZG A;  2PYJ A;  1F21 A;  3AVG A;  5F1X A;  4DU4 A;  4M3T A;  1TL3 A;  4IZ9 A;  4CF0 A;  3TAQ A;  4X64 K;  4FLW A;  3H08 A;  2QWR A;  5LMN K;  3ZSQ A;  3G10 A;  2B4J A;  2HF3 A;  3O9S A;  1JLE A;  1ZXO A;  4O8K A;  4AH9 A;  3SQ1 A;  2HHQ A;  1TKZ A;  1XUP O;  4PY5 A;  1RNH A;  3THW B;  4CEC A;  4WFN L;  4JI2 K;  3RR7 A;  1LW2 A;  4DV5 K;  4YOT A;  3A5L C;  3J7A P;  4ISF A;  5J2N A;  1RDC A;  3KLE A;  2QI2 A;  5KGX A;  1JJ2 M;  4KI4 A;  1GLB G;  1RDB A;  5AQF A;  3SV3 A;  3ULD A;  5C2D A;  3CJC A;  3E9L A;  3ID6 A;  3J8A A;  1FJG K;  4IJA A;  2HHV A;  3D6R A;  3LAM A;  3M6G A;  1R59 O;  3JSM A;  3ENO A;  3O9U A;  3E9O A;  4CJQ A;  2QXL A;  1WNS A;  4CF1 A;  1HLU A;  4CBX A;  4DR5 K;  4H5T A;  4FW1 A;  4M41 A;  3VEW A;  3L3V A;  3QO9 A;  1XHZ A;  4HUF A;  4KB0 A;  1FKO A;  4M45 A;  4GV6 A;  2YNF A;  4LFA K;  4PUO A;  3L4I A;  2QA4 N;  3QFU A;  4C8M A;  4DWI A;  3S3O A;  4KAZ A;  1Z25 A;  4BR5 A;  1M90 O;  4IBN A;  4CVN E;  1WAJ A;  2HNY A;  4E3S A;  3QIC A;  1NK0 A;  4OKK A;  4DFP A;  1NKB A;  4O4G A;  3O9R A;  2IGI A;  2GBZ A;  1SL0 A;  4QS8 A;  4IOA L;  1X3M A;  4B9L A;  1S9E A;  5F2R A;  3T3F A;  1ATR A;  3P83 D;  3SPZ A;  3O3H A;  2F8S A;  4N76 A;  4YDU C;  3VGM A;  1NGH A;  3S9H A;  3CYM A;  1RBS A;  5KGW A;  1GOA A;  3CC2 N;  2A3Z A;  2D0P A;  3O3F A;  5HRO A;  3ISN C;  3U9D A;  2VCP A;  2P9S A;  2HHX A;  3LL3 A;  1NGA A;  5M1P A;  1WBB A;  4CHQ A;  4PL7 A;  4XEI A;  1BIU A;  1QHT A;  4WYB A;  4BG8 A;  3NHG A;  1HYZ A;  4JKE A;  1BCO A;  1VSH A;  4CJ3 A;  4J2D A;  4B3R K;  4UY8 O;  1WLJ A;  3MED A;  1A5V A;  2NLX A;  4E7K A;  1ASU A;  1DKG D;  1OH5 A;  3VEO A;  2OAN A;  3DLG A;  1KXP A;  1NKE A;  1EXQ A;  3KTQ A;  4DTX A;  2P9P A;  3GOI A;  2QWM A;  1CZ9 A;  4BC2 A;  3RRH A;  3TAG A;  1TUY A;  3D2F A;  4CZJ A;  4KI6 A;  5FPD A;  3CFO A;  1SV5 A;  1KRP A;  3L2V A;  4DSL A;  3AY9 A;  4LC9 B;  1KSP A;  2FLO A;  4NO7 A;  4O5B A;  2PZS A;  4KHN A;  4A2A A;  5FRN A;  4CJU A;  1QVF M;  4CF8 A;  4BRF A;  2Q0R A;  2D0O A;  4JK7 A;  3ZX0 A;  4B9N A;  4CD3 A;  4BRO A;  3G0Z A;  4FLU A;  4K41 A;  3EKU A;  4CJ7 A;  1Q81 O;  2WBN A;  4WFB L;  1EWR A;  2KZM A;  3AVK A;  3LP0 A;  2KFZ A;  4BRP A;  3VF6 A;  3DAW A;  3U6F A;  1JCF A;  4OPH A;  2O4I A;  4YOX A;  1TK8 A;  1J9A A;  5AQH A;  3VOV A;  3VQD A;  3D0P A;  1IG9 A;  1TV6 A;  4GV9 A;  4QS9 A;  2O8D A;  2V51 B;  1NGD A;  1LWC A;  4FZX C;  3CXC M;  3HPH A;  2P9K B;  4CEA A;  3AAQ A;  3AA2 A;  1HPZ A;  3AV9 A;  2P9N B;  5C25 A;  2VWJ A;  4DR3 K;  1RGI A;  4DU3 A;  4FJ5 A;  4Q0B A;  3ZT1 A;  3TSP A;  4Z94 A;  3LP2 A;  4FK4 A;  3CCE N;  1ZBU A;  4FM0 A;  1NLV A;  3RWU A;  4QOZ B;  4JHD A;  4JI0 K;  4KV8 A;  3B6P A;  2DTU A;  1XC9 A;  1YTU A;  4RW7 A;  1RBT A;  4LH5 A;  5KPR A;  4Z0U A;  5KPT A;  2Q97 A;  3ZSR A;  4DTP A;  4FJG A;  4DTU A;  2HW3 A;  2YKN A;  4G1Q A;  2F4V K;  3K2P A;  5BRH A;  1CZA N;  2WOM A;  3E1Y A;  1NGI A;  1VRT A;  2VG5 A;  4B1V A;  3C95 A;  2HVI A;  4BWJ A;  4WQ5 A;  2CH5 A;  1I3A A;  4CHN A;  3ATU A;  5CY4 A;  5AQI A;  3ZT0 A;  2QKB A;  4B3T K;  3DRR A;  4CZI A;  1VSM A;  3I8B A;  2R7Y A;  4KFB A;  3PX4 A;  4X62 K;  4E1J A;  4DFK A;  4LH4 A;  1ESV A;  2GEM A;  4CZE A;  4F3O A;  3BP8 A;  2NRH A;  2FF3 B;  3P4I A;  3QNO A;  5JVG L;  3Q7C A;  4EP5 A;  2O8F A;  4JEP A;  4FWK A;  2KQ2 A;  3HZ6 A;  4IOX A;  4DSI A;  4FWM A;  4BDP A;  1Q9X A;  1EP4 A;  4DSE A;  2CGK A;  3MCP A;  4JRP A;  1N6Q A;  1T7P A;  4CZL A;  4NLC A;  4H5N A;  4DMN A;  2BH1 A;  4FSV A;  1QQM A;  4CHY A;  1UAX A;  4BVP A;  3JS6 A;  4DR6 K;  5AQY A;  3K5N A;  4FWO A;  5IT9 O;  5DM6 L;  3IRX A;  4A59 A;  3CCU N;  4R5P A;  1DTT A;  2PAV A;  3SUQ A;  2QWO A;  1GLD G;  3A0I X;  3O9T A;  1XWL A;  3THX A;  4ID1 A;  5FRO A;  1JKH A;  3OYM A;  4JD2 A;  5AQX A;  1CZB A;  3C6H A;  4B8C A;  3QIN A;  1U48 A;  4B3O A;  3AVN A;  3WQT A;  1RDA A;  2Q2R A;  1UOC A;  4NYN A;  5LJW A;  2E2O A;  5BPN A;  4DQR A;  4WE1 A;  3HP6 A;  3FLC O;  1ZBS A;  2AJQ A;  3JAM O;  1U49 A;  1T05 A;  3CCR N;  2EX3 A;  4Q5V A;  3F2K A;  4KKO A;  1RT5 A;  3BZK A;  1L3V A;  1T44 A;  4IEI A;  1WSJ A;  3J7Z O;  1RFQ A;  3LAN A;  4ISG A;  2DPN A;  1HKC A;  4KRE A;  2ASM A;  4H03 B;  3M8S A;  3KZB A;  4RW9 A;  3MWT A;  3OYI A;  3VQP A;  3MEC A;  1KLN A;  5AQM A;  4EZ9 A;  2G8H A;  4W5R A;  5KI6 A;  1Z26 A;  3E01 A;  1QQN A;  4MDA A;  4CEO A;  4ID5 A;  2B5J A;  2RHK A;  3SJH A;  4E7J A;  4WQ4 A;  3CJB A;  3QEV A;  4DR1 K;  1N34 K;  3CC4 N;  3OYA A;  2YCH A;  3FR0 A;  4CJ5 A;  1LOT B;  2FSN A;  3G25 A;  2UXB K;  4AM7 A;  4H5R A;  3VEN A;  3VQ7 A;  3CMA N;  1JLA A;  1JCG A;  2EWS A;  3SMS A;  1NG9 A;  4DV3 K;  3HO1 A;  1YHQ N;  2O8E B;  4JN4 A;  4PKG A;  4GY2 B;  3RSE B;  1X9S A;  1JLB A;  1KCF A;  1HNW K;  4CK3 A;  3VEX A; 
#chains in the Genus database with same CATH homology
 4LF8 K;  5IWA K;  4JI7 K;  4LFA K;  4X65 K;  2UUC K;  4DR6 K;  4DV2 K;  5IT9 O;  4DV0 K;  4LF6 K;  4CVN E;  2E5L K;  3T1H K;  2UU9 K;  2VQF K;  4DR3 K;  4DR2 K;  2HHH K;  4DUZ K;  1HR0 K;  1IBL K;  5LL6 Z;  4B3S K;  1XNQ K;  4JI0 K;  2ZM6 K;  1J5E K;  4NXN K;  5BR8 K;  4DV6 K;  4LFB K;  4DR4 K;  4NXM K;  4LFC K;  4JI3 K;  5A2Q O;  1I94 K;  1XNR K;  5AJ3 K;  4DR7 K;  3OTO K;  4K0K K;  4JI5 K;  3JAM O;  4CW7 B;  2F4V K;  4JI1 K;  1N32 K;  4LF5 K;  1XMO K;  4DUY K;  4B3R K;  2UXD K;  5LMU K;  1IBK K;  4LF9 K;  4JI8 K;  4B3M K;  4DV7 K;  4GKJ K;  2VQE K;  4X64 K;  3J7Y P;  5FLX O;  4B3T K;  3T1Y K;  4YY3 K;  5LMN K;  4V19 S;  1XMQ K;  1IBM K;  1HNX K;  4DR1 K;  4JI4 K;  1N34 K;  4X66 K;  2UXC K;  4X62 K;  4LF4 K;  4YHH K;  4OX9 K;  4JI2 K;  4DV5 K;  1N33 K;  4JV5 K;  4DV1 K;  3J7A P;  2UXB K;  4KHP K;  4JYA K;  1HNZ K;  2UUB K;  4DV4 K;  4AQY K;  1FJG K;  1N36 K;  4DV3 K;  3J81 O;  4LF7 K;  3J80 O;  2UUA K;  4JI6 K;  4GKK K;  4DR5 K;  1HNW K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...