3T1HK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 3t1hK00
5IWAK 4DR2K 3T1YK 1XMOK 1N36K 3J7YP 4X66K 1N34K 4DV3K 4CW7B 4LFCK 3JAMO 4DR1K 4GKKK 3J81O 4YHHK 5LL6Z 4DUYK 4CVNE 4DR5K 4X64K 4YY3K 2ZM6K 1XMQK 2UUCK 3T1HK 4B3MK 4LFBK 4GKJK 1XNQK 4X62K 4LF8K 4JI8K 2E5LK 5AJ3K 2HHHK 4B3RK 4K0KK 4JI5K 1J5EK 4JI6K 4JI1K 4JI0K 1HNZK 2VQEK 4DV7K 1IBMK 1XNRK 4DV0K 5LMNK 2F4VK 4B3SK 4DV1K 2VQFK 4JV5K 1IBLK 1IBKK 4DR3K 2UU9K 4AQYK 4JYAK 1N32K 4LFAK 2UUBK 4LF9K 4OX9K 4LF6K 4DV2K 5IT9O 4LF4K 4LF5K 4NXMK 4NXNK 2UXDK 4JI2K 1I94K 1N33K 4B3TK 1HR0K 2UXCK 5BR8K 4JI3K 2UXBK 4DV4K 4X65K 4JI7K 4DV6K 3J7AP 4DUZK 5A2QO 3J80O 4DR7K 1FJGK 4JI4K 2UUAK 4KHPK 3OTOK 4LF7K 5LMUK 4V19S 4DR4K 4DR6K 5FLXO 1HNWK 4DV5K 1HNXK
chains in the Genus database with same CATH superfamily
5E26A 3M3ZA 4I7FA 2DFFA 3HPHA 3THVA 3CHWA 1HMVA 3EY1A 3TAPA 2G8WA 1J53A 4OPKA 1HJRA 4R79A 2I7PA 4ZHRA 5CZ1A 3CCSN 3H45C 3SQ0A 3ZLJA 3WQUA 2P9NA 3CCUN 3AO5A 1KAZA 4Y1CA 3VQDA 1T3VA 3HOSA 1RNHA 1BGXT 2ATQA 3T1HK 2Z1HA 4FPAA 4CIGA 4PUOA 4LFBK 1HRHA 3M8RA 4FJ9A 1VSIA 1IH7A 4B1UB 1HLUA 2E20A 4F9OA 1U45A 1BCOA 1WAJA 4RW9A 3QEWA 3CCQN 4FWKA 4EFHA 4DU3A 1JL1A 3VEWA 4B9LA 3GOIA 3HYFA 2P5OA 1SL2A 3QB0A 1F21A 2GELA 2KFZA 3DWLA 2HVIA 5AQSA 4ID1A 4B1XB 3KZBA 3QFUA 1B92A 2ZE2A 1VSLA 2IOCA 3RMDA 3O3FA 3SPYA 4BC4A 4JKBA 4B9MA 1ATRA 3NCIA 1O13A 1QHAA 4E1NA 1T44A 2HF4A 3NVKA 3A5NC 3AVAA 4BC2A 1ESVA 2F96A 5DM7L 4JI2K 4O44A 3EKSA 1RT4A 3BF1A 1VRUA 2PBDA 1BI4A 1D5AA 2XY8A 5BR8K 3G71N 3D0PA 2HOEA 3AAQA 2ASPA 3RMAA 1YIJN 1RGIA 3K5LA 2FSJA 3J7AP 2LSNA 2KFNA 3MECA 2W40A 3VQBA 4DR7K 1VQ8N 1LWEA 4HTUA 1HKCA 2ASMA 1SL1A 5FPEA 4DR4K 2FSNA 1TAUA 1OVYA 4DQ8A 4AM6A 2RPIA 4J2BA 5KPRA 4DSLA 1UA1A 2QKBA 2G8UA 4B1VA 3SZ2A 3NE6A 4FLVA 1NK6A 3O9SA 1WSIA 3HRGA 4BROA 4A5AA 3TSQA 4FPBA 1DTTA 1VK0A 3C6UA 4BRHA 4FO0A 4DV3K 4FM2A 1NJIO 2YNGA 2D0CA 3OW2M 3MK6A 4W5QA 4KB0A 3M6GA 1DKGD 2HMIA 1RT7A 4FK4A 3FZKA 3KJVA 3SUOA 4X64K 2KZMA 4IOCL 2UUCK 5E41A 1C0GA 5HRSA 3FFKB 5AQFA 4DLGA 3JSMA 4ILHA 3CF5L 3V1RA 4DQIA 1J9AA 4H4OA 4EHTA 2QWLA 1Z05A 1E4GT 1K8KB 5CYMA 3G4SN 4B3SK 1RBTA 1JLCA 4OVLA 5T7BA 1QZ6A 3H1QA 1IBLK 2E2QA 4IFEA 3ZT0A 4DSKA 3C6AA 2UU9K 2W6KA 2GEMA 4PHTX 1DLOA 3CCLN 3OYJA 3U8XA 4E19A 3ZSQA 2OYQA 3CC7N 4DCHA 2P9IA 2J4RA 4DLEA 4DTRA 5AQWA 4IZ9A 1RTHA 2HNZA 1BDGA 3I8BA 1QZ5A 3WEEB 4IO8A 4NXNK 2P9PB 1IV0A 4BR7A 2Y1IA 4M3ZA 4KH5A 5HLFA 2QW9A 4H4MA 4JKHA 3VEXA 2Z1IA 5BRDA 2QWNA 4BVOA 1EXQA 1WUAA 3VEVA 2NRVA 4CI6A 5C15A 1VQ4N 4CFCA 1C0MA 1KRPA 3O1BA 3K5NA 1L3TA 3KD1E 3VQ7A 1X3MA 1B9DA 1Y64A 3MWPA 4LC9B 5KQ8A 5IWAK 4QOZB 1BHLA 3AVFA 2ZGZA 1XMOK 2JGUA 3HJFA 4WFAL 4DFJA 2XRIA 1VQLN 3L2WA 4PL7A 5AQOA 3MDQA 4JLHA 3AVLA 3L4QA 4OKEA 3L2UA 3V9UA 1YI2N 4KBOA 3V1OA 4DSJA 1NGBA 4YY3K 5C10A 4LH5A 2OPSA 3FR0A 3HXMA 1RBVA 4XH5A 4W5OA 3TSUA 3H3NO 2KTQA 4KHQA 3NF7A 3QINA 5AJ3K 2F9TA 3PX0A 1U48A 4FXDA 1ZBSA 4L8RB 3ULEA 1OH5A 2EX3A 4FLTA 1TUYA 1NGGA 1KQSM 3CYMA 2P9KB 5AZIB 1IG9A 3VESA 1KTQA 4B9SA 4GY2B 3TTFA 4RG8A 3T19A 3H08A 5FRNA 4ZTJA 4AQYK 4L3QA 4I9LA 3VMFB 2PYJA 3F5TA 5EVZA 3D2FB 4O0JA 4LF4K 3PSFA 2YHAA 3DMJA 4MO5A 3L3UA 3CQ8A 5AQUA 1M1KO 4AHUA 1LOTB 1D9DA 1RFQA 1VQON 1BA1A 5AQIA 3E66A 4FVMA 3DOKA 4WYBA 2BUPA 1KAYA 3OYIA 4Z4FA 5EU7A 3AA5X 2UUAK 3OVNA 3R1XA 4BDPA 1TKTA 3E9PA 1KFDA 3VA0A 3OBYA 5CHIA 3ZX3A 1YF5L 5ADXH 1NMNA 3OY9A 4N5SA 5KGXA 5DMRA 1IKWA 4AHRA 5AQNA 1JLAA 5J2NA 1SKRA 4A59A 3AVJA 1VSHA 3NGZA 1Q81O 1JKHA 1ITGA 4FM1A 4GV9A 4CESA 1UAXA 3FGUA 3VQ8A 4I6MA 3CFOA 4JK7A 2RKIA 3O9QA 2CGLA 4RW8A 2QTDA 4DU1A 3QFPA 4I9QA 3O4NA 4TSXA 2BDPA 3K2PA 4CJ5A 1BIZA 1EQYA 3L2VA 4DTUA 1BISA 4BRMA 3IKMA 1TK8A 3HP6A 3V9SA 4B9NA 3FE1A 4OKKA 1XWLA 4Z4CA 3LPTA 4CF1A 3AGRA 1RT2A 4JD2A 3D2EB 3H6EA 3DI6A 4C1NI 4RW6A 2P5GA 1QSSA 1NGCA 5HP1A 3N4PA 1NBWA 4OGCA 4FZYA 1YTUA 4CF9A 3THWA 3Q7BA 4ISGA 3NBPA 4NYNA 1Z25A 4CZEA 4FWSA 2P9SB 3VTIA 3DLBA 3K9JA 4NLBA 3AVBA 3AVNA 3MN5A 4ELUA 1C0UA 1NK9A 5JLHA 3EEQA 3CFRA 4K8ZA 1GLJO 4NXMK 4C8NA 3DXKA 1VQ5N 3VQ4A 4CJWA 4AHVA 4HTLA 2A1RA 1K6YA 2Q31A 4ISEA 3O9TA 4RCHA 3PO5A 4CCHA 3LDSA 4RW7A 1SKWA 3CC4N 5C42A 2PYLA 2ZJQL 2O8CA 2GWJA 3KKSA 3OHRA 4GNIA 1L3VA 3K0SA 3H3OB 1OVQA 1R59O 4JKGB 4CGIA 3LDNA 3MEEA 4CJVA 3TI0A 1VSFA 2QA4N 1NOZA 4DHYA 4CE9A 5GAHP 1J54A 4F3TA 3ZEUA 3QESA 3J7YP 4CJQA 3T7ZA 3AVIA 1NKBA 4FJ7A 1C0FA 1S1UA 4CIFA 2ZD1A 4CW7B 1DT9A 2P9NB 2A41A 3LDOA 2ITMA 4QAGA 3SPZA 3C7NA 4GKKK 3ZSXA 1LAVA 1S9GA 3ZYYX 2YCHA 3EE8A 1WSJA 2QWMA 3VQ6A 3HSCA 1WAFA 5AR0A 2IVNA 4IBNA 2HHQA 3GE1A 3PIPL 2VWKA 3NGYA 1YTAA 1BWFO 1VSMA 2NRRA 2V51B 4JI6K 4OO1J 2A42A 4HCBA 5GAEP 2G8FA 4E1MA 2FBVA 4CJRA 4OLAA 3DLEA 1XQSC 3E9LA 3HVRA 1Q82O 1QQNA 1REVA 5JS1A 1MDUB 3UB5A 2HNDA 4PY5A 2YV0X 1K9MO 5GIOA 3PIOL 4F8RA 4YOUA 1XI1A 3UE5A 4Q5VA 4M42A 1CLQA 3CCJN 3O5BA 4KHYA 4GVMA 3BUZB 1TGOA 4NCGA 4NO7A 2P51A 3ALYA 4CF2A 1RTJA 3FLCO 4JKAA 2QWRA 4CD1A 4YOWA 2P9UA 1E4FT 3HI0A 1BI4B 4BRIA 4JEPA 4B08A 4IJAA 4O8UA 4HHTA 4F2SA 1E3MA 4FJHA 4IG3A 3ZSWA 3CFPA 4RW4A 3TAMA 4RWTA 2Q0UA 3VQCA 4A62A 5BPLA 1YITN 5A2QO 4EP4A 5JVGL 4CZGA 4JI4K 4IXCA 3OTOK 4CZIA 4H5NA 5CYQA 2JWLA 4YDUC 4CFBA 1HNWK 4DV5K 4R5PA 3T69A 1S72N 1XC3A 3LM2A 1NGFA 5H1SQ 1W9HA 3SAFA 3K5MA 4BRCA 4H5RA 4DQQA 4X66K 1WBBA 2RE2A 4K41A 2NNWA 3FFIA 4CK2A 1CZAN 5BR9A 2IAJA 1U2VA 5CR4A 1VQPN 1S1WA 4B9UA 2X6NA 5AQZA 5SWMA 1NJXA 4CVNE 3ZSOA 4BY9C 4E7LA 2GUIA 4PWDA 3AO2A 1KLMA 4FK2A 5AFUH 1TYQA 4BRNA 4FW1A 2YHXA 4M7XA 3SLCA 3LM9A 4CJKA 2Z1JA 2WC9A 4CJUA 4BGBA 3ZSVA 1WSHA 5EX5A 1VQ9N 3BGRA 3O4WA 1JXBA 4FL9A 2VQEK 4C1NK 3SUNA 3DLGA 1QQOA 3AO3A 4BRPA 4DV0K 1ILYA 5LMNK 3HP9A 3MMVA 1D8YA 1J5OA 2VQFK 2IVPA 3LDQA 2O4IA 4WFNL 3O6WA 3O4QA 1WOQA 1RILA 4BC5A 3KLGA 4N76A 3DJCA 5E84A 1S9EA 4HCCA 3EN9A 3V6DA 3QNNA 2P9IB 1T7PA 3VEOA 1QVGM 5KRTA 3L2RA 2QM1A 4XH1A 4LF6K 3A8YA 3MCAB 1IO2A 4H0OA 3ZETA 2IVOA 5BREA 5J2PA 4H0VB 3ZSZA 2GTDA 3LZIA 4M63C 5KTQA 4UQGA 3NH2A 4FLZA 4CEBA 1V4TA 1G99A 4FM0A 3WXMB 4ILJA 2O8DA 4BWJA 5C2FA 1S1TA 2NZTA 2KQ2A 4YOTA 1X3NA 4IOXA 1VSDA 1C1CA 3O08A 3THXA 4DTJA 2AJQA 1HNXK 3SV4A 2F7TA 3DRRA 1VSJA 2Z1GA 4CJEA 4OPHA 1FKPA 3O9RA 2HBLA 3PSIA 4DKWA 3C94A 2QI2A 2VGMA 3O9UA 2B4JA 1KVCA 2GV9A 3VN5A 4I2QA 4BQZA 1ZBIA 3OYHA 4BGAA 1TK5A 2YKNA 1SKSA 1UWBA 1RT1A 4JRQA 2E4LA 2YNIA 4CZHA 2HF3A 3CMEN 1XHXA 3NAEA 4JAXA 4GKJK 3BZCA 3H46O 3M1FA 3L2QA 2F8TA 1NGHA 4QS7A 3HPGA 3M8SA 4FLWA 4CIEA 5BPMA 3ULEB 3CMAN 2PAVA 4FWOA 1N8RO 3O8MA 3J8AA 3RR7A 4WE1A 1X1PA 3A0IX 2HHXA 2GUPA 4J2AA 4JK8A 4AHSA 3RTVA 3FZMA 3TTDA 3C0BA 1UA0A 2P1JA 1HUXA 1HKGA 1SL0A 1NK8A 1TVRA 2EWSA 2A6AA 2IIRA 1S5JA 4MDAA 1YJ9N 2E6LA 1JLBA 1T6DA 3N4QA 1WN7A 1J6ZA 1KXPA 2IS3A 1R0AA 1YJNN 3QIOA 1SV5A 4O4GA 4MLHA 3VQPA 4BR5A 3R9PA 4O5FA 5FRMA 2UXCK 3CQXA 3UKUA 1KVAA 3NF9A 3CXCM 3LL3A 1NJZA 1SUQA 4JI7K 3A5LC 1L3SA 5KPTA 3L8BA 1RTIA 3U4LA 4FJLA 1YAGA 5JICA 4BDYA 1U49A 1JCGA 4KPYA 2YHYA 5HBMA 1BO5O 1RDWX 3LP0A 4JS5A 1IKXA 2VWBA 3KWGA 4BE0A 1ASWA 1P8ZA 3DOLA 3DXMA 3RSEA 4ILGB 3BY5A 4DR2K 3MXMA 2YJEA 1N36K 4FOIA 1TV6A 3HBTA 3CJ1A 2FC0A 4YOXA 4CEQA 4PKHA 1HYSA 3BEXA 3OJSA 3RR8A 3LP1A 1U47A 1NG9A 4I6MB 3IUCA 4CJTA 3M8PA 4Y1DA 2OPRA 4BRQA 4YHHK 2BTFA 4DQPA 1W0HA 2OZSA 4JRPA 4PA1A 3PLAA 5AZJA 3OA9A 4OJRA 4YOYA 1GLDG 4CJ3A 5GIPA 3WXKA 3TR8A 1EWQA 4BR0A 3DAWA 4H5WA 1J5EK 4PQUA 1K73O 3RRHA 2VG5A 1EWRA 2CGKA 5SZTA 3VF2A 2G8HA 1HNZK 1JJ2M 1HYZA 4JD2B 1I3AA 1GOBA 1KD1O 4RTFD 3GG4A 3BZKA 2QWOA 5BN9A 4W5TA 5AQRA 4BR4A 3V9WA 3P31A 3QIPA 3THWB 4JV5K 3W0LA 3VPZA 1HNIA 4IKFA 1NMDA 4K42A 5D3GA 4DSIA 4W5RA 4K8XA 1N32K 5C0YA 2DFEA 1A5XA 3VEZA 3R6MA 2D5RA 1GLAG 1C1AA 4FJXA 5C25A 3DXKB 3DLRA 2AA4A 5HRRA 3TTCA 2V7YA 2NRWA 4IJNA 4WQ4C 3JS6A 4BRAA 4B3TK 4FLYA 3V4IA 2FF3B 2YKMA 2O8FA 3NH1A 2RN2A 1SZ2A 1S6PA 5M1PA 1NGJA 1DTQA 3CCMN 2O8CB 4CJFA 3B6OA 2F8SA 3ID6A 4DV6K 2FBXA 3NGIA 4BE2A 4OGEA 4YORA 3TANA 4ISFA 3A2FA 2X74A 4FJNA 1EX4A 4H5VA 4CHQA 4DUYK 4M41A 1WSGA 3DRPA 3RWUA 4YOVA 4E7JA 1T03A 3ENBA 1NKEA 3ZEUB 3CCRN 4MLEA 3T1YK 3JXUA 1NGIA 1TUUA 2YNFA 2XO7A 2Q97A 4CHPA 3TAQA 1YT3A 3I33A 1VSKA 1C0TA 4JHDB 2QXFA 5DM6L 1BL3A 2H3GX 4FZXC 3TARA 3F73A 3HVTA 4DB3A 4NCBA 5LL6Z 5C24A 3SMPA 3SI6A 1XMQK 2E1ZA 1ZYQA 1T8EA 4E0DA 4A2BA 4X62K 3NFAA 2YJFA 1ASVA 3AVGA 1VQMN 4C8OA 5M1KA 4DF4A 3D7EO 2DY4A 3ZSRA 3LWLA 2ETJA 4LD0A 1TL3A 1I39A 3VQ9A 2I5JA 3QLHA 4IEIA 2NRTA 2IDOA 3PV8A 1YVUA 2HMPA 4GVEA 1Q7YO 1SAZA 3SJJA 4MFBA 3VQEA 4CBUA 3K59A 3OS0A 3AV9A 1MA9B 3K5OA 1RBSA 5I9EB 3LDPA 1W2BM 4HVJA 1QE1A 3R3LA 4FOEA 3ATUA 1JL2A 2O8EA 3DM2A 2UYTA 2PY5A 1MWMA 1HPZA 3CPEA 3THYA 5I42A 3P4IA 3OYBA 5FROA 4N47A 4CHZA 3TWHA 1RTDA 1QVFM 2VYPA 2HBKA 1I94K 1N33K 3I56N 3LZJA 2D0OA 3QICA 1HR0K 1ZBLA 3LDLA 3IRXA 4BG8A 3PO4A 3WXJA 3WXLA 4WQ5C 5F0XA 4CGGA 2ZJRL 3KVGA 4FYDA 3SJHA 3U3YA 3RMBA 5AQGA 2G8IA 4CZFA 5HRPA 3ENHA 1QHTA 3O3GA 1VQ6N 4E7IA 1GLEG 3RRGA 3ZT4A 4MDBA 5HROA 1KFSA 3CIPA 4MQ3A 1Y97A 4EHUA 1HQUA 1GLLO 4WQ5A 2XY5A 2WBNA 3T1AA 3DLKA 4FWQA 3EZWA 1NK0A 1P90A 4CEFA 5F1XA 5J1EA 1U2VB 2Q2RA 4CGHA 3IS9A 1QTMA 2HHUA 2W42A 4IWVA 4FCYA 4JKCA 1W7AA 4M3UA 1SS6A 4BQLA 2P9KA 3AVCA 1TYQB 4CEZA 3BF3A 5HRNA 4CK3A 4KTZA 4EIAA 1NK7A 2ZJPL 1XHZA 4ICLA 4CEOA 2OPQA 1BCMA 2NRZA 3KIOA 1SQKA 4BG9A 4KREA 4M7YA 5EXWA 3TABA 1JLFA 4JI1K 3U9ZA 4CFDA 2KKZA 3SV3A 3HOTA 4H0YB 3KLIA 3GDQA 4DWIA 3C95A 4B9VA 3VF4A 3ZT3A 1LCUA 3L3VA 2RF2A 2DTUA 1JCEA 3MN7A 3P83D 3VQAA 4CHYA 3AA4A 4JKEA 4GMJB 4DTXA 4JS4A 5AQLA 1S22A 3BP8A 4UY8O 1T6CA 3ZETB 1BG3A 4DV2K 4M3XA 4C8LA 3MN6A 1OH8A 1TKZA 4EP5A 1DEJA 4Z4HA 4OPJA 1NJWA 5KPZA 1WSFA 4OPAA 2DPNA 2VWJA 3I8DA 4PKGA 5HL7L 1GLBG 1YXQA 3I55N 4CZKA 3MWTA 4BRGA 4CEAA 2O8DB 3T3FA 3CETA 2BE2A 5KGWA 3SUQA 3QDKA 4J8FA 3AGKA 3O3HA 4H03B 3A5OC 4PL8A 3THXB 3CQYA 4V19S 2E1YA 5FLXO 3QERA 4KFBA 4KHUA 1K8AO 5KRSA 4CEEA 1DGKN 3CJBA 3O1WA 3DYAA 3SQ1A 3VETA 3SUPA 2YHWA 5TKWA 4EZ6A 4FJ5A 4BRDA 4KTWA 4LFCK 5AQHA 4CECA 1S1VA 2D0PA 4NYFA 1HNVA 1NLVA 3ENOA 1ZC6A 4F2RA 4M3YA 3BDPA 3ATVA 2HBJA 3A5MC 2O8BA 3C6HA 3MCPA 2E5LK 5M1OA 4IO9L 3UKRA 4CZMA 2JLEA 2CGJA 1BA0A 3CPWM 3AVHA 4CZJA 4B9TA 1LW0A 2Q36A 3HM9A 2E6MA 1XNRK 3TU5A 4YDUA 2F4VK 4KRFA 5AQQA 1G15A 4IOAL 5FPDA 4B1WB 4DR3K 1JLGA 2VCPA 3ZCMA 3OS2A 3QNOA 4J2EA 1IJJA 4HUFA 3ZT2A 3VOVA 3WT0A 2KZZA 4DFMA 1ZBHA 1ZBUA 4KI4A 2YNHA 3M5RA 2UUBK 1X9MA 3HM8A 4KI6A 5J2MA 3IG1A 2P9LA 4LSNA 4DTMA 3EE9A 3K9KA 4DQSA 4PKIA 5MLCQ 3RVCA 3UKUB 1Q18A 5CE3A 4C8KA 2HBMA 4JKGA 2WUSA 3LPUA 4M45A 3MX2A 4C8MA 1TL1A 1M90O 3E1YA 3TAFA 4FJGA 5AQXA 2UXBK 4DV4K 3KWIA 3VA3A 5DK5A 1VAZA 4DUZK 3HO1A 3H1VX 4DSFA 2GWKA 4KHPK 2FF6A 3KLHA 1RDDA 4A2AA 1TK0A 3E01A 1B9FA 3SYZA 1HX1A 3MX5A 3DXMB 3RSEB 1BQMA 4M3RA 2ASOA 4F4KA 3HT3A 2AP1A 4ELTA 4EAHD 4G9ZA 4FWNA 3LANA 3RMCA 5TKYA 4Z0UA 3V9ZA 2PFUA 1N34K 3CJCA 4Z4GA 1EP4A 1LWFA 3JAMO 2I7NA 3K58A 3U6FA 3VF6A 1D9FA 4CK1A 4OLBA 3J81O 1X9JA 3L0QA 5AZJB 4DTNA 4A5BA 3OYAA 4DTOA 4B3MK 1RCHA 2DFHA 3MEDA 3LALA 3WNHA 4AM7A 2FLOA 4FWPA 3OYEA 4LF8K 3OYLA 3MXJA 3DLHA 4Z94A 3CCVN 4B3RK 1YHQN 3NMUA 3WXIA 4XIUA 1ZBFA 4CEDA 5AQVA 3EO3A 3AVKA 4CJ4A 4BWMA 2OTJN 3QEPA 5EOYA 3SCXA 1C1BA 1RDAA 2FXUA 4B1ZA 4YNQA 5M1QA 3S9HA 4GV6A 3GL1A 2HHSA 5CZ2A 4DTPA 3MXIA 2GX9A 1HPMA 3KK7A 3VTHA 4IDKA 4XH4A 5AQYA 5FDLA 4A57A 1QQMA 5LY3A 4CF8A 4LF5K 2E88A 3QBWA 4DFPA 3NH0A 3AVMA 1BOTO 1U04A 3SMSA 5LJVA 3U9DA 1A5VA 4CHNA 3OYKA 4H0XB 3CJ7A 2O8FB 3JYTA 4H0PA 1EO1A 3EZ5A 1EKEA 2YHBA 3NDKA 1LV5A 4E7HA 1X9SA 2QWPA 4KH6A 2V7ZA 4K43A 3ZSYA 4CHOA 1EETA 3IFRA 1Q86O 4CBWA 2FBTA 2OA8A 1FJGK 1NNEA 3C65A 1CZBA 1CXQA 1D4XA 4ID5A 4MO4A 4DR6K 3HK2A 3EKUA 5HOOA 3QEVA 4FWRA 5ELZA 1QSYA 3AA2A 3TAEA 3L6QA 4CGFA 4JN4A 1NU0A 1IKVA 5C12A 3P39A 4WF9L 4C23A 4DQRA 2Q1NA 3KLFA 3ASMA 1NOYA 4B8AB 2E2PA 1IKYA 2A5XA 3S41A 5F2RA 1S3XA 3CI5A 2G8KA 5ADXA 3G25A 2O4GA 3NF6A 2BH1A 3Q7CA 3NHGA 2QK9A 4JK9A 4WFBL 2BGGA 1Z26A 4BVPA 3CCEN 3WUHA 2HSTA 2CH6A 2OTLN 3MAQA 3SAGA 4NCAA 3WNEA 5BRHA 2XY6A 4Z4IA 4U7BA 3KK2A 3KTQA 4KHWA 1NGDA 2W41A 4XEIA 3F9KA 1NGAA 4IDHA 4Q0BA 1RT5A 2YI1A 1BU6O 2B6AA 3S3OA 4KAZA 1NK4A 1LAWA 1QQCA 1YVNA 4FK0A 5J2QA 2O8EB 1RDBA 3V1QA 2XHBA 4LFAK 3THYB 4CD3A 4O0IA 3PY8A 2X78A 2BANA 1GOAA 5IT9O 3SQ4A 3E9OA 1VRTA 3KKRA 4CERA 1OH7A 3GBTA 2F9WA 2HVHA 1W97L 1C6VA 1MWKA 2FBYA 3OYDA 2HW3A 1OKJA 1WNSA 1X9WA 3G0ZA 3I0RA 1CXUA 3U3GA 3S3MA 1IG8A 4KKOA 2GBZA 1YUWA 4E1JA 2D0BA 2Q0RA 1ATNA 3KK1A 3B8AX 2KLAA 3VERA 1LWCA 3WNFA 4GV3A 4LF7K 3HZ6A 3CERA 2IGIA 4O8KA 4ZTFA 4N41A 4F3OA 3VENA 1T05A 3LWMA 2A3ZA 2KW4A 4IFYA 4BACA 4EZ9A 2JWKA 3ID8A 3LAMA 1FW6A 3ISNC 5M1NA 2WFBA 2X6SA 4FLXA 2OANA 3SBTA 1WSEA 1YJWN 1RDCA 4LY7A 1N6QA 3OYGA 4H5TA 4M3TA 3ITHA 5AQKA 1VSEA 3HL8A 4JNEA 5EY4A 2ITGA 4WQ4A 4CZLA 5GAGP 5AQMA 1CZ9A 4O55A 2E2OA 1H1VA 2OCEA 1XNQK 2D4WA 3KLEA 1A5WA 3M8QA 4NB4A 2VGNA 4HUEA 4ELVA 4LSLA 3C7NB 1ATSA 4FLUA 4M3WA 2G8VA 4BE1A 1K8KA 5AQPA 2KHOA 1RDUA 2NRXA 1LW2A 1O1WA 3P38A 5KI6A 4DF8A 2PZSA 4W5NA 2ZQBA 3EYZA 2XY7A 1WB9A 2QWQA 4K25A 5BN8A 2HHWA 3ZX2A 4A61A 2A40A 1NWKA 4JKDA 3PX4A 4OX9K 1QS4A 4AH9A 3OYFA 1ASUA 4E3SA 1XC9A 4E7KA 4BR9A 4B9QA 2E8AA 4QS8A 3WEEA 2V52B 3NF8A 2P9PA 5M1FA 4HWIA 2RHKA 3TSPA 3OYMA 2W6LA 3MEGA 5LJWA 4X65K 3D6RA 4BRLA 1NJYA 3CC2N 2D1KA 2VG6A 1S1XA 1S6QA 4DU4A 1KAXA 2NRHA 3FZFA 5JLFA 3O80A 3AAPA 2P9UB 2WONA 4CGJA 4HUGA 5CY4A 3QETA 4IG0A 3QMLA 3J7ZO 5KQDA 3CM6A 5JMVA 4CGDA 3K57A 2HHTA 3P5JA 1L5UA 4NLCA 1Q9XA 3PX6A 4FJIA 3AY9A 4BR2A 3F9MA 1GLCG 4WCEL 1JLEA 3OYCA 5BRFA 4KTQA 4B1YB 3KK3A 3VQQA 2ZM6K 4KHSA 2YX6A 3P1GA 3AARA 4Y0WA 2O8BB 2D0AA 3IDHA 2WOMA 3UKRB 3CJ9A 1BIUA 2HNYA 4JI8K 3NVMA 3KD5E 4QCLA 4KHNA 4BRKA 3SAHA 1NGEA 3WQTA 4FSVA 4FWLA 4DMNA 4CFAA 1RT6A 3R8EA 4DV1K 4O5BA 1L3UA 5AFUA 1VQ7N 4DFKA 5I3UA 3HSTB 4OKJA 4JKFA 5AZIA 2Y1JA 1Q9YA 4N56A 4JYAK 3MN9A 5BPNA 2IC3A 2QXLA 1BUPA 3SBGA 4LF9K 5GINA 2EHGA 5B8HA 3LAKA 2P9LB 4Z4EA 3D2FA 3CG7A 1HYVA 3IAYA 3VGLA 1VHXA 3ZX0A 4KV8A 1HJOA 1MU2A 4CJSA 1NM1A 3ULDA 4CJPA 3V9XA 3SQ2A 1FK9A 4E89A 2ZF5O 4DS4A 4DS5A 4AF1A 3OS1A 3G10A 2NUBA 3KHYA 4FJ8A 3CM5A 3L4IA 1JLQA 1VQNN 4CJ7A 3B6PA 1GOCA 3ZT1A 4DSEA 4FJJA 1KSPA 4JHDA 2ZWHA 3FZLA 3QEXA 3J80O 2R7YA 5LMUK 1Z6RA 3VGKA 1TKXA 4FVUA 4BREA 4FZZA 4BDZA 3W3DA 4QS9A 5AQTA 5C2DA 3QEIA 3OBWA 3SNNA 4H0TB 2HHVA 3DRSA 3UIQA 3FZHA 4KH4A 4IEEA 4DR1K 2WTUA 1TKDA 1N5YA 5JS2A 4DR5K 3C6TA 1NK5A 4FW2A 1RBRA 5FPNA 1U6ZA 1UOCA 1U4BA 1WLJA 1FKOA 5K14A 2FSKA 1HKBA 3VEYA 2HHHK 3QBXA 4U67L 4K0KK 4JI5K 3HTVA 1Q8IA 4GW6A 3VQ5A 3SK3A 1JXEA 5JVHL 4JI0K 4BRFA 4DV7K 3HPOA 1KCFA 3V81A 2Q3SA 1IBMK 4AILC 4IFVA 4CBXA 4YFUA 4B3OA 1KC8O 1VQKN 4FJMA 1GLFO 3OYNA 3DLLL 1NKCA 3D2EA 3AO1A 1WBDA 2VG7A 3QO9A 1XUPO 4KB1A 3G6EN 3LP3A 1IBKK 4AHCA 4FJKA 4CF0A 4DTSA 1KLNA 3EL2A 1KVBA 3CJAA 3VGMA 4KO0A 2QKKA 1FXXA 2OZMA 3IMXA 4LH4A 1BQNA 2QEXN 2P9SA 1OH6A 4AHTA 1RT3A 2OPPA 3TPQA 2UXDK 3LP2A 3PUFA 2B5JA 1QSLA 4I2PA 3AO4A 1ZXOA 4J2DA 4DG1A 3F2KA 3WNGA 4JI3K 1JCFA 4CJLA 5AQJA 4H8KA 4FWMA 3D45A 4G1QA 1V4SA 1HQEA 3AA3A 2A1SA 2E2NA 2NLXA 3OJUA 1RBUA 2CH5A 2ZGYA 4B8CA 1TAQA 5GADP 2HB5A 5FPMA 3S3NA 4BC3A 3TAGA 3I0SA 3CD6N
chains in the Genus database with same CATH topology
5IWAK 4DR2K 3T1YK 1XMOK 1N36K 3J7YP 4X66K 1N34K 4DV3K 4CW7B 4LFCK 3JAMO 4DR1K 4GKKK 3J81O 4YHHK 5LL6Z 4DUYK 4CVNE 4DR5K 4X64K 4YY3K 2ZM6K 1XMQK 2UUCK 3T1HK 4B3MK 4LFBK 4GKJK 1XNQK 4X62K 4LF8K 4JI8K 2E5LK 5AJ3K 2HHHK 4B3RK 4K0KK 4JI5K 1J5EK 4JI6K 4JI1K 4JI0K 1HNZK 2VQEK 4DV7K 1IBMK 1XNRK 4DV0K 5LMNK 2F4VK 4B3SK 4DV1K 2VQFK 4JV5K 1IBLK 1IBKK 4DR3K 2UU9K 4AQYK 4JYAK 1N32K 4LFAK 2UUBK 4LF9K 4OX9K 4LF6K 4DV2K 5IT9O 4LF4K 4LF5K 4NXMK 4NXNK 2UXDK 4JI2K 1I94K 1N33K 4B3TK 1HR0K 2UXCK 5BR8K 4JI3K 2UXBK 4DV4K 4X65K 4JI7K 4DV6K 3J7AP 4DUZK 5A2QO 3J80O 4DR7K 1FJGK 4JI4K 2UUAK 4KHPK 3OTOK 4LF7K 5LMUK 4V19S 4DR4K 4DR6K 5FLXO 1HNWK 4DV5K 1HNXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA K;  4DR2 K;  3T1Y K;  1XMO K;  1N36 K;  3J7Y P;  4X66 K;  1N34 K;  4DV3 K;  4CW7 B;  4LFC K;  3JAM O;  4DR1 K;  4GKK K;  3J81 O;  4YHH K;  5LL6 Z;  4DUY K;  4CVN E;  4DR5 K;  4X64 K;  4YY3 K;  2ZM6 K;  1XMQ K;  2UUC K;  3T1H K;  4B3M K;  4LFB K;  4GKJ K;  1XNQ K;  4X62 K;  4LF8 K;  4JI8 K;  2E5L K;  5AJ3 K;  2HHH K;  4B3R K;  4K0K K;  4JI5 K;  1J5E K;  4JI6 K;  4JI1 K;  4JI0 K;  1HNZ K;  2VQE K;  4DV7 K;  1IBM K;  1XNR K;  4DV0 K;  5LMN K;  2F4V K;  4B3S K;  4DV1 K;  2VQF K;  4JV5 K;  1IBL K;  1IBK K;  4DR3 K;  2UU9 K;  4AQY K;  4JYA K;  1N32 K;  4LFA K;  2UUB K;  4LF9 K;  4OX9 K;  4LF6 K;  4DV2 K;  5IT9 O;  4LF4 K;  4LF5 K;  4NXM K;  4NXN K;  2UXD K;  4JI2 K;  1I94 K;  1N33 K;  4B3T K;  1HR0 K;  2UXC K;  5BR8 K;  4JI3 K;  2UXB K;  4DV4 K;  4X65 K;  4JI7 K;  4DV6 K;  3J7A P;  4DUZ K;  5A2Q O;  3J80 O;  4DR7 K;  1FJG K;  4JI4 K;  2UUA K;  4KHP K;  3OTO K;  4LF7 K;  5LMU K;  4V19 S;  4DR4 K;  4DR6 K;  5FLX O;  1HNW K;  4DV5 K;  1HNX K; 
#chains in the Genus database with same CATH topology
 5E26 A;  3M3Z A;  4I7F A;  2DFF A;  3HPH A;  3THV A;  3CHW A;  1HMV A;  3EY1 A;  3TAP A;  2G8W A;  1J53 A;  4OPK A;  1HJR A;  4R79 A;  2I7P A;  4ZHR A;  5CZ1 A;  3CCS N;  3H45 C;  3SQ0 A;  3ZLJ A;  3WQU A;  2P9N A;  3CCU N;  3AO5 A;  1KAZ A;  4Y1C A;  3VQD A;  1T3V A;  3HOS A;  1RNH A;  1BGX T;  2ATQ A;  3T1H K;  2Z1H A;  4FPA A;  4CIG A;  4PUO A;  4LFB K;  1HRH A;  3M8R A;  4FJ9 A;  1VSI A;  1IH7 A;  4B1U B;  1HLU A;  2E20 A;  4F9O A;  1U45 A;  1BCO A;  1WAJ A;  4RW9 A;  3QEW A;  3CCQ N;  4FWK A;  4EFH A;  4DU3 A;  1JL1 A;  3VEW A;  4B9L A;  3GOI A;  3HYF A;  2P5O A;  1SL2 A;  3QB0 A;  1F21 A;  2GEL A;  2KFZ A;  3DWL A;  2HVI A;  5AQS A;  4ID1 A;  4B1X B;  3KZB A;  3QFU A;  1B92 A;  2ZE2 A;  1VSL A;  2IOC A;  3RMD A;  3O3F A;  3SPY A;  4BC4 A;  4JKB A;  4B9M A;  1ATR A;  3NCI A;  1O13 A;  1QHA A;  4E1N A;  1T44 A;  2HF4 A;  3NVK A;  3A5N C;  3AVA A;  4BC2 A;  1ESV A;  2F96 A;  5DM7 L;  4JI2 K;  4O44 A;  3EKS A;  1RT4 A;  3BF1 A;  1VRU A;  2PBD A;  1BI4 A;  1D5A A;  2XY8 A;  5BR8 K;  3G71 N;  3D0P A;  2HOE A;  3AAQ A;  2ASP A;  3RMA A;  1YIJ N;  1RGI A;  3K5L A;  2FSJ A;  3J7A P;  2LSN A;  2KFN A;  3MEC A;  2W40 A;  3VQB A;  4DR7 K;  1VQ8 N;  1LWE A;  4HTU A;  1HKC A;  2ASM A;  1SL1 A;  5FPE A;  4DR4 K;  2FSN A;  1TAU A;  1OVY A;  4DQ8 A;  4AM6 A;  2RPI A;  4J2B A;  5KPR A;  4DSL A;  1UA1 A;  2QKB A;  2G8U A;  4B1V A;  3SZ2 A;  3NE6 A;  4FLV A;  1NK6 A;  3O9S A;  1WSI A;  3HRG A;  4BRO A;  4A5A A;  3TSQ A;  4FPB A;  1DTT A;  1VK0 A;  3C6U A;  4BRH A;  4FO0 A;  4DV3 K;  4FM2 A;  1NJI O;  2YNG A;  2D0C A;  3OW2 M;  3MK6 A;  4W5Q A;  4KB0 A;  3M6G A;  1DKG D;  2HMI A;  1RT7 A;  4FK4 A;  3FZK A;  3KJV A;  3SUO A;  4X64 K;  2KZM A;  4IOC L;  2UUC K;  5E41 A;  1C0G A;  5HRS A;  3FFK B;  5AQF A;  4DLG A;  3JSM A;  4ILH A;  3CF5 L;  3V1R A;  4DQI A;  1J9A A;  4H4O A;  4EHT A;  2QWL A;  1Z05 A;  1E4G T;  1K8K B;  5CYM A;  3G4S N;  4B3S K;  1RBT A;  1JLC A;  4OVL A;  5T7B A;  1QZ6 A;  3H1Q A;  1IBL K;  2E2Q A;  4IFE A;  3ZT0 A;  4DSK A;  3C6A A;  2UU9 K;  2W6K A;  2GEM A;  4PHT X;  1DLO A;  3CCL N;  3OYJ A;  3U8X A;  4E19 A;  3ZSQ A;  2OYQ A;  3CC7 N;  4DCH A;  2P9I A;  2J4R A;  4DLE A;  4DTR A;  5AQW A;  4IZ9 A;  1RTH A;  2HNZ A;  1BDG A;  3I8B A;  1QZ5 A;  3WEE B;  4IO8 A;  4NXN K;  2P9P B;  1IV0 A;  4BR7 A;  2Y1I A;  4M3Z A;  4KH5 A;  5HLF A;  2QW9 A;  4H4M A;  4JKH A;  3VEX A;  2Z1I A;  5BRD A;  2QWN A;  4BVO A;  1EXQ A;  1WUA A;  3VEV A;  2NRV A;  4CI6 A;  5C15 A;  1VQ4 N;  4CFC A;  1C0M A;  1KRP A;  3O1B A;  3K5N A;  1L3T A;  3KD1 E;  3VQ7 A;  1X3M A;  1B9D A;  1Y64 A;  3MWP A;  4LC9 B;  5KQ8 A;  5IWA K;  4QOZ B;  1BHL A;  3AVF A;  2ZGZ A;  1XMO K;  2JGU A;  3HJF A;  4WFA L;  4DFJ A;  2XRI A;  1VQL N;  3L2W A;  4PL7 A;  5AQO A;  3MDQ A;  4JLH A;  3AVL A;  3L4Q A;  4OKE A;  3L2U A;  3V9U A;  1YI2 N;  4KBO A;  3V1O A;  4DSJ A;  1NGB A;  4YY3 K;  5C10 A;  4LH5 A;  2OPS A;  3FR0 A;  3HXM A;  1RBV A;  4XH5 A;  4W5O A;  3TSU A;  3H3N O;  2KTQ A;  4KHQ A;  3NF7 A;  3QIN A;  5AJ3 K;  2F9T A;  3PX0 A;  1U48 A;  4FXD A;  1ZBS A;  4L8R B;  3ULE A;  1OH5 A;  2EX3 A;  4FLT A;  1TUY A;  1NGG A;  1KQS M;  3CYM A;  2P9K B;  5AZI B;  1IG9 A;  3VES A;  1KTQ A;  4B9S A;  4GY2 B;  3TTF A;  4RG8 A;  3T19 A;  3H08 A;  5FRN A;  4ZTJ A;  4AQY K;  4L3Q A;  4I9L A;  3VMF B;  2PYJ A;  3F5T A;  5EVZ A;  3D2F B;  4O0J A;  4LF4 K;  3PSF A;  2YHA A;  3DMJ A;  4MO5 A;  3L3U A;  3CQ8 A;  5AQU A;  1M1K O;  4AHU A;  1LOT B;  1D9D A;  1RFQ A;  1VQO N;  1BA1 A;  5AQI A;  3E66 A;  4FVM A;  3DOK A;  4WYB A;  2BUP A;  1KAY A;  3OYI A;  4Z4F A;  5EU7 A;  3AA5 X;  2UUA K;  3OVN A;  3R1X A;  4BDP A;  1TKT A;  3E9P A;  1KFD A;  3VA0 A;  3OBY A;  5CHI A;  3ZX3 A;  1YF5 L;  5ADX H;  1NMN A;  3OY9 A;  4N5S A;  5KGX A;  5DMR A;  1IKW A;  4AHR A;  5AQN A;  1JLA A;  5J2N A;  1SKR A;  4A59 A;  3AVJ A;  1VSH A;  3NGZ A;  1Q81 O;  1JKH A;  1ITG A;  4FM1 A;  4GV9 A;  4CES A;  1UAX A;  3FGU A;  3VQ8 A;  4I6M A;  3CFO A;  4JK7 A;  2RKI A;  3O9Q A;  2CGL A;  4RW8 A;  2QTD A;  4DU1 A;  3QFP A;  4I9Q A;  3O4N A;  4TSX A;  2BDP A;  3K2P A;  4CJ5 A;  1BIZ A;  1EQY A;  3L2V A;  4DTU A;  1BIS A;  4BRM A;  3IKM A;  1TK8 A;  3HP6 A;  3V9S A;  4B9N A;  3FE1 A;  4OKK A;  1XWL A;  4Z4C A;  3LPT A;  4CF1 A;  3AGR A;  1RT2 A;  4JD2 A;  3D2E B;  3H6E A;  3DI6 A;  4C1N I;  4RW6 A;  2P5G A;  1QSS A;  1NGC A;  5HP1 A;  3N4P A;  1NBW A;  4OGC A;  4FZY A;  1YTU A;  4CF9 A;  3THW A;  3Q7B A;  4ISG A;  3NBP A;  4NYN A;  1Z25 A;  4CZE A;  4FWS A;  2P9S B;  3VTI A;  3DLB A;  3K9J A;  4NLB A;  3AVB A;  3AVN A;  3MN5 A;  4ELU A;  1C0U A;  1NK9 A;  5JLH A;  3EEQ A;  3CFR A;  4K8Z A;  1GLJ O;  4NXM K;  4C8N A;  3DXK A;  1VQ5 N;  3VQ4 A;  4CJW A;  4AHV A;  4HTL A;  2A1R A;  1K6Y A;  2Q31 A;  4ISE A;  3O9T A;  4RCH A;  3PO5 A;  4CCH A;  3LDS A;  4RW7 A;  1SKW A;  3CC4 N;  5C42 A;  2PYL A;  2ZJQ L;  2O8C A;  2GWJ A;  3KKS A;  3OHR A;  4GNI A;  1L3V A;  3K0S A;  3H3O B;  1OVQ A;  1R59 O;  4JKG B;  4CGI A;  3LDN A;  3MEE A;  4CJV A;  3TI0 A;  1VSF A;  2QA4 N;  1NOZ A;  4DHY A;  4CE9 A;  5GAH P;  1J54 A;  4F3T A;  3ZEU A;  3QES A;  3J7Y P;  4CJQ A;  3T7Z A;  3AVI A;  1NKB A;  4FJ7 A;  1C0F A;  1S1U A;  4CIF A;  2ZD1 A;  4CW7 B;  1DT9 A;  2P9N B;  2A41 A;  3LDO A;  2ITM A;  4QAG A;  3SPZ A;  3C7N A;  4GKK K;  3ZSX A;  1LAV A;  1S9G A;  3ZYY X;  2YCH A;  3EE8 A;  1WSJ A;  2QWM A;  3VQ6 A;  3HSC A;  1WAF A;  5AR0 A;  2IVN A;  4IBN A;  2HHQ A;  3GE1 A;  3PIP L;  2VWK A;  3NGY A;  1YTA A;  1BWF O;  1VSM A;  2NRR A;  2V51 B;  4JI6 K;  4OO1 J;  2A42 A;  4HCB A;  5GAE P;  2G8F A;  4E1M A;  2FBV A;  4CJR A;  4OLA A;  3DLE A;  1XQS C;  3E9L A;  3HVR A;  1Q82 O;  1QQN A;  1REV A;  5JS1 A;  1MDU B;  3UB5 A;  2HND A;  4PY5 A;  2YV0 X;  1K9M O;  5GIO A;  3PIO L;  4F8R A;  4YOU A;  1XI1 A;  3UE5 A;  4Q5V A;  4M42 A;  1CLQ A;  3CCJ N;  3O5B A;  4KHY A;  4GVM A;  3BUZ B;  1TGO A;  4NCG A;  4NO7 A;  2P51 A;  3ALY A;  4CF2 A;  1RTJ A;  3FLC O;  4JKA A;  2QWR A;  4CD1 A;  4YOW A;  2P9U A;  1E4F T;  3HI0 A;  1BI4 B;  4BRI A;  4JEP A;  4B08 A;  4IJA A;  4O8U A;  4HHT A;  4F2S A;  1E3M A;  4FJH A;  4IG3 A;  3ZSW A;  3CFP A;  4RW4 A;  3TAM A;  4RWT A;  2Q0U A;  3VQC A;  4A62 A;  5BPL A;  1YIT N;  5A2Q O;  4EP4 A;  5JVG L;  4CZG A;  4JI4 K;  4IXC A;  3OTO K;  4CZI A;  4H5N A;  5CYQ A;  2JWL A;  4YDU C;  4CFB A;  1HNW K;  4DV5 K;  4R5P A;  3T69 A;  1S72 N;  1XC3 A;  3LM2 A;  1NGF A;  5H1S Q;  1W9H A;  3SAF A;  3K5M A;  4BRC A;  4H5R A;  4DQQ A;  4X66 K;  1WBB A;  2RE2 A;  4K41 A;  2NNW A;  3FFI A;  4CK2 A;  1CZA N;  5BR9 A;  2IAJ A;  1U2V A;  5CR4 A;  1VQP N;  1S1W A;  4B9U A;  2X6N A;  5AQZ A;  5SWM A;  1NJX A;  4CVN E;  3ZSO A;  4BY9 C;  4E7L A;  2GUI A;  4PWD A;  3AO2 A;  1KLM A;  4FK2 A;  5AFU H;  1TYQ A;  4BRN A;  4FW1 A;  2YHX A;  4M7X A;  3SLC A;  3LM9 A;  4CJK A;  2Z1J A;  2WC9 A;  4CJU A;  4BGB A;  3ZSV A;  1WSH A;  5EX5 A;  1VQ9 N;  3BGR A;  3O4W A;  1JXB A;  4FL9 A;  2VQE K;  4C1N K;  3SUN A;  3DLG A;  1QQO A;  3AO3 A;  4BRP A;  4DV0 K;  1ILY A;  5LMN K;  3HP9 A;  3MMV A;  1D8Y A;  1J5O A;  2VQF K;  2IVP A;  3LDQ A;  2O4I A;  4WFN L;  3O6W A;  3O4Q A;  1WOQ A;  1RIL A;  4BC5 A;  3KLG A;  4N76 A;  3DJC A;  5E84 A;  1S9E A;  4HCC A;  3EN9 A;  3V6D A;  3QNN A;  2P9I B;  1T7P A;  3VEO A;  1QVG M;  5KRT A;  3L2R A;  2QM1 A;  4XH1 A;  4LF6 K;  3A8Y A;  3MCA B;  1IO2 A;  4H0O A;  3ZET A;  2IVO A;  5BRE A;  5J2P A;  4H0V B;  3ZSZ A;  2GTD A;  3LZI A;  4M63 C;  5KTQ A;  4UQG A;  3NH2 A;  4FLZ A;  4CEB A;  1V4T A;  1G99 A;  4FM0 A;  3WXM B;  4ILJ A;  2O8D A;  4BWJ A;  5C2F A;  1S1T A;  2NZT A;  2KQ2 A;  4YOT A;  1X3N A;  4IOX A;  1VSD A;  1C1C A;  3O08 A;  3THX A;  4DTJ A;  2AJQ A;  1HNX K;  3SV4 A;  2F7T A;  3DRR A;  1VSJ A;  2Z1G A;  4CJE A;  4OPH A;  1FKP A;  3O9R A;  2HBL A;  3PSI A;  4DKW A;  3C94 A;  2QI2 A;  2VGM A;  3O9U A;  2B4J A;  1KVC A;  2GV9 A;  3VN5 A;  4I2Q A;  4BQZ A;  1ZBI A;  3OYH A;  4BGA A;  1TK5 A;  2YKN A;  1SKS A;  1UWB A;  1RT1 A;  4JRQ A;  2E4L A;  2YNI A;  4CZH A;  2HF3 A;  3CME N;  1XHX A;  3NAE A;  4JAX A;  4GKJ K;  3BZC A;  3H46 O;  3M1F A;  3L2Q A;  2F8T A;  1NGH A;  4QS7 A;  3HPG A;  3M8S A;  4FLW A;  4CIE A;  5BPM A;  3ULE B;  3CMA N;  2PAV A;  4FWO A;  1N8R O;  3O8M A;  3J8A A;  3RR7 A;  4WE1 A;  1X1P A;  3A0I X;  2HHX A;  2GUP A;  4J2A A;  4JK8 A;  4AHS A;  3RTV A;  3FZM A;  3TTD A;  3C0B A;  1UA0 A;  2P1J A;  1HUX A;  1HKG A;  1SL0 A;  1NK8 A;  1TVR A;  2EWS A;  2A6A A;  2IIR A;  1S5J A;  4MDA A;  1YJ9 N;  2E6L A;  1JLB A;  1T6D A;  3N4Q A;  1WN7 A;  1J6Z A;  1KXP A;  2IS3 A;  1R0A A;  1YJN N;  3QIO A;  1SV5 A;  4O4G A;  4MLH A;  3VQP A;  4BR5 A;  3R9P A;  4O5F A;  5FRM A;  2UXC K;  3CQX A;  3UKU A;  1KVA A;  3NF9 A;  3CXC M;  3LL3 A;  1NJZ A;  1SUQ A;  4JI7 K;  3A5L C;  1L3S A;  5KPT A;  3L8B A;  1RTI A;  3U4L A;  4FJL A;  1YAG A;  5JIC A;  4BDY A;  1U49 A;  1JCG A;  4KPY A;  2YHY A;  5HBM A;  1BO5 O;  1RDW X;  3LP0 A;  4JS5 A;  1IKX A;  2VWB A;  3KWG A;  4BE0 A;  1ASW A;  1P8Z A;  3DOL A;  3DXM A;  3RSE A;  4ILG B;  3BY5 A;  4DR2 K;  3MXM A;  2YJE A;  1N36 K;  4FOI A;  1TV6 A;  3HBT A;  3CJ1 A;  2FC0 A;  4YOX A;  4CEQ A;  4PKH A;  1HYS A;  3BEX A;  3OJS A;  3RR8 A;  3LP1 A;  1U47 A;  1NG9 A;  4I6M B;  3IUC A;  4CJT A;  3M8P A;  4Y1D A;  2OPR A;  4BRQ A;  4YHH K;  2BTF A;  4DQP A;  1W0H A;  2OZS A;  4JRP A;  4PA1 A;  3PLA A;  5AZJ A;  3OA9 A;  4OJR A;  4YOY A;  1GLD G;  4CJ3 A;  5GIP A;  3WXK A;  3TR8 A;  1EWQ A;  4BR0 A;  3DAW A;  4H5W A;  1J5E K;  4PQU A;  1K73 O;  3RRH A;  2VG5 A;  1EWR A;  2CGK A;  5SZT A;  3VF2 A;  2G8H A;  1HNZ K;  1JJ2 M;  1HYZ A;  4JD2 B;  1I3A A;  1GOB A;  1KD1 O;  4RTF D;  3GG4 A;  3BZK A;  2QWO A;  5BN9 A;  4W5T A;  5AQR A;  4BR4 A;  3V9W A;  3P31 A;  3QIP A;  3THW B;  4JV5 K;  3W0L A;  3VPZ A;  1HNI A;  4IKF A;  1NMD A;  4K42 A;  5D3G A;  4DSI A;  4W5R A;  4K8X A;  1N32 K;  5C0Y A;  2DFE A;  1A5X A;  3VEZ A;  3R6M A;  2D5R A;  1GLA G;  1C1A A;  4FJX A;  5C25 A;  3DXK B;  3DLR A;  2AA4 A;  5HRR A;  3TTC A;  2V7Y A;  2NRW A;  4IJN A;  4WQ4 C;  3JS6 A;  4BRA A;  4B3T K;  4FLY A;  3V4I A;  2FF3 B;  2YKM A;  2O8F A;  3NH1 A;  2RN2 A;  1SZ2 A;  1S6P A;  5M1P A;  1NGJ A;  1DTQ A;  3CCM N;  2O8C B;  4CJF A;  3B6O A;  2F8S A;  3ID6 A;  4DV6 K;  2FBX A;  3NGI A;  4BE2 A;  4OGE A;  4YOR A;  3TAN A;  4ISF A;  3A2F A;  2X74 A;  4FJN A;  1EX4 A;  4H5V A;  4CHQ A;  4DUY K;  4M41 A;  1WSG A;  3DRP A;  3RWU A;  4YOV A;  4E7J A;  1T03 A;  3ENB A;  1NKE A;  3ZEU B;  3CCR N;  4MLE A;  3T1Y K;  3JXU A;  1NGI A;  1TUU A;  2YNF A;  2XO7 A;  2Q97 A;  4CHP A;  3TAQ A;  1YT3 A;  3I33 A;  1VSK A;  1C0T A;  4JHD B;  2QXF A;  5DM6 L;  1BL3 A;  2H3G X;  4FZX C;  3TAR A;  3F73 A;  3HVT A;  4DB3 A;  4NCB A;  5LL6 Z;  5C24 A;  3SMP A;  3SI6 A;  1XMQ K;  2E1Z A;  1ZYQ A;  1T8E A;  4E0D A;  4A2B A;  4X62 K;  3NFA A;  2YJF A;  1ASV A;  3AVG A;  1VQM N;  4C8O A;  5M1K A;  4DF4 A;  3D7E O;  2DY4 A;  3ZSR A;  3LWL A;  2ETJ A;  4LD0 A;  1TL3 A;  1I39 A;  3VQ9 A;  2I5J A;  3QLH A;  4IEI A;  2NRT A;  2IDO A;  3PV8 A;  1YVU A;  2HMP A;  4GVE A;  1Q7Y O;  1SAZ A;  3SJJ A;  4MFB A;  3VQE A;  4CBU A;  3K59 A;  3OS0 A;  3AV9 A;  1MA9 B;  3K5O A;  1RBS A;  5I9E B;  3LDP A;  1W2B M;  4HVJ A;  1QE1 A;  3R3L A;  4FOE A;  3ATU A;  1JL2 A;  2O8E A;  3DM2 A;  2UYT A;  2PY5 A;  1MWM A;  1HPZ A;  3CPE A;  3THY A;  5I42 A;  3P4I A;  3OYB A;  5FRO A;  4N47 A;  4CHZ A;  3TWH A;  1RTD A;  1QVF M;  2VYP A;  2HBK A;  1I94 K;  1N33 K;  3I56 N;  3LZJ A;  2D0O A;  3QIC A;  1HR0 K;  1ZBL A;  3LDL A;  3IRX A;  4BG8 A;  3PO4 A;  3WXJ A;  3WXL A;  4WQ5 C;  5F0X A;  4CGG A;  2ZJR L;  3KVG A;  4FYD A;  3SJH A;  3U3Y A;  3RMB A;  5AQG A;  2G8I A;  4CZF A;  5HRP A;  3ENH A;  1QHT A;  3O3G A;  1VQ6 N;  4E7I A;  1GLE G;  3RRG A;  3ZT4 A;  4MDB A;  5HRO A;  1KFS A;  3CIP A;  4MQ3 A;  1Y97 A;  4EHU A;  1HQU A;  1GLL O;  4WQ5 A;  2XY5 A;  2WBN A;  3T1A A;  3DLK A;  4FWQ A;  3EZW A;  1NK0 A;  1P90 A;  4CEF A;  5F1X A;  5J1E A;  1U2V B;  2Q2R A;  4CGH A;  3IS9 A;  1QTM A;  2HHU A;  2W42 A;  4IWV A;  4FCY A;  4JKC A;  1W7A A;  4M3U A;  1SS6 A;  4BQL A;  2P9K A;  3AVC A;  1TYQ B;  4CEZ A;  3BF3 A;  5HRN A;  4CK3 A;  4KTZ A;  4EIA A;  1NK7 A;  2ZJP L;  1XHZ A;  4ICL A;  4CEO A;  2OPQ A;  1BCM A;  2NRZ A;  3KIO A;  1SQK A;  4BG9 A;  4KRE A;  4M7Y A;  5EXW A;  3TAB A;  1JLF A;  4JI1 K;  3U9Z A;  4CFD A;  2KKZ A;  3SV3 A;  3HOT A;  4H0Y B;  3KLI A;  3GDQ A;  4DWI A;  3C95 A;  4B9V A;  3VF4 A;  3ZT3 A;  1LCU A;  3L3V A;  2RF2 A;  2DTU A;  1JCE A;  3MN7 A;  3P83 D;  3VQA A;  4CHY A;  3AA4 A;  4JKE A;  4GMJ B;  4DTX A;  4JS4 A;  5AQL A;  1S22 A;  3BP8 A;  4UY8 O;  1T6C A;  3ZET B;  1BG3 A;  4DV2 K;  4M3X A;  4C8L A;  3MN6 A;  1OH8 A;  1TKZ A;  4EP5 A;  1DEJ A;  4Z4H A;  4OPJ A;  1NJW A;  5KPZ A;  1WSF A;  4OPA A;  2DPN A;  2VWJ A;  3I8D A;  4PKG A;  5HL7 L;  1GLB G;  1YXQ A;  3I55 N;  4CZK A;  3MWT A;  4BRG A;  4CEA A;  2O8D B;  3T3F A;  3CET A;  2BE2 A;  5KGW A;  3SUQ A;  3QDK A;  4J8F A;  3AGK A;  3O3H A;  4H03 B;  3A5O C;  4PL8 A;  3THX B;  3CQY A;  4V19 S;  2E1Y A;  5FLX O;  3QER A;  4KFB A;  4KHU A;  1K8A O;  5KRS A;  4CEE A;  1DGK N;  3CJB A;  3O1W A;  3DYA A;  3SQ1 A;  3VET A;  3SUP A;  2YHW A;  5TKW A;  4EZ6 A;  4FJ5 A;  4BRD A;  4KTW A;  4LFC K;  5AQH A;  4CEC A;  1S1V A;  2D0P A;  4NYF A;  1HNV A;  1NLV A;  3ENO A;  1ZC6 A;  4F2R A;  4M3Y A;  3BDP A;  3ATV A;  2HBJ A;  3A5M C;  2O8B A;  3C6H A;  3MCP A;  2E5L K;  5M1O A;  4IO9 L;  3UKR A;  4CZM A;  2JLE A;  2CGJ A;  1BA0 A;  3CPW M;  3AVH A;  4CZJ A;  4B9T A;  1LW0 A;  2Q36 A;  3HM9 A;  2E6M A;  1XNR K;  3TU5 A;  4YDU A;  2F4V K;  4KRF A;  5AQQ A;  1G15 A;  4IOA L;  5FPD A;  4B1W B;  4DR3 K;  1JLG A;  2VCP A;  3ZCM A;  3OS2 A;  3QNO A;  4J2E A;  1IJJ A;  4HUF A;  3ZT2 A;  3VOV A;  3WT0 A;  2KZZ A;  4DFM A;  1ZBH A;  1ZBU A;  4KI4 A;  2YNH A;  3M5R A;  2UUB K;  1X9M A;  3HM8 A;  4KI6 A;  5J2M A;  3IG1 A;  2P9L A;  4LSN A;  4DTM A;  3EE9 A;  3K9K A;  4DQS A;  4PKI A;  5MLC Q;  3RVC A;  3UKU B;  1Q18 A;  5CE3 A;  4C8K A;  2HBM A;  4JKG A;  2WUS A;  3LPU A;  4M45 A;  3MX2 A;  4C8M A;  1TL1 A;  1M90 O;  3E1Y A;  3TAF A;  4FJG A;  5AQX A;  2UXB K;  4DV4 K;  3KWI A;  3VA3 A;  5DK5 A;  1VAZ A;  4DUZ K;  3HO1 A;  3H1V X;  4DSF A;  2GWK A;  4KHP K;  2FF6 A;  3KLH A;  1RDD A;  4A2A A;  1TK0 A;  3E01 A;  1B9F A;  3SYZ A;  1HX1 A;  3MX5 A;  3DXM B;  3RSE B;  1BQM A;  4M3R A;  2ASO A;  4F4K A;  3HT3 A;  2AP1 A;  4ELT A;  4EAH D;  4G9Z A;  4FWN A;  3LAN A;  3RMC A;  5TKY A;  4Z0U A;  3V9Z A;  2PFU A;  1N34 K;  3CJC A;  4Z4G A;  1EP4 A;  1LWF A;  3JAM O;  2I7N A;  3K58 A;  3U6F A;  3VF6 A;  1D9F A;  4CK1 A;  4OLB A;  3J81 O;  1X9J A;  3L0Q A;  5AZJ B;  4DTN A;  4A5B A;  3OYA A;  4DTO A;  4B3M K;  1RCH A;  2DFH A;  3MED A;  3LAL A;  3WNH A;  4AM7 A;  2FLO A;  4FWP A;  3OYE A;  4LF8 K;  3OYL A;  3MXJ A;  3DLH A;  4Z94 A;  3CCV N;  4B3R K;  1YHQ N;  3NMU A;  3WXI A;  4XIU A;  1ZBF A;  4CED A;  5AQV A;  3EO3 A;  3AVK A;  4CJ4 A;  4BWM A;  2OTJ N;  3QEP A;  5EOY A;  3SCX A;  1C1B A;  1RDA A;  2FXU A;  4B1Z A;  4YNQ A;  5M1Q A;  3S9H A;  4GV6 A;  3GL1 A;  2HHS A;  5CZ2 A;  4DTP A;  3MXI A;  2GX9 A;  1HPM A;  3KK7 A;  3VTH A;  4IDK A;  4XH4 A;  5AQY A;  5FDL A;  4A57 A;  1QQM A;  5LY3 A;  4CF8 A;  4LF5 K;  2E88 A;  3QBW A;  4DFP A;  3NH0 A;  3AVM A;  1BOT O;  1U04 A;  3SMS A;  5LJV A;  3U9D A;  1A5V A;  4CHN A;  3OYK A;  4H0X B;  3CJ7 A;  2O8F B;  3JYT A;  4H0P A;  1EO1 A;  3EZ5 A;  1EKE A;  2YHB A;  3NDK A;  1LV5 A;  4E7H A;  1X9S A;  2QWP A;  4KH6 A;  2V7Z A;  4K43 A;  3ZSY A;  4CHO A;  1EET A;  3IFR A;  1Q86 O;  4CBW A;  2FBT A;  2OA8 A;  1FJG K;  1NNE A;  3C65 A;  1CZB A;  1CXQ A;  1D4X A;  4ID5 A;  4MO4 A;  4DR6 K;  3HK2 A;  3EKU A;  5HOO A;  3QEV A;  4FWR A;  5ELZ A;  1QSY A;  3AA2 A;  3TAE A;  3L6Q A;  4CGF A;  4JN4 A;  1NU0 A;  1IKV A;  5C12 A;  3P39 A;  4WF9 L;  4C23 A;  4DQR A;  2Q1N A;  3KLF A;  3ASM A;  1NOY A;  4B8A B;  2E2P A;  1IKY A;  2A5X A;  3S41 A;  5F2R A;  1S3X A;  3CI5 A;  2G8K A;  5ADX A;  3G25 A;  2O4G A;  3NF6 A;  2BH1 A;  3Q7C A;  3NHG A;  2QK9 A;  4JK9 A;  4WFB L;  2BGG A;  1Z26 A;  4BVP A;  3CCE N;  3WUH A;  2HST A;  2CH6 A;  2OTL N;  3MAQ A;  3SAG A;  4NCA A;  3WNE A;  5BRH A;  2XY6 A;  4Z4I A;  4U7B A;  3KK2 A;  3KTQ A;  4KHW A;  1NGD A;  2W41 A;  4XEI A;  3F9K A;  1NGA A;  4IDH A;  4Q0B A;  1RT5 A;  2YI1 A;  1BU6 O;  2B6A A;  3S3O A;  4KAZ A;  1NK4 A;  1LAW A;  1QQC A;  1YVN A;  4FK0 A;  5J2Q A;  2O8E B;  1RDB A;  3V1Q A;  2XHB A;  4LFA K;  3THY B;  4CD3 A;  4O0I A;  3PY8 A;  2X78 A;  2BAN A;  1GOA A;  5IT9 O;  3SQ4 A;  3E9O A;  1VRT A;  3KKR A;  4CER A;  1OH7 A;  3GBT A;  2F9W A;  2HVH A;  1W97 L;  1C6V A;  1MWK A;  2FBY A;  3OYD A;  2HW3 A;  1OKJ A;  1WNS A;  1X9W A;  3G0Z A;  3I0R A;  1CXU A;  3U3G A;  3S3M A;  1IG8 A;  4KKO A;  2GBZ A;  1YUW A;  4E1J A;  2D0B A;  2Q0R A;  1ATN A;  3KK1 A;  3B8A X;  2KLA A;  3VER A;  1LWC A;  3WNF A;  4GV3 A;  4LF7 K;  3HZ6 A;  3CER A;  2IGI A;  4O8K A;  4ZTF A;  4N41 A;  4F3O A;  3VEN A;  1T05 A;  3LWM A;  2A3Z A;  2KW4 A;  4IFY A;  4BAC A;  4EZ9 A;  2JWK A;  3ID8 A;  3LAM A;  1FW6 A;  3ISN C;  5M1N A;  2WFB A;  2X6S A;  4FLX A;  2OAN A;  3SBT A;  1WSE A;  1YJW N;  1RDC A;  4LY7 A;  1N6Q A;  3OYG A;  4H5T A;  4M3T A;  3ITH A;  5AQK A;  1VSE A;  3HL8 A;  4JNE A;  5EY4 A;  2ITG A;  4WQ4 A;  4CZL A;  5GAG P;  5AQM A;  1CZ9 A;  4O55 A;  2E2O A;  1H1V A;  2OCE A;  1XNQ K;  2D4W A;  3KLE A;  1A5W A;  3M8Q A;  4NB4 A;  2VGN A;  4HUE A;  4ELV A;  4LSL A;  3C7N B;  1ATS A;  4FLU A;  4M3W A;  2G8V A;  4BE1 A;  1K8K A;  5AQP A;  2KHO A;  1RDU A;  2NRX A;  1LW2 A;  1O1W A;  3P38 A;  5KI6 A;  4DF8 A;  2PZS A;  4W5N A;  2ZQB A;  3EYZ A;  2XY7 A;  1WB9 A;  2QWQ A;  4K25 A;  5BN8 A;  2HHW A;  3ZX2 A;  4A61 A;  2A40 A;  1NWK A;  4JKD A;  3PX4 A;  4OX9 K;  1QS4 A;  4AH9 A;  3OYF A;  1ASU A;  4E3S A;  1XC9 A;  4E7K A;  4BR9 A;  4B9Q A;  2E8A A;  4QS8 A;  3WEE A;  2V52 B;  3NF8 A;  2P9P A;  5M1F A;  4HWI A;  2RHK A;  3TSP A;  3OYM A;  2W6L A;  3MEG A;  5LJW A;  4X65 K;  3D6R A;  4BRL A;  1NJY A;  3CC2 N;  2D1K A;  2VG6 A;  1S1X A;  1S6Q A;  4DU4 A;  1KAX A;  2NRH A;  3FZF A;  5JLF A;  3O80 A;  3AAP A;  2P9U B;  2WON A;  4CGJ A;  4HUG A;  5CY4 A;  3QET A;  4IG0 A;  3QML A;  3J7Z O;  5KQD A;  3CM6 A;  5JMV A;  4CGD A;  3K57 A;  2HHT A;  3P5J A;  1L5U A;  4NLC A;  1Q9X A;  3PX6 A;  4FJI A;  3AY9 A;  4BR2 A;  3F9M A;  1GLC G;  4WCE L;  1JLE A;  3OYC A;  5BRF A;  4KTQ A;  4B1Y B;  3KK3 A;  3VQQ A;  2ZM6 K;  4KHS A;  2YX6 A;  3P1G A;  3AAR A;  4Y0W A;  2O8B B;  2D0A A;  3IDH A;  2WOM A;  3UKR B;  3CJ9 A;  1BIU A;  2HNY A;  4JI8 K;  3NVM A;  3KD5 E;  4QCL A;  4KHN A;  4BRK A;  3SAH A;  1NGE A;  3WQT A;  4FSV A;  4FWL A;  4DMN A;  4CFA A;  1RT6 A;  3R8E A;  4DV1 K;  4O5B A;  1L3U A;  5AFU A;  1VQ7 N;  4DFK A;  5I3U A;  3HST B;  4OKJ A;  4JKF A;  5AZI A;  2Y1J A;  1Q9Y A;  4N56 A;  4JYA K;  3MN9 A;  5BPN A;  2IC3 A;  2QXL A;  1BUP A;  3SBG A;  4LF9 K;  5GIN A;  2EHG A;  5B8H A;  3LAK A;  2P9L B;  4Z4E A;  3D2F A;  3CG7 A;  1HYV A;  3IAY A;  3VGL A;  1VHX A;  3ZX0 A;  4KV8 A;  1HJO A;  1MU2 A;  4CJS A;  1NM1 A;  3ULD A;  4CJP A;  3V9X A;  3SQ2 A;  1FK9 A;  4E89 A;  2ZF5 O;  4DS4 A;  4DS5 A;  4AF1 A;  3OS1 A;  3G10 A;  2NUB A;  3KHY A;  4FJ8 A;  3CM5 A;  3L4I A;  1JLQ A;  1VQN N;  4CJ7 A;  3B6P A;  1GOC A;  3ZT1 A;  4DSE A;  4FJJ A;  1KSP A;  4JHD A;  2ZWH A;  3FZL A;  3QEX A;  3J80 O;  2R7Y A;  5LMU K;  1Z6R A;  3VGK A;  1TKX A;  4FVU A;  4BRE A;  4FZZ A;  4BDZ A;  3W3D A;  4QS9 A;  5AQT A;  5C2D A;  3QEI A;  3OBW A;  3SNN A;  4H0T B;  2HHV A;  3DRS A;  3UIQ A;  3FZH A;  4KH4 A;  4IEE A;  4DR1 K;  2WTU A;  1TKD A;  1N5Y A;  5JS2 A;  4DR5 K;  3C6T A;  1NK5 A;  4FW2 A;  1RBR A;  5FPN A;  1U6Z A;  1UOC A;  1U4B A;  1WLJ A;  1FKO A;  5K14 A;  2FSK A;  1HKB A;  3VEY A;  2HHH K;  3QBX A;  4U67 L;  4K0K K;  4JI5 K;  3HTV A;  1Q8I A;  4GW6 A;  3VQ5 A;  3SK3 A;  1JXE A;  5JVH L;  4JI0 K;  4BRF A;  4DV7 K;  3HPO A;  1KCF A;  3V81 A;  2Q3S A;  1IBM K;  4AIL C;  4IFV A;  4CBX A;  4YFU A;  4B3O A;  1KC8 O;  1VQK N;  4FJM A;  1GLF O;  3OYN A;  3DLL L;  1NKC A;  3D2E A;  3AO1 A;  1WBD A;  2VG7 A;  3QO9 A;  1XUP O;  4KB1 A;  3G6E N;  3LP3 A;  1IBK K;  4AHC A;  4FJK A;  4CF0 A;  4DTS A;  1KLN A;  3EL2 A;  1KVB A;  3CJA A;  3VGM A;  4KO0 A;  2QKK A;  1FXX A;  2OZM A;  3IMX A;  4LH4 A;  1BQN A;  2QEX N;  2P9S A;  1OH6 A;  4AHT A;  1RT3 A;  2OPP A;  3TPQ A;  2UXD K;  3LP2 A;  3PUF A;  2B5J A;  1QSL A;  4I2P A;  3AO4 A;  1ZXO A;  4J2D A;  4DG1 A;  3F2K A;  3WNG A;  4JI3 K;  1JCF A;  4CJL A;  5AQJ A;  4H8K A;  4FWM A;  3D45 A;  4G1Q A;  1V4S A;  1HQE A;  3AA3 A;  2A1S A;  2E2N A;  2NLX A;  3OJU A;  1RBU A;  2CH5 A;  2ZGY A;  4B8C A;  1TAQ A;  5GAD P;  2HB5 A;  5FPM A;  3S3N A;  4BC3 A;  3TAG A;  3I0S A;  3CD6 N; 
#chains in the Genus database with same CATH homology
 5IWA K;  4DR2 K;  3T1Y K;  1XMO K;  1N36 K;  3J7Y P;  4X66 K;  1N34 K;  4DV3 K;  4CW7 B;  4LFC K;  3JAM O;  4DR1 K;  4GKK K;  3J81 O;  4YHH K;  5LL6 Z;  4DUY K;  4CVN E;  4DR5 K;  4X64 K;  4YY3 K;  2ZM6 K;  1XMQ K;  2UUC K;  3T1H K;  4B3M K;  4LFB K;  4GKJ K;  1XNQ K;  4X62 K;  4LF8 K;  4JI8 K;  2E5L K;  5AJ3 K;  2HHH K;  4B3R K;  4K0K K;  4JI5 K;  1J5E K;  4JI6 K;  4JI1 K;  4JI0 K;  1HNZ K;  2VQE K;  4DV7 K;  1IBM K;  1XNR K;  4DV0 K;  5LMN K;  2F4V K;  4B3S K;  4DV1 K;  2VQF K;  4JV5 K;  1IBL K;  1IBK K;  4DR3 K;  2UU9 K;  4AQY K;  4JYA K;  1N32 K;  4LFA K;  2UUB K;  4LF9 K;  4OX9 K;  4LF6 K;  4DV2 K;  5IT9 O;  4LF4 K;  4LF5 K;  4NXM K;  4NXN K;  2UXD K;  4JI2 K;  1I94 K;  1N33 K;  4B3T K;  1HR0 K;  2UXC K;  5BR8 K;  4JI3 K;  2UXB K;  4DV4 K;  4X65 K;  4JI7 K;  4DV6 K;  3J7A P;  4DUZ K;  5A2Q O;  3J80 O;  4DR7 K;  1FJG K;  4JI4 K;  2UUA K;  4KHP K;  3OTO K;  4LF7 K;  5LMU K;  4V19 S;  4DR4 K;  4DR6 K;  5FLX O;  1HNW K;  4DV5 K;  1HNX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...