3T1HK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 3t1hK00
4X62K 4DV6K 4DUZK 4DV4K 4KHPK 5AJ3K 4B3TK 4OX9K 4YY3K 4V19S 4LFAK 4X66K 2UU9K 1XMQK 4B3MK 4JI7K 4DV5K 4X65K 2VQFK 1N32K 3T1HK 1HNWK 4LF9K 5LL6Z 4LFBK 4LF6K 3J80O 4DR1K 4LF4K 4LF7K 4GKKK 4DR2K 4NXNK 4K0KK 2UUAK 4DR5K 4YHHK 4DV1K 1XMOK 4JI3K 1HR0K 2UUBK 2UUCK 5BR8K 4DR7K 3J7AP 5FLXO 3OTOK 4LF5K 4JV5K 1J5EK 4DR6K 4DV2K 4JI2K 3T1YK 1IBMK 4AQYK 2UXDK 2E5LK 2ZM6K 5LMUK 1N33K 4CW7B 4DR4K 4DV7K 5IWAK 4CVNE 2F4VK 5LMNK 1XNQK 1HNZK 4NXMK 4JI6K 1HNXK 1FJGK 2VQEK 4DR3K 4X64K 3J81O 5A2QO 1I94K 4B3SK 1IBLK 5IT9O 4LFCK 4JI0K 1XNRK 2UXCK 3JAMO 4JI1K 4JI5K 2HHHK 4DV3K 1IBKK 3J7YP 4GKJK 1N36K 4JYAK 4DV0K 2UXBK 1N34K 4B3RK 4DUYK 4JI8K 4JI4K 4LF8K
chains in the Genus database with same CATH superfamily
5T7BA 3AVGA 3KWIA 4DCHA 1SS6A 4Z4HA 3ZSZA 3OS1A 1CLQA 3RRHA 5AQTA 1X3MA 3FLCO 2IDOA 3KWGA 3KTQA 4N41A 4E7LA 4L8RB 1FKPA 1B9FA 2HHSA 4IKFA 1DKGD 1VQPN 4I9QA 1T44A 3RSEA 2BDPA 4KHYA 1SV5A 2O8EA 4YOVA 4AHSA 1GLLO 3QINA 4ILHA 4IWVA 4FK4A 3ISNC 4KKOA 4KH4A 4H03B 2P9UA 1BI4A 3HM9A 3VTHA 3PX0A 1HX1A 4FWMA 4K0KK 2E2PA 4AHTA 1NM1A 3ULEA 1TAUA 3HPOA 4C1NK 4DTRA 4YDUA 1SKRA 4Z4CA 4FJ9A 4BREA 1D5AA 1ASWA 3MMVA 3ENHA 2FXUA 3LDSA 2YCHA 3Q7CA 5AZJB 3OYCA 3V9XA 3HM8A 4WYBA 3CFOA 2OZSA 4CJFA 3SQ0A 2HHQA 3MEEA 2EHGA 1QQOA 5LMNK 2Z1JA 1JLCA 3H3OB 3AVAA 2Z1GA 5BRDA 3KD5E 1RBRA 1M1KO 3QNOA 1UOCA 3ZEUB 4OLBA 2HSTA 3P1GA 3V1RA 3PX4A 3N4PA 4FK2A 4FYDA 3HBTA 3N4QA 4C23A 3O80A 4JD2A 3C7NB 2VG7A 4ISGA 3SMSA 4YOUA 3WXIA 1CXQA 4DV3K 4H4OA 4BDZA 1QQMA 5FPDA 1LWEA 4LH4A 5B8HA 4CZKA 5KQ8A 3LALA 1HYZA 3U9DA 4KH5A 3CCLN 3DLLL 1VK0A 3MX5A 5CHIA 2ZGZA 4WFBL 3K9JA 3MX2A 4YY3K 4CGGA 4HHTA 4J2EA 4O44A 3NCIA 3ZLJA 1BHLA 3SQ2A 4BC3A 1RNHA 5CYMA 3VA3A 2VQFK 3A5OC 1N32K 3LP3A 2Y1IA 4K41A 3ITHA 1KQSM 3WNGA 2Q3SA 2V52B 3O1WA 4CJ5A 4CEAA 4HCBA 4GW6A 1D8YA 1YI2N 5LJVA 5J2MA 4PY5A 3CFRA 4O5FA 3ZT3A 1VQ7N 3B6PA 4E1JA 2BTFA 2BH1A 3FR0A 1YAGA 4B1UB 3C0BA 3D0PA 3AGKA 3PLAA 1HRHA 2GX9A 4QS7A 4DTSA 3I0SA 4KH6A 4DV2K 4JI2K 4FW2A 4YNQA 4BR9A 1QQCA 1HKGA 1NK5A 4FOEA 3A0IX 5KPRA 3E9OA 5E84A 4DV7K 1U45A 3OYIA 1A5WA 1MDUB 2HB5A 2NRZA 4DWIA 3OY9A 5AQPA 4FM0A 5TKWA 4LD0A 3I0RA 4B1ZA 2QWMA 4RWTA 1TL1A 4CJ3A 3ZT2A 3NF7A 5GAGP 4CZMA 4CFDA 3DI6A 5JVGL 5C2FA 2YV0X 4LC9B 4IG0A 5JMVA 3PY8A 3KJVA 4O8UA 2CH5A 4DF4A 3ZCMA 2OTJN 4CBWA 4BDPA 3KLHA 3PX6A 3NE6A 4E89A 1K9MO 4CJTA 4BC2A 4CHQA 5GIPA 4IFVA 4DV4K 1HLUA 1BCMA 2GELA 4NYFA 4DS4A 4OX9K 3TAMA 4FJNA 2KTQA 2A1SA 1CXUA 1KXPA 1LWCA 2W40A 3AA2A 2Z1IA 3H08A 4YOTA 4B9UA 3S3OA 4U67L 3IDHA 4EZ9A 4E7HA 2OPSA 4X65K 1Q18A 1RTJA 1U6ZA 2OTLN 2QEXN 4DLEA 2QW9A 4BROA 4BRCA 4DQRA 5GAEP 2X6SA 4K8XA 3J7ZO 4BRHA 4JRPA 1TL3A 3LWLA 4YHHK 2ZQBA 4HUEA 4BGBA 2FC0A 4BACA 2DFFA 1QZ5A 2O8FB 1KAZA 1DTQA 2GEMA 3AY9A 3WQUA 1GLBG 5FLXO 2YNGA 3OTOK 4MO5A 4I6MA 4JKEA 4J2DA 4FM2A 3PUFA 2A42A 1IJJA 2Z1HA 4I7FA 3E9PA 3WXJA 1HQUA 4DSFA 1XHZA 1LAVA 4CW7B 2I7NA 2CGLA 4NLCA 3CJ1A 4CGDA 5DMRA 1D4XA 3VEWA 1XNQK 2B6AA 4DFJA 3V1OA 2FF6A 3MCPA 1HNXK 4QAGA 3VF2A 2X78A 3F9MA 4B1VA 3OS0A 3C7NA 3RMCA 1F21A 4JD2B 5AQGA 3MN6A 4KI6A 3AVIA 3NF9A 4BRAA 2P51A 5CZ1A 3KVGA 3ZT4A 4ISEA 3IUCA 4CEBA 3QNNA 1RFQA 1QVFM 1GOBA 3G10A 3ZEUA 3CMAN 1A5VA 4CGHA 3VF6A 4DU1A 4E7IA 4WCEL 1N36K 3V1QA 2E2QA 4XIUA 2OANA 2ZGYA 1BCOA 1IKYA 4FJJA 3VEXA 3OYJA 3LP2A 3HSCA 4I9LA 4DTNA 1R59O 3NBPA 1WOQA 5AJ3K 2OCEA 3O4NA 4LH5A 5AZJA 5ADXA 3QEXA 4CI6A 4LFAK 4X66K 2F7TA 2QTDA 2QXLA 2P9NA 4B9MA 3HK2A 3EYZA 1S5JA 2A5XA 3VQPA 3SLCA 5AZIB 4KHWA 3O8MA 3VEOA 5DM7L 3WT0A 3LWMA 4CF0A 3OYGA 1K8KA 2FSJA 1BI4B 3QIPA 3KKRA 3VESA 3S3MA 1WSHA 3OBYA 4A62A 4H5VA 4IEEA 1VQ6N 3D2FB 4E3SA 4O55A 1SQKA 3QEIA 4Y1DA 4B8AB 3V9WA 1I3AA 5AQVA 4FJXA 4J2AA 2G8FA 1SL0A 4B3OA 4H5WA 4DQIA 4ILGB 4F3OA 4OO1J 3CXCM 4WQ5C 2V7ZA 3RMAA 3CCSN 2E5LK 1ITGA 4K43A 4CGJA 1FK9A 4IFEA 3CC2N 3OYAA 2OZMA 4CZGA 5IWAK 4BWJA 1RDAA 4GMJB 3VA0A 1NK8A 4FJIA 1GLCG 4FVUA 3NFAA 4AM7A 4DSLA 2O8DA 4FL9A 4KTZA 3DOKA 4LSLA 1IV0A 1EO1A 2A3ZA 3TTCA 1EQYA 3ID8A 4CZEA 1JL1A 3NH0A 4C8KA 1UWBA 3AO4A 1TK8A 4E7JA 1SZ2A 1L3SA 3AO2A 3ZT0A 1WAJA 4CJPA 4BRIA 3AVJA 5GIOA 4CZFA 4JI4K 4A57A 1C0FA 4IDHA 4FZXC 3OS2A 4M3XA 3HO1A 4DV6K 3PIPL 4H8KA 3EY1A 3VQ6A 5KTQA 2P9PB 4RW8A 3TSUA 1ZBIA 1Y64A 4FCYA 1X1PA 3ZETA 4CK2A 2HNZA 3WEEB 2G8HA 1L3TA 3P5JA 4QOZB 3PSIA 1VQON 4JHDA 1TK0A 4B3MK 3L8BA 1EP4A 2IVNA 1NJIO 1BISA 4O4GA 1YVNA 3NDKA 1HNWK 4FLZA 3VEZA 4CHOA 1T03A 2JWLA 5FRMA 3QESA 4YFUA 5CYQA 1JLAA 4Z4EA 1IO2A 4A61A 4DR1K 4CGIA 3LL3A 2FSNA 4JKGA 1LOTB 5H1SQ 5E26A 4DR5K 1S72N 1YF5L 2V51B 4O5BA 2PY5A 2G8UA 4U7BA 1RT6A 4YOWA 4CF8A 5HL7L 2NRWA 1KFDA 2XRIA 1C0TA 4FJGA 5KI6A 3CPEA 3AVLA 5DK5A 2ZWHA 4DHYA 1K6YA 3L3UA 3UKRA 1J5EK 1I39A 4KPYA 3K9KA 2D5RA 4FJLA 3FZHA 2ZJQL 5J1EA 3OYEA 5HLFA 3NGYA 5FROA 1UA0A 3P39A 2HVHA 1DEJA 4NYNA 1K8AO 1BDGA 3TAQA 3SBTA 2X74A 1IKXA 2JLEA 2QM1A 1HNZK 4CEEA 3F9KA 1KAXA 4JI6K 4CJWA 1Q86O 4FJ8A 1VSDA 3SJJA 4DSEA 2VQEK 4DR3K 2HNYA 1BL3A 2E6MA 3VQ9A 1JLEA 1NGHA 4CEQA 5M1NA 3SV3A 1YHQN 1IBLK 5IT9O 1U49A 3FZLA 1RTIA 1S1UA 4M3RA 4IFYA 1SL2A 2QKBA 3K59A 1GLAG 2OPQA 5C25A 5CE3A 3L2VA 3IS9A 1RT7A 2Q2RA 1KVBA 4QS8A 4ZTFA 4B9VA 3RMDA 3KK7A 3P31A 1C0UA 4A2AA 2P9IA 3K2PA 4GVEA 3V4IA 4Y0WA 4DUZK 3I8DA 4KHPK 1NBWA 4EFHA 3FZMA 3P4IA 2YKNA 3LM9A 4AHRA 3WQTA 4ID1A 3SI6A 1MU2A 1NLVA 3RR8A 1TGOA 4BY9C 3UKRB 2O8BA 4B9NA 4L3QA 1ATSA 4FWRA 4DV5K 3G25A 1UA1A 1WSJA 2I7PA 3L3VA 2YKMA 4H0YB 2NRRA 3ZSRA 3SZ2A 3G0ZA 3VF4A 2YX6A 1BWFO 2WC9A 3OHRA 3K57A 2AP1A 4RTFD 3SAFA 4OPJA 5BR9A 2QWPA 4JKAA 3CFPA 3ATVA 3O3HA 3U9ZA 2YI1A 4NXNK 3ZT1A 3LZJA 4OPAA 2JGUA 3H46O 4DV1K 3E9LA 4FLTA 2KZMA 5AQNA 2NUBA 2RE2A 4WQ5A 1EWRA 1HYSA 2D0AA 4KRFA 4BQLA 4BWMA 4CFBA 3E66A 3SPYA 5ADXH 4ZHRA 2QK9A 4LF5K 3A8YA 1NMDA 3DLBA 3WEEA 3T1YK 5AQOA 5C42A 4XEIA 3HVTA 3SBGA 2HBMA 4F8RA 4KHQA 1ASVA 1WUAA 1QZ6A 4HWIA 3AGRA 3AA3A 2YJEA 3B8AX 2Q0RA 3BF1A 4IDKA 3W3DA 3MEGA 1BIUA 2KHOA 1N6QA 4FWOA 5HRRA 4K25A 3QBWA 4MO4A 4CHYA 3QEWA 1S3XA 1NJXA 4CJ4A 3I55N 1O1WA 4F2SA 3CCJN 1HMVA 4XH4A 3ALYA 1VSKA 5AQYA 3A5MC 1NK0A 1RT5A 3S9HA 3R1XA 3F2KA 2WFBA 1NWKA 3L2RA 2A1RA 1U48A 4R79A 2ZF5O 4IZ9A 3J7YP 2F96A 4Z4GA 2ASMA 4C8OA 1IG8A 1LWFA 3HXMA 3NH1A 3KK1A 1BOTO 3DLEA 5FPNA 4AHVA 3ZX3A 4PQUA 4RW9A 4BR4A 4CK1A 1DGKN 4FSVA 4TSXA 1TUYA 3MEDA 4UY8O 1B9DA 3HRGA 3WXKA 1VQKN 4FJKA 3QFPA 1JCFA 4M41A 4HTUA 1JL2A 2YHBA 4M42A 1D9DA 3CCQN 2Q97A 1Z25A 3UKUB 4CBXA 2E2OA 4IO9L 3MWTA 1REVA 1XUPO 2W41A 1SKWA 3LDLA 1XQSC 5KGWA 1NGDA 4LF7K 5FRNA 3DRRA 3NF8A 2KQ2A 4IBNA 4RG8A 5M1FA 1JLBA 4PKHA 3FZFA 5ELZA 5SZTA 4XH1A 5I3UA 4DTPA 2CGJA 3NMUA 2P9NB 4W5NA 3SAGA 4AQYK 3NGIA 5AQSA 4WFNL 1BQNA 3SUQA 5BREA 4EHUA 1R0AA 1NK9A 2HNDA 3LPTA 3GG4A 4FLYA 4IOCL 2E88A 3O5BA 3PO4A 4FZYA 3NHGA 2YNHA 1OH7A 3WXMB 3ZSWA 3MN9A 2Q31A 2KW4A 2D0CA 1JXBA 2QA4N 1NGGA 3NVKA 2HHXA 1BUPA 2RHKA 1UAXA 5AFUH 1LAWA 4IJNA 3LDNA 1S6QA 1S1VA 1XNRK 1WAFA 1TKXA 3LDQA 3M1FA 3TPQA 4PL7A 1V4SA 5HRNA 3AAPA 1X9WA 4JKDA 1QQNA 5AQIA 3ZYYX 4CJVA 3L4QA 3JS6A 4JYAK 1KCFA 5J2QA 5FDLA 4JI8K 2XY7A 2DFEA 4LF8K 4X62K 3KLEA 3CHWA 3DLKA 4NLBA 4DSJA 3THWB 4CESA 4BRMA 2JWKA 1QHTA 4B1XB 4ICLA 1TVRA 4JEPA 3AVBA 2BANA 2GUPA 4I6MB 4WQ4A 1NJYA 4MFBA 2Y1JA 2GUIA 3KIOA 1G15A 4JI7K 3HTVA 4FM1A 4JKBA 1O13A 3T1HK 3MDQA 2F9TA 4E19A 3T3FA 5EY4A 2O8FA 3O1BA 2HHWA 4GY2B 3ZX0A 3AVHA 3VQ5A 1VSLA 4DG1A 5E41A 3TABA 4PWDA 3C6UA 2P1JA 3BZCA 5BRHA 3SQ1A 3TSPA 5KPZA 4CZHA 1L5UA 4BRQA 2VCPA 3L0QA 3DXKA 2FBYA 2PBDA 1J6ZA 4JHDB 3QEVA 3VQAA 3EE9A 2HMIA 3TSQA 4JAXA 2X6NA 3THVA 1EETA 1ZBUA 3SCXA 3F73A 3B6OA 4I2PA 3CQ8A 1N33K 1Q7YO 2P9PA 1RDDA 4H0OA 1Y97A 5AQUA 1HJRA 1NGBA 3CJ9A 3K0SA 4FPBA 1RBVA 1SUQA 4BRKA 3PO5A 3WNFA 3GDQA 2A41A 1RT1A 1GOAA 1HUXA 3WUHA 3THYA 5AFUA 1U2VA 3VN5A 4B9SA 3M5RA 4BRLA 2ATQA 4CIGA 3TAGA 4OKEA 2XY5A 1P90A 3T69A 1J5OA 2UXCK 3MAQA 5KQDA 3O4WA 1L3VA 3SAHA 1XC3A 1QVGM 3HP9A 1NGFA 3CMEN 1XWLA 4G1QA 2ETJA 2R7YA 4FWSA 4UQGA 3QB0A 1IKVA 3FZKA 2PYJA 3V9SA 2DY4A 2HOEA 5HOOA 1E4GT 4DU4A 3U6FA 3BGRA 4DSKA 3SJHA 4DFPA 4F9OA 2CGKA 3AVFA 3DRSA 5JLFA 3VQ8A 1YXQA 4EHTA 1ATNA 1ZC6A 3OYFA 3C65A 4Z4FA 4FWNA 4NCBA 3VETA 4IJAA 4IO8A 5AQLA 3FGUA 3EO3A 3D2FA 4NO7A 4A2BA 3R8EA 3CG7A 4IOAL 3ZSYA 3M3ZA 1WBDA 1IH7A 4FPAA 1JCEA 1C6VA 4N47A 2F9WA 4EZ6A 4N76A 4DR2K 4E1MA 2HVIA 1EX4A 3OYHA 2F8TA 2XO7A 4KFBA 4F3TA 2A40A 3D2EA 4N5SA 1KD1O 4CERA 1Q9XA 4CD3A 5BR8K 3HSTB 2E1ZA 2FBTA 3I56N 4CIFA 1VQ5N 3NF6A 4KB0A 2F8SA 3ZSOA 3EZ5A 3KHYA 3J7AP 4YORA 2V7YA 5K14A 1T7PA 1N8RO 4DF8A 1IBMK 5JS2A 4CEOA 1C1AA 4CEFA 5D3GA 2DTUA 3DM2A 1NNEA 3M8QA 4JK7A 1LCUA 2WUSA 4BR0A 2WTUA 1NJWA 1J54A 3MN5A 1RTHA 4CF1A 4MDBA 4O0JA 3F5TA 3EKSA 4FVMA 1NGCA 2QWQA 2OA8A 4W5OA 4H4MA 1VSIA 3M8RA 1QSYA 1SL1A 3CJCA 3K5MA 1NGAA 4FLUA 2D0PA 4YDUC 1Z6RA 2ZD1A 5HROA 3WNHA 1NGIA 4FW1A 4XH5A 4K8ZA 1RBUA 4PL8A 1VSMA 4JKFA 3CD6N 4JK9A 1RT3A 3DYAA 3HZ6A 2DPNA 2HBKA 3IRXA 3QICA 4LY7A 2QKKA 1VRUA 4CE9A 4GV3A 2UYTA 2HBJA 1OVYA 4AH9A 1EWQA 4V19S 4CGFA 3AO3A 2LSNA 2KFZA 1SKSA 1BGXT 1XMQK 2ASOA 1HNIA 2GBZA 3TAEA 2NZTA 3CERA 2KKZA 3D2EB 4LF9K 5EXWA 3ENOA 3PIOL 4FK0A 2VG6A 3J8AA 3FE1A 3D45A 3Q7BA 3CI5A 3FFKB 3CC7N 3CCUN 2EWSA 4LSNA 3IFRA 4CJUA 3C6HA 3A2FA 2FSKA 4AILC 1XMOK 2YHXA 3SYZA 3MXMA 2J4RA 3VQ4A 2VG5A 3VEVA 2UUBK 4KREA 5EOYA 3VQCA 3CM5A 3RSEB 2H3GX 3EE8A 5M1QA 2HHTA 3S3NA 2CH6A 4FLVA 5FPEA 4NB4A 1BA0A 1VSFA 2B5JA 3KKSA 4M45A 3CCRN 3QEPA 2PYLA 1QS4A 5AQHA 4CHZA 3CYMA 5CY4A 5AQQA 3OYDA 1MWKA 3ASMA 2ZM6K 3K58A 1XHXA 4I2QA 1W7AA 3RVCA 4OGCA 4BR5A 3G4SN 3C95A 4DR4K 1EKEA 3DAWA 4IEIA 3DLHA 1S9GA 1S1WA 4CECA 2KZZA 2IS3A 1S1XA 4NCGA 5CR4A 4BRPA 2YNIA 1W9HA 3LM2A 4PKGA 2E20A 3HOTA 4YOXA 1T6CA 3VQQA 3VERA 4HUFA 1ESVA 5JICA 1W97L 1U2VB 1WN7A 4BR7A 3CC4N 2NRTA 1ZYQA 3ATUA 2D4WA 3TR8A 5SWMA 3BEXA 1X9SA 2IGIA 1WB9A 1TV6A 1HKBA 3K5NA 2NLXA 1QSLA 4GKJK 3MN7A 4M3WA 4DV0K 3H1VX 5J2NA 4BGAA 4ELUA 3QFUA 5BPMA 3VEYA 3HOSA 3TAFA 1N5YA 4HTLA 5EX5A 4NCAA 4AF1A 3BUZB 3CCEN 3TANA 3QIOA 1NOYA 4B08A 5LL6Z 5J2PA 1OVQA 3H3NO 2RPIA 3HVRA 1FXXA 4C8LA 1KRPA 1ZBHA 4GVMA 3QETA 2WBNA 4YOYA 1QE1A 5F1XA 3DOLA 1TKZA 1YT3A 4CJ7A 4KTWA 4RCHA 5BN9A 3FFIA 4FJ5A 3BF3A 4BRDA 5FPMA 1J9AA 1RBTA 2UUCK 2GWKA 4CIEA 4CFCA 1HYVA 1NGEA 4BDYA 4GV6A 1GOCA 1FKOA 3RWUA 2FF3B 4DR6K 1S6PA 5M1PA 4HCCA 3U4LA 4H0TB 2HBLA 5LMUK 4JKHA 3VTIA 5M1KA 4H0PA 2B4JA 5GADP 1BIZA 1YTAA 1WSEA 3LPUA 4DQQA 3DRPA 3EZWA 1W0HA 4WE1A 3RRGA 4N56A 1KFSA 4EIAA 2XHBA 1VQ4N 4KI4A 4OJRA 1WSFA 3O9SA 3A5NC 5A2QO 2P9SA 3O6WA 4B3SK 1V4TA 3KLFA 1TYQB 2IIRA 2IVPA 3AV9A 4HUGA 2QI2A 1KVAA 3SV4A 4QS9A 1RILA 2PZSA 2P9KA 3E01A 4AHUA 3U3GA 4W5QA 4MLEA 1YVUA 3EKUA 4A5AA 3SK3A 3VENA 2IC3A 1S9EA 3OYNA 2BUPA 3OBWA 1JJ2M 1XC9A 4BQZA 3QMLA 3BZKA 1WNSA 1ZXOA 3SUNA 2NNWA 2VWBA 3O3GA 4PA1A 4FWQA 3UB5A 1M90O 2ITMA 4R5PA 5DM6L 4RW4A 3ULEB 1YIJN 4LF6K 1RGIA 5BN8A 3NGZA 2RF2A 3ZX2A 4GKKK 3ENBA 4DTXA 3OJSA 5F0XA 3MXJA 4OGEA 2P9UB 1VSEA 2UUAK 1RCHA 4W5RA 3AVMA 5JVHL 4EP4A 5AQJA 4M7XA 3AAQA 2VWKA 4FO0A 3O9UA 2O8EB 4CZLA 4DR7K 2IAJA 1ZBFA 2QWNA 2HMPA 3OYLA 4JNEA 3VMFB 4BRFA 3KLGA 4QCLA 5JLHA 1JKHA 3CPWM 3L2WA 4FLWA 1VSHA 2NRHA 1WLJA 1C0MA 4J2BA 2AA4A 4F2RA 4J8FA 1VSJA 4KB1A 4EAHD 4JS4A 3MWPA 3HT3A 4DKWA 3L2UA 3IG1A 1ZBSA 3PV8A 4M3YA 4Z0UA 1Q82O 1VHXA 2P9LA 1RBSA 2E6LA 4WFAL 3TI0A 3LANA 1NJZA 3A5LC 3NVMA 4GV9A 1VRTA 3G71N 1WSIA 3AA4A 3RR7A 1D9FA 5BPLA 3H45C 5C0YA 1KLNA 3K5LA 1DT9A 4LFCK 1GLJO 2HF3A 3VQBA 3THYB 5JS1A 2NRXA 4JS5A 1T3VA 4ISFA 5AQRA 3AA5X 2YHWA 2UXBK 3EN9A 1N34K 2OPPA 4BE2A 2HF4A 4FWPA 3MXIA 3KD1E 3NH2A 4KAZA 4B3TK 3EL2A 3QBXA 3JSMA 4KHNA 2FLOA 4KHUA 1T6DA 3HPGA 3VQ7A 3QDKA 4CK3A 5I42A 2RN2A 3OJUA 1HNVA 2XY8A 2UU9K 4CEDA 4DTOA 1HPMA 3DXKB 5AQMA 3RMBA 3KLIA 3LAMA 4M3TA 2HHVA 4FJHA 4CJSA 4G9ZA 4BG8A 3LDOA 3THXB 4DFMA 4CJLA 5EVZA 4LFBK 1E3MA 4M63C 4FZZA 1ZBLA 3CM6A 1KAYA 4CZJA 4DLGA 1LW2A 4MQ3A 4FJ7A 4H0VB 5AQKA 1U04A 3T7ZA 3O9TA 3UE5A 4CF2A 3SMPA 1HR0K 2RKIA 1RDBA 3C6AA 1NKBA 1A5XA 5HRSA 1JCGA 4MLHA 1W2BM 3E1YA 4C8NA 3C94A 1Q81O 4KTQA 1BO5O 3CJAA 1OKJA 4BVPA 3V81A 3PSFA 1IG9A 3H1QA 4O8KA 3S41A 1Q9YA 4CEZA 1SAZA 4CZIA 2D0BA 4CJRA 3THWA 4OPHA 4C8MA 1ATRA 3LP0A 3JXUA 3CCMN 1MA9B 4PKIA 3VQEA 3CCVN 1GLDG 1NK4A 1LV5A 3M8SA 1HJOA 5I9EB 3D7EO 4JRQA 1YTUA 3V9ZA 4DS5A 2EX3A 5HP1A 1C1CA 3L2QA 3CQYA 3HP6A 4X64K 4BR2A 3V6DA 3HPHA 1I94K 3K5OA 1WBBA 4HVJA 1KTQA 2VGMA 3VQDA 3W0LA 3WNEA 3DMJA 4BE1A 4E0DA 1JXEA 5GINA 3JAMO 2Q1NA 3OA9A 4JI1K 2W6KA 4B9TA 1RT2A 2HHHK 4Z4IA 2WOMA 3TAPA 2A6AA 4CFAA 3DLGA 3QERA 3L6QA 3KK2A 1T8EA 3O9QA 2YHAA 3NAEA 2OPRA 2E2NA 1HQEA 2QXFA 2O8CB 4AHCA 3HL8A 3DLRA 5HRPA 4DB3A 3DJCA 1U47A 5F2RA 2HHUA 2ZJRL 4H0XB 1OH5A 3LDPA 2E4LA 3AO1A 4JKGB 2ZJPL 1NKEA 2QWOA 3VOVA 4CJEA 5BRFA 4OPKA 3AARA 1OH6A 3SPZA 3VGLA 1GLFO 5TKYA 1QTMA 4H5RA 3SNNA 2BE2A 3THXA 3TTDA 1YJWN 3MK6A 4M3ZA 1S1TA 3ZSVA 3UKUA 1X3NA 3V9UA 2ASPA 5AR0A 1K73O 3CJ7A 1WSGA 3HI0A 3CQXA 3D6RA 3EEQA 1X9JA 1Z05A 4OKJA 3T1AA 3LAKA 2ITGA 3ZETB 3DWLA 3R9PA 1RTDA 4M3UA 1L3UA 2D0OA 3O9RA 2G8IA 1VAZA 1U4BA 2IVOA 3I8BA 5C10A 2VYPA 2I5JA 3IAYA 3OYMA 3OW2M 4BG9A 1QHAA 3DXMA 3I33A 4B9QA 3VGMA 4CD1A 4Q5VA 1TUUA 2W42A 4DQPA 3ZSQA 3AO5A 3CETA 3ZSXA 4WF9L 4JI0K 4ELTA 3C6TA 4EP5A 3LP1A 3TTFA 4E1NA 4B9LA 3KZBA 3DXMB 4DQSA 4IXCA 4KBOA 1YITN 2P9LB 2FBVA 2O8DB 1G99A 2VGNA 4RW6A 4FLXA 2BGGA 4B3RK 4CCHA 3HJFA 4CJQA 4PUOA 2FBXA 4PHTX 3O4QA 1X9MA 3M8PA 1NK6A 2Q36A 2O4IA 1BQMA 1HKCA 3MCAB 3BDPA 1S22A 1NG9A 1YJNN 5C2DA 3O08A 4A59A 4WQ4C 5HBMA 1KVCA 5KRTA 1NK7A 4IOXA 4CHPA 1RDWX 4C1NI 4W5TA 3KK3A 1K8KB 3GE1A 4LF4K 1XI1A 2DFHA 3U8XA 3R3LA 4BC5A 1BU6O 4B1WB 3VGKA 1T05A 2PAVA 5AZIA 1KSPA 2NRVA 4FXDA 3ULDA 4H5NA 3O3FA 3OYBA 1KLMA 4K42A 1NOZA 1RDCA 5MLCQ 3BP8A 4JV5K 2O8BB 4F4KA 2G8KA 2O8CA 1P8ZA 2GV9A 3CJBA 4JKCA 4DTMA 2KFNA 2AJQA 3LZIA 1EXQA 1CZBA 2Q0UA 2G8WA 3TARA 2YHYA 3TU5A 4FWLA 3CIPA 3SQ4A 1JLGA 4Y1CA 3BY5A 5C24A 4BC4A 2P9KB 3WXLA 2P9IB 5LJWA 4NXMK 4DMNA 1C0GA 4KHSA 4CJKA 3HYFA 3GOIA 3UIQA 1FJGK 2QWLA 4BVOA 3MECA 1RT4A 4DQ8A 1H1VA 1VQNN 2IOCA 1TKTA 1VQ9N 1TYQA 3TWHA 1ASUA 5CZ2A 2P9SB 4DFKA 4GNIA 1TAQA 1MWMA 5KPTA 4JN4A 4JI5K 4CHNA 3GBTA 1CZAN 1TK5A 4IG3A 1VQMN 5AQFA 1J53A 4KV8A 2W6LA 1KC8O 4B1YB 1TKDA 1E4FT 4KO0A 4M7YA 3RTVA 2WONA 2KLAA 5LY3A 1C1BA 4FOIA 5KGXA 3IMXA 4ILJA 4DU3A 4BRGA 5BPNA 4BE0A 2QWRA 4JK8A 1JLQA 3SUPA 2HW3A 1BG3A 2YJFA 3GL1A 3G6EN 4DSIA 4Q0BA 2YNFA 4CF9A 3OYKA 1ILYA 4OVLA 3P83D 1QSSA 3CF5L 4FWKA 5M1OA 3J80O 5GAHP 1FW6A 5AQWA 4Z94A 3U3YA 2GWJA 3M6GA 2P5GA 1NU0A 2VWJA 4MDAA 4AM6A 4JI3K 2P5OA 1NGJA 4O0IA 5AQXA 4OLAA 1VQ8N 1Q8IA 1NMNA 3QO9A 1YJ9N 1GLEG 3SUOA 2OYQA 4RW7A 1Z26A 3P38A 5EU7A 5C15A 1IKWA 4ELVA 4B8CA 3QLHA 2UXDK 4BRNA 2GTDA 4A5BA 4JLHA 3AVKA 1NKCA 2PFUA 4CVNE 3AVCA 1CZ9A 3T19A 2F4VK 1JLFA 3JYTA 4OKKA 4E7KA 2XY6A 3R6MA 1HPZA 1RDUA 1VQLN 2ZE2A 2E8AA 1OH8A 3H6EA 5KRSA 2G8VA 3L4IA 5AQZA 2E1YA 3J81O 3OVNA 4ZTJA 1DLOA 4FJMA 3IKMA 3AVNA 5C12A 1YUWA 4ID5A 3VPZA 1LW0A 2O4GA 4H5TA 1IBKK 2D1KA 4DTJA 1B92A 4DTUA 1DTTA 4CBUA 4DUYK 3ID6A 1BA1A
chains in the Genus database with same CATH topology
4X62K 4DV6K 4DUZK 4DV4K 4KHPK 5AJ3K 4B3TK 4OX9K 4YY3K 4V19S 4LFAK 4X66K 2UU9K 1XMQK 4B3MK 4JI7K 4DV5K 4X65K 2VQFK 1N32K 3T1HK 1HNWK 4LF9K 5LL6Z 4LFBK 4LF6K 3J80O 4DR1K 4LF4K 4LF7K 4GKKK 4DR2K 4NXNK 4K0KK 2UUAK 4DR5K 4YHHK 4DV1K 1XMOK 4JI3K 1HR0K 2UUBK 2UUCK 5BR8K 4DR7K 3J7AP 5FLXO 3OTOK 4LF5K 4JV5K 1J5EK 4DR6K 4DV2K 4JI2K 3T1YK 1IBMK 4AQYK 2UXDK 2E5LK 2ZM6K 5LMUK 1N33K 4CW7B 4DR4K 4DV7K 5IWAK 4CVNE 2F4VK 5LMNK 1XNQK 1HNZK 4NXMK 4JI6K 1HNXK 1FJGK 2VQEK 4DR3K 4X64K 3J81O 5A2QO 1I94K 4B3SK 1IBLK 5IT9O 4LFCK 4JI0K 1XNRK 2UXCK 3JAMO 4JI1K 4JI5K 2HHHK 4DV3K 1IBKK 3J7YP 4GKJK 1N36K 4JYAK 4DV0K 2UXBK 1N34K 4B3RK 4DUYK 4JI8K 4JI4K 4LF8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 K;  4DV6 K;  4DUZ K;  4DV4 K;  4KHP K;  5AJ3 K;  4B3T K;  4OX9 K;  4YY3 K;  4V19 S;  4LFA K;  4X66 K;  2UU9 K;  1XMQ K;  4B3M K;  4JI7 K;  4DV5 K;  4X65 K;  2VQF K;  1N32 K;  3T1H K;  1HNW K;  4LF9 K;  5LL6 Z;  4LFB K;  4LF6 K;  3J80 O;  4DR1 K;  4LF4 K;  4LF7 K;  4GKK K;  4DR2 K;  4NXN K;  4K0K K;  2UUA K;  4DR5 K;  4YHH K;  4DV1 K;  1XMO K;  4JI3 K;  1HR0 K;  2UUB K;  2UUC K;  5BR8 K;  4DR7 K;  3J7A P;  5FLX O;  3OTO K;  4LF5 K;  4JV5 K;  1J5E K;  4DR6 K;  4DV2 K;  4JI2 K;  3T1Y K;  1IBM K;  4AQY K;  2UXD K;  2E5L K;  2ZM6 K;  5LMU K;  1N33 K;  4CW7 B;  4DR4 K;  4DV7 K;  5IWA K;  4CVN E;  2F4V K;  5LMN K;  1XNQ K;  1HNZ K;  4NXM K;  4JI6 K;  1HNX K;  1FJG K;  2VQE K;  4DR3 K;  4X64 K;  3J81 O;  5A2Q O;  1I94 K;  4B3S K;  1IBL K;  5IT9 O;  4LFC K;  4JI0 K;  1XNR K;  2UXC K;  3JAM O;  4JI1 K;  4JI5 K;  2HHH K;  4DV3 K;  1IBK K;  3J7Y P;  4GKJ K;  1N36 K;  4JYA K;  4DV0 K;  2UXB K;  1N34 K;  4B3R K;  4DUY K;  4JI8 K;  4JI4 K;  4LF8 K; 
#chains in the Genus database with same CATH topology
 5T7B A;  3AVG A;  3KWI A;  4DCH A;  1SS6 A;  4Z4H A;  3ZSZ A;  3OS1 A;  1CLQ A;  3RRH A;  5AQT A;  1X3M A;  3FLC O;  2IDO A;  3KWG A;  3KTQ A;  4N41 A;  4E7L A;  4L8R B;  1FKP A;  1B9F A;  2HHS A;  4IKF A;  1DKG D;  1VQP N;  4I9Q A;  1T44 A;  3RSE A;  2BDP A;  4KHY A;  1SV5 A;  2O8E A;  4YOV A;  4AHS A;  1GLL O;  3QIN A;  4ILH A;  4IWV A;  4FK4 A;  3ISN C;  4KKO A;  4KH4 A;  4H03 B;  2P9U A;  1BI4 A;  3HM9 A;  3VTH A;  3PX0 A;  1HX1 A;  4FWM A;  4K0K K;  2E2P A;  4AHT A;  1NM1 A;  3ULE A;  1TAU A;  3HPO A;  4C1N K;  4DTR A;  4YDU A;  1SKR A;  4Z4C A;  4FJ9 A;  4BRE A;  1D5A A;  1ASW A;  3MMV A;  3ENH A;  2FXU A;  3LDS A;  2YCH A;  3Q7C A;  5AZJ B;  3OYC A;  3V9X A;  3HM8 A;  4WYB A;  3CFO A;  2OZS A;  4CJF A;  3SQ0 A;  2HHQ A;  3MEE A;  2EHG A;  1QQO A;  5LMN K;  2Z1J A;  1JLC A;  3H3O B;  3AVA A;  2Z1G A;  5BRD A;  3KD5 E;  1RBR A;  1M1K O;  3QNO A;  1UOC A;  3ZEU B;  4OLB A;  2HST A;  3P1G A;  3V1R A;  3PX4 A;  3N4P A;  4FK2 A;  4FYD A;  3HBT A;  3N4Q A;  4C23 A;  3O80 A;  4JD2 A;  3C7N B;  2VG7 A;  4ISG A;  3SMS A;  4YOU A;  3WXI A;  1CXQ A;  4DV3 K;  4H4O A;  4BDZ A;  1QQM A;  5FPD A;  1LWE A;  4LH4 A;  5B8H A;  4CZK A;  5KQ8 A;  3LAL A;  1HYZ A;  3U9D A;  4KH5 A;  3CCL N;  3DLL L;  1VK0 A;  3MX5 A;  5CHI A;  2ZGZ A;  4WFB L;  3K9J A;  3MX2 A;  4YY3 K;  4CGG A;  4HHT A;  4J2E A;  4O44 A;  3NCI A;  3ZLJ A;  1BHL A;  3SQ2 A;  4BC3 A;  1RNH A;  5CYM A;  3VA3 A;  2VQF K;  3A5O C;  1N32 K;  3LP3 A;  2Y1I A;  4K41 A;  3ITH A;  1KQS M;  3WNG A;  2Q3S A;  2V52 B;  3O1W A;  4CJ5 A;  4CEA A;  4HCB A;  4GW6 A;  1D8Y A;  1YI2 N;  5LJV A;  5J2M A;  4PY5 A;  3CFR A;  4O5F A;  3ZT3 A;  1VQ7 N;  3B6P A;  4E1J A;  2BTF A;  2BH1 A;  3FR0 A;  1YAG A;  4B1U B;  3C0B A;  3D0P A;  3AGK A;  3PLA A;  1HRH A;  2GX9 A;  4QS7 A;  4DTS A;  3I0S A;  4KH6 A;  4DV2 K;  4JI2 K;  4FW2 A;  4YNQ A;  4BR9 A;  1QQC A;  1HKG A;  1NK5 A;  4FOE A;  3A0I X;  5KPR A;  3E9O A;  5E84 A;  4DV7 K;  1U45 A;  3OYI A;  1A5W A;  1MDU B;  2HB5 A;  2NRZ A;  4DWI A;  3OY9 A;  5AQP A;  4FM0 A;  5TKW A;  4LD0 A;  3I0R A;  4B1Z A;  2QWM A;  4RWT A;  1TL1 A;  4CJ3 A;  3ZT2 A;  3NF7 A;  5GAG P;  4CZM A;  4CFD A;  3DI6 A;  5JVG L;  5C2F A;  2YV0 X;  4LC9 B;  4IG0 A;  5JMV A;  3PY8 A;  3KJV A;  4O8U A;  2CH5 A;  4DF4 A;  3ZCM A;  2OTJ N;  4CBW A;  4BDP A;  3KLH A;  3PX6 A;  3NE6 A;  4E89 A;  1K9M O;  4CJT A;  4BC2 A;  4CHQ A;  5GIP A;  4IFV A;  4DV4 K;  1HLU A;  1BCM A;  2GEL A;  4NYF A;  4DS4 A;  4OX9 K;  3TAM A;  4FJN A;  2KTQ A;  2A1S A;  1CXU A;  1KXP A;  1LWC A;  2W40 A;  3AA2 A;  2Z1I A;  3H08 A;  4YOT A;  4B9U A;  3S3O A;  4U67 L;  3IDH A;  4EZ9 A;  4E7H A;  2OPS A;  4X65 K;  1Q18 A;  1RTJ A;  1U6Z A;  2OTL N;  2QEX N;  4DLE A;  2QW9 A;  4BRO A;  4BRC A;  4DQR A;  5GAE P;  2X6S A;  4K8X A;  3J7Z O;  4BRH A;  4JRP A;  1TL3 A;  3LWL A;  4YHH K;  2ZQB A;  4HUE A;  4BGB A;  2FC0 A;  4BAC A;  2DFF A;  1QZ5 A;  2O8F B;  1KAZ A;  1DTQ A;  2GEM A;  3AY9 A;  3WQU A;  1GLB G;  5FLX O;  2YNG A;  3OTO K;  4MO5 A;  4I6M A;  4JKE A;  4J2D A;  4FM2 A;  3PUF A;  2A42 A;  1IJJ A;  2Z1H A;  4I7F A;  3E9P A;  3WXJ A;  1HQU A;  4DSF A;  1XHZ A;  1LAV A;  4CW7 B;  2I7N A;  2CGL A;  4NLC A;  3CJ1 A;  4CGD A;  5DMR A;  1D4X A;  3VEW A;  1XNQ K;  2B6A A;  4DFJ A;  3V1O A;  2FF6 A;  3MCP A;  1HNX K;  4QAG A;  3VF2 A;  2X78 A;  3F9M A;  4B1V A;  3OS0 A;  3C7N A;  3RMC A;  1F21 A;  4JD2 B;  5AQG A;  3MN6 A;  4KI6 A;  3AVI A;  3NF9 A;  4BRA A;  2P51 A;  5CZ1 A;  3KVG A;  3ZT4 A;  4ISE A;  3IUC A;  4CEB A;  3QNN A;  1RFQ A;  1QVF M;  1GOB A;  3G10 A;  3ZEU A;  3CMA N;  1A5V A;  4CGH A;  3VF6 A;  4DU1 A;  4E7I A;  4WCE L;  1N36 K;  3V1Q A;  2E2Q A;  4XIU A;  2OAN A;  2ZGY A;  1BCO A;  1IKY A;  4FJJ A;  3VEX A;  3OYJ A;  3LP2 A;  3HSC A;  4I9L A;  4DTN A;  1R59 O;  3NBP A;  1WOQ A;  5AJ3 K;  2OCE A;  3O4N A;  4LH5 A;  5AZJ A;  5ADX A;  3QEX A;  4CI6 A;  4LFA K;  4X66 K;  2F7T A;  2QTD A;  2QXL A;  2P9N A;  4B9M A;  3HK2 A;  3EYZ A;  1S5J A;  2A5X A;  3VQP A;  3SLC A;  5AZI B;  4KHW A;  3O8M A;  3VEO A;  5DM7 L;  3WT0 A;  3LWM A;  4CF0 A;  3OYG A;  1K8K A;  2FSJ A;  1BI4 B;  3QIP A;  3KKR A;  3VES A;  3S3M A;  1WSH A;  3OBY A;  4A62 A;  4H5V A;  4IEE A;  1VQ6 N;  3D2F B;  4E3S A;  4O55 A;  1SQK A;  3QEI A;  4Y1D A;  4B8A B;  3V9W A;  1I3A A;  5AQV A;  4FJX A;  4J2A A;  2G8F A;  1SL0 A;  4B3O A;  4H5W A;  4DQI A;  4ILG B;  4F3O A;  4OO1 J;  3CXC M;  4WQ5 C;  2V7Z A;  3RMA A;  3CCS N;  2E5L K;  1ITG A;  4K43 A;  4CGJ A;  1FK9 A;  4IFE A;  3CC2 N;  3OYA A;  2OZM A;  4CZG A;  5IWA K;  4BWJ A;  1RDA A;  4GMJ B;  3VA0 A;  1NK8 A;  4FJI A;  1GLC G;  4FVU A;  3NFA A;  4AM7 A;  4DSL A;  2O8D A;  4FL9 A;  4KTZ A;  3DOK A;  4LSL A;  1IV0 A;  1EO1 A;  2A3Z A;  3TTC A;  1EQY A;  3ID8 A;  4CZE A;  1JL1 A;  3NH0 A;  4C8K A;  1UWB A;  3AO4 A;  1TK8 A;  4E7J A;  1SZ2 A;  1L3S A;  3AO2 A;  3ZT0 A;  1WAJ A;  4CJP A;  4BRI A;  3AVJ A;  5GIO A;  4CZF A;  4JI4 K;  4A57 A;  1C0F A;  4IDH A;  4FZX C;  3OS2 A;  4M3X A;  3HO1 A;  4DV6 K;  3PIP L;  4H8K A;  3EY1 A;  3VQ6 A;  5KTQ A;  2P9P B;  4RW8 A;  3TSU A;  1ZBI A;  1Y64 A;  4FCY A;  1X1P A;  3ZET A;  4CK2 A;  2HNZ A;  3WEE B;  2G8H A;  1L3T A;  3P5J A;  4QOZ B;  3PSI A;  1VQO N;  4JHD A;  1TK0 A;  4B3M K;  3L8B A;  1EP4 A;  2IVN A;  1NJI O;  1BIS A;  4O4G A;  1YVN A;  3NDK A;  1HNW K;  4FLZ A;  3VEZ A;  4CHO A;  1T03 A;  2JWL A;  5FRM A;  3QES A;  4YFU A;  5CYQ A;  1JLA A;  4Z4E A;  1IO2 A;  4A61 A;  4DR1 K;  4CGI A;  3LL3 A;  2FSN A;  4JKG A;  1LOT B;  5H1S Q;  5E26 A;  4DR5 K;  1S72 N;  1YF5 L;  2V51 B;  4O5B A;  2PY5 A;  2G8U A;  4U7B A;  1RT6 A;  4YOW A;  4CF8 A;  5HL7 L;  2NRW A;  1KFD A;  2XRI A;  1C0T A;  4FJG A;  5KI6 A;  3CPE A;  3AVL A;  5DK5 A;  2ZWH A;  4DHY A;  1K6Y A;  3L3U A;  3UKR A;  1J5E K;  1I39 A;  4KPY A;  3K9K A;  2D5R A;  4FJL A;  3FZH A;  2ZJQ L;  5J1E A;  3OYE A;  5HLF A;  3NGY A;  5FRO A;  1UA0 A;  3P39 A;  2HVH A;  1DEJ A;  4NYN A;  1K8A O;  1BDG A;  3TAQ A;  3SBT A;  2X74 A;  1IKX A;  2JLE A;  2QM1 A;  1HNZ K;  4CEE A;  3F9K A;  1KAX A;  4JI6 K;  4CJW A;  1Q86 O;  4FJ8 A;  1VSD A;  3SJJ A;  4DSE A;  2VQE K;  4DR3 K;  2HNY A;  1BL3 A;  2E6M A;  3VQ9 A;  1JLE A;  1NGH A;  4CEQ A;  5M1N A;  3SV3 A;  1YHQ N;  1IBL K;  5IT9 O;  1U49 A;  3FZL A;  1RTI A;  1S1U A;  4M3R A;  4IFY A;  1SL2 A;  2QKB A;  3K59 A;  1GLA G;  2OPQ A;  5C25 A;  5CE3 A;  3L2V A;  3IS9 A;  1RT7 A;  2Q2R A;  1KVB A;  4QS8 A;  4ZTF A;  4B9V A;  3RMD A;  3KK7 A;  3P31 A;  1C0U A;  4A2A A;  2P9I A;  3K2P A;  4GVE A;  3V4I A;  4Y0W A;  4DUZ K;  3I8D A;  4KHP K;  1NBW A;  4EFH A;  3FZM A;  3P4I A;  2YKN A;  3LM9 A;  4AHR A;  3WQT A;  4ID1 A;  3SI6 A;  1MU2 A;  1NLV A;  3RR8 A;  1TGO A;  4BY9 C;  3UKR B;  2O8B A;  4B9N A;  4L3Q A;  1ATS A;  4FWR A;  4DV5 K;  3G25 A;  1UA1 A;  1WSJ A;  2I7P A;  3L3V A;  2YKM A;  4H0Y B;  2NRR A;  3ZSR A;  3SZ2 A;  3G0Z A;  3VF4 A;  2YX6 A;  1BWF O;  2WC9 A;  3OHR A;  3K57 A;  2AP1 A;  4RTF D;  3SAF A;  4OPJ A;  5BR9 A;  2QWP A;  4JKA A;  3CFP A;  3ATV A;  3O3H A;  3U9Z A;  2YI1 A;  4NXN K;  3ZT1 A;  3LZJ A;  4OPA A;  2JGU A;  3H46 O;  4DV1 K;  3E9L A;  4FLT A;  2KZM A;  5AQN A;  2NUB A;  2RE2 A;  4WQ5 A;  1EWR A;  1HYS A;  2D0A A;  4KRF A;  4BQL A;  4BWM A;  4CFB A;  3E66 A;  3SPY A;  5ADX H;  4ZHR A;  2QK9 A;  4LF5 K;  3A8Y A;  1NMD A;  3DLB A;  3WEE A;  3T1Y K;  5AQO A;  5C42 A;  4XEI A;  3HVT A;  3SBG A;  2HBM A;  4F8R A;  4KHQ A;  1ASV A;  1WUA A;  1QZ6 A;  4HWI A;  3AGR A;  3AA3 A;  2YJE A;  3B8A X;  2Q0R A;  3BF1 A;  4IDK A;  3W3D A;  3MEG A;  1BIU A;  2KHO A;  1N6Q A;  4FWO A;  5HRR A;  4K25 A;  3QBW A;  4MO4 A;  4CHY A;  3QEW A;  1S3X A;  1NJX A;  4CJ4 A;  3I55 N;  1O1W A;  4F2S A;  3CCJ N;  1HMV A;  4XH4 A;  3ALY A;  1VSK A;  5AQY A;  3A5M C;  1NK0 A;  1RT5 A;  3S9H A;  3R1X A;  3F2K A;  2WFB A;  1NWK A;  3L2R A;  2A1R A;  1U48 A;  4R79 A;  2ZF5 O;  4IZ9 A;  3J7Y P;  2F96 A;  4Z4G A;  2ASM A;  4C8O A;  1IG8 A;  1LWF A;  3HXM A;  3NH1 A;  3KK1 A;  1BOT O;  3DLE A;  5FPN A;  4AHV A;  3ZX3 A;  4PQU A;  4RW9 A;  4BR4 A;  4CK1 A;  1DGK N;  4FSV A;  4TSX A;  1TUY A;  3MED A;  4UY8 O;  1B9D A;  3HRG A;  3WXK A;  1VQK N;  4FJK A;  3QFP A;  1JCF A;  4M41 A;  4HTU A;  1JL2 A;  2YHB A;  4M42 A;  1D9D A;  3CCQ N;  2Q97 A;  1Z25 A;  3UKU B;  4CBX A;  2E2O A;  4IO9 L;  3MWT A;  1REV A;  1XUP O;  2W41 A;  1SKW A;  3LDL A;  1XQS C;  5KGW A;  1NGD A;  4LF7 K;  5FRN A;  3DRR A;  3NF8 A;  2KQ2 A;  4IBN A;  4RG8 A;  5M1F A;  1JLB A;  4PKH A;  3FZF A;  5ELZ A;  5SZT A;  4XH1 A;  5I3U A;  4DTP A;  2CGJ A;  3NMU A;  2P9N B;  4W5N A;  3SAG A;  4AQY K;  3NGI A;  5AQS A;  4WFN L;  1BQN A;  3SUQ A;  5BRE A;  4EHU A;  1R0A A;  1NK9 A;  2HND A;  3LPT A;  3GG4 A;  4FLY A;  4IOC L;  2E88 A;  3O5B A;  3PO4 A;  4FZY A;  3NHG A;  2YNH A;  1OH7 A;  3WXM B;  3ZSW A;  3MN9 A;  2Q31 A;  2KW4 A;  2D0C A;  1JXB A;  2QA4 N;  1NGG A;  3NVK A;  2HHX A;  1BUP A;  2RHK A;  1UAX A;  5AFU H;  1LAW A;  4IJN A;  3LDN A;  1S6Q A;  1S1V A;  1XNR K;  1WAF A;  1TKX A;  3LDQ A;  3M1F A;  3TPQ A;  4PL7 A;  1V4S A;  5HRN A;  3AAP A;  1X9W A;  4JKD A;  1QQN A;  5AQI A;  3ZYY X;  4CJV A;  3L4Q A;  3JS6 A;  4JYA K;  1KCF A;  5J2Q A;  5FDL A;  4JI8 K;  2XY7 A;  2DFE A;  4LF8 K;  4X62 K;  3KLE A;  3CHW A;  3DLK A;  4NLB A;  4DSJ A;  3THW B;  4CES A;  4BRM A;  2JWK A;  1QHT A;  4B1X B;  4ICL A;  1TVR A;  4JEP A;  3AVB A;  2BAN A;  2GUP A;  4I6M B;  4WQ4 A;  1NJY A;  4MFB A;  2Y1J A;  2GUI A;  3KIO A;  1G15 A;  4JI7 K;  3HTV A;  4FM1 A;  4JKB A;  1O13 A;  3T1H K;  3MDQ A;  2F9T A;  4E19 A;  3T3F A;  5EY4 A;  2O8F A;  3O1B A;  2HHW A;  4GY2 B;  3ZX0 A;  3AVH A;  3VQ5 A;  1VSL A;  4DG1 A;  5E41 A;  3TAB A;  4PWD A;  3C6U A;  2P1J A;  3BZC A;  5BRH A;  3SQ1 A;  3TSP A;  5KPZ A;  4CZH A;  1L5U A;  4BRQ A;  2VCP A;  3L0Q A;  3DXK A;  2FBY A;  2PBD A;  1J6Z A;  4JHD B;  3QEV A;  3VQA A;  3EE9 A;  2HMI A;  3TSQ A;  4JAX A;  2X6N A;  3THV A;  1EET A;  1ZBU A;  3SCX A;  3F73 A;  3B6O A;  4I2P A;  3CQ8 A;  1N33 K;  1Q7Y O;  2P9P A;  1RDD A;  4H0O A;  1Y97 A;  5AQU A;  1HJR A;  1NGB A;  3CJ9 A;  3K0S A;  4FPB A;  1RBV A;  1SUQ A;  4BRK A;  3PO5 A;  3WNF A;  3GDQ A;  2A41 A;  1RT1 A;  1GOA A;  1HUX A;  3WUH A;  3THY A;  5AFU A;  1U2V A;  3VN5 A;  4B9S A;  3M5R A;  4BRL A;  2ATQ A;  4CIG A;  3TAG A;  4OKE A;  2XY5 A;  1P90 A;  3T69 A;  1J5O A;  2UXC K;  3MAQ A;  5KQD A;  3O4W A;  1L3V A;  3SAH A;  1XC3 A;  1QVG M;  3HP9 A;  1NGF A;  3CME N;  1XWL A;  4G1Q A;  2ETJ A;  2R7Y A;  4FWS A;  4UQG A;  3QB0 A;  1IKV A;  3FZK A;  2PYJ A;  3V9S A;  2DY4 A;  2HOE A;  5HOO A;  1E4G T;  4DU4 A;  3U6F A;  3BGR A;  4DSK A;  3SJH A;  4DFP A;  4F9O A;  2CGK A;  3AVF A;  3DRS A;  5JLF A;  3VQ8 A;  1YXQ A;  4EHT A;  1ATN A;  1ZC6 A;  3OYF A;  3C65 A;  4Z4F A;  4FWN A;  4NCB A;  3VET A;  4IJA A;  4IO8 A;  5AQL A;  3FGU A;  3EO3 A;  3D2F A;  4NO7 A;  4A2B A;  3R8E A;  3CG7 A;  4IOA L;  3ZSY A;  3M3Z A;  1WBD A;  1IH7 A;  4FPA A;  1JCE A;  1C6V A;  4N47 A;  2F9W A;  4EZ6 A;  4N76 A;  4DR2 K;  4E1M A;  2HVI A;  1EX4 A;  3OYH A;  2F8T A;  2XO7 A;  4KFB A;  4F3T A;  2A40 A;  3D2E A;  4N5S A;  1KD1 O;  4CER A;  1Q9X A;  4CD3 A;  5BR8 K;  3HST B;  2E1Z A;  2FBT A;  3I56 N;  4CIF A;  1VQ5 N;  3NF6 A;  4KB0 A;  2F8S A;  3ZSO A;  3EZ5 A;  3KHY A;  3J7A P;  4YOR A;  2V7Y A;  5K14 A;  1T7P A;  1N8R O;  4DF8 A;  1IBM K;  5JS2 A;  4CEO A;  1C1A A;  4CEF A;  5D3G A;  2DTU A;  3DM2 A;  1NNE A;  3M8Q A;  4JK7 A;  1LCU A;  2WUS A;  4BR0 A;  2WTU A;  1NJW A;  1J54 A;  3MN5 A;  1RTH A;  4CF1 A;  4MDB A;  4O0J A;  3F5T A;  3EKS A;  4FVM A;  1NGC A;  2QWQ A;  2OA8 A;  4W5O A;  4H4M A;  1VSI A;  3M8R A;  1QSY A;  1SL1 A;  3CJC A;  3K5M A;  1NGA A;  4FLU A;  2D0P A;  4YDU C;  1Z6R A;  2ZD1 A;  5HRO A;  3WNH A;  1NGI A;  4FW1 A;  4XH5 A;  4K8Z A;  1RBU A;  4PL8 A;  1VSM A;  4JKF A;  3CD6 N;  4JK9 A;  1RT3 A;  3DYA A;  3HZ6 A;  2DPN A;  2HBK A;  3IRX A;  3QIC A;  4LY7 A;  2QKK A;  1VRU A;  4CE9 A;  4GV3 A;  2UYT A;  2HBJ A;  1OVY A;  4AH9 A;  1EWQ A;  4V19 S;  4CGF A;  3AO3 A;  2LSN A;  2KFZ A;  1SKS A;  1BGX T;  1XMQ K;  2ASO A;  1HNI A;  2GBZ A;  3TAE A;  2NZT A;  3CER A;  2KKZ A;  3D2E B;  4LF9 K;  5EXW A;  3ENO A;  3PIO L;  4FK0 A;  2VG6 A;  3J8A A;  3FE1 A;  3D45 A;  3Q7B A;  3CI5 A;  3FFK B;  3CC7 N;  3CCU N;  2EWS A;  4LSN A;  3IFR A;  4CJU A;  3C6H A;  3A2F A;  2FSK A;  4AIL C;  1XMO K;  2YHX A;  3SYZ A;  3MXM A;  2J4R A;  3VQ4 A;  2VG5 A;  3VEV A;  2UUB K;  4KRE A;  5EOY A;  3VQC A;  3CM5 A;  3RSE B;  2H3G X;  3EE8 A;  5M1Q A;  2HHT A;  3S3N A;  2CH6 A;  4FLV A;  5FPE A;  4NB4 A;  1BA0 A;  1VSF A;  2B5J A;  3KKS A;  4M45 A;  3CCR N;  3QEP A;  2PYL A;  1QS4 A;  5AQH A;  4CHZ A;  3CYM A;  5CY4 A;  5AQQ A;  3OYD A;  1MWK A;  3ASM A;  2ZM6 K;  3K58 A;  1XHX A;  4I2Q A;  1W7A A;  3RVC A;  4OGC A;  4BR5 A;  3G4S N;  3C95 A;  4DR4 K;  1EKE A;  3DAW A;  4IEI A;  3DLH A;  1S9G A;  1S1W A;  4CEC A;  2KZZ A;  2IS3 A;  1S1X A;  4NCG A;  5CR4 A;  4BRP A;  2YNI A;  1W9H A;  3LM2 A;  4PKG A;  2E20 A;  3HOT A;  4YOX A;  1T6C A;  3VQQ A;  3VER A;  4HUF A;  1ESV A;  5JIC A;  1W97 L;  1U2V B;  1WN7 A;  4BR7 A;  3CC4 N;  2NRT A;  1ZYQ A;  3ATU A;  2D4W A;  3TR8 A;  5SWM A;  3BEX A;  1X9S A;  2IGI A;  1WB9 A;  1TV6 A;  1HKB A;  3K5N A;  2NLX A;  1QSL A;  4GKJ K;  3MN7 A;  4M3W A;  4DV0 K;  3H1V X;  5J2N A;  4BGA A;  4ELU A;  3QFU A;  5BPM A;  3VEY A;  3HOS A;  3TAF A;  1N5Y A;  4HTL A;  5EX5 A;  4NCA A;  4AF1 A;  3BUZ B;  3CCE N;  3TAN A;  3QIO A;  1NOY A;  4B08 A;  5LL6 Z;  5J2P A;  1OVQ A;  3H3N O;  2RPI A;  3HVR A;  1FXX A;  4C8L A;  1KRP A;  1ZBH A;  4GVM A;  3QET A;  2WBN A;  4YOY A;  1QE1 A;  5F1X A;  3DOL A;  1TKZ A;  1YT3 A;  4CJ7 A;  4KTW A;  4RCH A;  5BN9 A;  3FFI A;  4FJ5 A;  3BF3 A;  4BRD A;  5FPM A;  1J9A A;  1RBT A;  2UUC K;  2GWK A;  4CIE A;  4CFC A;  1HYV A;  1NGE A;  4BDY A;  4GV6 A;  1GOC A;  1FKO A;  3RWU A;  2FF3 B;  4DR6 K;  1S6P A;  5M1P A;  4HCC A;  3U4L A;  4H0T B;  2HBL A;  5LMU K;  4JKH A;  3VTI A;  5M1K A;  4H0P A;  2B4J A;  5GAD P;  1BIZ A;  1YTA A;  1WSE A;  3LPU A;  4DQQ A;  3DRP A;  3EZW A;  1W0H A;  4WE1 A;  3RRG A;  4N56 A;  1KFS A;  4EIA A;  2XHB A;  1VQ4 N;  4KI4 A;  4OJR A;  1WSF A;  3O9S A;  3A5N C;  5A2Q O;  2P9S A;  3O6W A;  4B3S K;  1V4T A;  3KLF A;  1TYQ B;  2IIR A;  2IVP A;  3AV9 A;  4HUG A;  2QI2 A;  1KVA A;  3SV4 A;  4QS9 A;  1RIL A;  2PZS A;  2P9K A;  3E01 A;  4AHU A;  3U3G A;  4W5Q A;  4MLE A;  1YVU A;  3EKU A;  4A5A A;  3SK3 A;  3VEN A;  2IC3 A;  1S9E A;  3OYN A;  2BUP A;  3OBW A;  1JJ2 M;  1XC9 A;  4BQZ A;  3QML A;  3BZK A;  1WNS A;  1ZXO A;  3SUN A;  2NNW A;  2VWB A;  3O3G A;  4PA1 A;  4FWQ A;  3UB5 A;  1M90 O;  2ITM A;  4R5P A;  5DM6 L;  4RW4 A;  3ULE B;  1YIJ N;  4LF6 K;  1RGI A;  5BN8 A;  3NGZ A;  2RF2 A;  3ZX2 A;  4GKK K;  3ENB A;  4DTX A;  3OJS A;  5F0X A;  3MXJ A;  4OGE A;  2P9U B;  1VSE A;  2UUA K;  1RCH A;  4W5R A;  3AVM A;  5JVH L;  4EP4 A;  5AQJ A;  4M7X A;  3AAQ A;  2VWK A;  4FO0 A;  3O9U A;  2O8E B;  4CZL A;  4DR7 K;  2IAJ A;  1ZBF A;  2QWN A;  2HMP A;  3OYL A;  4JNE A;  3VMF B;  4BRF A;  3KLG A;  4QCL A;  5JLH A;  1JKH A;  3CPW M;  3L2W A;  4FLW A;  1VSH A;  2NRH A;  1WLJ A;  1C0M A;  4J2B A;  2AA4 A;  4F2R A;  4J8F A;  1VSJ A;  4KB1 A;  4EAH D;  4JS4 A;  3MWP A;  3HT3 A;  4DKW A;  3L2U A;  3IG1 A;  1ZBS A;  3PV8 A;  4M3Y A;  4Z0U A;  1Q82 O;  1VHX A;  2P9L A;  1RBS A;  2E6L A;  4WFA L;  3TI0 A;  3LAN A;  1NJZ A;  3A5L C;  3NVM A;  4GV9 A;  1VRT A;  3G71 N;  1WSI A;  3AA4 A;  3RR7 A;  1D9F A;  5BPL A;  3H45 C;  5C0Y A;  1KLN A;  3K5L A;  1DT9 A;  4LFC K;  1GLJ O;  2HF3 A;  3VQB A;  3THY B;  5JS1 A;  2NRX A;  4JS5 A;  1T3V A;  4ISF A;  5AQR A;  3AA5 X;  2YHW A;  2UXB K;  3EN9 A;  1N34 K;  2OPP A;  4BE2 A;  2HF4 A;  4FWP A;  3MXI A;  3KD1 E;  3NH2 A;  4KAZ A;  4B3T K;  3EL2 A;  3QBX A;  3JSM A;  4KHN A;  2FLO A;  4KHU A;  1T6D A;  3HPG A;  3VQ7 A;  3QDK A;  4CK3 A;  5I42 A;  2RN2 A;  3OJU A;  1HNV A;  2XY8 A;  2UU9 K;  4CED A;  4DTO A;  1HPM A;  3DXK B;  5AQM A;  3RMB A;  3KLI A;  3LAM A;  4M3T A;  2HHV A;  4FJH A;  4CJS A;  4G9Z A;  4BG8 A;  3LDO A;  3THX B;  4DFM A;  4CJL A;  5EVZ A;  4LFB K;  1E3M A;  4M63 C;  4FZZ A;  1ZBL A;  3CM6 A;  1KAY A;  4CZJ A;  4DLG A;  1LW2 A;  4MQ3 A;  4FJ7 A;  4H0V B;  5AQK A;  1U04 A;  3T7Z A;  3O9T A;  3UE5 A;  4CF2 A;  3SMP A;  1HR0 K;  2RKI A;  1RDB A;  3C6A A;  1NKB A;  1A5X A;  5HRS A;  1JCG A;  4MLH A;  1W2B M;  3E1Y A;  4C8N A;  3C94 A;  1Q81 O;  4KTQ A;  1BO5 O;  3CJA A;  1OKJ A;  4BVP A;  3V81 A;  3PSF A;  1IG9 A;  3H1Q A;  4O8K A;  3S41 A;  1Q9Y A;  4CEZ A;  1SAZ A;  4CZI A;  2D0B A;  4CJR A;  3THW A;  4OPH A;  4C8M A;  1ATR A;  3LP0 A;  3JXU A;  3CCM N;  1MA9 B;  4PKI A;  3VQE A;  3CCV N;  1GLD G;  1NK4 A;  1LV5 A;  3M8S A;  1HJO A;  5I9E B;  3D7E O;  4JRQ A;  1YTU A;  3V9Z A;  4DS5 A;  2EX3 A;  5HP1 A;  1C1C A;  3L2Q A;  3CQY A;  3HP6 A;  4X64 K;  4BR2 A;  3V6D A;  3HPH A;  1I94 K;  3K5O A;  1WBB A;  4HVJ A;  1KTQ A;  2VGM A;  3VQD A;  3W0L A;  3WNE A;  3DMJ A;  4BE1 A;  4E0D A;  1JXE A;  5GIN A;  3JAM O;  2Q1N A;  3OA9 A;  4JI1 K;  2W6K A;  4B9T A;  1RT2 A;  2HHH K;  4Z4I A;  2WOM A;  3TAP A;  2A6A A;  4CFA A;  3DLG A;  3QER A;  3L6Q A;  3KK2 A;  1T8E A;  3O9Q A;  2YHA A;  3NAE A;  2OPR A;  2E2N A;  1HQE A;  2QXF A;  2O8C B;  4AHC A;  3HL8 A;  3DLR A;  5HRP A;  4DB3 A;  3DJC A;  1U47 A;  5F2R A;  2HHU A;  2ZJR L;  4H0X B;  1OH5 A;  3LDP A;  2E4L A;  3AO1 A;  4JKG B;  2ZJP L;  1NKE A;  2QWO A;  3VOV A;  4CJE A;  5BRF A;  4OPK A;  3AAR A;  1OH6 A;  3SPZ A;  3VGL A;  1GLF O;  5TKY A;  1QTM A;  4H5R A;  3SNN A;  2BE2 A;  3THX A;  3TTD A;  1YJW N;  3MK6 A;  4M3Z A;  1S1T A;  3ZSV A;  3UKU A;  1X3N A;  3V9U A;  2ASP A;  5AR0 A;  1K73 O;  3CJ7 A;  1WSG A;  3HI0 A;  3CQX A;  3D6R A;  3EEQ A;  1X9J A;  1Z05 A;  4OKJ A;  3T1A A;  3LAK A;  2ITG A;  3ZET B;  3DWL A;  3R9P A;  1RTD A;  4M3U A;  1L3U A;  2D0O A;  3O9R A;  2G8I A;  1VAZ A;  1U4B A;  2IVO A;  3I8B A;  5C10 A;  2VYP A;  2I5J A;  3IAY A;  3OYM A;  3OW2 M;  4BG9 A;  1QHA A;  3DXM A;  3I33 A;  4B9Q A;  3VGM A;  4CD1 A;  4Q5V A;  1TUU A;  2W42 A;  4DQP A;  3ZSQ A;  3AO5 A;  3CET A;  3ZSX A;  4WF9 L;  4JI0 K;  4ELT A;  3C6T A;  4EP5 A;  3LP1 A;  3TTF A;  4E1N A;  4B9L A;  3KZB A;  3DXM B;  4DQS A;  4IXC A;  4KBO A;  1YIT N;  2P9L B;  2FBV A;  2O8D B;  1G99 A;  2VGN A;  4RW6 A;  4FLX A;  2BGG A;  4B3R K;  4CCH A;  3HJF A;  4CJQ A;  4PUO A;  2FBX A;  4PHT X;  3O4Q A;  1X9M A;  3M8P A;  1NK6 A;  2Q36 A;  2O4I A;  1BQM A;  1HKC A;  3MCA B;  3BDP A;  1S22 A;  1NG9 A;  1YJN N;  5C2D A;  3O08 A;  4A59 A;  4WQ4 C;  5HBM A;  1KVC A;  5KRT A;  1NK7 A;  4IOX A;  4CHP A;  1RDW X;  4C1N I;  4W5T A;  3KK3 A;  1K8K B;  3GE1 A;  4LF4 K;  1XI1 A;  2DFH A;  3U8X A;  3R3L A;  4BC5 A;  1BU6 O;  4B1W B;  3VGK A;  1T05 A;  2PAV A;  5AZI A;  1KSP A;  2NRV A;  4FXD A;  3ULD A;  4H5N A;  3O3F A;  3OYB A;  1KLM A;  4K42 A;  1NOZ A;  1RDC A;  5MLC Q;  3BP8 A;  4JV5 K;  2O8B B;  4F4K A;  2G8K A;  2O8C A;  1P8Z A;  2GV9 A;  3CJB A;  4JKC A;  4DTM A;  2KFN A;  2AJQ A;  3LZI A;  1EXQ A;  1CZB A;  2Q0U A;  2G8W A;  3TAR A;  2YHY A;  3TU5 A;  4FWL A;  3CIP A;  3SQ4 A;  1JLG A;  4Y1C A;  3BY5 A;  5C24 A;  4BC4 A;  2P9K B;  3WXL A;  2P9I B;  5LJW A;  4NXM K;  4DMN A;  1C0G A;  4KHS A;  4CJK A;  3HYF A;  3GOI A;  3UIQ A;  1FJG K;  2QWL A;  4BVO A;  3MEC A;  1RT4 A;  4DQ8 A;  1H1V A;  1VQN N;  2IOC A;  1TKT A;  1VQ9 N;  1TYQ A;  3TWH A;  1ASU A;  5CZ2 A;  2P9S B;  4DFK A;  4GNI A;  1TAQ A;  1MWM A;  5KPT A;  4JN4 A;  4JI5 K;  4CHN A;  3GBT A;  1CZA N;  1TK5 A;  4IG3 A;  1VQM N;  5AQF A;  1J53 A;  4KV8 A;  2W6L A;  1KC8 O;  4B1Y B;  1TKD A;  1E4F T;  4KO0 A;  4M7Y A;  3RTV A;  2WON A;  2KLA A;  5LY3 A;  1C1B A;  4FOI A;  5KGX A;  3IMX A;  4ILJ A;  4DU3 A;  4BRG A;  5BPN A;  4BE0 A;  2QWR A;  4JK8 A;  1JLQ A;  3SUP A;  2HW3 A;  1BG3 A;  2YJF A;  3GL1 A;  3G6E N;  4DSI A;  4Q0B A;  2YNF A;  4CF9 A;  3OYK A;  1ILY A;  4OVL A;  3P83 D;  1QSS A;  3CF5 L;  4FWK A;  5M1O A;  3J80 O;  5GAH P;  1FW6 A;  5AQW A;  4Z94 A;  3U3Y A;  2GWJ A;  3M6G A;  2P5G A;  1NU0 A;  2VWJ A;  4MDA A;  4AM6 A;  4JI3 K;  2P5O A;  1NGJ A;  4O0I A;  5AQX A;  4OLA A;  1VQ8 N;  1Q8I A;  1NMN A;  3QO9 A;  1YJ9 N;  1GLE G;  3SUO A;  2OYQ A;  4RW7 A;  1Z26 A;  3P38 A;  5EU7 A;  5C15 A;  1IKW A;  4ELV A;  4B8C A;  3QLH A;  2UXD K;  4BRN A;  2GTD A;  4A5B A;  4JLH A;  3AVK A;  1NKC A;  2PFU A;  4CVN E;  3AVC A;  1CZ9 A;  3T19 A;  2F4V K;  1JLF A;  3JYT A;  4OKK A;  4E7K A;  2XY6 A;  3R6M A;  1HPZ A;  1RDU A;  1VQL N;  2ZE2 A;  2E8A A;  1OH8 A;  3H6E A;  5KRS A;  2G8V A;  3L4I A;  5AQZ A;  2E1Y A;  3J81 O;  3OVN A;  4ZTJ A;  1DLO A;  4FJM A;  3IKM A;  3AVN A;  5C12 A;  1YUW A;  4ID5 A;  3VPZ A;  1LW0 A;  2O4G A;  4H5T A;  1IBK K;  2D1K A;  4DTJ A;  1B92 A;  4DTU A;  1DTT A;  4CBU A;  4DUY K;  3ID6 A;  1BA1 A; 
#chains in the Genus database with same CATH homology
 4X62 K;  4DV6 K;  4DUZ K;  4DV4 K;  4KHP K;  5AJ3 K;  4B3T K;  4OX9 K;  4YY3 K;  4V19 S;  4LFA K;  4X66 K;  2UU9 K;  1XMQ K;  4B3M K;  4JI7 K;  4DV5 K;  4X65 K;  2VQF K;  1N32 K;  3T1H K;  1HNW K;  4LF9 K;  5LL6 Z;  4LFB K;  4LF6 K;  3J80 O;  4DR1 K;  4LF4 K;  4LF7 K;  4GKK K;  4DR2 K;  4NXN K;  4K0K K;  2UUA K;  4DR5 K;  4YHH K;  4DV1 K;  1XMO K;  4JI3 K;  1HR0 K;  2UUB K;  2UUC K;  5BR8 K;  4DR7 K;  3J7A P;  5FLX O;  3OTO K;  4LF5 K;  4JV5 K;  1J5E K;  4DR6 K;  4DV2 K;  4JI2 K;  3T1Y K;  1IBM K;  4AQY K;  2UXD K;  2E5L K;  2ZM6 K;  5LMU K;  1N33 K;  4CW7 B;  4DR4 K;  4DV7 K;  5IWA K;  4CVN E;  2F4V K;  5LMN K;  1XNQ K;  1HNZ K;  4NXM K;  4JI6 K;  1HNX K;  1FJG K;  2VQE K;  4DR3 K;  4X64 K;  3J81 O;  5A2Q O;  1I94 K;  4B3S K;  1IBL K;  5IT9 O;  4LFC K;  4JI0 K;  1XNR K;  2UXC K;  3JAM O;  4JI1 K;  4JI5 K;  2HHH K;  4DV3 K;  1IBK K;  3J7Y P;  4GKJ K;  1N36 K;  4JYA K;  4DV0 K;  2UXB K;  1N34 K;  4B3R K;  4DUY K;  4JI8 K;  4JI4 K;  4LF8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...