3T1OA

Mgla bound to gdp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
192
Chain Sequence
STINFANREINFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIGEVKGFKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Gliding protein mglA
total genus 60
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t1oA00
4TTPA 3P1JA 3DHWC 1Z8FA 2FGKA 3M6AA 4HB2A 1VCNA 1QHNA 3HDTA 2QU8A 3U4QB 4K81B 1TU3A 1IY1A 4V0LA 2DPXA 5FBLB 2FE4A 1MO3A 3TNFA 1TF5A 4GMXA 5JCZA 4DIEA 4B6EA 1T4GA 1PUIA 5EXSA 2FGJA 4OL0A 1JQJC 3LH5A 3PUVA 1TTTA 1YHNA 3FMPB 1OT3A 3EPKA 1X3SA 1M8PA 1D2MA 2FPKA 3CRVA 1D9ZA 4BFWA 3B85A 3PITA 5IT5A 4CF7A 3T35A 2BCJQ 3WYAA 1HH4A 3K0CA 1IHUA 5DH9A 4D0NA 5C18A 3P27A 4XSGA 2EYUA 1A82A 4C0JA 4AKIA 3SQWA 3S1AB 2OILA 1E9CA 2H57A 2BVNA 4Q1FA 1P72A 1UKEA 2CK3A 3LWNA 1YQTA 3HPQA 4GP7A 5DLQC 3I5XA 4KCGA 3U7FB 2MMCA 3TH5A 3QUSA 4D0LB 4Q1BA 4F7WA 3FE2A 1N6NA 5FOVA 2PLFA 2IHBA 1ZU5A 3TW8B 1WDTA 3CPJB 2KBFA 2X77A 2ZI3A 2GAOA 1BIFA 1U8AA 4XJXA 4ZPXA 4DBLC 3N5CA 4JBXA 3CF6R 2ATVA 1W2GA 3QKTA 1G41A 2G83A 3BB4A 2WWWA 1HT2E 1R5BA 1E99A 1ZU4A 4AK9A 3GLIA 3GLGE 4TMKA 1U81A 4HZUB 2RGAA 1E2NA 2D2EA 4M1KA 2EFCB 4JL5A 4JLAA 3CUEF 3AUYA 4QHYA 2ZE8A 1T8UA 2CCJA 1Z06A 4FMDF 1VKJA 1D2EA 2OSBA 3F8TA 1Z0FA 1G291 2ORVA 3IQWA 3F0TA 3KB1A 1OXTA 2REXB 4Q4HA 4Y0AA 1ZUIA 4UNQA 2FOLA 3DKVA 3TR5A 2UZ3A 3BS4A 2JLVA 1LB1B 2V6IA 3VU9A 3NEYA 4JBYA 1H8ED 4JYBA 1MO4A 2VLIA 3LNCA 1AKEA 2V4ZA 3LLUA 3UMSA 3KQNA 3H84A 5JSZB 1AS0A 3ZVMA 5CLQA 3QXHA 2PMKA 1NBMD 4QGAA 5HCNA 3SZRA 1NNEA 3KX2A 4JT2A 2OLJA 4DKXA 2HF8A 5LPNA 1E32A 1X8KA 4PPQA 3U61B 2KB0A 3KFVA 5CYPA 1Z22A 2VP5A 1RYHA 4Q18A 2WJVA 4M1TA 5TDHA 3B1WA 5L3VA 1W44A 3BIFA 3RSLA 1X6VA 2ZI4A 3ND9A 2GESA 5E95A 1ZC4A 4KFUA 4B44A 2K5UA 4DXAA 2R6AA 2WSMA 3KJIA 4M8NE 1LY1A 3PIRA 5J47A 1Y3AA 4C0KA 4LJYA 3UKDA 4AI6A 2X2EA 5EP1A 4Q21A 4AG6A 4PQYA 2GZDA 1IQPA 3TQFA 4IW3B 3VHXA 3TR0A 4U00A 2ZJ8A 3CNLA 2JLQA 3EAQA 3L8YA 1H65A 3PEWA 4PHTA 4UNNA 1IY0A 4FCWA 2REBA 5JSZA 4OKSA 3GEIA 4FWTA 4DWJA 5KPDA 1KKLA 3ZLJA 1KTVA 1A4RA 1XBTA 2GZAA 3VTKA 3FPAA 2QRZA 4L9SA 5G3YA 1KY2A 1QRAA 4M1OA 3P26A 2ZI5A 5SZIA 2YNMA 4ABYA 3TQCA 5J40A 3CNOA 3A4NA 1NN3A 4OHZA 4IDOA 2ZR0A 1IN8A 2BIFA 4YMWA 4OI0A 3BGWA 4AYWA 4X8HA 1SULA 4PAQA 1BOFA 3CWZA 3IQXA 2VP4A 1ZBDA 3VQTA 1TUEA 4AYTA 2YKGA 2QNRA 4QGGA 4DDUA 2XJ9A 4B2IA 4EKDA 1OPXA 3QI2A 4IVRA 2JIZA 5FBVB 3OFND 1COWD 5KDLA 5C4GB 4BWYA 1AQYA 2B6HA 4JJZA 4MH0R 621PA 2ZAMA 1KDTA 1KK3A 4P4UA 1YZUA 4KU4A 2YWHA 2C78A 2ASEA 2CE2X 3AF0A 3Q5DA 4NH0A 4ZDWA 3NBFA 2H17A 4NE2A 5EQTA 3RS3A 1G1MA 3BFXA 421PA 2O0KA 1AIPA 2QAJA 3O8CA 4B32A 1F2TB 2ZTSA 3CH4B 4LHWA 3GFPA 3T1VA 3QF4A 3IHLA 2EWVA 1XTSA 4AG5A 5TB5A 1QHGA 2ZRNA 1WBDA 4R7ZA 4BUJA 2V7QA 5K8TA 1ELOA 2ODWA 1DG3A 3KQHA 2I1VB 2PT7A 1OJLA 3QXXA 4MKIA 1NBMA 5JJKA 1JR3D 1S3SA 2ZYTX 4PO9A 4Z54A 3EA5A 5CB8A 5DI9A 2NO9A 3Q3JB 4EPTA 4OQMA 2BMFA 2OM2A 4QL3A 3IIMA 4PR0A 2C9YA 4M9XA 4FIDA 4V0ME 4Y0VA 2HF9A 5JECA 4I81A 1ZNXA 1YVDA 3RWMB 2QP4A 2VBCA 3DPUA 1H8HD 4RKFA 4DLSA 2GZHA 4KSCA 1MABA 4OJQA 4HLQB 2QENA 3EPHA 1KJWA 2IYSA 3MWKA 4KAXA 1D8TA 4ACBA 3HU2A 3SNHA 2D3WA 2DWOA 2GRJA 3DMNA 3L2OB 4CW7A 4A15A 2EFHB 2ZYWX 1GSIA 2GK7A 5HKKA 2ZJBA 3D6TB 1P9WA 3H2YA 2J0SA 2ZI6A 3FGNA 1G7SA 1E79A 3AKDA 3GJ4A 3OEEA 1QVRA 3NC0C 4CEIA 3V4FA 1CP2A 1E0KA 2WMNB 1NMYA 4HB3A 5DO9A 1XDBA 1QG2A 4G3XA 2RGNC 3CX8A 3NIBA 3IO5A 4UXIA 3CF0A 4I99A 4XWKA 4TTRA 4UQOA 4PO1A 4PSAA 2BEKA 3C14C 5LD2C 1DVRA 2QMUA 2XB4A 3VHLB 2V1UA 3ZIAD 4D4JA 4E5UA 1FOEB 1U0HC 1W2HA 4OQFA 4BQSA 5B64A 3VAAA 3ZIAA 4LI0A 3BORA 3MUFA 4QGHA 4RKEA 1CJVC 1QHYA 2WKQA 3QKUA 4BEJA 4LJ9A 1P7CA 1TQ4A 2VHJA 3AM1A 4DLWA 1ZVQA 4F92B 4LCBA 2YHSA 4C2UA 5J5CA 2JLWA 1JEDA 1LVGA 5FUWA 1NLFA 1G3IA 2ANCA 4EQ6B 1IBRA 1AQUA 2F7SA 2GXUA 3KKOA 4KV9A 4V0KA 2WBLC 4QXAA 4YQFA 1OV4A 5AR1A 3X1XA 2P3SA 4BRUA 1P2VA 2CHGA 3AKYA 4KFTA 1R10A 2QPTA 1G5TA 2IHYA 1ZD1A 3KJEA 1GVNB 1TADA 4B3BA 3GEHA 5E7JA 1X1SA 1KO8A 1NJGA 2GILA 3I32A 5CIQA 3U7EB 2ATXA 2IS1A 1COWA 1A2KC 5FOUA 5GJVC 1RJ9B 3NHBA 1EX6A 1OLOA 3CLVA 5FTKA 4DSNA 3QJYA 3EZ2A 3SBEA 1KK1A 4DT1B 2Q3MA 2ZSEA 1Q1EA 1Z6XA 1E2EA 1C4OA 1MT0A 1ZM3A 1XD2B 5IK2A 3K09C 1VYVA 4JSYA 4NHOA 4LK2A 1HTWA 2OLKA 4DDWA 3B2EA 3I72A 4DCTA 2H7VA 5KNDA 1KI1A 3A37A 1JR3E 2D62A 3P20A 4XVQA 3MSXA 3L82B 4OQLA 3HYTA 3MWLA 4ESHA 1J8YF 3T15A 3T1QA 3WRXC 2GBLC 3TVTA 3T06B 3B82A 4D4MA 5HPYB 3BH0A 4O3MA 3BBPA 4XWAA 2FSFA 4DCSA 2R6DA 4UXJA 1M1YE 1KI8A 4W5WA 2QSYA 2GEDA 3GMTA 2R62A 4PX9A 5JI2E 3HU1A 1A1VA 4WZAE 2ZVPX 1YZTA 3CW2A 4F4IA 4U7DA 3SJAA 3PUWA 4PO8A 2QRNA 2ZYVX 5BYKA 1T5IA 4WZ6A 2HUPA 3DZ8A 3RYTC 1E2FA 1F3OA 4QJ4A 5CJPA 2WIAA 2FSGA 4ERNA 1XPOA 2IYLD 2QT1A 1LW7A 1LFDB 4UNRA 1TNDA 1ZAKA 3SBDA 4NYMR 3NWJA 1RC8A 1B0UA 1L4YA 1DAHA 2WICA 3LXXA 5ANRB 1OH6A 2ZSAA 5ELXA 2J7KA 2QQ0A 4NPHA 2F6RA 3IPYA 2CJWB 1DELA 1CR1A 3SJZA 4N3NA 1R6BX 1QF9A 4G0NA 3BRWD 2OUKA 2RGBA 1NMXA 4Q7MB 2ZUDA 4F4CA 4XSHA 1TX4B 4YDSA 1E98A 2IL1A 4RJLA 2O8CA 3EA0A 4HUQA 2VYFA 2J9RA 3D8BA 3GFTA 2NO7A 2XZLA 2W00A 4DJTA 4IVPA 4IDQA 3EW9A 1PZNA 2FJUA 3EWSA 4JLKA 3SQXA 3J81k 4H9GA 5DE3A 3RLFA 1F6BA 3TW4A 2W2XA 1Q57A 4FINA 4FMDB 3G0HA 4L16A 2Y8EA 2W2VA 4QFMA 3RNLA 3QE0A 3WYGA 2P5TB 2RGDA 1G4UR 1YZKA 4URVR 3CONA 2B21A 1FP6A 1HV8A 1ZUNB 2WPDA 2VTKA 2CL6X 3KQUA 2GJ9A 3X1DA 4DEYA 2YWFA 2DFTA 2QMOA 4JVLA 5J4KA 2ZRMA 5KDDA 2ZRPA 3IO3A 3A8TA 1UEIA 4QRHA 2CJWA 2IYZA 3GLIE 2B8WA 2WWGA 4MQBA 5HZKA 5HE8A 4GOXA 5IHPA 1XZQA 3VMFA 3W8NA 1GKIA 3EZFA 1PLJA 1PUJA 2F9LA 1J7KA 3K9HA 4G5GA 1E2DA 4KVAA 2IUUA 5EJEA 1E0AA 1RW4A 2OBLA 4ZIRB 1X86B 1G3RA 2JAQA 5EUQB 5BWMA 5L8VA 5FOXA 4R2IA 4QBIA 4RSGA 3ZVNA 2QUZA 1HURA 4EJSB 1E2GA 3CBQA 4DVGA 4BLOA 3R7WA 2WKPA 1RPZA 3I62A 2ONJA 2R6FA 1C9KA 4P3YA 1KI9A 5TMPA 2VHTA 3GEEA 3GLHA 2CLDX 1E9BA 2W6JA 1JECA 1KAOA 4ARZB 1P2TA 5HKKD 2MMGA 3E2IA 2JATA 4OK6A 3WXMA 3A1TA 4EPVA 2VSXA 1XPRA 1ETUA 1JPJA 1VTKA 3K0AA 4HAYA 4URZR 3RHFA 1BMFD 4YXWD 1NG1A 1T6NA 2XNSA 4UKDA 3OEHA 3B5JA 2FZLA 2N1BA 4A0RA 3LQRA 1F2UB 3RWOA 1UJ2A 4OHXA 2PH1A 4BFVA 4NYIR 1XU4A 3A1SA 3EARA 4P32A 1OE0A 1IXZA 1Q21A 2B7CA 3DL0A 2ZS7A 1XMJA 4MRVA 2XNDA 3H1TA 3U3MA 4EJSA 1BO6A 1ZIOA 3KKPA 3KXKA 3OIUA 3T1OA 121PA 1KMHA 2DFKB 3ZYCA 4TLCA 3FWYA 4TMVA 2RCNA 1EFCA 2A5FA 3QVUA 3VR5A 3IKJA 5EP4A 1T3HA 1KSHA 2V1XA 4LRWA 4FCTA 3VX3A 1XMIA 3AVQA 2J7PA 2WHXA 3GJ7A 4A6XA 1J2JA 2E9SA 2OCPA 4A2PA 4CGZA 1PLLA 3AF3A 3ADDA 3LRPA 2GEVA 1DO2A 2AN9A 3K0AB 3RANA 1E2LA 2VIIA 3AP2A 4G5SA 5FTMA 3X1ZA 4EPYA 4F93B 1Z08A 3UXMA 5KHOC 2J0UA 3QSYA 1OH8A 2QQEA 4ITRC 4JLNA 2WTUA 1FP7A 3QG1A 3IUYA 3FMFA 1R0XA 3MJHA 4TMXA 4W9MC 1VCIA 2XGJA 2QI9C 5DYGA 5FUVA 1E0JA 5CM8B 4YONB 3IEVA 5B57C 1YU9A 3T5DA 4DSUA 1KO5A 1SVOA 1VG1A 4I1OA 4LYFA 5BN5A 1OIXA 2ZRHA 3A36A 1OH7A 1W4RA 2AD1A 1HE8B 3OIVA 1DAGA 4HAWA 1NY5A 3CPHA 4MUBA 2R6GA 4EFMA 4URWR 2IW3A 1G3UA 5CLLA 3CNNA 2IXEA 1WQ1R 3BFKA 4D0GA 5F9HA 1OXVA 3WRYC 4NKRA 4PZYA 4CEJA 4NMMA 2PJRA 1W1WA 2UVQA 3U6BA 2IUTA 1UBGA 4BGDA 4NTZA 1Z5ZA 2JCSA 3KXLA 1SGWA 2ZJAA 3TSWA 2JEOA 2G3YA 4B34A 1ZM9A 2HXSA 3L0IB 3VX4A 4Q4JA 4LY6A 2QM8A 2BMDA 5L3RA 4B2PA 4Q7JB 2UZIR 4BE7B 3GCGA 2OAP1 3D3QA 3K53A 4ZKEA 1GKUB 3BC1A 2BM1A 3W6OA 4ZCMA 3IILA 2H8KA 3S1AA 4PC1A 4TYQA 4ZDKA 5GVRA 4DIDA 2A5JA 3OF5A 5FR2A 1VHLA 3SDZA 2D06A 2VHUA 4N1AA 2H18A 3IBYA 3SI7A 2IEZA 3PEUA 4GDFA 1IM2A 1AN0A 4TSFD 3HR7A 2XEXA 1ZYUA 1GL7A 2P6NA 4US1R 4NL4H 1KKMA 4CZ2A 5F3WB 1LS1A 2CNWA 1IXSB 3T12A 4HDCA 4XH9B 3KKMA 1AKYA 3OE7A 4OBEA 8OHMA 1GTVA 2CDNA 1G7TA 1KO1A 1R5OA 1OFIA 3EPLA 4Q48A 2YC2C 2OBMA 3WHKA 2CL7X 4I1VA 4U02A 1QG4A 4POAA 1OYWA 3B1XA 4Q4JB 1Z2CA 1DEKA 2ZRBA 1OB5A 5JBQA 2O8FB 1TEVA 3SYNA 2P67A 4Q00A 1XNJA 4LZZA 4MGIR 3W5IA 4GOKA 1EFRA 3WMEA 5JS8A 4R71A 4LPSA 4MKGA 1W46A 4EPRA 1RRPA 4Q1DA 2F1IA 4PANA 5DI3B 2ZRDA 2XITA 5IRCD 2O8BA 1P3JA 2BMJA 2ZRCA 3QXSA 3LDAA 2JDID 1VCOA 2O5VA 3FKQA 3Q8XB 1N0VC 4PPGA 1NLYA 3UWKA 1L8QA 4C7OA 2WWIA 1OFHA 1W36B 2KBEA 2R9VA 4TZ6A 4PHFA 4DRZA 1GNQA 5E4FA 4N0DA 3OEHD 3AKCA 5FBWB 4QNMA 2YV5A 5GADl 2ZAOA 1RRCA 3A58B 3X1YA 2AFHE 2XZPA 2NO6A 1W48A 3B1YA 2IYVA 4XWOA 2O8FA 3GLGA 1U2RA 1U8YA 1UAAA 2OEPA 3DOFA 4URYR 2ZR9A 4KYIB 3FHTA 4HLDA 4Q01A 4IOLA 4HAXA 5KTYA 3THOA 5KPJA 2CVHA 4E22A 4HLUC 2JLXA 2ZREA 5P21A 3C4JA 3DM5A 4A8JC 3KL4A 4QOSA 1SVSA 4G5OA 5DIFA 3WBJA 4RD1A 4AC9A 4JJKA 3GP8A 1JJ7A 2ANBA 3PEVA 4DLRA 1E2IA 3W6NA 3OAAA 3RSOA 1QVAA 2HT6A 4Q1EA 3I1FA 4MDEA 1V43A 4W5JA 4QKQA 1II9A 5EXPA 2AX4A 1S0UA 4C0HA 4RD3A 3BB3A 1XEFA 2CVFA 2VF7A 1G8PA 3AF2A 1F2TA 3LBNA 2GCPA 4M0LA 2AR7A 1G21E 2BBWA 1O87A 2EVWX 4G5RA 1FQJA 2BDTA 2GXSA 4X8MA 5EZ5A 1YZLA 4M1MA 1N0WA 1N6IA 2V55B 1G8YA 1W49A 4RFSB 3UG7A 4JLMA 4KLNA 2WJHA 4EUNA 4RD2A 4O0MA 2HT1A 5JJIA 1T5LA 4M9SA 1QBKC 2XJ4A 4Q9HA 4M21A 3EASA 5B58C 3I61A 5FTNA 2GJSA 4PPFA 4AURA 2XSZA 2ORWA 2NG1A 5CB6A 3ZQ6A 3NHAA 1XEWY 2DWQA 4URUR 2V9PA 2BKUA 2RHDA 2JIZD 2ODNA 4LJ4A 2HDNB 1QHXA 3QXJA 3UWOA 1W7AA 3THYB 3BAFA 5AJWA 2F43A 3SHFA 3MWYW 4E09A 3TUZC 2CHVA 5J4HA 3QNUA 5KUTA 3A4MA 3B78A 4DLXA 2OXCA 4OQNA 1Q0UA 4BLQA 2VHQA 2GDJA 3U3KA 1E9RA 4US2R 1N0UA 3PXGA 2QP3A 5G53C 3HJNA 4WBSA 1XTKA 2OO7A 1CLUA 1H8EA 5H68A 3FHCB 1OF1A 4PAOA 4PHHA 4RFSA 1YE8A 3A4LA 1KDOA 4TLEA 4LJ5A 4AWXA 2PX0A 3R8FA 3L0SA 1WCV1 5FPKA 4IFBA 3UMFA 4XD7D 4B75A 4FMBB 2VP9A 1NIJA 4PPNA 3GLFA 2F1RA 1SXJD 4RZ3A 4EFLA 3E1SA 1MABB 2HEIA 2FDCA 3ZS9A 1S96A 3L8ZA 4HAZA 2G9NA 2B92A 2H92A 4LJ7A 2D7CA 4FD2A 4C9BA 2ZXUA 1IN4A 1DAMA 1MH1A 1P62B 2GKSA 5F9FA 3A1VA 4B3XA 2NZ8A 4S2EA 4GI7A 1W5TA 5H8WA 2ZE7A 3LW8A 3SYKA 3AV0B 4D80A 1JI0A 2J7PD 4O2RA 3IIJA 3PENA 2GAAA 4BECA 4MYTA 2R6CA 4QC2A 5KYKA 3KQLA 2ZE5A 1KIMA 4D82A 4ZI2A 1KI6A 3CZQA 4V0OA 4LHZA 5L3QB 2H16A 1HT1E 2JLSA 1N6HA 1NBME 2FX3A 4Q5IA 5JWOA 2C9CA 4DUGD 4FCVA 3QXCA 1OKKD 2BEJA 2LKCA 3B9PA 2PCLA 4WXRA 4HEJA 4P0TA 1IJEA 1E94E 4CRWB 2DB3A 3H4MA 4IOKA 4LV5B 3IGFA 1IJFA 1W4BA 1FUKA 1RJ9A 1XXHA 3Q7QA 2IS2A 2OHFA 4D6PA 4FWIB 1SKQA 3FKSA 4ILEA 2GJ8A 1VECA 3K9NA 5FFMA 3QKRB 2ZETA 2A5YB 1FPMA 1HUQA 1RZ3A 3MG9A 1QHSA 2KJQA 1G9XA 1KSJA 1MRNA 3DOEA 4MITA 5AUPB 4KI0A 1GRRA 1XEWX 2C98A 5DSZA 4QJ3A 4IRUB 3D31A 1SVLA 1E79D 3ZJYA 2IC5A 3UK6A 2A7QA 3REGA 4LBVA 2FWRA 2VF8A 1CULC 1Z0IA 3DVLA 1Q1ZA 2J3EA 3BXZA 5JWHA 2WJJA 3V4RA 5TXGA 4B3DA 1CXZA 5FOWA 4C30A 1TPZA 4ZCIA 5FPSA 1F5NA 1AK2A 4P4TA 1L2TA 4B47A 4EJSC 2RGEA 3O47A 1TUIA 2QA5A 4HSEA 2D7DA 2CK3D 3SFVA 5JEEA 2UKDA 3U7HB 4B33A 1K6MA 2HJGA 2VA8A 1AZSC 1YRBA 1M7BA 1Z3IX 1KDRA 3PVSA 3QKRA 4KVGA 1OKKA 2C04A 2O8EA 3AVPA 3I73A 3CIOA 3AP1A 2Q21A 3Q85A 4D4LA 4GRAA 1ONBA 2ZJ5A 4M1WA 2JJ1A 2XTMA 4X8LA 1CEEA 1QZXA 2FH5B 1QHIA 3H0KA 5JMTA 1E6CA 4LBYA 1FUUA 4Q9LA 4YMUA 2EFGA 2F55A 1EESA 3TJZA 1SVIA 2J41A 4TQ9A 4ZDIA 5DGXA 2WJYA 2RGGA 3MFYA 4A36A 5AJXA 1ESMA 2AKAB 2W6IA 4KHZA 3OE7D 1ZMXA 3W9YA 2MSEB 1DARA 1TQ6A 1E2PA 1GM5A 3GLHE 3AVUA 1G8FA 2FEOA 1JNYA 1Q1BA 3CO5A 4TQAA 1G6OA 3LFUA 4R9UC 2OFXA 1HA3A 2QMEA 3GJ6A 3N2IA 1FTSA 5C46F 2GVZC 1I2DA 3LVRE 1G4AE 5BYJA 1ESNA 4CT5A 2O8EB 3UATA 4AD8A 1SQ5A 3ZVRA 2PL3A 4MUAA 1P61B 1G18A 1P5ZB 2IS4A 1J70A 1T91A 2Z0MA 5H70A 4Q66C 1CTQA 1NKTA 5D3QA 1S3GA 4BLPA 3TAUA 3KQKA 1R7RA 3NBYC 3AGPA 5JFGA 2O8CB 3AVVA 5EP2A 3F3YA 1N3BA 1US8B 1UKZA 5JLJA 1P9RA 3QKSA 1JAHA 2V6JA 4CVNA 2QY9A 2KI5A 2GEUA 1CR4A 1XJ0A 4L9WA 1E9DA 1I4TD 1R0ZA 2OT3B 3PUZA 3TGPA 1OSNA 2D2FA 1YR8A 5M04A 2B8TA 4JVSB 4GNKA 1KJZA 4HAUA 1ZM7A 4M22A 3CB4A 1GFIA 5A5GA 4C3ZA 3THWB 2GCNA 3NC1C 4CIDA 3SOPA 2A9KA 1T0JB 1NI3A 1VG9B 4A9AA 1CJKC 2W6ID 3WYFA 2IX3A 4JLBA 1CF4A 3N70A 4QBFA 3HP1A 3R9IA 1P9NA 4JT4A 3LO5A 1N5JA 2ZR7A 4QBHA 3VKWA 2RGNA 1M2OB 3QPVA 5FL7A 2G88A 1NVXQ 3BH6A 1HQYE 2JJ2D 2WIBA 1GWNA 4CEHA 2VSOA 2NPIA 1OW3B 1XWIA 1Z6TA 3U3JA 3DEFA 1NL3A 3R8CA 4Q03A 4ZIRA 3FKSD 1F2UA 2G0NA 1UDWA 2AXNA 2VRWA 3VKHA 2FFAA 4Q02A 3TAHA 4FW9A 1GOTA 4HUTA 3UANA 3CF2A 3CKLA 5JCPA 2H5EA 2Z5FA 4B73A 3EIHA 2NO0A 2VSFA 4TZ0A 1N2CE 4DB4A 1JQLB 2PEYA 2IYRA 2PZGA 4ZO4A 1BS1A 3GPLA 2FSHA 3M4YA 1VCMA 2ERYA 1GAJA 2WJGA 2XTNA 2ZSDA 4HYYA 1CU1A 4HDOB 3ADKA 2RMKA 4OYHA 2HYDA 3OESA 1Z0DA 1EFUA 2X19A 1S2MA 1XB2A 1S4QA 4JKIA 1AJEA 1KNXA 3TBKA 2AK2A 4NCKA 1T9HA 4XVUA 5BN3A 3X1WA 2MSDB 4KFRA 3THWA 2G0TA 1W4CA 4LOAA 5AJYA 5JS7A 2OCBA 4AIIA 1NSFA 3K09A 3FOZA 4LYAA 1II0A 4M1SA 2PJZA 1SZPA 2BJWA 3QENA 4H1UA 3TIFA 4B48A 4Q1CA 5FPTA 3CWQA 1P60A 2O52A 3KTAA 1S9DA 1UADA 4AKHA 3QF4B 3NVAA 4B35A 3EZ9A 3ETLA 5C4MA 2QM7A 4LSGA 3VR6A 5CDFE 1EWQA 1ZRHA 3VKGA 3TSZA 3AVWA 1KI2A 1A2BA 4P4SB 3OIWA 3BFVA 3FMIA 4TSFA 2WSSD 3TUIC 1XMVA 4QM7A 2CBZA 2CLSA 2Q0HA 1E1QD 3N2EA 5EE3A 2GWHA 4HDQB 2REOA 1NVVQ 2EU8A 2WMOB 1GIAA 1T3SA 3U5ZB 3W5JA 2XB2A 3DDCA 1P2SA 1Q44A 1WXQA 2XX3A 5FUYA 5LBIA 2ZQ5A 3CZPA 5FPYA 1Z2AA 1F60A 1ZCAA 1KGDA 4JVNA 1XTRA 2Q6TA 2GBLA 1BKDR 1LS6A 2E87A 2HLDD 2ZU0C 3HU3A 3WMGA 4BPBA 2QE7D 4CEJB 1G7RA 3FVQA 4PC6A 2J0UB 4B3FX 3LA6A 2F3RA 3QY0A 2A78A 1Z29A 2QEQA 4UXHA 2IUSA 5K8LA 4CEIB 1ZM4A 4RD4A 1VIYA 2GJKA 1VDZA 5DN6D 1HY3A 2L0XA 3MMPA 1EFTA 3WP0A 1RYFA 5D3MA 3RS7A 2RGXA 4BFYA 2QAGC 2HYIC 1KSGA 1CRPA 2P0EA 2W58A 3K1JA 4KBFA 4OHWA 3ZGXA 1MV5A 5K8IA 1WB9A 1OH5A 3P32A 2I4IA 4XTCS 3ICEA 4IOJA 3PV0A 2AK3A 2BV3A 4BFXA 3AVOA 4OI1A 1SXJA 2F1HA 2YZ2A 1R0WA 2ZRIA 5SZKB 2V7QD 3U6KA 3BH7A 2JLYA 5HE9A 3K0FA 2ZI7A 4LC0A 3Q72A 3AKEA 2A30A 3MCAA 4PQFA 1N6PA 5KSYA 1IN7A 2IYTA 1ZW6A 2YOGA 3P4YA 5AJVB 4Z8XA 5KU1A 2HCJB 3TUJC 3NTUA 1KJYA 3RDPA 5IDVA 1AS2A 2GETA 2B7BA 2NTYC 3IEUA 4EQ6A 4KSBA 1CR0A 5LDDC 4EFNA 3PR1A 1U94A 1Z6AA 3RS0A 3X2SA 2BM0A 1BH2A 2QTFA 1EXMA 4TLBA 2GF0A 2GXAA 3TLXA 5UKDA 3QBTA 4FMCB 1ZC3A 5LB4A 1KK0A 1IOZA 5KSZA 4LPKA 3NBXX 2FEMA 2WWXA 4JLPA 3KKQA 3QG5A 2FFHA 2XZOA 2JJ1D 3NH9A 3V9PA 1I2MA 3GJ0A 4E07A 5TY0A 5TARA 2NMVA 2QTHA 4NCJA 5J4LA 4JLDA 1GRQA 4BZPA 4M53A 1G64A 5J4VA 4B43A 3NDBB 1UM8A 1DO0A 2A3RA 4MRNA 4C7OB 4A6PA 4O25A 4IJMA 5DN6A 3WBKA 1JEEA 4EPWA 3K0SA 5AUOB 3SS8A 1X8LA 5LD2B 3AH8A 2FFBA 4LC1A 4YXWA 1KO7A 2YINC 5EE9A 1E4YA 1UPTA 4G5QA 4A2WA 4TYWA 2WM9B 3GLIB 3VR3A 1CJUC 4HB4A 1EK0A 4HZUA 4II7A 2IF2A 4Q19A 3NXSA 1ZD9A 4Q7KA 1VIAA 2FPMA 4KLZA 2OCYC 4DCUA 4AKGA 3ZD6A 2I3BA 3SC3A 2V8OA 4LWZA 5JEDA 5DI3A 3MJRA 3QEOA 1OXXK 4Q4HB 1U0JA 1R8QA 2OCAA 4IXMA 1FFHA 4MRSA 2PCJA 1ZJ6A 1E3MA 4MYCA 3CPEA 1MRSA 2FN4A 2F9MA 2BBOA 5HTKA 1UKVY 2OFWA 1E69A 4GL2A 4MYHA 5G3ZA 3NDPA 2IT1A 5FTLA 1II8B 1KAGA 2C95A 1LF0A 3HR8A 3B7GA 3L0PA 3OEED 1NF3A 4DLZA 2P65A 3RAPR 4BLRA 1M7HA 2F3TA 2OV2A 4RZUA 1N6RA 1ANKA 2ODBA 5FI0B 2OXRA 1FL9A 4MYUA 2EW1A 2FG5A 3O8DA 4V02A 2ORIA 2TMKA 4GT1A 2O8DA 3GLGB 2J45A 2QN6A 2EYQA 3EG5A 1X8JA 1TL7C 1IAQA 1FMLA 3B9QA 1ZCBA 2EFDB 1OHHD 5BN4A 1SKYE 1SKYB 2ZRJA 4LYJA 4NBSA 2J1LA 4PC3A 3O8BA 4Q9KA 2KSQA 3AVXA 1WP9A 2FSIA 1HYQA 2ERXA 2ZJZA 3AP3A 3C5CA 1B23P 2QP9X 1DTSA 2WKRA 3ASZA 1JR6A 2C96A 2C5LA 4Q1AA 1UKYA 1RE0A 1W0JA 3BD9A 3KDSE 3SHWA 5K8UA 4GFDA 2YOFA 1IN6A 2PZEA 4PAMA 2G77B 3REFA 2ZRAA 1JALA 4ZCLA 4LHVA 3JVUA 3EIEA 3AVYA 1K5DA 1II8A 2YWEA 3LAWA 1P4SA 4HATA 4MRPA 1OXUA 3JZMA 3UPUA 1PVOA 5CK5A 5LB2A 3O8RA 1N6OA 4A0GA 4V03A 3W6PA 1GUAA 1KNQA 4ASUD 1E96A 2Z4SA 2O8DB 1NN5A 3NH6A 2IBMA 3A1WA 2BCGY 1P75A 2KE5A 2YJTD 3BERA 2J59A 5EXXA 4E03A 3LD9A 1YR6A 4PZLA 4LBZA 3CRW1 4IDNA 3SJBA 2IYUA 2JA1A 1E9EA 5SZHB 2HXYA 2QBYB 521PA 4RCYA 5F98A 2RB4A 5JZVA 1DAKA 5FPHA 3KFXA 4GBMA 2FV8A 2J5XA 1WBBA 2C99A 1RFLA 4A8JA 1G5PA 1IY2A 3AQ4A 4JLJA 3LXRA 3C41J 3MAAC 2F43B 5E3HA 2OFOA 4TL7A 1W5SA 4ARZA 4B74A 3ECCA 3OHMA 4BZXA 4C0LA 3VR1A 3WMFA 1U8ZA 3DMDA 5L3SB 1GILA 4TYNA 5KDOA 5EXTA 5BW8A 3I8XA 5H1YA 4A82A 3NG1A 1RVDA 2CCKA 1FNMA 4UJ5A 3PFIA 3T34A 3HPRA 1J99A 2VH5R 4CT4B 2R44A 3TRFA 1DOAA 4M9ZA 3VNVA 1KI3A 2ZS8A 3OFNA 5FBRB 1M34E 5CM9C 3UIEA 2QMHA 3T1TA 1YRAA 4AKEA 2DYKA 4NCHA 2PT5A 4DLTA 2QBYA 3B6EA 4G1UC 5EE0A 4XTRA 4F91B 4BZQA 2WVJA 3JVVA 4AYXA 5DHAA 2R2AA 1QHHB 3LV8A 3FYHA 4Q4LA 4F4JA 1D6JA 1S9HA 1NVWQ 1XXHB 2GJAA 4MRRA 1DAFA 2ZUCA 2E1RA 2W83A 4PC7A 2QROA 3BK7A 1G19A 1UFQA 4TQUS 4XIGS 5A0FA 3EC1A 4YMSA 5A4JA 2WAXA 3LBHA 1D2NA 2BKEA 2YWGA 2JLZA 3R9XA 2AL7A 2JLUA 3SN6A 3ZDQA 3CR7A 4RZ2A 3AEZA 3CRQA 4Z1MD 2QAGA 1NY6A 3CX7A 4CDGA 2IWHA 4IXNA 4GMDA 2CCGA 1KI6B 1E2HA 2RKOA 5JRZA 3PUXA 4WIAA 3ICQB 4DLUA 5KSPA 5KNCA 1N6LA 4L15A 2ZRGA 2RAPA 2NPFA 4TL8A 5AWFC 1W0JD 2N42A 5JI3E 4A0FA 4TT3D 3WHLA 2AXPA 3CX6A 4LX0A 3KKNA 3C15C 2J87A 2DBYA 1XCPA 3VNUA 1E9FA 1RRFA 4C0BA 2P6RA 2FF7A 4JBWA 1G7CA 1RRGA 4Z51A 2MSCB 4BASA 3GLFE 3TE6A 3GJ8A 2JLRA 3EZ6A 4URXR 2EQBA 1UEJA 3D7MA 4JL6A 4WXPA 1AZTA 4HLUA 4GP6A 4G01B 3LBIA 2IYWA 3SR0A 2CL0X 4IOMA 5CIWA 3RC3A 3F5FA 2QE7A 5FH9A 4QM6A 1XRJA 5JJLA 1DADA 2W6JD 4WZBE 4DLVA 1XEXB 4C0SA 5CDFA 2G1JA 4J0QA 2R8RA 4MDFA 1NRJB 2G1KA 2PLRA 3AF4A 3C8UA 1EWRA 1OB2A 1W0KA 2BBSA 3L0OA 1NG9A 1EFRD 1R4AA 4YDHB 821PA 2IK8A 1KO4A 1NVUQ 1MO6A 1E4VA 4IVQA 5GJBA 3LX8A 2W0MA 4TMWA 1DG1G 3BWDD 1E2JA 4UJ3A 4CYMA 2O0JA 2VL7A 1JPNA 1AGRA 3RRMA 1HE1C 1ZM2A 5B30A 5C2JB 3VR2A 4DT1A 2DY1A 1UBFA 2AKYA 4OK5A 4C0QC 4NYJQ 1YR9A 1NP6A 4R2HA 1SXJC 2WWYA 3C7KA 4WAUA 3U4QA 1BYUA 1JXMA 1SVMA 4DDTA 2AWNA 1ODFA 4DCVA 4HB0A 3FFBA 2A5DA 4OI2A 4JL8A 4QHSA 1Q1QA 2PZFA 4WVFA 2IYXA 4W7SA 4A0HA 1ZP6A 2BWJA 2R65A 1RIFA 2GVDC 3AF1A 1O3YA 2Q9BA 4RFVA 1KI4A 1A5TA 3QIAA 1IONA 2BBTA 2JJ8A 1E1RD 1Q3TA 1Y63A 4IEIA 1XZPA 1GKYA 4PTLA 2VP6A 1LF5A 2ZS9A 3QQ5A 4RVCA 4LV6A 5HR5A 4WW0A 4PHGA 1JAIA 1XJQA 3RS5A 1E9SA 2JDIA 1CIPA 2OE2A 5E7MA 1VG8A 3BB1A 4GZLA 4LBWA 2WOOA 2ZI9A 3W3AA 1ZD8A 4K8OA 1CRQA 3K70D 3QVVA 1T8TA 4US0R 3U44B 1JJVA 4NONA 3THXA 1A7JA 2A2ZA 1KK2A 2OG2A 3TK1A 2VP0A 5F2EA 5CJ2A 3A1UA 3VU9B 3IPXA 4GSYA 2AWOA 4PFSA 3SEAA 3TKLA 4A2QA 4RD0A 2Z6VA 1XTQA 1OHHA 1G3MA 4TT3A 4EPXA 2C9OA 3SJCA 3B8HA 1NIPA 1NMZA 2GF9A 2BC9A 4L8GA 5FL3A 3RS4A 2I1QA 2FNAA 4NDZA 2Z43A 3GJ5A 2N46A 5EP3A 4MA4A 4S35A 3EX7C 3ZS8A 2FPLA 1U9IA 2ZITA 3FFAA 4M2LA 4DSTA 3U3OA 2HV8A 2GNOA 4Z8YA 1MOZA 3R20A 1TMKA 1WE2A 4KO8A 1CR2A 2ZJ2A 3QPWA 4ZKDA 1U9IC 1H8HA 2OZEA 2BMEA 1VMAA 2J0QA 1I4LD 2O0HA 3PUYA 1YZNA 4M1YA 3U44A 4LUCA 3E70C 3THXB 3K70B 2C03A 2VHCA 4TN1A 1XXHE 1G3QA 1K8RA 1NVVR 3I4LA 4LHYA 1EGAA 1M74A 4FXPA 4HLCA 1DAEA 4I1UA 3EC2A 3QEJA 4IDPA 3SYLA 1L4UA 4D81A 1UBCA 3I8SA 3RABA 1GDDA 2WZQA 5IK2D 2VEDA 5KO2A 1FQKA 4UNPA 2DFNA 4CEHB 3AB3A 5KNBA 3BJIC 5GVSA 2RH5A 3LLMA 1XJCA 1ZNZA 1G17A 1E0SA 1Q20A 1MR3F 4OI4A 2WOJA 3QBVA 3EPJA 3ADCA 1GNRA 4C0AC 5FOSA 1S8FA 4IFEA 5G41A 5AJZA 1Z0KA 1Z07A 3GQBA 4MGZR 4U5XA 1FW6A 4V0MA 3U7GA 2ZU6A 3HYRA 2EWWA 4QG7A 3R7WB 2ZRLA 4NU0A 3MLEA 1NSTA 2ZE6A 3FMOB 2WWFA 1CBUA 3LQQA 1AM4D 2Q3HA 2RGCA 4LGMA 4ASUA 4TMTA 1K5GA 3FHOA 4DLYA 5EUMA 2F1JA 3PEYA 2XNDD 1RKBA 1X1RA 3I5YA 2A5GA 4KXFB 4DDVA 4TTQA 2FMXA 2QGNA 4BFSA 4DEXA 3THYA 2DFLA 5DYIA 2IA5A 2ZVQX 721PA 4V0NA 1PLKA 1XCMA 4EDHA 4D25A 3VFDA 2OESA 2GXQA 1GZSA 2ONKA 4P4SA 4B3GA 3NEJA 1KSFX 4EIWA 3ADBA 1CJMA 1GRNA 1Z6YA 1PV4A 4AY2A 1WA5A 3B13B 3GJ3A 1CS4C 1TU4A 3B1VA 4PXAA 5D3MB 5G40A 5HCIA 4PC2A 1M6NA 1N5IA 2ECKA 4IKEA 1XTIA 1KOFA 3W90A 3K0CC 3OIYA 3GLFB 4Q4AA 4DUGA 1UDXA 2IXFA 4Q47A 3CM0A 1D5CA 4JYCA 1AGPA 4MKFA 2HJVA 2OBNA 3U2QA 4DCNA 1E1RA 1OYYA 3K0FB 4YMTA 1LNZA 5FTJA 3K9LA 2ODEA 5FI1B 2OAQ1 1XFAA 4QJ5A 4DSOA 1AS3A 5DNYB 2QZ4A 3ZD7A 2FZ4A 4FMCF 1BMFA 3CRRA 4GPTA 2XAUA 3IHWA 3T61A 2C8VA 3ZH9B 4MKHA 3ND8A 2CE7A 2WV9A 2LKDA 3K8YA 4WA7A 1Z47A 1LTQA 1ZIPA 2YOHA 4YLGA 1E2QA 5CITA 4PQRA 2GCOA 1G6HA 3GD7A 5BXQC 4B3CA 3RC8A 2J0VA 1KYIA 1SXJE 1DE0A 1WRBA 3G82C 3TVDA 1SXJB 1PJRA 4NCIA 4PSVA 5KOYA 3CRMA 1N25A 3LVQE 4YC7A 1FX0B 1G16A 3DKPA 4Q4AB 1FZQA 1EX7A 1R2QA 1VPLA 4M9QA 2RHMA 4F38A 1MKYA 1OIVA 4OHYA 1ZINA 1YKSA 1Z0JA 2WJIA 4Q7LA 1W4AA 2LWIA 5KSOA 3KZ1E 3E5HA 2CEAA 2YC4C 1XMSA 4R98A 4I1SA 5E7IA 4NYMQ 1OXSC 2DWPA 2H1LA 1JR3A 2NO1A 3MGCA 4KFSA 2XXAA 1U0LA 3DZDA 5CK4A 1XCGB 3GJXC 4JS0A 4NYJR 3CH5A 3TMKA 2ZIAA 2ZYUX 2Q9CA 2QPAA 4BLSA 1Z28A 4IHQA 1FNNA 3FB4A 3HWSA 3RRNA 3K0EA 2JJ2A 4A1FA 4B71A 4QGFA 3WNBA 2IS6A 1KMQA 3BOSA 4LDJA 2GCOB 3UG6A 1J8MF 1KI7A 1YR7A 1VYTA 3EIQA 2ZM5A 4HZIA 1KZ7B 1ZNYA 2V54A 4TYYA 1DBSA 2QPOA 4W5HA 3T5GA 1R0YA 1FX0A 3ASYA 2QSZA 1I4DD 3KJHA 4M4SA 4TLDA 3C16C 2PBRA 3EXAA 5FR1A 5TV2A 1SVWA 4GZMA 4DC9A 2SHKA 3M1IA 4PZZA 4PSKA 4JMPA 2YVUA 2IXGA 3U3RA 3PJRA 4LV8B 4EAQA 1XD2A 3EZ7A 221PA 3M0EA 1P73A 4Z1MA 3R9WA 3DM9B 1UF9A 1CKEA 1N5LA 4KITB 1N6KA 2XXAB 1Z83A 1C1YA 5BQ5A 3AVTA 1U90A 1EG7A 3LW7A 2IF0A 1GITA 1N5KA 4TL6A 1IXRC 5DHFA 4P31A 1Z6GA 2P2LA 1WMSA 1NJFA 4TLAA 2QT0A 2YYZA 1ZUHA 1TF7A 3EWAA 4WOPA 4DZZA 3NBZC 2Z4RA 4P33A 3FDIA 3G5UA 4ZV4A 2BJVA 2CHQA 2VP2A 3PQCA 4OK3A 4BRWA 4L5BA 1DPFA 4LJAA 1TF2A 3IBGA 2O8BB 1S1CA 1XD8A 3MWJA 1KHTA 2WSSA 3OZXA 1Z63A 5AUQA 4BFTA 5FOTA 2IEYA 2EFEB 4KODA 4TWZA 3B60A 3B1ZA 4QNRA 2BOVA 1JB1A 1LV7A 3NKVA 5JHHB 4KBGA 5EE1A 1U98A 1YZGA 3W3ZB 1GL6A 2GTPA 2PMDA 2HLDA 2FU5C 4JLVA 2D74A 4ON9A 3W34A 5JHGB 3L43A 2VO1A 1QDEA 2XOKA 5HZHA 5FUXA 2CMKA 2Q9AA 2CXXA 4D26A 4RY2A 3PCRB 4BFZA 3AGQA 2IWRA 4ZDJA 5AUNB 2X1VA 1GP2A 1AA9A 2FFQA 4FN5A 1US8A 2X2FA 2ZEJA 1OFTA 1GL9B 4K46A 4BLTA 3QKSB 1SVKA 1Z0AA 3Q5EA 2NIPA 1FMJA 3FTQA 1TEXA 3ONWA 5CYOA 1V5WA 2NZJA 1VG0B 3Q9LA 4X8OA 1NLZA 2Q3FA 1E2MA 1TQ2A 4OHVA 3V00A 2ZRFA 3AUXA 4B6FA 3UMRA 2QG6A 3H86A 4GOJA 3PG5A 3WNCA 2PEZA 2KWIA 5J4YA 4H1VA 3TSOA 3GFOA 4A8JB 2GHIA 4D4KA 5C1BA 2ZSFA 1Q12A 4LHXA 1W0KD 1TQDA 1G8HA 1SHKA 2XOKD 3MD0A 3RRZA 3SU8A 2DHRA 4JVMA 4JIMA 1G20E 2QGZA 5DISB 2FA9A 2ZRKA 2C2HA 3I92A 5B2ZA 1CJTC 4TL9A 2W2TA 1HQCA 4KJZA 4A4DA 1VYUA 3IDQA 1W36D 1L7VC 4ACAA 4HUQB 1XF9A 2CNWD 3LY5A 4LJ6A 4L4UA 1R5NA 2DCUA 4D2IA 3JZAA 3QOFA 4JZKA 4NCNA 4RZXA 4HI0E 2IYYA 1E9AA 5GJCA 4BFUA 1W47A 1E2KA 1KDPA 3DO6A 1ZNWA 1T0HB 1SHZA 3VR4A 4KYUA 3KUCA 1W36C 1XP8A 1E1QA 1EFHA 2D4HA 4Q9JA 5TVKA 1OFUX 3C5HA 4FI3C 1XX6A 4DB2A 3KUDA 1QHHA 3KJGA 2QL6A 4QHTA 1P6XA 5L3SA 4HAVA 3W8RA 2ZANA 4NP6A 2BHRA 4A92A 2ZPTX 3KB2A 1KZGB 1JBKA 4OQXA 4JSTA 4TMZA 2NOAA 4OJKA 3ZVLA 1NN1A 3CR8A 3K70C 1D9XA 4JKYA 1T3LA 3KTAB 1XTJA 2WPDD 2NQ2C 2WAYA 1JXOA 1BYIA 2WWHA 5FBQB 3RRYA 1TAGA 4N0EA 5FL7D 4RD6A 2QAGB 5AK0A 4ZI3A 1VHTA 2G6BA 5EZ6B 4NZYA 4LYHA 4B76A 2J46A 2ZJYA 1DAIA 4MGKR 2P6UA 2AD5A 1R8SA 2HCBA 1G8GA 4DHEA 2XSZD 1P2UA 4QBGB 4NYIQ 6Q21A 3WP1B 5EE5B 1UBEA 4C4PA 1GNPA 2QORA 2ZJOA 3K9GA 2ZROA 4LJ8A 3GLHB 1M7GA 1YJ5A 2V3CC 1KMHB 1J90A 2GK6A 2P5SA 1NKSA 1WF3A 2PX3A 2ZUBA 1FTNA 3QPUA 5IF9A 4B2LA 4O2LA 1XPUA 1GG2A 1MO5A 4RCZA 4XOIA 2GA8A 2XTZA 4C2TA 3ZZ0A 4BEBA 4TYPA 1XD9A 2IYQA 2ZSBA 4IEEA 3ZZUA 1IN5A 3QF7A 4MGYR 1F48A 1Q22A 3MRSA 2JASA 3WY9A 4JLOA 3U60B 3Q7PA 1YZQA 2VPPA 3RS2A 2AFIE 2DR3A 4Q9IA 3SFZA 1NN0A 3KXIA 5SZJA 1XEXA 3OAAD 2Z83A 3SE0A 3WNDA 4I4LA 5GJWC 3I3SR 5L3QA 3IIKA 1KY3A 4IDHA 1DS6A 2AHOA 2X8AA 3P4XA 3BE4A 4UNSA 4YMVA 2W0SA 4ESVA 1HEIA 2NGRA 1U99A 3LX5A 2LCFA 1S1MA 3RVBA 5JWRA 5JRJA 4XD7A 3A6PC 2VQSA 2QTVB 4XVRA 2JGNA 1OIWA 3ZZTA 1G5RA 2C77A 1Q3HA 3ZQJA 2CLCX
chains in the Genus database with same CATH superfamily
4TTPA 5C8VA 3P1JA 4G09A 4AZ0B 3NYRA 4INOA 2NVBA 3FUXA 3T7RA 2NXCA 1NTOA 1Y3FE 1P91A 3QU2A 2QU8A 4IS2A 4PLFA 2BFFB 4K81B 1WV1A 1P2DA 4MJ7A 1DOHA 2O59A 4MAMA 2QD4A 4WNYA 5CPBA 4D8YA 2DPXA 2F64A 3QFSA 5FBLB 4DGSA 1RI4A 3WL7A 4ZQHA 1TA4A 3B5IA 5E9AA 3Q9SA 2FGJA 3AZOA 2DERA 2BKVA 2P4UA 4IFIA 4YPVA 3IXLA 5DMHA 1QPGA 1YHNA 4KIWA 3R5HA 2IV7A 3U4DA 5BMVB 1ONNA 4DA7A 4Z9BA 3EPKA 1X3SA 1JHZA 3JQFC 4JBNA 3GI1A 4BGUA 2DMRA 1NASA 3IQHX 3RSHA 1UC4B 3WYBA 2OOSA 1RYZA 1U9CA 2J33A 5SICE 2EW2A 4XCQA 1HH4A 1U8CB 1IHUA 2HNBA 2OC9A 2QYHA 3CVJA 1IDOA 4XSGA 2EYUA 4AULA 5C18A 1O95C 3R5KA 1EXDA 4O33A 1DKPA 4Q1FA 3ER6A 4OM8A 3RARA 4LJRA 4KCGA 4C03A 3TH5A 3ICPA 4F7WA 1C3JA 4FHCA 3O9VA 3DE5X 1JF8A 1OBFO 1WDTA 3JVIA 2QPLA 1OILA 5A5EA 4JWTA 4KRYA 4P3NA 4B2YA 1U2EA 4JBXA 2VDLB 1Z4NA 2ATVA 3QKTA 2FW9A 1RKUA 3HB9A 4UQLA 3ECSA 3NOVA 2H5LA 5CHEA 1SUDA 3NRCA 2FUNB 3RTCA 2AFHA 3LX6A 3ZV5A 2WWWA 1R5BA 4DCJA 2XMDA 5CFQA 1JKFA 1JWBB 3MJSA 5G4KA 3IUNA 3EXEB 1EWKA 2AOVA 2RGAA 9LDBA 3AEUB 4JLAA 3D9QX 1E7MA 3VU0A 3AUYA 5JE8A 4AICA 4BP1A 2ZUFA 1M73E 4EUFA 2OCDA 3RFFA 2CCJA 4EF5A 1Z06A 2Q46A 2WHPA 3AWDA 3K73O 3R4CA 4FMDF 2OSBA 1ULBA 3UV3A 3V7NA 1Z0FA 1G291 3M8KA 2H7XA 2PMWB 3PC8C 1OXTA 4Q4HA 3G13A 1EZ4A 5ALRA 3V4LA 4IDAA 3R6WA 3TR5A 1RLMA 2JLVA 2XMSA 5IH3A 2V6IA 1Y6RA 4Y1RB 5ALZA 3NEYA 2HWXA 3FNRA 2VBIA 4MUHA 2C29D 3F5DA 5C53B 1K6JA 3D4OA 3LLUA 3KQNA 5JSZB 1FP1D 4EGQA 1JDSA 3G0GA 3QXHA 4ZU6X 2IEDA 4WZZA 5JD5A 1TVCA 4QGAA 1NNEA 3LT1A 3CN7A 4P9NA 3NTRA 1RU3A 1MOSA 5EC8A 2ODQA 2M6RA 1OUMA 2W2KA 5IT4A 4DKXA 5LPNA 1SCNE 4EGCB 3IPCA 3RJZA 4GIBA 2WZBA 3STVA 3U61B 3CLUC 1P7WA 3B6ZA 5ARDA 1RYHA 3LQ2A 4C5AA 1RC1A 2H9YA 4CLHA 1JR4A 2D3TA 2H0AA 4DYHA 2BDEA 7MDHA 1QLJA 1DNPA 2GRUA 1UC5B 2HA0A 3G0CA 5L3VA 1RQLA 1XLTC 4JJ4A 5E95A 5JOQA 1UKCA 1Z8HA 4DXAA 2R6AA 2WSMA 1M76A 6ABPA 3PIRA 4P93A 5IAKA 2X58A 3E84A 3N8GA 5JAQA 2DXIA 1PX0A 4GAEA 4DLBA 1M1ZA 2XQKA 1JVBA 2GZDA 2I2XB 3GMDA 4PQYA 3KEOA 4ZTZB 2YJ5A 3DDOA 3GLKA 4PYIA 1SBNE 2JLQA 4ER5A 3PEWA 2JJMA 3ETGA 4QU8A 2Q41A 4UTXA 4DWJA 3FCOA 3C3AA 3RREA 1GHTA 3TQSA 3ZLJA 1IUPA 2W2MA 1A4RA 4LQLA 3UAWA 3S1LA 3SD7A 3VTKA 3RBVA 1DRVA 3AR9A 3O8OB 2VDRB 1EK2A 3OT5A 4L0DA 4L9SA 4BO4A 2C7GA 1QRAA 5I3CA 4PGFA 2XHEA 3GDFA 1FTGA 1YU6A 2FUKA 3ONDA 4ONEA 3BMCA 1IHYA 2VA9A 3RUDA 1QCDA 3UB3A 6REQB 4AZWA 1DBVO 1FU4A 2TMDA 5LJIA 1T9GS 4X8HA 1RZVA 4NFLA 4PZCA 1AU9A 4B7UA 2VP4A 4JNKA 2XH8A 1JSRA 4E2ZA 2VHZA 4K9DA 4NEGA 3RD5A 3RGWS 2HO4A 2HRBA 3HO1A 3NKFA 2XJ9A 1M34B 2TECE 1ZSNA 3SFTA 1G2OA 1OTXA 2EKQA 2ZBEA 4OBXA 4UTRA 1TZMA 2QUAA 2VOEA 2VPYA 1OQAA 4M0DA 2O50A 4NQZA 4JJZA 3TSCA 2ZAMA 1N5OX 4R2KA 1LI4A 1KDTA 2OGSA 4KQHA 4R7GA 2PUBA 4NENA 1AO3A 3QVTA 2WT9A 1ZOOA 2BUAA 2ORED 3AEKB 3BSYA 4MIOA 3UHJA 3ROEA 3AF0A 1CK4A 5JC1A 5G0SA 3T0GA 4ZDWA 1LQ2A 2EW8A 5DYTA 2H17A 1JPUA 3RS3A 1KEZA 4JXKA 3AFHA 2C2OA 2QLJA 3G89A 4RK0A 4RELA 3UFXB 1IYZA 3F7MA 3HB7A 5EKUA 3O8CA 1AGYA 1KP3A 3L79A 3EGEA 3BD6A 1ZGBA 4PZ9A 2WIKA 3CG4A 4JOBA 4LN1A 2HMTA 1GV0A 1ODJA 4OJNA 2ZTSA 3RRJA 1HETA 3BICA 4ENPA 2R68A 4LHWA 4WJKB 4D3FA 1PQPA 3B70A 1RS0A 3T1VA 3QF4A 2ZYIA 2DKNA 1LKZA 2EWVA 3IHLA 4LFBB 3OJFA 2ZRNA 2PQ2A 1MB9A 3RVNA 2VDOB 1L7RA 4V0QA 3OHPA 4BV9A 3SE7A 1ELOA 2ODWA 5JJKA 2IPLA 1S3SA 2Y9MB 2ZYTX 3BKXA 4PO9A 5TMEA 4X71A 2VTBA 2R00A 3PC4A 1WPXA 2BMFA 2OM2A 4QL3A 1THGA 4LVUA 4WKGA 3PGMA 2CXSA 3B2NA 1B7GO 4Y0VA 3ELBA 4MI1A 1VBKA 1ZNXA 3KAPA 1A0OA 1NI4B 1Y4UA 2BZSA 3IEPA 4UEJA 3T99A 1ADBA 2Y0PA 2VBCA 1BX3A 3FMVA 3I01A 1XZCA 4YAEA 1SK9A 4F4UA 4RKFA 2YWDA 2H1SA 1RHJA 3T9EA 2PL5A 4RBNA 3ZYZA 1GNVA 5KYWB 1MABA 4PSDA 4EKIA 2NADA 2HNAA 4OJQA 3T6KA 2IYSA 4DR1B 3S8EA 1QTQA 2VI5A 1JILA 3WIOA 4RK6A 3GXOA 2D3WA 2C9BA 4E6EA 4HN9A 5EVCA 4RHCA 2ZYWX 1VLQA 2H3HA 2ZJBA 1YDGA 3D6TB 3E9YA 2BGUA 4IDEA 5K8CA 1XT6A 1Q7CA 1E79A 1WD5A 2HRDA 3KQYA 4TT8A 4O4IA 3OX1A 3OEEA 3NC0C 4Q9AA 5TJ9A 4HX2A 3Q9UA 1RAIA 3PYMA 3DB1A 3WRWA 4LAFA 1WZEA 4HB3A 4OB7A 1XDBA 1O8BA 1BE0A 5DBEX 4Z0PA 4G3XA 1G4HA 1PW5A 4XE5A 1AMNA 5EINA 1KQOA 5K03A 1DI0A 2DR0A 4UQOA 5B4VA 4GPZA 3RUPA 4I55A 3DOHA 1VGQA 3HCPA 3TDKA 1V16B 1Y81A 3L6RA 3OZBA 4ZT2A 4NATA 2D13A 3JQGB 2WFAA 4Z2AA 2PWYA 1U0HC 5ALJA 5B64A 3T9BA 1DMRA 4LI0A 4RV9A 2O57A 3MUFA 4R1SA 1PL7A 4RKEA 1BEEA 4XPZA 3WX0A 4MWZA 5JYEA 1OX4A 4LJ9A 4Z99A 3JSAA 3U9TA 3ZQ4A 4QDKA 1KEPA 3Q7RA 3QZUA 4YDRA 3FLMA 2VWGA 3V4SA 4KN6A 2H0RA 2HLPA 5J5CA 1DLIA 1TVKA 1JEDA 2JFZA 1SHTX 1ZA2A 2JIMA 2GSWA 3DO5A 3IQFA 1IBRA 1KC1A 1U8TA 4QSMA 1XGKA 2GXUA 5B7QA 4RE5A 1OV4A 5D5QA 3X1XA 2P3SA 3FPKA 4L5IA 4BRUA 4D0SA 4C3VA 4EUKA 3G9XA 2SKCA 4HNQA 5B55A 5BSEA 1G5TA 1WVGA 1V39A 4FOSA 4ZV9A 2OZPA 1PSWA 1TADA 3LUHA 1Q95A 3V4PB 4J1TC 3L7OA 4U2KA 3N2LA 1X1SA 1T0BA 4JCCA 1A9XA 4J1SA 3GJQA 2YN0A 3U7EB 3HMKA 3JAKA 4RETA 1M2KA 1OLOA 1L5QA 5EERA 5F33A 4R1UA 1EFVB 1T34A 3O7MA 3PJRA 1DKNA 1E2EA 1YBAA 1JAZA 1DIGA 4Y2SA 5K2OA 2X2OA 3HB1A 1XD2B 3C45A 1J8VA 5IK2A 4YCAA 3JQPA 1XU9A 4UREA 1V25A 1HTWA 1MJHA 1RM4A 4HMOA 3M3DA 1KOGA 4ER6A 1BXGA 4B4WA 2HGSA 2XUPA 3ABOB 1VLHA 4GI5A 4Y1EA 3VO9A 4W5NA 2ZT8A 3IP6A 4H4CA 4IQFA 1FTWA 4EEKA 3IAEA 4IJUA 4OIFA 4PE5B 4XVQA 4AT1A 1XDGA 2R8OA 3MWLA 3T1QA 1R12A 5REQA 3LGSA 3VHRA 2H4XA 3RVLA 4HDNA 2GBLC 2HB6A 3TVTA 2W2PA 1V1RA 3ZHZA 4UPVA 3U81A 5JALA 4O3MA 1CCWA 1JMYA 1VHWA 3B51X 3JS5A 3IC5A 3KWMA 2H31A 3H1FA 4DCSA 2H0QA 4HX9A 1M1YE 2CUKA 1QDLB 3I3OA 4RPGA 4W5WA 2QSYA 2I03A 3UHAA 4AUMA 2VDKB 3GMTA 2R62A 3OM9A 4PX9A 3WIBA 3BD8A 3UAOA 4CUZA 4F4FA 4W6QA 3SQMA 1UZAA 1MB0A 3IHTA 5LP6C 2RGWA 2BGRA 2ZVPX 5I9SA 2GCEA 1JHUA 3I45A 4PO8A 3L05A 5KHAA 3ZWAA 1OBOA 2JPDA 1MBZA 13PKA 1QYCA 3DZ8A 3LJKA 5FBHA 3UMBA 3JD1A 2AC2A 1OAAA 5A7HA 2H07A 4CG3A 2HK7A 2WIAA 5CJPA 1XPOA 2P1ZA 4KO1S 3OBBA 3WLPA 5DYWA 4OY3A 4UNRA 1TNDA 3IERA 4OU4A 4ZP1A 1IUNA 2IZZA 4JQOA 3KUXA 3NWJA 4NYMR 3SBDA 1B0UA 4DPKA 4F3TA 3T0IA 1DAHA 4E33A 1LBSA 1V6AA 2QRUA 4BFTA 1UMDA 5ELXA 2Z58A 1H05A 2OMKA 3K1YA 1QGDA 1IEWA 4MGHA 4RMGA 3BULA 1DELA 1XA4A 5T6MA 2OUKA 1EHYA 5HKBA 1NMXA 1O0SA 5CPFA 5LJLA 2OBYA 1GA6A 4XSHA 2FP4A 1TX4B 4ZT7A 3A7DA 4HRAA 5AVSA 2O8CA 4HUQA 2J9RA 2ZB3A 3TQRA 4G56A 3B3FA 3SC6A 1LLUA 4IVPA 2NT3A 1NSYA 3EW9A 4FFMA 4YJ2A 5LM3A 2Q49A 4U9HS 4UBNA 1OZFA 2RHHA 3EWSA 2WWRA 2PTHA 4PFQA 2AKEA 3SQXA 5DE3A 4R68A 4KR6A 3RTEA 4IXDA 1R00A 1YOBA 4FINA 2GBGA 4KH0A 4NQRA 3ELUA 4TVOA 3KU1A 4IDBA 3S5UA 2FR1A 4PAGA 3BL5A 4G65A 3QE0A 1L3IA 3R77A 1GGKA 4YPFA 4BAZA 2P6PA 1DQSA 2BEVB 2EKLA 1G4UR 1YZKA 3LUGA 5E4YA 4UM8B 2WD7B 4J2HA 5LDHA 4MR9B 3AR7A 4OQEA 4EW1A 1HV8A 3N58A 1MAUA 4JU8A 1ZRNA 4N48A 3KQUA 4CM3A 4Q3KA 3GCWA 3H9GA 4UHFA 3R3ZA 4EWLA 4GBED 1KZYC 5KDDA 2ZRPA 3IO3A 5FO0A 3PC6A 4G0VA 4JLWA 3SDBA 3D4LA 1GA1A 2CJWA 2WT4A 4KZPA 4MQBA 4PS1A 1CUWA 4GOXA 4J0GA 5LN1A 3EZFA 3DV0A 1A4XA 1AGNA 2QR2A 3G9TA 1PUJA 3HRHA 1YWGO 4R9RA 4X7RA 5E6RB 5K99A 2ZUTA 4G5GA 4NNPA 4G4SP 5L9AA 4MDYA 3TI9A 3ILHA 2PVSA 5F64A 4ZIRB 2OO5C 2JAQA 3HS3A 3O3MB 4HL6A 4XVCA 1N2ZA 2AHRA 2P9TA 4NXMB 3GBVA 2B34A 5L8VA 1Y89A 2ZWPA 1CFZA 2EWMA 2XA1A 3RKSA 3SYTA 2GFQA 4ID9A 1HURA 1YQ9A 4KVZA 4EJSB 5EJ8A 4BLOA 3M1LA 4JQYA 1Q7BA 3HNRA 1L7AA 2ZCVA 4F3RA 5DGHA 4N6GA 1J2UA 3DP7A 3Q0IA 2YIDA 4LRYA 4P3YA 4DCCA 2V3WA 1YB4A 1XHLA 1R37A 1T0IA 4CF4A 3D3WB 4LGVA 1JECA 4ARZB 3F7TA 2QTRA 1F1BA 4K26A 1P2TA 1ND6A 3D1LA 2AUNA 1HR0B 3M89A 3RB8A 1QFMA 3DBRB 4M1QA 4XARA 4P0PB 2R5WA 3A1TA 1FVFA 2WSBA 4EPVA 5IJZA 1XPRA 1ETUA 5PNTA 4DQUA 2M9MA 4CQMB 4MV9A 3L6DA 3VPGA 4NBRA 3KALA 3U16A 1ENPA 4NOJA 2HEGA 4WN3A 2PD3A 4XLTA 1SK8A 3IMFA 4BNYA 1NJ1A 4DJJA 5TC4A 5BWLA 4EFDA 3DMHA 3NNNA 4G2TA 1UJ2A 3TBFA 4BCCA 3GBPA 1M2HA 1ZH8A 2IW1A 1Z3CA 1GGHA 1UBMS 1GVHA 3A1SA 2O3SA 3A9WA 3FJYA 1Z4KA 1N2SA 3L7NA 1OE0A 1LRLA 1Q21A 3S1SA 2Q4DA 1LBHA 2JIBA 3HUTA 4MRVA 4BYGA 3HHPA 4KPUA 1J7JA 3WLIA 4L2IA 2C20A 3DVRX 5C7LO 3E7DA 5TMDA 1L7BA 1SCIA 2OB2A 2VT3A 2XRYA 3OIUA 3VOSA 2DFKB 1CEYA 4QARA 4EG5A 2F3QA 1JU3A 3S2YA 3T1YB 2ILTA 3CTMA 1K27A 4JA2A 1CD5A 1XTPA 1Z7EA 3EVCA 1T3HA 1KSHA 3LTEA 1NX6A 2R60A 3AIOA 3IOYA 1IFXA 4FCTA 4MW6A 1ZGJA 3MRVA 1XJ5A 2WYWA 1A7AA 3EFOA 3ZD9A 3H5NA 3RODA 3SC2B 3WV5A 3ZK7A 4A6XA 3WLAA 2QX7A 2OCPA 2A0FA 4JUFA 4CGZA 4V3CA 3FTEA 4CM8A 3RS8A 1PLLA 2GD0A 2JKZA 2Y0BA 3WLLA 1OWOA 2IV2X 5KOHA 4EG6A 5H3HA 3SICE 1AKRA 1DL5A 5HS6A 5I51A 3NHYA 4K6CA 3TOCA 1QZUA 3AF5A 4UD2A 4EPYA 3ZHSA 1Z08A 1LDEA 5KHOC 3OF3A 2HPZA 4JLNA 1SCUB 3AESA 5TGTA 4EX7A 5C37A 4IO0A 4FOPA 2MSWA 1IATA 2W6MA 2I29A 4RDIA 4KXXA 3VI4B 2QI9C 4LTDA 1QVWA 4HF7A 4TVKA 3ZBQA 4DIKA 1EWTA 4EB0A 3T5DA 1A97A 4OYYA 1SVOA 5KIAA 4Q37A 3NCTA 5CCDA 4F2WA 2ODPA 3GHYA 1OIXA 3GMSA 3H8VA 1V6CA 1W4RA 2WA1A 1IMJA 1R6AA 3ELDA 4G5FA 4GMKA 1NY5A 4HAWA 2X3YA 3T7SA 3HNPA 4UOQA 4EFMA 1G3UA 3IEMA 1IWBB 3D3EA 3GZJA 4Z3DA 1ARZA 3KOUA 5CX1A 4BMPB 1VGVA 3IE1A 2IH2A 3HFJA 3PHHA 4X1YA 3WRYC 4IV5A 3ZXSA 1B41A 4CEJA 4P98A 2Q7DA 4BO9A 2QX6A 1FK8A 1NUSA 4JIGA 2IUTA 1UBGA 4BGDA 4NTZA 1RWMA 3H5LA 3DUFA 3IRVA 4ISCA 1MA3A 1SGWA 3C98A 5DOVA 1IBLB 1SUFA 4KR9A 2BYTA 5JC8A 3L0IB 2QE6A 4Q4JA 5B58C 2W2LA 1ZONA 1EE1A 4ZAFA 1MJGM 2RH4A 2RIRA 1Q84A 2ORYA 3FIUA 2UZIR 2ZSUA 3O8LA 4G8CA 4PWZA 2Z3ZA 3MNFA 4ZVRA 1LRKA 4BE7B 1DZ3A 4REQA 1EVLA 2QN2A 3Q3IA 4OHKA 5DK4A 1CUFA 4AZTA 2OAP1 4ZKEA 1IWOA 2L19A 4MW9A 4N82A 4FTWA 3HA3A 5LU8A 3IILA 2JBWA 3DMRA 3PT9A 3OEYA 3D3NA 4DIDA 2O6LA 3OF5A 2ZXFA 2D06A 3RC8A 2BJHA 3T5PA 2ZR8A 2H18A 2YHUA 2IEZA 4RSMA 1IM2A 3CZ9A 2FW8A 2RHWA 3IS3A 4BBZA 1M2VB 1P1KA 2VH2A 3BMOA 2P6NA 4HWPA 4NL4H 5F3WB 2IU4A 3HN7A 2HRQA 2W93A 4YP1A 1IXSB 4CKCA 4JITA 3KKMA 3KZVA 3PA6A 3T1HB 3LK6A 2M1ZA 3DE3X 2Z5GA 1GEGA 4Y18A 3NRJA 4XAQA 1Q0RA 3FDZA 1R5OA 1NULA 3EPLA 3ITNA 1A8HA 4DWVA 4TMYA 3FPFA 1QG4A 2CNNA 2IP2A 4POAA 2ISSD 3I2KA 1QRDA 4ZREA 2IPMA 4RHYA 1JUDA 2WY2D 2ZRBA 4ZO8A 4UVGA 5K3FB 3JWPA 3RIYA 3LWDA 5BNZA 4WNAA 4WACA 3SYNA 4PR3A 3NPMA 4IGEA 2HA5A 1NDUA 3O9MA 2OVFA 1Q6ZA 1CUEA 2FPRA 4PICA 3WLMA 3FCUB 4GF5A 4MKXA 4R8LA 4XB2A 2ACWA 5LXTA 2XTAA 4Q1DA 4B80A 2JBHA 1Z4IA 3OQNA 3LP5A 2NSDA 4TKMA 2ZRCA 4E5MA 1ESDA 2C8LA 1AK1A 3L5OA 4BC1A 1N0IA 1YV9A 1T1RA 2OTCA 1XN1A 4LGYA 4PPGA 3UWKA 4C7OA 1G8KA 2WWIA 1XDSA 2ZBFA 1NE2A 1TKRA 3PLNA 2KBEA 4JFAA 2C5FA 2G1AA 3UYLA 3W4KA 1DCMA 2AIRA 1GNQA 2BM8A 3OEHD 3P4UA 3KQSA 5ALXA 3RUEA 4LF5B 3ZQUA 3OT1B 4E4YA 3CIFA 1C1HA 2NV2B 3MUEA 2HRCA 4K6GA 5HFAA 1W52X 2ZAOA 3MLAA 1KGSA 3VR6H 1FJHA 5LLSA 1ZUWA 2B4AA 3JRXA 4HPXB 3B1YA 2XZPA 3HP4A 1W48A 3X1YA 1Z56C 2LPMA 1HFJA 3BQNB 1VL5A 4L28A 1KARA 4MPJA 5DGIA 1OCEA 2ZYGA 2WDZA 1VE9A 3IP5A 1CVLA 3TKAA 3FHTA 2ZUVA 3L8HA 1X7WB 3E7FA 1IDN1 2YJ6A 1W73A 4HAXA 5KTMA 4KYVA 3AQIA 1Q15A 2R8EA 5FI3A 1TD9A 1MPXA 2DSNA 1KEEA 2NVWA 3H42B 4IH9A 2OCIA 1YZFA 1G8JA 3C4JA 3DM5A 4FFNA 3NC4A 4RTQA 2P41A 4DMKA 1QIEA 1SVSA 4QOSA 4G5OA 2GZMA 3ANTA 1EQ2A 2VJQA 4IQ0A 5J5VA 5CCXA 3HVKA 1XA3A 4DM3A 3QU4A 3GP8A 3DAYA 4L4XA 4UBMA 3OAAA 5ENDA 5K3FA 2HT6A 1GPAA 4P38A 3RSOA 3F4LA 3DE4X 1XCJA 4JI7B 1MU0A 1VZ2A 2GX6A 4W5JA 4FFRA 3T5TA 3TG8A 1II9A 3WQHA 5EXPA 2CJFA 2UUBB 2AX4A 1Y6ZA 1OYVA 4MVJG 4KQJA 4OXRA 4C0HA 4RD3A 3KEMA 3BB3A 3PPWA 2GK4A 4F84A 3AF2A 2AXQA 3F5QA 2XCTB 2GCPA 3VJLA 1S2NA 3NHKA 1G21E 1Q1NA 1S5PA 1HWYA 2O2DA 2W7TA 1O87A 2XCUA 3FWZA 1A71A 1FQJA 2ASVA 1KZHA 3V5NA 1XDDA 5JT1A 4X8MA 2GDZA 4HPWA 1M34A 1PL8A 1VXOA 4RZQA 2G08A 2KMLA 3ZDDA 3LT4A 2CMDA 3TWOA 3UUGA 3UG7A 4IP0A 3UJHA 4O0MA 1N3YA 4OSEA 3PUIA 2JJYA 3INTA 2XJ4A 4JP5A 1UJCA 2ZIWB 3VVBA 3KSBC 4PM4A 1Z17A 1CZHA 5KTSA 1L7NA 1PJCA 4JBHA 2NG1A 4KBYA 3GFSA 1Z15A 4KQIA 2ZIVB 2LP4Y 2BKUA 2RHDA 2JIZD 4J6FA 4WDQA 4XD2A 5HIMA 3VGJA 2G6TA 5LZ4A 1QIJA 5T64A 2BFDB 1Y1RA 3QXJA 2OHOA 4TKVA 1W7AA 4PW0A 3HGMA 1UPCA 3CURA 1UAYA 1SU6A 5HIJA 5D6NA 3V8NA 4N03A 3MILA 2YIJA 3OPNA 2CHVA 3AOGA 3KDPA 3QNUA 4D1YA 2FHPA 3V55A 4QAJA 2OXCA 2R4TA 2P1RA 2YWXA 4OQNA 3OZSA 3ZDZB 4TTSA 4YUWA 5LZ2A 3U3KA 4E5KA 1E9RA 4US2R 3PXGA 1PT7A 3MLBA 1DAPA 3QUAA 1ZY2A 2VTBB 3LC1O 3J81A 4NHEA 4F2PA 1CLUA 1H8EA 3E0XA 4B87A 1U04A 2GEKA 4ROSA 4BNJA 2YV3A 3IEKA 3LCRA 4GLBA 3OBIA 1ZVMA 4P92A 4YEDA 3A4LA 1P19A 3LMKA 1QWSA 1V3VA 2PX0A 1UBSB 2XKBA 4KXLA 4D42A 3PICA 5LP6B 3KELA 2CLHB 3FD8A 1EU1A 3OSZA 3IP1A 4IFBA 1I6MA 4M89A 3UMFA 1JDUA 3GLFA 3TM5A 4ZHSA 4RZ3A 1OWMA 4RXTA 4MQEA 1XZDA 1Z4OA 2HEIA 3NASA 1QRSA 3UHOA 4IRMA 4OA5A 2FDCA 4HAZA 2LDBA 1CRLA 2YHIA 3I53A 3R3SA 4JH0A 4PTYA 5IH7A 3L7JA 2G9NA 3QFRA 2Q62A 2H92A 1AQNA 5CBKA 1KKUA 4GI3A 3D64A 3DAHA 1MG5A 2J85A 2OAGA 2VDUE 1WPQA 3TXAA 4IJ6A 3A1VA 1BVYF 1UMBB 3TLCA 5KTTA 1A9YA 4DMRA 1QH0A 4XDHA 1BAPA 1KMMA 1YB6A 4MQ4A 3W8EA 1UEXC 2A94A 3LW8A 4OAOA 5HX7A 1OGYA 2XT0A 2J7PD 1AB5A 4O2RA 4N54A 1ZQ9A 4MYTA 4LDQA 2IPXA 4ZO7A 3KQLA 1AC5A 1XROA 2A0WA 3EFBA 5A0TA 4ZI2A 3CZQA 3FCSB 2FMIA 1TEZA 4N7MA 1KVRA 2JLSA 3S7TA 2FX3A 1YQEA 2R1VA 4EL0A 2FX5A 3VGPA 4DUGD 1VKRA 1EXVA 3GAFA 1PU2A 1TE2A 3QXCA 4FCVA 3V7YA 4ZYWA 5JG7A 2XVMA 4QXQA 3H1AA 2HFKA 4ZCQA 3AHJA 5EKSA 1W4BA 1XXHA 2HFJA 3K94A 3WNQA 2IS2A 5AT1A 2H29A 3NHRA 1EVYA 1TRHA 4FWIB 1SKQA 1PSDA 1WZIA 1XRPA 3O82A 3E3MA 5K3BA 1M1NA 1VECA 3K9NA 3L7CA 5FFMA 3YASA 2ZETA 1R4MA 2OA0A 4X90A 2A5YB 1RZ3A 1HUQA 1QHSA 2KJQA 1G9XA 1M5UA 2I4NA 1NJSA 3EDRA 1RQRA 5JFTA 1GRRA 3EUEA 1JPVA 1XEWX 3JQFA 3R0JA 3D31A 3FCYA 2X23A 1NJ8A 2GBIA 1SVLA 4R1NA 3IBFA 1ZH6A 3SR4A 1BGXT 2O2ZA 2X0NA 3ORQA 2JGDA 2A7QA 3UK6A 2AOTA 5D85A 2FWRA 3DYIA 5F2KA 2X8JB 1LLCA 5JAIA 3A6ZA 4MICA 1R6TA 1V5FA 1Z0IA 3V4RA 5JWHA 4Q05A 1X7XA 2C0CA 5TXGA 4D8XA 3X1KA 5IDYA 1RHMA 2Q3JA 1NPTO 2I6QA 3IA7A 4M8LA 1LK5A 2Q2WA 1TPZA 4TXNA 3I9NA 1S6YA 1F5NA 3L6EA 4P4TA 4RQTA 4IV0A 3NX4A 2JKVA 4CHTA 3KAJA 5JASA 2QA5A 2XWBF 3UJCA 3ZWOA 3FNFA 4HH4A 2PV7A 4IDCA 4L0MA 4MVJP 4BVHA 5JAZA 4WCFA 4ETNA 1Q0SA 2IIVA 3D0OA 4WFKA 4XGIA 2HJGA 4V0SA 1M7BA 3IJEB 4F71A 3PVSA 5AOCA 5I9MA 1Y33E 4FFBA 3JYHA 1FLAA 4HGNA 3DMGA 4LDAA 3RE1A 2LD4A 1U0RA 2Q1WA 2RHCA 3AP1A 3ANYB 3C5WP 4ZVTA 5BORA 2GQ0A 3DPIA 1L8OA 2C4UA 3WGJA 4GDMA 3THYB 4F3CA 4CNQA 1SKMA 3TZ6A 1PFKA 1E5LA 1T5HX 1J22A 3C7TA 4LBYA 5B1HA 1FUUA 2I9KA 3U0BA 1EESA 1BS9A 1RKXA 4TXJA 3AEUA 1HSZA 4TQ9A 3PGA1 3SIPA 2WJYA 2WDPA 4A36A 2QY6A 4FHGA 5AJXA 3T3OA 3G3EA 5BR1A 1QH8A 1DQPA 4KHZA 5KOJA 1AMUA 3A11A 2Q3DA 3WL3A 3W9YA 4DIOA 3LUCA 3ZCSA 2PRKA 4JQCA 5E0KB 4WZAB 4GBJA 3AVUA 1G8FA 3K9FC 3IOBA 1GPKA 4TQAA 3VZBA 5LXTF 2P62A 1QRTA 3C7DB 3CF4A 1L8AA 2ZSIA 3INRA 5AH0A 1QGED 1YK1A 3V46A 5CXUA 4J1NA 3U3DA 1GZ4A 3INYA 5C46F 2GVZC 3K4HA 4LX8A 3CJQA 3EVBA 4QDZA 4MMXB 3PUHA 3LVFO 1A88A 4CT5A 5ALLA 5D01A 2PVPA 3DR3A 3KUKA 4MUAA 3D5EA 1N9ZA 3DAGA 3E9NA 3SX4A 2ZBUA 3FJ1A 3DLPX 2DQSA 1THMA 3E5MA 3BEDA 3SQLA 5FA5A 2WMYA 4TXMA 3TAUA 1R7RA 3NBYC 5FF9A 5AW0A 5JFGA 2YFQA 2O8CB 5T4BA 1JLMA 1FYWA 2W6ZA 1Z8NA 3H9EO 2Y76A 4E70A 3SR3A 3KHTA 4WLNA 4RIIA 5DM2A 4YJ2B 3AHHA 2V6JA 3TAXA 4P53A 1CR4A 2OHXA 1L6RA 4JKOA 1E9DA 1I4TD 2OZKA 2OT3B 1H0HA 2WZCA 3TRDA 1BHO1 2OR3A 4QPJC 3IUPA 4XUCA 1DTWB 1YR8A 3T5BA 2XECA 3DMTA 1ZD2P 4U0KA 3DFFA 4G4JA 4PYOA 1GPYA 1KJZA 1D7AA 1ZM7A 2FX2A 3H75A 2H11A 2Y93A 3N8NA 4HAUA 4NSNA 1JFRA 3ZGYA 5JCXA 1ICIA 1N2GA 3THWB 3KXDA 3NC1C 1W9MA 1Y1SA 3LIPA 1AKQA 1NI3A 1VG9B 3BXGA 3DC2A 1IB0A 1T36B 2NUBA 1TK2A 2HBRA 2PLAA 2W6ID 3EQ6A 2H9IA 5AJUA 3WYFA 5L53A 1SNYA 1ODCA 3N70A 3RYCA 3EH2A 3RNOA 2V5VA 1UODA 3R9IA 1NV8A 3MS7A 2V6GA 3LQ4A 2ZR7A 3QMPA 1SN7A 5CVCA 2GN8A 4ER3A 1EWVA 2G88A 3BH6A 2VZ8A 4K9MA 5AVKA 4Z4CA 4YT8A 3NT4A 2DEUA 4CEHA 1CUGA 3C85A 1F2UA 2G0NA 1WX1A 2FFAA 3I34X 4FW9A 4QYIB 4D3YA 5JCPA 5KWVA 5HQJA 3CKLA 2QVCA 4RKYA 1EP2B 3TGWA 2NO0A 3LECA 1LZLA 3ENKA 1IE3A 4DB4A 4WXYB 1HRKA 2PZGA 1USGA 4ZO4A 2WUWE 2FSHA 4MCIA 2WJGA 1ZN7A 4HYYA 4NCXA 2NU7B 2D5AA 4HNAB 4KQKA 4B6SA 4OYHA 1Z0DA 3B3JA 3EBOA 4P4LA 4ZOLB 5BUSA 1GTZA 3FTFA 5BN3A 4NCKA 4Y6SA 3VJKA 4XVUA 5C4IA 2MSDB 3BWCA 3KRTA 3SY8A 5BR8B 2EKBA 3K1AA 5JS7A 3N0XA 4NV0A 3V2GA 4HAOA 4MW4A 2EZ8A 4OQPA 4TV9B 2TRSB 5DNUA 2PJZA 1SZPA 1OWPA 1U7WA 2BJWA 2Z5LA 3DCJA 4LXXA 4YRFA 5C1IA 4YRNA 2O52A 1KY5A 2QD5A 3KTAA 2DH5A 1DIAA 1GPJA 1UADA 1P18A 2FR8C 3QF4B 3PX7A 5C4MA 3F1LA 2CSXA 1LJLA 4JC5A 4E6PA 4GHWA 4UU8A 2NU6B 5FFNA 3REQA 1ORIA 1VBNA 3OIWA 1P6QA 2BP7A 3GQBB 3B89A 3TUIC 2EKDA 5BWCA 5JAUA 5K0EA 4HBZA 5MFPA 1V26A 3D1JA 2CLSA 3H11A 3CMCO 3KSDO 1VL2A 2AMFA 1VDMA 1HFEL 2GWHA 4HDQB 3CX3A 4EJFA 1OLXA 4MS1B 2WMOB 2CZCA 4YP6A 1GIAA 3I58A 5FLKA 4EZIA 5KQPA 1OZHA 3U5ZB 3K05A 8LDHA 2V7TA 4KRFA 1P2SA 3KR9A 5FUYA 2E4XA 3CZPA 4GE0A 5AXAA 1O0CA 3V4OA 5AKXA 3FXAA 1F60A 2P9CA 1KGDA 2I6XA 4JVNA 2WF6A 1KA9H 1VE6A 3RV3A 3U3XA 2ZU0C 5J2UF 2GBLA 1LS6A 3G2MA 1EWYA 2AI1A 2B4RO 1XZMA 1A3CA 5DLEA 3ZQKA 1WMEA 3WNZA 2X76A 4U1RA 3T3NA 1H69A 2GEJA 4PC6A 2YICA 3PCXA 5I3ZA 1OXMA 3B2QA 2F3RA 4W6ZA 3G1UA 3QY0A 1NVBA 1YJAA 2A78A 2PS9A 4GE3A 4R1QA 3WB9A 3U1BA 1ORVA 2QEQA 4UAUA 2IUSA 4NBNA 5K8LA 3E3OA 3S2UA 2GJKA 2VNSA 4D0GA 1HY3A 1WDMA 1DX6A 2XXJA 2JF0A 4K6OA 3KK0A 2CEKA 3J80A 2W70A 4BX3A 2RGXA 3A4YA 4BFYA 1ILWA 2QAGC 3E7XA 2XUJA 2OMEA 3NU1A 4D6XA 2HYIC 1RJFA 1ZRSA 1S7CA 2W58A 3R3VA 1IQUA 4GH5A 3RVJA 3JQ9C 3BGDA 5HUHA 5K0FA 3FFXA 3DXZA 2VSQA 1OH5A 4XTCS 1EX1A 4J91A 3ZHRA 1U0GA 2AMYA 1CNFA 4PGAA 5CB4A 2X3UA 4ARIA 2BN4A 3AVOA 3V32A 1SXJA 2F1HA 1H5UA 3RK0A 1R8XA 3NAGA 5B1YA 2ZRIA 1NVMB 4IUYA 1J21A 3BRWA 4L6CA 4MXDA 1ZJYA 4RA6A 5HE9A 2RK3A 4TTAA 4LC0A 2AG8A 1NNSA 3FCCA 3AU9A 3VSAA 4BN0A 4CMJA 1FVHA 2BFNA 4R1OA 4XRRA 1VLVA 3GPBA 3B3GA 1NVAA 2HCJB 3CF4G 2IY8A 4I4TA 3RIEA 5JSHA 5IKXA 3LA8A 1YCHA 5JXHA 3IXMA 3L0YA 2GETA 2NTYC 2B7BA 3KSRA 4LOLA 4QODA 4EFKA 1W30A 5A4IS 2XRMA 3SVTA 4XQEA 1O08A 1JN0A 3ETCA 1T2NA 2I1WA 1YQWA 3OU2A 4NJMA 2GCGA 3PDJA 3RS0A 3H8SA 2NYUA 3PNYA 5F73A 4F6RB 1T5OA 1VIVA 2ECPA 4NDAA 3HKEA 1EXMA 2R7LA 2EHDA 2SKEA 3FOAA 3GFBA 1ORTA 2OPHA 1QH9A 1L5LA 3PXEA 1Y1QA 4BVGA 1IOZA 4PYMA 5JAPA 4IWNA 1OBHA 4JJIA 4AZ3B 1H1LA 1YNOA 1ZSVA 1UDAA 2VDJA 3NWOA 5I7OA 1M2VA 1X38A 3GJ0A 4HGOA 3WYCA 2EBWA 2QTHA 2OORA 4AJEA 3WOHA 4CM4B 2C61A 3TQIA 1P1BA 3EEOA 1Z7YA 1L7QA 2RI0A 1O9HA 2OV6A 4BZPA 4M53A 5CCBA 4RANA 1YA4A