3T1OA

Mgla bound to gdp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
192
Chain Sequence
STINFANREINFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIGEVKGFKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Gliding protein mglA
total genus 60
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t1oA00
4OHWA 4B34A 4GPTA 1QHXA 2JJ1D 2EYUA 1DAEA 3MFYA 3FB4A 3VHXA 2O8BA 4YDHB 3RDPA 2GILA 3S1AB 2WHXA 2W58A 3W90A 4A0FA 2H5EA 1Z28A 1JBKA 2GZDA 1NVWQ 3JVVA 5KSZA 2G3YA 1DTSA 1T8UA 2P67A 2XSZA 4NCKA 4B3CA 4BE7B 1W4AA 3ND9A 2FPMA 5AUQA 4TMZA 2GJ9A 3THXA 4IVPA 4LJ8A 3CW2A 5AJZA 2FNAA 4D0GA 5L3SB 2GVDC 1I4TD 4HZIA 4A2WA 4DBLC 2AKAB 1L4YA 1U90A 4L9WA 1OV4A 4W9MC 1T0JB 4OKSA 2ZVQX 4HDOB 3DKPA 3CPHA 4DUGD 2QNRA 4LHVA 3M4YA 1VG8A 4QJ3A 2E9SA 2FZ4A 2BMEA 2FFAA 2QE7A 4LC0A 1ZM2A 1Z8FA 2QTFA 2KE5A 5TMPA 1XPOA 2AK3A 1HE1C 2WVJA 4YMVA 4M9QA 3VR4A 3ONWA 4KVAA 2O8DA 5FH9A 3FFBA 2FE4A 4MKGA 4OHZA 1AIPA 1G6HA 2ZE8A 4TQUS 4V0ME 1E99A 3ZVRA 4R98A 2W0MA 5EE0A 2A9KA 4KBGA 3VNUA 3VR3A 2ZRKA 5H8WA 4JBWA 3GLHA 4PSVA 2PMDA 1F60A 3OHMA 5DH9A 1EFUA 1QBKC 3WXMA 1Q44A 3QXSA 4XTCS 1W36C 2Z6VA 4IRUB 4MKHA 4HUQB 4LSGA 2ZRPA 1WA5A 2IUTA 3ZGXA 2CL7X 2XOKD 4DKXA 5EP3A 5BWMA 4C0SA 2VYFA 1P60A 5HTKA 2ZROA 3T12A 1NVVQ 2SHKA 5JSZB 1GRNA 3BH7A 4HB4A 4MGKR 1SKQA 1T3SA 1QHIA 2XOKA 2BCJQ 1AS2A 2ZJYA 1W49A 1P6XA 4RVCA 4NH0A 1G19A 1DG3A 4Q4HB 1W0KD 1DS6A 1Z0KA 4O3MA 1NY6A 2YWHA 4OJQA 3CRVA 4I1VA 3KXLA 3KXKA 3QBVA 4ZDIA 3THWA 4NYJR 1NF3A 3W5IA 1X8KA 3CZQA 3SI7A 2FU5C 2ZJ5A 3CRRA 2ZI4A 2IWRA 3PXGA 3PUXA 4AWXA 1XEXB 5FI0B 1MKYA 1K8RA 1NSFA 1U9IC 4G1UC 4IW3B 3IIMA 5JHGB 3BBPA 4XOIA 121PA 5JECA 4Y0VA 2HF9A 4OK3A 4QM6A 2J7PD 5ELXA 2XZLA 5J40A 3A4NA 2HEIA 4YC7A 3T1TA 2YJTD 2W83A 3QVUA 4IOKA 1ZJ6A 3CUEF 1E1QD 4M22A 4MRSA 4D4MA 2IYQA 4D80A 4D25A 1WMSA 2CDNA 3EIEA 4G3XA 3AP2A 4A0RA 5JWHA 3GJ5A 4DZZA 1XEFA 3I8SA 4A15A 2HYDA 4C0HA 2IYXA 3ICQB 4EPRA 2PZFA 5FBVB 2WSSD 4URWR 4IVQA 4O0MA 1RYFA 2C9YA 2GAAA 3W5JA 4YXWA 1Z06A 3C14C 4NONA 2DFNA 5TARA 4OHYA 2V6IA 2ONKA 4EDHA 5FBRB 4M8NE 4PQYA 2IYWA 3W6NA 2VSXA 4ESHA 4JL5A 2OESA 2JCSA 2Z4SA 1PUJA 4YXWD 4NYIQ 4HLQB 5C4MA 5JRZA 3BJIC 1GIAA 1K5GA 4QRHA 1W1WA 5KNDA 2PMKA 1E0AA 3P32A 1CJKC 3TE6A 2X19A 5FFMA 5FOTA 4MRNA 3A6PC 1ZD8A 2GAOA 4AY2A 1IN5A 2ZI7A 4K81B 2H8KA 3RHFA 2H92A 4LYHA 1JECA 2O52A 4P4SA 4ACAA 3TMKA 4KU4A 5EZ5A 2CCKA 1KI8A 3RC3A 2ZJOA 1T3LA 1E9DA 3FTQA 2AHOA 4EJSA 1OFHA 1RRPA 4JS0A 1W4BA 3AGQA 3ETLA 4Q01A 5L3RA 1GNPA 3SJZA 3SBEA 3K53A 5EXXA 3WBKA 2C96A 4N0EA 3FMIA 3H84A 3GJ3A 1W0KA 2A5YB 4WZAE 2G9NA 5H70A 5FI1B 2OFOA 5TY0A 3RC8A 1KAOA 1TUEA 4PPFA 3TUZC 4QJ4A 1Q1BA 4ZIRB 2IUSA 1YR8A 4Q9HA 5CIQA 2Q3MA 5HE9A 1SQ5A 1LTQA 2K5UA 2IUUA 1R0YA 1YZUA 2JIZD 3K1JA 2IS6A 1RJ9A 3KL4A 1WCV1 1W36D 5EXTA 3K09C 2ZXUA 2DBYA 3BGWA 4B47A 4I1SA 1JI0A 2PEZA 3CWQA 3U4QB 5F9FA 5KDLA 1U0LA 3OIWA 4GP6A 1FTSA 4A36A 1SVOA 2ODNA 4Q4AB 3UXMA 2WSMA 1E94E 3EZFA 5HCNA 1YKSA 2VHJA 2O8FB 3VU9B 5EE3A 3U60B 5GADl 4Q48A 2YWFA 4AKHA 3LWNA 1A2KC 1W47A 5DN6A 1E1RD 1A82A 1KSGA 1XPUA 3NBYC 3B60A 3RS5A 4HB0A 2H1LA 3B1WA 3C5CA 1BYUA 2B8TA 2BBSA 2BV3A 1GOTA 3WYGA 3BE4A 4HATA 3U6BA 5HE8A 2ZS8A 3VFDA 5AUNB 4U7DA 5FOSA 4WXRA 1RRCA 4LJ6A 4B3XA 4KYUA 3TSWA 2FFBA 1UAAA 1XCMA 3CH5A 3QNUA 4UJ5A 2V3CC 5BW8A 4Q7LA 3I61A 1TEXA 1KJWA 1P62B 3CH4B 1LFDB 4QGHA 1FQJA 1QDEA 2WIBA 2RGCA 3PEVA 4Q03A 3I73A 5DI3B 1NKTA 4OQMA 4ZI2A 2RGXA 4V0LA 3L82B 3EWAA 1G8HA 1Q20A 4DCTA 4EFNA 1DEKA 4J0QA 4ON9A 4ZDWA 4KHZA 4HLUA 2O8EB 3IUYA 3H2YA 4RZXA 2PT7A 2GF0A 2PLRA 4C0QC 1KNXA 1YU9A 3OEEA 5FBWB 4TYNA 1T8TA 1LF5A 3UMSA 2QUZA 4ESVA 5TV2A 1TQ4A 1Q0UA 2BBWA 5C2JB 1YE8A 5LD2B 3GLFA 2IF2A 3PQCA 2J87A 2RGAA 3BWDD 1VYVA 4GOKA 2J1LA 2GKSA 4AC9A 4ZO4A 4Z1MA 4OQXA 1TAGA 3GFPA 1C4OA 1Z0IA 4WBSA 1D5CA 1E1QA 3EC2A 4TQ9A 3T34A 1PLLA 3BAFA 2FA9A 1TPZA 2QM7A 4ITRC 1VKJA 4M1YA 4MH0R 1E0JA 2I1QA 3T5GA 2X1VA 1KKMA 2F3TA 2YNMA 4G0NA 3TR5A 5CJ2A 1DG1G 2A5JA 2ZU6A 4RD4A 4MKFA 3L0IB 4AURA 4Q1BA 4RFSA 3W8NA 3QIAA 1NI3A 3FKQA 2QP9X 1A5TA 2OCBA 1BMFD 4HAVA 3LLUA 3OFND 3WBJA 1E2QA 2IXFA 1Z47A 1H65A 1ESMA 1E2HA 1KY2A 2EWVA 5BN4A 1PZNA 4K8OA 4B32A 3FE2A 2WIAA 4TZ0A 3NDBB 1NLYA 1RRFA 1BO6A 2XNDA 2ZREA 1OSNA 5B2ZA 4CRWB 3ZD7A 1UPTA 2P5TB 2F1JA 1R7RA 2CNWD 2FSHA 4V03A 1ONBA 2F43B 4DLVA 1P2VA 1DPFA 2RGGA 2Q9BA 2VP4A 4IKEA 1G8PA 1N6KA 2CL0X 3WMGA 3SHFA 2FEMA 2B8WA 2WWHA 3DMDA 3OIUA 3ZDQA 5JBQA 3NH6A 5SZIA 2FN4A 3VR5A 1MH1A 1J70A 3E2IA 5JJKA 1UBFA 5IK2D 2ONJA 2QAGB 2NO0A 1OT3A 3AP3A 2KI5A 4H9GA 1YR9A 2N1BA 1QVRA 3V9PA 1MR3F 2Y8EA 4LHXA 3PIRA 1UBCA 4E07A 1YZNA 3N2EA 5A0FA 3NHAA 1ZRHA 2UVQA 3WYAA 4A92A 3WRXC 1N5LA 2RCNA 3MJRA 1EESA 4QBHA 1G8YA 4JBYA 2C2HA 4MGZR 2JIZA 1A4RA 1Z2AA 3K0AB 1EGAA 1XFAA 2R6AA 3CPEA 1N6HA 4DXAA 4RD0A 2IYVA 3TW8B 3CX7A 4M53A 4TSFA 2IHYA 3PJRA 4AKIA 4A0GA 1F48A 2GETA 4TMVA 4EQ6A 3FPAA 1P5ZB 1X6VA 5JCPA 3RAPR 1P73A 1ZCAA 1KO4A 2V55B 5EUMA 3N2IA 2HYIC 4M0LA 1KO1A 3GFOA 1W48A 4B6EA 3QF7A 1PLJA 2Q0HA 1OYWA 5C4GB 4F4IA 2VTKA 1Q57A 3L43A 3QUSA 2JA1A 3RS2A 4PR0A 3B82A 3QEOA 4XJXA 4PO1A 3IBYA 2WICA 4QKQA 4BPBA 2IS4A 2GZHA 1GWNA 2O0KA 5HCIA 2IS2A 1DELA 4TLDA 3HDTA 1GM5A 3CO5A 4AD8A 4BUJA 1W4RA 2QT0A 4BFUA 1D9XA 3U6KA 1FFHA 3TJZA 1AQUA 1G8FA 2RGNC 4P3YA 1ETUA 5KYKA 3K0EA 5LB2A 2XTNA 3D31A 4GRAA 5E4FA 3X1DA 1IN4A 4NYMR 2C77A 4M1KA 4BEJA 4ASUA 3QPWA 5DYGA 1XTKA 3HJNA 3AVOA 1Q3HA 5HKKA 4QOSA 4ZCIA 3BFXA 4LJYA 4R9UC 4TMXA 1QHHB 2P3SA 3NDPA 4MYTA 4R71A 2J45A 1YR7A 3O47A 3U3MA 3HU1A 3RRZA 2A30A 5M04A 1KSFX 4A2PA 3KDSE 4M1MA 1CJTC 4FMBB 4M2LA 2J0UA 3U3OA 4PO9A 3B1XA 3I92A 5DHAA 5KU1A 4HDQB 2PJZA 1ZM4A 4QGAA 4RZ3A 4DIDA 4AYTA 2P2LA 4EIWA 1MRNA 5FOUA 2I3BA 1KZGB 1NBME 1A7JA 2D2EA 2ZPTX 1IOZA 4G5QA 2NO1A 3QXJA 2VF7A 1LF0A 1NVUQ 2H7VA 3LAWA 2ZYWX 5DLQC 4G01B 1GL7A 4P33A 2ZI3A 4RD3A 3MSXA 2W6IA 3KTAB 3FWYA 5JEDA 4Y0AA 4CEHA 3PR1A 4JLOA 1QRAA 1Z3IX 4AK9A 3KQLA 1KY3A 3SQXA 2WTUA 2QORA 1K5DA 3EG5A 1IJFA 3AEZA 3IIJA 2E87A 2FG5A 4DCSA 2CEAA 1LNZA 5AUOB 2C9CA 3KQHA 3TK1A 2VP0A 4DCVA 3G82C 4Z1MD 4EJSB 1ZC3A 4PZYA 2O8BB 3IO3A 5G3ZA 4D81A 3S1AA 1CULC 1XD8A 2V9PA 2R62A 4LX0A 2PT5A 3R9WA 1OIXA 1FMJA 3Q85A 1FX0A 4M1OA 3HR7A 4JJZA 1UKYA 4LV5B 3WP1B 1UKZA 3AF0A 2A3RA 3BS4A 2QGZA 4HYYA 2QBYA 4V02A 1TNDA 1RFLA 2QQEA 4DLYA 3HPQA 5SZJA 1BYIA 4TL8A 3VTKA 1S3GA 3SE0A 4XWOA 2EU8A 4PHTA 3L0OA 4EUNA 1X8JA 3NEJA 4HAZA 3TSZA 2ECKA 1IBRA 1IN7A 2QE7D 2ZVPX 3LBIA 1R10A 4M4SA 4WXPA 1G4AE 2EFHB 1DAIA 3GJXC 4UQOA 3SC3A 3EIHA 3V00A 4LBWA 2R9VA 3CRMA 3TNFA 4FXPA 4UNNA 1M1YE 5KDDA 2VEDA 5E7IA 1L7VC 1ZNYA 4BRWA 4CEIA 2ORWA 5JEEA 1FL9A 1HH4A 3IQWA 3QG1A 2WKQA 4GZLA 2VL7A 3U3KA 1J2JA 5LPNA 4BLQA 2GBLA 2VBCA 2BM1A 5HKKD 2L0XA 2FWRA 3B85A 3MLEA 3L2OB 3LFUA 1E9AA 1G8GA 1XJ0A 3AF3A 3I5YA 1WE2A 1XZPA 2BM0A 2OE2A 3P1JA 3QKSB 4QBIA 5B57C 1Y63A 2V7QA 4DLZA 3A58B 1XTQA 1ZC4A 1TU4A 2GK6A 1KK2A 3LDAA 2EFGA 2XZOA 2IYUA 1O3YA 3FOZA 5KOYA 1S1MA 1PVOA 1WF3A 4NCNA 1R2QA 4OQLA 4BLTA 1G20E 2VRWA 4FI3C 5JHHB 1VPLA 4URVR 2OSBA 2QZ4A 5JS7A 2DFTA 4URYR 1M8PA 3R20A 5H68A 5K8UA 4Q9JA 5E7MA 2BVNA 1GNQA 3ZIAA 4OYHA 3UWOA 1XWIA 1OPXA 4GOXA 4JBXA 1OXUA 2JLRA 3IEVA 3IHWA 5B64A 2ZYTX 3ADBA 1W5TA 2YOGA 4I4LA 2J7PA 1HQYE 1KMHA 2X2EA 1KJZA 3U44B 2XXAA 3GD7A 4RD2A 1GRQA 1TL7C 5AJVB 1CEEA 4BZXA 5J4LA 1OFUX 5BQ5A 2BDTA 1M34E 2EWWA 3H86A 4JVNA 2V1XA 4ARZA 2NPIA 5DO9A 1G17A 4M21A 3U2QA 2N46A 3AKDA 1OB2A 2ZJ2A 1Z07A 4LUCA 3IO5A 1QZXA 2PZGA 4URZR 4BFXA 5GJVC 3LH5A 3REGA 3AQ4A 1V5WA 2CCJA 3ZQ6A 1GKYA 1X1RA 2VSOA 3Q7PA 1I4DD 3KJIA 2PX3A 4LPKA 1X8LA 4WIAA 1R0ZA 2CLCX 5EE1A 4PHFA 1ZD1A 1E9FA 1HURA 1KDTA 2EFCB 3QJYA 4WZBE 3PEYA 2C8VA 5TVKA 2WJJA 4OQNA 5D3MA 1KI4A 1M7BA 3NBXX 2JLZA 3ZS9A 4PXAA 2AWOA 1OYYA 5TDHA 4KBFA 2QRNA 5CITA 4DLUA 2ZANA 1VMAA 5C18A 2IK8A 4B6FA 4AG5A 1K6MA 1ANKA 3A8TA 3RRYA 3OZXA 2GBLC 3DDCA 2QGNA 1YZTA 2XAUA 3GEIA 1AN0A 2OHFA 2PBRA 1KTVA 3O8RA 3KB2A 1M7HA 2WJIA 1UKVY 4PSKA 1F2UB 4TQAA 4YONB 3C16C 4LC1A 3GLGB 2IYSA 5A4JA 1GZSA 1SVLA 4WA7A 3R8FA 1Z29A 4P4SB 1KO5A 2C78A 4DDVA 3IDQA 4G5RA 2R65A 3NBFA 1Z0FA 1OH5A 1ZW6A 3ZVNA 2FPLA 1L8QA 2QT1A 4GNKA 4IOJA 1XJCA 2WSSA 5KSYA 2ANCA 2IYYA 2ZRAA 2GCOA 3W8RA 5KDOA 5EJEA 4YDSA 3CR8A 2ORVA 4ZV4A 1DO0A 4BQSA 2J0VA 3WHLA 3E1SA 5LD2C 2DB3A 1QVAA 2FX3A 5FR1A 4JL6A 1PLKA 1FZQA 1NMXA 1CS4C 4OI4A 1GFIA 4FINA 2QAGA 4FMDF 2R6CA 4X8HA 3SFZA 2ZAMA 4DDWA 1VIAA 2D06A 3UKDA 2P6RA 3RSLA 4QG7A 4Q4LA 2QMHA 3MWYW 1SVMA 3W3AA 2YZ2A 3M6AA 3T1VA 2QTHA 2IXEA 1RPZA 2HF8A 2ZYUX 2G6BA 2F7SA 1ZVQA 2HXSA 4XD7D 4NZYA 5CIWA 3Q72A 4MRPA 4RD6A 4B3DA 2F1HA 1G3RA 2BEJA 2C9OA 1RJ9B 1KDPA 3C5HA 3IEUA 2ZRFA 1XEWY 1T9HA 2ZRNA 1U94A 1IXZA 5DI9A 3C8UA 4B48A 2BIFA 4YMUA 1TF7A 5G41A 3MGCA 4LBYA 1W4CA 3IKJA 2IYRA 1QG4A 2ZEJA 3I32A 3U7GA 4HAXA 2YVUA 1AKEA 2RB4A 3CLVA 1XP8A 1D9ZA 1QG2A 4JLNA 4KYIB 3MMPA 2OM2A 3TIFA 3CONA 4PAMA 1ZMXA 3SHWA 4IFEA 1UFQA 2E1RA 3LW8A 5FPTA 4BFWA 5JCZA 2CJWB 3K70C 2HT1A 4I81A 1WB9A 4TYYA 1ZBDA 1U8ZA 4R2IA 1C9KA 2JAQA 3QY0A 2OLKA 4FW9A 1FOEB 2AX4A 1S9DA 4GMXA 1DADA 3EZ9A 4IHQA 2XB4A 3LX8A 4JSTA 4CT5A 3V4RA 3GJ6A 1QHGA 5FPHA 4JJKA 4KCGA 2ZRHA 3GLGE 5CLQA 1DARA 3AV0B 3B78A 3SU8A 5E95A 8OHMA 4PPQA 1E2DA 1TEVA 2FGJA 2JLQA 2NO9A 4B2PA 4BEBA 5IRCD 4O25A 2JLYA 1TF2A 2DWQA 1JNYA 4DT1A 2QMUA 4JVSB 5KSPA 1M74A 2QG6A 1W5SA 3B13B 4BFTA 2R2AA 2ZI5A 2J0SA 1B23P 1P2UA 2CCGA 4D82A 2NZ8A 3B5JA 1AS0A 5DI3A 2FFQA 5K8TA 3ZJYA 3CX8A 3DPUA 1Z6XA 2ZSDA 4R2HA 2F1IA 3QKRB 3L8YA 3HYTA 4EFMA 2RGBA 4JLBA 1HE8B 3KKQA 3TH5A 4DB4A 3I72A 1OB5A 4KODA 3UIEA 3Q9LA 1FNMA 1NRJB 4KFRA 2XJ9A 1MV5A 2C95A 4OK5A 3V4FA 1G7CA 1ZAKA 4HLUC 3I8XA 2WWIA 2AL7A 4WOPA 1E79A 3ND8A 4C0KA 3NBZC 1IN6A 4HAUA 1VHTA 3FYHA 4GL2A 2IEYA 4TWZA 2ZJAA 3FKSD 2WWGA 4TZ6A 1E98A 4IXNA 3SQWA 1YZGA 3AVTA 2ZRDA 3EPHA 2UKDA 2Q9CA 1W36B 1ZINA 3BC1A 3U5ZB 2MMCA 1BKDR 3LA6A 5AR1A 3ZZTA 1U9IA 4M9ZA 4MA4A 4C3ZA 4Q00A 2CBZA 1Z6YA 3X1YA 4XD7A 3X2SA 4LGMA 1X86B 4IEIA 1LB1B 4NMMA 3QXHA 1COWA 3MJHA 4Q1EA 1CIPA 2JASA 2WMOB 4RD1A 4U5XA 4TLAA 2ZRMA 1KI6B 3A1VA 4PTLA 2ANBA 1II0A 4S2EA 4FCTA 4RFSB 4YMWA 4IJMA 2NQ2C 1JJVA 3KXIA 4P4TA 1FX0B 4JLMA 4BFYA 1LV7A 5DHFA 2MSEB 3MRSA 4A8JA 3R7WA 1D2NA 2OXCA 3SJCA 2OXRA 4TL9A 2MSCB 4B76A 4PC3A 2WWFA 1E2NA 3X1XA 3LQRA 1NJGA 2XX3A 1XXHB 4KSBA 1UKEA 4O2LA 2X2FA 3OEHA 2QPAA 3AUYA 1F2TB 2GJSA 2ODWA 2JJ8A 1OW3B 3ZZ0A 4C0LA 1E2FA 1R5NA 1R6BX 4R7ZA 1IAQA 2IYZA 4KLNA 2IXGA 4BLRA 2CHQA 4D4KA 2NMVA 1DAMA 4DLXA 2GEDA 3FGNA 4KSCA 5IK2A 1OHHA 1KJYA 1Z6GA 3I3SR 1W0JD 4DCUA 3DOFA 5FPKA 5JI3E 1HT2E 2JJ2D 3L0PA 5C1BA 4CW7A 5EP2A 5KSOA 2ZS7A 1FMLA 2AR7A 2ZRLA 2WWWA 3T5DA 4JMPA 3TUJC 1OH6A 5F2EA 4CGZA 1G9XA 4IOMA 3FMPB 1R5OA 4AKGA 3VNVA 3A4MA 1BMFA 4W5WA 2DY1A 2GXSA 3CX6A 3THWB 3OE7A 3QKSA 4LOAA 4QJ5A 3X1ZA 3RRMA 2BBTA 3WYFA 3HU2A 3M1IA 4ZPXA 4N3NA 4AIIA 2OBNA 4S35A 2CK3A 2GJ8A 3W6OA 3ADCA 1ZU5A 1XEXA 2GXQA 4XWAA 1HEIA 3A37A 4RZUA 3R8CA 1NN1A 3ZQJA 2GXAA 1IONA 2EFEB 3AKCA 1YJ5A 1N5JA 3C4JA 3WNBA 4EQ6B 4JLPA 2D2FA 2FZLA 1XMVA 3IHLA 4L15A 4PX9A 3TR0A 1N0WA 3SZRA 2ZJ8A 1NVXQ 5CDFA 1SKYB 2MSDB 3GJ0A 2OBMA 3UMFA 1E69A 2GESA 2YYZA 1YHNA 3NH9A 5BYJA 3A1WA 2OV2A 3LQQA 1SULA 4JLKA 1TX4B 2W6JA 3NKVA 1KMHB 5CK5A 1ZNWA 1UBGA 2ZRBA 1PV4A 2JATA 4DLTA 3VAAA 3GLIA 2FOLA 2GA8A 5F98A 2I1VB 4FMCF 4JZKA 3B7GA 4TN1A 5BYKA 1NG9A 1DAFA 3MWLA 2OZEA 4C7OB 2WWYA 4IDNA 2A5FA 2WPDA 3LD9A 2GTPA 1GSIA 5CYPA 4AKEA 2KSQA 4B2LA 4M9XA 2JDID 2GJKA 3EA5A 4PSAA 2ATVA 4JYCA 1V43A 3N70A 3Q5EA 3FMFA 1KIMA 2QU8A 5KO2A 4MITA 5JRJA 3WMFA 4PZLA 2XTZA 2B7CA 1KOFA 2OLJA 2WPDD 4PPNA 3VR6A 2WWXA 2JLWA 1Q3TA 4KFUA 1N0UA 2PEYA 4A0HA 4Q02A 2UZIR 1CJUC 1R0XA 3A1TA 2LKDA 4NPHA 3MD0A 3A1SA 1QHNA 2I4IA 2IF0A 3TQCA 4AG6A 4LCBA 3UG6A 2QROA 2A5DA 3PITA 4LV6A 2ODBA 1E32A 4B33A 4EPWA 3LLMA 2J3EA 3GLHB 2XEXA 3PFIA 5KUTA 4GDFA 2AD5A 4ZKEA 2QPTA 1F3OA 4GSYA 1KMQA 2XZPA 3BERA 2Q9AA 3TGPA 3KQNA 4F91B 3IQXA 1FQKA 5CM9C 5J4KA 5L3QB 4OI2A 3BH6A 2DFLA 1NIJA 1U99A 4BWYA 1WRBA 2BMDA 3DM5A 5JSZA 1E1RA 1NJFA 2VIIA 4DEYA 1XMIA 1N6LA 1Z0DA 4US0R 4ABYA 4IOLA 4NDZA 3IIKA 2JLSA 1VHLA 3R9XA 3GJ4A 1JB1A 1KK3A 1A2BA 1SXJC 2P5SA 1VCMA 3B1ZA 1E2LA 2QY9A 4FN5A 3CF0A 1F2UA 4TLEA 4W7SA 3HWSA 3GLGA 1D6JA 4DEXA 5EP1A 2KJQA 3ECCA 4KJZA 4PZZA 3ZVMA 4YMTA 1IJEA 4TYQA 5LBIA 2XNDD 3DHWC 3RWOA 3P26A 1XTIA 3U7EB 2P6UA 4B71A 1EK0A 3KJHA 2DHRA 4LDJA 3RANA 3RLFA 2WAYA 3VR2A 1D8TA 1KO7A 1P2TA 4F93B 2P0EA 4P4UA 4HUTA 2NGRA 1ESNA 2DPXA 3ZS8A 1E0SA 3EZ6A 2FSGA 3RYTC 4CYMA 2J9RA 5DISB 2EFDB 3CRQA 3LY5A 2QENA 4A1FA 2ZYVX 4KITB 2O8DB 1YVDA 1QHSA 4P32A 4Q4AA 2IYTA 4IDHA 4G5SA 2GZAA 1SXJB 2BHRA 1XD2A 4PC6A 4UNQA 1MABA 1CXZA 1H8HD 1AJEA 3AGPA 3KQUA 4KI0A 1G6OA 2QEQA 3CNNA 4NCHA 1NMZA 4XVRA 2G0TA 4G5GA 3SEAA 3AVXA 2O8CA 4JKIA 3K0FA 2CMKA 2F1RA 4B35A 2HLDD 3VKWA 3PUYA 2XITA 2PH1A 1H8ED 1E3MA 4Q47A 5FTMA 3RS3A 3RABA 1S8FA 3O8BA 1MO4A 4I1UA 4BFVA 1AZTA 3KKOA 1JXOA 3U61B 2D62A 4CEIB 4GOJA 5EXSA 1CR2A 4DSOA 3X1WA 2VA8A 3ZLJA 3H0KA 4B43A 4Q4HA 4Q4JB 2DFKB 1SVWA 1U0HC 2ZR9A 1EFHA 5HZKA 3DZDA 1KO8A 2BBOA 3K8YA 1ZUNB 3P4YA 5CYOA 3T15A 2R6GA 4MRVA 2NPFA 3ASYA 1G21E 3HYRA 4L8GA 1U0JA 1TADA 4E22A 5IHPA 5KHOC 1G4UR 1WXQA 1DE0A 3CBQA 3PVSA 2AFHE 4QC2A 1SXJE 5J4VA 2RHMA 4PAOA 2FSIA 2V8OA 3T1QA 2CE7A 3KJEA 1N5IA 1XF9A 2IC5A 3GEHA 3G5UA 1UBEA 3NC1C 3VKGA 4CT4B 5E3HA 3QPVA 4D0LB 1P4SA 1A1VA 2REBA 4PC2A 3VHLB 4A4DA 5FUWA 1HA3A 5KNBA 4XWKA 1OFIA 2V7QD 3AKYA 4DLSA 5JZVA 3QENA 1E9EA 1G3MA 2DR3A 4NCJA 4F4CA 1CKEA 2ZITA 1OFTA 4CF7A 2XJ4A 3GLFB 3THXB 1II8A 1XD9A 1D2MA 521PA 4TMKA 5L3SA 4LJ4A 2Z83A 1LW7A 1OE0A 3LX5A 1PUIA 4YQFA 1RZ3A 4QGGA 1NMYA 3GFTA 3FHOA 4UJ3A 4Q7KA 1ZM7A 4M1SA 2OFXA 4DC9A 1EFRD 2JJ2A 1JR3E 5K8LA 1Q1QA 3NVAA 3QPUA 5FL3A 4O2RA 1GG2A 1KI1A 2IW3A 821PA 5J4HA 2RKOA 4FWTA 4Q7MB 2WOJA 1DBSA 1KI7A 1YZLA 1ZUIA 1W46A 2ZJZA 4U00A 2X8AA 3B6EA 4JLVA 1LVGA 1NG1A 3DMNA 2RMKA 4MKIA 4XSGA 2QAGC 1YZQA 3U4QA 2VH5R 1N2CE 2WBLC 3KKMA 3SJBA 2PZEA 3I4LA 2D4HA 4CEJA 4DB2A 2OFWA 2W00A 2OCAA 5FOXA 2LKCA 1X3SA 2KBEA 3AF1A 3VR1A 4Q9LA 2NG1A 3F5FA 3VU9A 3UANA 5FTLA 4PPGA 4CIDA 2QRZA 1AQYA 3O8DA 2GJAA 3VMFA 1R4AA 5LDDC 3EXAA 3LXXA 1SGWA 3K70B 4BLSA 2VP2A 2FMXA 1E2EA 4TYPA 4HB2A 2QQ0A 5KPJA 1SHKA 2PLFA 5GJBA 3SS8A 3QVVA 1F5NA 2VF8A 2F9LA 1EX7A 2BMJA 1G7RA 3PCRB 2CLSA 3REFA 5A5GA 1ZU4A 3HPRA 1FUUA 2UZ3A 3EC1A 2FDCA 2CXXA 3TRFA 1WBDA 3RS4A 1J90A 1HYQA 4LBZA 3PUZA 1ZUHA 4A6XA 3L8ZA 4X8OA 4LI0A 4BRUA 3QQ5A 2FV8A 3QE0A 3C7KA 2H18A 4DLWA 5HZHA 2LWIA 5AJWA 5ANRB 1BIFA 4XH9B 3FKSA 2RGEA 2YWGA 4C4PA 2F9MA 3OFNA 2R44A 3K9NA 2F6RA 1U81A 4QBGB 4I1OA 3NG1A 1KK0A 4EPTA 3B9PA 4RCYA 2VP6A 2ZSFA 1MO3A 3BB4A 2AXPA 1XTJA 3EASA 1IXSB 1WDTA 5FPSA 1VCNA 2GCOB 4L16A 3THYA 1OXXK 1DO2A 1KDRA 4TT3A 2AKYA 2OCPA 1XCPA 2YV5A 4U02A 1YRBA 1W2GA 2KB0A 4IDOA 3WP0A 2VHQA 1RC8A 1VG0B 1Z0AA 1ZNXA 2YHSA 3K09A 1JALA 1ZNZA 2R6DA 3GJ8A 221PA 1DAGA 4RCZA 2WKPA 1OXTA 3ZYCA 1Z83A 1DVRA 4CDGA 3RVBA 1NLZA 1GAJA 4QNRA 4EKDA 1EFCA 2OBLA 1JPNA 3PUWA 2DWPA 3WMEA 1OIVA 1UEJA 4XIGS 2IX3A 3GCGA 4HAWA 3HU3A 3PEUA 2IS1A 2A7QA 3BFKA 1YZKA 5GJWC 1CU1A 5DIFA 5B30A 1U98A 3D7MA 4E09A 1UJ2A 3LRPA 4QHSA 3UK6A 4RKFA 1OKKD 3KKPA 3QF4A 4OK6A 2ZI9A 4BLOA 3CF2A 1ZIPA 3WNDA 2YOFA 4XVUA 1FPMA 1RW4A 2DYKA 1KGDA 5JFGA 1Z5ZA 2IEZA 4DSUA 4YLGA 4DDUA 1TTTA 1MOZA 1G7SA 1EX6A 3QXXA 4D4JA 5JMTA 2WJGA 2ZR7A 3PV0A 1P9NA 1NN0A 1MO5A 2G88A 5CJPA 1KSHA 1NSTA 4ZCMA 3NEYA 2FH5B 4NP6A 5JWRA 2EVWX 2G83A 4MDEA 2B92A 1ZM9A 1XXHE 4V0NA 5EUQB 3TLXA 2F43A 3PENA 4C7OA 3T1OA 3BORA 4H1UA 2RH5A 5CDFE 4LV8B 3FVQA 4B74A 2RGNA 1E2JA 3JZMA 4NBSA 2FSFA 3A4LA 5JJLA 5UKDA 1TUIA 1N6NA 2HDNB 1KHTA 2O0HA 4A2QA 4EAQA 4B3GA 4BLPA 1Z0JA 1BH2A 3CM0A 1G16A 3DZ8A 5J5CA 4Z51A 1AS3A 4JIMA 2D3WA 2G1KA 2BC9A 2C5LA 4Q18A 1KYIA 3BH0A 3DOEA 5TXGA 2H57A 2AD1A 4EPYA 4ZIRA 1ZYUA 2CVFA 3CWZA 4KLZA 3SYNA 4ASUD 1G41A 3VX3A 2XGJA 3AF2A 4HZUA 5TB5A 4NE2A 1WP9A 1G5TA 1Z63A 3OAAD 4JVMA 3SJAA 3W3ZB 4QHTA 4LYJA 5L3QA 1E2KA 3BK7A 4NHOA 1OJLA 1Q21A 4TT3D 2HJVA 4TL6A 2ZTSA 1IY2A 3VQTA 3KUCA 3PUVA 3RRNA 1MRSA 1JR6A 3LW7A 1JXMA 4QGFA 5BN3A 1AGPA 4URUR 2O8FA 1RYHA 4Q66C 1NKSA 1CRQA 5DNYB 4DSNA 2ATXA 3Q8XB 5F9HA 2LCFA 4DRZA 1VCOA 2YC4C 4NYJQ 2QBYB 4L9SA 2H16A 2WKRA 4A9AA 1N6IA 3IPYA 4AI6A 4DHEA 1SVKA 4FWIB 3PG5A 2D74A 3GMTA 4IDQA 3FFAA 3I1FA 5AK0A 4URXR 3MCAA 4C0JA 4DCNA 5P21A 4ZDJA 1XDBA 3SDZA 1NLFA 3SYKA 3LVRE 4NL4H 2VO1A 5EXPA 2CVHA 4QXAA 1SVIA 3U3RA 4ZDKA 1E0KA 1WQ1R 4MYHA 1E2IA 2MMGA 1OLOA 5CB8A 4IFBA 2Q3HA 4X8LA 3K70D 1XPRA 2ASEA 1TQ6A 1E4VA 2VP9A 1H8EA 3TAUA 1VG9B 1CJVC 2JJ1A 2OT3B 2VPPA 4GP7A 1E9SA 1NIPA 3ZD6A 3R7WB 1QHHA 3VX4A 1OXVA 3E5HA 2ZRJA 1Q22A 3F3YA 1XD2B 1Y3AA 4TTPA 3EX7C 1XXHA 1G5RA 3IBGA 2ZQ5A 3M0EA 5FUVA 1F2TA 2QPOA 3K0AA 2J0UB 2ZRCA 2Z5FA 2QI9C 5SZHB 1JR3A 2O8EA 1MT0A 4Q7JB 3BFVA 1CP2A 4DIEA 1G64A 4A6PA 1FW6A 2AFIE 2N42A 4WW0A 1SZPA 1JPJA 2OEPA 3D8BA 3H4MA 4FIDA 4NYIR 1T5IA 3AH8A 3EZ7A 4LWZA 3SR0A 3QSYA 2CHGA 2CE2X 4QM7A 4UXJA 2VHUA 1COWD 3SN6A 2KWIA 5FTJA 4NKRA 1IY1A 2XNSA 4Z8YA 1P72A 1DAKA 3BD9A 4Q9KA 5HPYB 2BMFA 3KTAA 4TLBA 2VLIA 4RSGA 3FHCB 2ZRGA 2IYLD 1J8YF 4C30A 1E6CA 2OCYC 2GRJA 4MGYR 5EP4A 4I99A 5DGXA 2J7KA 1HV8A 2WJYA 1NN5A 4TL7A 1F6BA 1ODFA 1S9HA 3IILA 1U2RA 1XU4A 4F92B 1JAIA 3TQFA 3MAAC 3LVQE 4IDPA 1R8SA 1R8QA 1Q1EA 1MO6A 2AXNA 1IM2A 3GLHE 1GP2A 4JT2A 4RJLA 3SOPA 2ZE6A 3RS7A 4L4UA 1NP6A 3N5CA 2ZE7A 4P31A 5FBLB 2G1JA 4V0MA 1KI3A 5FL7A 2YWEA 3AP1A 2QAJA 4MGIR 1DOAA 1XX6A 2BOVA 1OIWA 4HLDA 1W44A 1W0JA 3E70C 4LYFA 3IPXA 1NY5A 1TF5A 2QP3A 3CRW1 4BZPA 4DDTA 3RS0A 5E7JA 4W5HA 1II8B 1JQJC 2R8RA 3I5XA 3FMOB 2HCJB 1U8AA 1AKYA 2QP4A 2JLVA 2V1UA 3TVDA 3OEED 4E03A 4V0KA 3BXZA 1VIYA 1AGRA 3LBHA 4BFSA 4TSFD 3ASZA 5FPYA 1VYTA 4JSYA 3UG7A 1JAHA 4PHGA 3BB3A 2QA5A 3L0SA 1YQTA 3MUFA 1T3HA 2GNOA 4Q1DA 4RZ2A 4BFZA 4IEEA 1GITA 6Q21A 4C2UA 4UXIA 4LK2A 2ODEA 1G3IA 5AJYA 2RAPA 1KDOA 1B0UA 5GVRA 1HQCA 2ZSEA 4LY6A 1N3BA 1T5LA 3GPLA 1P7CA 3AF4A 3GLFE 2QTVB 5FUXA 2YOHA 2XB2A 1NL3A 4KFTA 3U7HB 1VCIA 1FP7A 1Z6TA 1EWQA 4D0NA 1IY0A 2FEOA 4ERNA 1P2SA 2A5GA 2P65A 5G53C 1UEIA 3NC0C 1RRGA 3ADKA 5DSZA 4D4LA 5DN6D 4C9BA 1O87A 1JEDA 3JVUA 2GK7A 4NU0A 1NNEA 3TVTA 3OIVA 2W6JD 4FMCB 2HJGA 2JEOA 4D6PA 1NBMD 2BKUA 5CM8B 1I2DA 1GL9B 3R9IA 1AM4D 5AUPB 2GWHA 1TU3A 4EJSC 1IXRC 2VP5A 2ZUBA 4LJ5A 4PC1A 4OQFA 4BECA 5B58C 1KAGA 3UMRA 4KVGA 4P0TA 5EE9A 2AWNA 3NTUA 4X8MA 1XMSA 3AVVA 1M7GA 1HT1E 4W5JA 1S4QA 1G3QA 3CPJB 4FCWA 2QMEA 3MG9A 3KUDA 4JYBA 5LB4A 1JJ7A 2F55A 1G5PA 1IQPA 3KFXA 3U44A 1II9A 5AWFC 2C03A 5SZKB 1JQLB 2IHBA 3SNHA 5CB6A 2GEUA 3K9GA 1EG7A 3EPLA 5DE3A 1HTWA 1GUAA 1UADA 2JGNA 3P4XA 1M6NA 1TQ2A 1Z2CA 3CKLA 3Q5DA 2REXB 3CNOA 5DYIA 4LJ9A 3GJ7A 4D2IA 4GZMA 5JS8A 1L4UA 4II7A 4HB3A 1E2GA 3EARA 4PC7A 3FDIA 1R5BA 1Q1ZA 1CR4A 2QSZA 2W6ID 3C41J 3SYLA 4XVQA 3CB4A 4CZ2A 2IWHA 1AZSC 4QL3A 5KNCA 4JLDA 1LS6A 3AVYA 4BZQA 4TTRA 4B44A 1T4GA 1CJMA 3T61A 3WY9A 3OAAA 3BB1A 2ZIAA 4QFMA 3EIQA 1AK2A 2KBFA 1KSJA 3DKVA 4LRWA 2HLDA 3UATA 1UF9A 3OE7D 2CLDX 1SVSA 2IT1A 1US8A 5EZ6B 3TKLA 1D2EA 1VG1A 2ZUCA 5D3QA 1QHYA 2EW1A 1NN3A 2HV8A 2QN6A 4JVLA 1VTKA 5FTNA 2CHVA 4WZ6A 3DM9B 5GJCA 1CLUA 2A78A 4FD2A 3OIYA 3BOSA 2ZS9A 3ADDA 3GEEA 4BASA 1RE0A 3QOFA 4PANA 3SFVA 2WAXA 4KAXA 2OUKA 2Z4RA 4RFVA 4MQBA 4PHHA 4C2TA 4CEHB 5C46F 4DT1B 4M1WA 1J8MF 1OF1A 2EYQA 3K9LA 1CTQA 3Q3JB 4HAYA 5FOWA 4WVFA 3I62A 4US2R 2J0QA 3G0HA 4MDFA 5KTYA 1G7TA 3TBKA 1PJRA 2C99A 3W34A 3OESA 3UPUA 5EE5B 2J5XA 4N0DA 3PEWA 1N0VC 2X77A 1GL6A 4M1TA 2BJWA 2IL1A 2F3RA 1U8YA 1TQDA 1FNNA 2WM9B 1GKUB 3C15C 1N6PA 2D7DA 4LHYA 1EXMA 4MYUA 1E79D 1NVVR 721PA 1KZ7B 1SKYE 2BCGY 3LXRA 5F3WB 1N6RA 2NZJA 2ZRIA 4LYAA 3VKHA 5KPDA 4V0OA 3BRWD 5HR5A 1KI2A 2GEVA 2YC2C 4JLJA 1UDXA 5IDVA 3QKUA 4XTRA 3SBDA 1VECA 3HR8A 2C98A 4KFSA 4TTQA 3MWJA 4HEJA 4AYWA 3A1UA 1S3SA 2NTYC 4PQRA 5L3VA 1OXSC 2C04A 4HUQA 3RNLA 4TYWA 2DCUA 3LO5A 1T91A 4B73A 4GMDA 3ZH9B 2VHTA 1XB2A 1ZD9A 3QKTA 1CRPA 1GILA 5FBQB 2B7BA 4HDCA 2WOOA 2ZM5A 2QSYA 1ELOA 3ZZUA 2PCLA 4GBMA 4ZKDA 2FGKA 2O0JA 3O8CA 3J81k 1G3UA 2OAQ1 3KQKA 1N5KA 3CZPA 3TUIC 4CEJB 2ERYA 1L2TA 1ZM3A 3KB1A 2AN9A 3T06B 4LPSA 1HY3A 2R6FA 3NWJA 1P61B 3CR7A 4KO8A 2ZU0C 2Q6TA 2J41A 3KZ1E 1XRJA 3QEJA 5JI2E 1JEEA 4PAQA 4OBEA 2IA5A 1SXJD 3QXCA 4HSEA 1XMJA 3LNCA 2WJVA 4RKEA 4A82A 2ZI6A 4UNRA 1AA9A 2ZE5A 3CNLA 1RVDA 2V54A 5J4YA 3U7FB 3A36A 4RY2A 5JWOA 1EFRA 3B1VA 4Q9IA 1UM8A 2ZUDA 4B75A 1VYUA 4EPXA 1FTNA 2B6HA 2OILA 2QM8A 2GVZC 4L5BA 1S96A 2GCNA 4UKDA 1EFTA 2O5VA 4XSHA 5JLJA 2PJRA 2OG2A 3DO6A 3P20A 4B2IA 3FHTA 1YR6A 1E9RA 4FCVA 621PA 3F8TA 4TMWA 4NYMQ 5CK4A 4Q1CA 4WAUA 4MRRA 4DLRA 2Q21A 5BN5A 2OO7A 4US1R 2W2XA 4M9SA 1E2MA 1XCGB 2YKGA 2XXAB 3WHKA 4UNSA 1Z08A 1GDDA 5J47A 2FJUA 4JLAA 1H8HA 5FR2A 4EFLA 4TMTA 5FTKA 3U3JA 3ICEA 2DWOA 2J46A 1E4YA 2ZAOA 4ARZB 2WJHA 1HUQA 3GLIE 4OHVA 3THYB 1WBBA 3B9QA 2HT6A 1XTSA 3OEHD 4LJ7A 1M2OB 2VSFA 3OF5A 2YINC 2Q3FA 5L8VA 5K8IA 1X1SA 2RGDA 4K46A 2V6JA 3EAQA 1GTVA 4MYCA 4F4JA 2REOA 5EQTA 3DEFA 2XTMA 2G77B 2BJVA 3K0CC 4DJTA 4PO8A 1GRRA 3LBNA 3Q7QA 4JT4A 1I4LD 1E2PA 1GNRA 1W7AA 1G291 2CJWA 1FP6A 1I2MA 1NBMA 1OHHD 5D3MB 1J7KA 2ZR0A 1TMKA 3KFVA 5IF9A 2BWJA 2EQBA 1LS1A 1IN8A 2WZQA 5G3YA 2NIPA 4B3BA 2Z0MA 4NTZA 3KX2A 3TW4A 3B1YA 4EPVA 4OI0A 1JR3D 4Q1FA 3T35A 1N6OA 2CL6X 2CK3D 4JL8A 4UXHA 1ZP6A 2HUPA 4NCIA 2W2TA 3EWSA 4N1AA 1OH8A 1DAHA 3QF4B 1KI6A 4KV9A 4Z8XA 1CBUA 2GDJA 4POAA 1RKBA 2W2VA 2TMKA 4TLCA 4GI7A 4YMSA 2ZSAA 3EA0A 3GP8A 4DSTA 3K9HA 1KI9A 1IHUA 1S2MA 2J59A 2V4ZA 4DWJA 4QBFA 3AVWA 3F0TA 1S0UA 3AKEA 1OKKA 1P9RA 4GT1A 2BEKA 3D3QA 5BXQC 1T0HB 4JKYA 3P27A 3DL0A 4F38A 1N25A 1QF9A 1SHZA 4DVGA 1ZCBA 1J99A 3NIBA 1XBTA 3GQBA 3EPJA 4D26A 1ZIOA 1XZQA 4AYXA 2XSZD 2PX0A 4Q21A 2FPKA 2ORIA 5FL7D 1YRAA 2P6NA 4G5OA 2NOAA 2PCJA 3BIFA 4LHZA 5FUYA 3RSOA 4Q5IA 5H1YA 3IGFA 2AK2A 3CIOA 2JDIA 4Z54A 5IT5A 4LZZA 4OHXA 4ZI3A 3AVUA 2RHDA 2GF9A 4LBVA 2WMNB 4OI1A 2JLUA 1CF4A 3ZVLA 1P3JA 3DVLA 2W0SA 1G18A 2NO6A 2Z43A 3AB3A 4HZUB 3KJGA 4ZCLA 3W9YA 4C0BA 1CR0A 4Q1AA 1Z6AA 4QHYA 4DUGA 3KKNA 2VQSA 3W6PA 2QL6A 3B8HA 5JJIA 4ILEA 3THOA 4OJKA 4PFSA 1XEWX 3K0CA 2A2ZA 3AVQA 3ZIAD 4CVNA 3HP1A 1RIFA 4FMDB 2NO7A 3B2EA 4LJAA 4GFDA 4Q19A 1XNJA 4MUBA 3EPKA 3LV8A 4IVRA 5CLLA 4A8JB 2FFHA 3H1TA 2JLXA 3K0SA 4B3FX 2H17A 1SXJA 4HLCA 1C1YA 3CF6R 1MABB 3AM1A 1XTRA 3AUXA 3MWKA 3WNCA 1Q12A 2HXYA 3QG5A 3GLIB 1UDWA 1G1MA 2ZJBA 4PQFA 1E9BA 4LHWA 4IXMA 2FF7A 4UNPA 3EZ2A 3D6TB 4OL0A 5AJXA 4KXFB 1BS1A 5FOVA 2O8CB 3K0FB 4MUAA 2PL3A 2B21A 2HCBA 1KKLA 3QI2A 1KK1A 4E5UA 1LY1A 2GCPA 1P9WA 3TAHA 2IBMA 4F7WA 2VHCA 3NXSA 3EW9A 421PA 3AVPA 2ERXA 1VDZA 4QNMA 2ZSBA 3QBTA 3RWMB 2GHIA 1S1CA 2WV9A 2ZETA 1XJQA 2G0NA 4H1VA 4Q4JA 1T6NA 3TSOA 4A8JC 3NHBA 1R0WA 4ACBA 1P75A 1W2HA 1Z22A 3QKRA 2QMOA 1OH7A 2BKEA 1KNQA 2GXUA 2CNWA 3WRYC 1CR1A 2D7CA 1E96A 4BGDA 2OAP1 3UWKA 5GVSA 1E9CA 1GKIA 1GVNB 4C0AC 3JZAA 1BOFA 5G40A 1FUKA 4HI0E 1US8B 1EWRA
chains in the Genus database with same CATH superfamily
1QAQA 2K4MA 1UXHA 1BD4A 1XJWA 2ZYAA 3CBGA 2GILA 3S1AB 1CK4A 1X42A 4ZHQB 3VOTA 4A0FA 1P33A 4AS2A 2GX6A 1Z28A 1JBKA 4K88A 4WNAA 4OQDA 3P94A 1SUCA 4HMOA 2WP0A 1XZKA 1T8UA 1OCEA 1T0UA 4B3CA 1T4DA 3KWLA 1T10A 5DM2A 3HCAA 1OLSB 4TMZA 5EMLA 1U7HA 4HGOA 4WOCA 3DV0A 4AP5A 3THXA 4MO9A 2J67A 5AJZA 1XK7A 4D0GA 1DFHA 1ACJA 3RVJA 1N2SA 2ZIEA 3IRVA 4K9MA 2OHGA 1AKQA 4AZTA 1BJKA 2XHEA 1Z5WA 3BMOB 3A1CA 3M5WA 2PUAA 4A2WA 1VMIA 2AKAB 2RCYA 4BFLA 3EHDA 1T0JB 4N5IX 1RFGE 3S6JA 1SCJA 2FW6A 2PANA 3I9OA 4HDOB 3K20A 5BVGA 2QNRA 4PTZA 2ZIUB 2QU7A 4KDEA 1JF8A 2E9SA 2FZ4A 4NZNA 3KXPA 5CB4A 3AINA 5I45A 3R09A 4MGHA 5LPNA 1RNLA 1Z8FA 3NRBA 4H3KB 2X9QA 1WTCA 4MP3A 5ALEA 3PXDA 2A67A 1YA6A 3B52X 1E60A 4M9QA 1A76A 1L3IA 1LRLA 3DULA 3O95A 5A2GA 1N3IA 5BWLA 2C7OA 4WADA 1VP3A 4G8CA 5FH9A 2QQFA 1PBNA 3MQ4A 2X8JA 1AIPA 2O6LA 4QFBA 2PX5A 1WXFA 2XXBA 4UC0A 4V0ME 3ZVRA 4MAMA 1LPNA 1SHJA 2A9KA 4CQNA 3KYCA 5E8RA 3VNUA 3VR3A 2ZRKA 2Z9CA 3F3KA 1RXUA 4WZZA 4C4AA 4YAUA 4CF5A 1UK9A 2A1TR 1N9GB 2PMDA 3L4BC 1QBKC 1XQYA 1Q44A 5KYTA 2Z6VA 5FA5A 4HUQB 4I6EA 4LSGA 4U7TB 1B3BA 3ELWA 2ZZMA 2JGDB 2FWNA 3K2EA 1LPOA 4WCVA 5BWMA 1DO8A 2VYFA 3RAEC 1IWOA 1P60A 10MHA 2G80A 1Q0RA 2AG5A 2Y4NA 2ZUVA 3BHMA 3CUWA 1E4EB 4D0RA 2SHKA 4RIGA 5BVHB 1SKQA 2C7RA 3B1KA 4PAWA 5EHGA 5FTWA 2FW1A 1AS2A 2ZJYA 1W49A 3CEJA 4EEZA 3AL0C 2YZNA 4TS1A 1X7WB 1F14A 1IQ0A 1NZFA 4O3MA 1ZK1A 4H16A 1ONPA 4RPKA 2JFBA 4U7JA 5JNWA 1PTJA 2PKRA 2PN1A 4FNGA 4H0FA 2Q3LA 3O74A 3U81A 3KXLA 5I4IA 3BE8A 3DF9A 1H9BA 2P40A 4U8GA 4K9LA 3DGFC 4KIWA 1HNWB 3GGGA 1X8KA 3CZQA 5BUQA 3SI7A 3JW8A 5DU2A 1A9RA 2FU5C 1DBWA 2X3YA 3CRRA 2ZI4A 5FNVF 1IXYA 1ECCA 1NNSA 5EXEA 4MS1A 2WIJA 2DBVO 3CTPA 5FI0B 1MKYA 4K6HA 1NSFA 2GCEA 5LZ8A 4G1UC 5A3JA 3GJSA 3ZWXA 1WLSA 2C2ZA 1EVLA 3S7TA 1AMOA 3GBVA 4OK3A 3C1TA 3KPYA 5CGZA 4YC7A 2YJTD 1ID1A 3DLBA 4Q15A 3CUEF 4DR5B 1HO3A 3CS3A 4ZQFA 5EIEA 2BEWA 2IYQA 3FFTA 4G1EB 4D80A 1BS9A 5ARBA 5CB0A 1NVBA 1YBHA 2NV0A 4WASA 3A4VA 4D8UA 4A15A 1N8KA 2HYDA 3WLPA 2P6OA 1IEWA 4IX1A 5LZ5A 1VB3A 2CZGA 1HRKA 1WXGA 2QZSA 1N7JA 2WSSD 3ROEA 1XLVA 1E3WA 1JLKA 2TMGA 4QPDA 2GAAA 3W5JA 1OILA 1JV2B 1RJFA 3ABRB 3L4BA 2PTGA 4XUCA 1KEZA 4RVHA 2W6QA 4OHYA 2V6IA 3UAXA 3MFQA 3MWGA 4PQYA 4UFNA 1LX6A 1JI3A 3OWXA 2JKYA 2VSXA 3TLGB 4ESHA 3QMPA 1QU2A 3SC2B 1RM5A 2IXAA 3D8NA 4NYIQ 4LMPA 4C0WA 5C4MA 7AT1A 4GKKB 3BJIC 1RJDA 4UHJA 5H16A 3WWEA 4MV5A 4XDHA 3LSTA 4JJFA 1G42A 1FRZA 3P2EA 4K28A 4UM5A 1Y42X 2X19A 4YAWA 2WHRA 3DDNA 1DKPA 2BFAA 4MRNA 5FOTA 2GAOA 1VBMA 3IBCA 3D43A 1IN5A 3H9UA 4KACA 3NU1A 1VLQA 4Q9NA 2YCBA 2AOUB 2FG6C 2JI4A 4YMHA 3HV2A 5F52A 4ACAA 4EYGA 4HVAA 3TMKA 4QULA 4OX9B 5EZ5A 5M34A 2BSAA 2SKEA 2Z8ZA 2ZJOA 4Y2HA 3OCVA 1E9DA 3MA0A 2AHOA 2FLKA 2P3OA 1RRPA 3PA8A 2ZWOA 4MAAA 1ZHHA 1I6LA 2AG1A 1EK6A 3Q2IA 3MTQA 2VFAA 4IIVA 1TZJA 3G5AA 5DM0A 2Q1XA 3UNXA 1ZH8A 2QLBA 1FJXA 3T3EA 3ET4A 3WGUA 3S28A 2Q3BA 1ZVJA 2XA9A 3K53A 3CRNA 1UDRA 1FYFA 1RYBA 4OP3A 4K3VA 4XLLA 3GT0A 3ZWAA 5BV2P 2CHFA 4J0CA 1M1YA 5A3QA 4LF7B 3H84A 1GQ2A 5KYYB 2B8JA 2IPXA 3DCYA 4RGBA 4RHYA 5C5DA 3TEMA 4BX8A 5CRIA 2W22A 1XTZA 3DNFA 1HLFA 4PPFA 1LDMA 1Z2DA 3PWKA 1MN6A 3EISA 1SBCA 4P82A 1B0ZA 5E0OA 4ZIRB 2BF4A 1J0DA 1ENPA 1QH8B 1F17A 3T9EA 3OZIA 1SQ5A 2XAAA 4RULA 4FGLA 2NTJA 1R0YA 1YZUA 1NNLA 2IS6A 2XMRA 3LRXA 1EQ2A 4U39A 1K88A 3TTWA 3RJ5A 4WN9A 1E3EA 3QU9A 1T9GS 1W36D 2FHPA 5EXTA 5BQFA 1JMKC 2DGDA 2DBYA 2QN9A 4UBMA 2Q5LA 2PEZA 4ISBA 4WOBA 4MEAA 1EDDA 3MELA 2W9XA 3GQBB 5TC4A 1J2TA 1IN1A 1U0LA 5IDWA 1WEHA 3OIWA 1UZUA 4A36A 1ZCFA 2IPMA 3ANYB 3ZHUA 1D0VA 3UXMA 1YK1A 2WSMA 5HCNA 1NZDA 1OXMA 1YKSA 3AHJA 2WFLA 2VHJA 3KLMX 1OA0A 2O2DA 4CI0B 3VJMA 3U60B 5GADl 1YBAA 8ADHA 3WLLA 3PTLA 5HMLA 1JDBC 3PD0A 3DV9A 4UUBA 4Y2PA 2FLWA 4HNHA 5DN6A 3VSBA 2OBYA 4NBRA 1A82A 1QYCA 1DT3A 1KR2A 2ET6A 2RC5A 4IHJA 4QA9A 1Y3FE 4EGQA 2WVHA 1LBQA 2QD1A 5AM3A 3NBYC 1NATA 3B60A 4RO0A 3FG9A 5TSDA 5KX5F 4M86A 3RAJA 3WLIA 4EECA 2VNKA 5IAAA 1MCZA 4MEBA 5FT9A 4BB5A 3ZCRA 4DPMA 4B3JA 4LOLA 5TT1A 3E8MA 1TZMA 1DMSA 1BN7A 5JE8A 1N2GA 5HE8A 2B2XA 5JS6A 3GVCA 3E15A 2YHIA 3NRCA 4U7DA 3LDUA 4GQIA 1FFSA 1SC1A 1ZN8A 2BJHA 4WXRA 4ISCA 4YP6A 5FOSA 5A6SB 2WDZA 1WX1A 3TSWA 2R4UA 4JOQA 3C5WP 3H2GA 3LP8A 5CFQA 1P19A 2QW0X 2DKOA 3ORRA 3QNUA 1K86A 4CIWA 1NW7A 4EGFA 3T9FA 2B25A 1H1LA 2VDUE 4Q7LA 5JDCC 4BRSA 2LV8A 1KJWA 3CH4B 1SG9A 3ZDYB 4ITVA 4LDZA 3BIWA 5E4TA 4C4YA 4IJWA 4H59A 4M7PA 2WIBA 2I8CA 3NI2A 3PEVA 4Q03A 1KRXA 4MW1A 2BMAA 4PTYA 4KO3S 4OQMA 3PQ8A 1T0PA 3FB1A 1WCIA 3G3EA 4KPYA 2P8SA 3KOZA 2OENG 2Y1XA 2JBAB 3UFXA 1DEKA 3MQFA 1EG2A 1NJ6A 1RKQA 2VPIA 4FNAA 3AX6A 4G0OA 1TC1A 5EKDA 4HMPA 1CDZA 1Z39A 3ONVA 2H08A 4ZDWA 3S2IA 1HYGA 1GCUA 3WAKA 1B8NA 4BGVA 1H3NA 4QBTA 2B0CA 1YXMA 2RBEA 2WU3A 2HQ1A 4D43A 2DTDA 4C0QC 1KNXA 3OEEA 4TYNA 4ESVA 3F7TA 3TIGA 1FSGA 3L7BA 1TQ4A 2BBWA 2CHEA 2G71A 1VI6A 2IF2A 3PQCA 2VLBA 3I6MA 2DF8A 3PRYA 3I9NA 5JDIA 4ZAVA 3I5MA 5REQA 3L8FA 2B82A 3O2QB 3X1JA 2WPNA 1VYVA 1A9QA 4J0IA 2AEMA 1N5RA 5CT4A 4DUYB 2GKSA 4ZO4A 3HJRA 2EV9A 1Q2UA 4MVXA 3KJXA 3WRXA 1JQ5A 4WBSA 4X66B 2IHZA 1E1QA 4C7XA 2YV4A 3UOGA 2B99A 3WL4A 5KQMA 4YA6A 3EH1A 4HMQA 1PLLA 1T8RA 2WUWE 4QYWA 2VT3A 2FA9A 1L4KA 2Z4TA 3AV3A 3NEPX 2NX2A 1E0JA 2BGLA 3T5GA 1KKMA 4QDTA 4BMYA 2YNMA 3PJGA 3GWGA 2APJA 4HXEB 5B7NA 2PX2A 2VDVE 3HL4A 5I8ZA 2ZIGA 4JP5A 3BSSA 3TR5A 4POOA 4O4HB 1GV1A 4QUIA 4ZQEA 5JCJA 1F0PA 2IKQA 1ZQ9A 4Z4IA 3K72B 4MKFA 4ENPA 4TRJA 3Q98A 4X1KA 2P9GA 4Q1BA 5IFLA 3QIAA 1NI3A 4C89A 4EHBA 2PGOA 3JQFC 2YIMA 5U4XA 3KVNA 1T8YA 5B7PA 1POXA 1BMFD 4HAVA 2BONA 3OFND 4UBIA 3UMYA 1FXUA 3BXGA 1OAOA 2I6XA 3LECA 4WNYA 1EWVA 3TI7A 2IXFA 4D74A 4HWGA 4O1IA 1DTEA 1E2HA 5AKLA 4CMCA 5BN4A 2JARA 3TO5A 2JJQA 3FE2A 1MQ8B 3ASUA 4KZKA 3WGQA 1CT9A 1RRFA 2XNDA 4RW0A 2XF2A 1N2IA 1B43A 3RYFA 4BP1A 5H0IA 1O5TA 4XJSA 3ZD7A 1R7RA 2G82A 1XA3A 3VGJA 2FSHA 3E81A 2ECFA 1VSQA 4I4TB 1J9EA 2BGMA 1NC3A 1S8AA 2I54A 3AERB 1AT1A 3EZNA 3N28A 3VR2D 1I5OA 1K98A 1ZGZA 3WMGA 1KE2A 3L49A 1UEXC 4Y8VA 5LJLA 3ZDQA 4MUKA 5B2EA 1U0GA 2JGRA 2FN4A 5SZIA 5TLSA 3R6TA 4CYMA 1J70A 3GJRA 1F8GA 1O95A 3T3OA 4Z7OB 5IK2D 4XXHA 1JHXA 3PDHA 3R6GA 2ONJA 1UZAA 1JG4A 1KJ8A 4UTPA 3CW9A 5HUQA 2Q2VA 4ER0A 3Q9SA 2EBHX 2QN8A 3H13A 3V9PA 2Y8EA 3MAJA 3BULA 1YF3A 4D3DA 3DQQA 2XNJA 3E9RA 3DXZA 3EVBA 3GV0A 2OBXA 2FXVA 1QFXA 2VYCA 3NHAA 5AK6A 3QU5A 3TN7A 2HMUA 4BNUA 4JGBA 1EESA 4D79A 5HM6A 1N34B 3PRKE 2C2HA 1A4RA 1E20A 2IHUA 1XFAA 3PEFA 3CPEA 4L95C 4QYSA 3KQYA 1N6HA 2F4VB 4C6TB 1SU8A 4GWLA 1REQB 1YB2A 1IHDA 4TSFA 3WWZA 1BEUB 3PF9A 3DUFB 1QSGA 1D0SA 2XGGA 3QVTA 3ZCUA 1AG9A 1KL7A 3EEYA 4EF4A 1E4EA 3FDZB 3H3FA 1OX4B 4OCZA 4WZAA 1P5ZB 1BCRB 2CBXA 1X6VA 4E3WA 2JRCA 4TVBA 4IUCS 4A27A 4QU5A 2A59A 3AJRA 3QWFA 4O4JA 2HIAA 4B6EA 3GFOA 5KZMB 3OQOA 4MQ6A 2HHHB 1QQTA 1YOVA 2MYUA 1OYWA 4U7PB 1ZVVA 1FFWA 1LK0A 5C4GB 4A73A 4EEXA 1GLVA 1QOPB 2V0NA 4F4IA 2VTKA 3Q8MA 2JA1A 5DSXA 4KQEA 3KM0A 1USWA 3EOZA 1GGHA 2HBRA 3IBYA 3OJEA 2WICA 4QKQA 1C81A 1U3WA 2O0KA 3ICCA 2OAGA 4FZ3A 4I9HA 4TLDA 5EUBA 3ZU6A 3ZV5A 1T1IA 3CO5A 4J4TA 3ZD8A 3TJZA 1G8FA 2G28A 2VRCD 3KZXA 4DY6A 1QFSA 2P9FA 1PD1A 4P3YA 4U2BA 5JD5A 2WAMA 1Y6FA 3GT3A 3Q3HA 5K03A 1ZGBA 1SMKA 3ILVA 3X1DA 1TT7A 3BA1A 3GFGA 2I7XA 3EH2A 4TXNA 2Q1UA 3K35A 2Y66A 4ASUA 3QPWA 3ZX5A 2VF5X 2VDKB 1O95C 3AVOA 5CP8A 4BO8A 2Y0BA 2H5LA 4EY5A 3MT9A 1PHPA 3KCNA 4M7WA 4PIMA 4Q82A 3URMA 1ETHA 3WZMA 4YRQA 2DQSA 3H8WA 4R9UC 4RKYA 4R84A 4TMXA 5MN4A 2C7PA 2JA2A 2J45A 3I58A 1QYDA 3RRZA 3L9XA 2A30A 3DL2A 3AEYA 1ECLA 3K4QA 4KRYA 4LK3A 5H9WA 2IV2X 1NV9A 3ZDDA 3ITKA 3KDSE 4NBVA 4DLKA 4FKMA 1T15A 4LY3A 1OBCA 3ZCSA 3JQ9C 3UKOA 4M2LA 5CD9A 4OFZA 1TK9A 2HKIA 5JU6A 4MVYA 3INTA 3PR3A 1L7NA 2QF7A 3NRJA 3JWEA 4PO9A 1Y7IA 4XQCA 5AK4A 4C3UA 5CCEA 2WRZA 3OURA 5B4TA 3I92A 2P11A 5CG2A 1X15A 5IAEA 4HDQB 1UOOA 1ZM4A 2PJZA 4QGAA 2C1XA 3ZU4A 4F5DA 2HEGA 1R8JA 1PJ3A 3IJEB 1MRNA 3ROQA 1SIBE 3W2EA 1KZGB 3P0JA 3CUYA 3BDAA 4TRMA 2PBLA 1DC5A 1V41E 3FNRA 5EFZA 2A1TS 3QXJA 3ZXXA 1EKXA 1V5GA 1Z82A 1PJLA 4N82A 1A69A 1BW9A 2FW0A 4P33A 2ZI3A 4JK3A 1U1IA 3FWYA 3KWMA 1OWPA 3NW9A 4RLFA 1ILEA 4XFDA 3K9FC 4OBBA 2BM9A 2CNOA 3A3PA 4G36A 1KY3A 2R87A 3EIUA 4P2GA 3WBBA 4AF8A 4W82A 3MCTA 3HNPA 2AFHB 4GSLA 4O1HA 3AEZA 1TT5A 2ZVDA 1FJ2A 3E9MA 4BMPB 2BFWA 5KJEA 1LNZA 4HFNA 2C9CA 3OOJA 3SYTA 3GVIA 4C29A 4DCVA 1IJKA 3VHXB 1X1TA 2P0YA 2V7XA 1H22A 4R5MA 3DWFA 1XD8A 2V9PA 4EY7A 4XLZA 4FDLA 4LIPD 3R9WA 1GNVA 5DCLA 4GBED 4JJZA 3WK9A 3WKEA 2TMYA 2A0YA 4J76A 4GLLA 3WP1B 1CUIA 1YDEA 3DBHB 1VLVA 3EXIA 3LUFA 2W93A 4CLEA 3AM5A 3NXKA 4DJAA 4FNOA 1NOJA 4HYYA 2PL1A 4YVFA 3WQQA 3KOWA 4Q6BA 4V02A 4J49A 1RFLA 5BN1A 1P5JA 3AY3A 3VUFA 2PUHA 2E4UA 2XRFA 3KLBA 3GAAA 3NIGB 5B37A 3VTKA 2JK1A 4PHTA 4ID3A 2EG5A 3L0OA 4RGVA 4AO7A 1X8JA 2ODTX 3GRZA 3NEJA 4W6QA 4EUNA 3TSZA 3ZHCA 1LEHA 2I0FA 3LDHA 4OHBA 2PJDA 2YN4A 1G4AE 2ZT6A 3FNFA 1JG6A 4OYLA 5F12A 1DAIA 3GJXC 4WE3A 4BNHA 4D02A 3EIHA 1Y4SA 3TNJA 2I33A 2R9VA 3TNFA 4MDYA 1VZ2A 3GUUA 2FI1A 5IAJA 3NIWA 2P62A 4CCWA 3KOMA 1I1QB 3Q6NA 3WO1A 1YJBA 2XQGA 4YRDA 5IM4F 3GMIA 4CG0A 5JEEA 4BP3A 1HH4A 4E21A 4GZLA 3FYUB 1P2FA 3ZWNA 2L0XA 1DRUA 3B85A 3MLEA 3PUKA 5DDIP 3JATB 4JUIA 3AF3A 3MS7A 1MNAA 2VK1A 3KAKA 2X5NA 1XZPA 3MJEA 3QKSB 1R15A 2PUFA 1Y63A 2OCKA 1GQYA 2V7QA 3QYPA 4KZPA 5CURA 2BTQA 5IXSA 2EFGA 2VHXA 1VP9A 3GDHA 1T5HX 3NP7A 3UKJA 1X39A 3KQMA 1RHMA 2O7SA 2O54A 4PNZA 4P58A 3VVBA 4F3TA 4NCNA 4OQLA 4BLTA 4YT8A 3GMSA 2OHHA 4LZAA 3CEHA 4D1YA 4URVR 3LXUX 3AOEC 5JS7A 4PZ9A 4MV9A 1GTZA 2C42A 4PONA 4Q9JA 1GQFA 1IHYA 2XDWA 2YWRA 5E7MA 3SXJA 3ZIAA 3TFQA 4OYHA 5BSHA 5F7JA 4EITA 2OAEA 1OPXA 5FFFA 1YZVA 4GOXA 3GLVA 4R1PA 2YYSA 3IHWA 1U5AA 5I7AA 5BRNA 4F21A 2NU7A 1W5TA 1ZX1A 3E27A 1MAUA 2CFCA 2C31A 3UC9A 3X3HA 4ZC1A 1ZH0A 4F3KA 4EKGA 3FI0A 2XXAA 1YMQA 1E6EA 1MJNA 2PUVA 3GD7A 5DNEA 2CT8A 3A31A 1GRQA 3R3JA 1JYEA 1TL7C 2NVOA 3BIJA 1NBWB 5AJVB 5FV7A 1IRIA 1IZ7A 1CR6A 1FDTA 2R7KA 3WLOA 4BO1A 5K01A 3RKUA 5BQ5A 1H5NA 1OZFA 4C43A 2EWWA 5CMLA 3TECE 1W8DA 3O6VA 2V1XA 5CHEA 2X41A 3ZHXA 3A6DA 3UFXB 4XFJA 5YASA 1PWZA 3F1LA 2WZCA 3NAMA 3U2QA 1DKQA 2V4UA 4YAGA 1HMYA 4E4YA 4N0PA 4URZR 4CQLA 3D7KA 2YVQA 5DHPA 5GJVC 5JNVA 3MMZA 3REGA 1T6ZA 3SIWA 4AMUA 2TECE 4BEWA 3HB7A 1D2AA 3C0KA 3PU6A 3ZQ6A 1RM3A 3ZLVA 4OQQA 1X1RA 4AUMA 3CLSC 1H2YA 1FUIA 1XN1A 3WGYA 2GK3A 1OD6A 5REQB 4U3JB 4BQPA 4LPKA 4WIAA 4D8VA 4L5CA 4BUCA 4R0VA 1RQRA 3QJYA 1L5RA 1KDTA 2EFCB 2YRFA 4KX3A 4WZBE 4X5OA 5JZ9A 2RHOA 2A1UB 5L4LA 2MR6A 4OQNA 2MINB 4B45A 3NBXX 3U4MA 5KWVA 1P8JA 2GKGA 3PC3A 3GK3A 3TI9A 5TMDA 2FUKA 3AF6A 4GX5A 1XXLA 2QRNA 5CPFA 1V35A 5CITA 5ERXA 4FFLA 4JROA 5BOVA 2DLDA 5BMOA 4QJIA 2IK8A 2VYNA 4B6FA 5EIBC 5BSMA 3ZV7A 3CH7A 5JMWA 1ANKA 1TU0A 2VH2A 1DTWB 3RRYA 3DDCA 2ZCUA 2XAUA 3N0VA 1QJ4A 5F1KA 5KNLA 2D59A 2P2NA 2OHFA 2VJCA 4GE0A 3RRJA 3SLRA 1J33A 3NUGA 4OEHA 3S2SA 1KZ4A 5FADA 2H5JA 3MINA 4IIEA 2VYND 3C16C 2CJXA 3JX9A 2I2WA 1FS6A 4PZPA 1GHTA 1EA5A 4WA7A 3R8FA 1KZ1A 2ZOSA 5EMHA 3VDQA 5E3HA 4FYHA 3G17A 1FLAA 1IL0A 2I2AA 3JASB 1Z17A 3RAFC 4N54A 4LJKA 2Q6IA 1P74A 1UJ6A 3NBFA 2IPLA 3UMJA 1ZW6A 2OGWA 2NSYA 3PE6A 1GYQA 1U0TA 1NT2A 1QIKA 3PI7A 3Q2OA 2QT1A 2Q2NA 1H2BA 2VHVA 1YS9A 5L95A 4LF9B 4RM2A 1I0ZA 3AETB 4ZCPA 5HA5A 3ROPA 5KSYA 3E9QA 1RXEA 3OO1A 2FMKA 3FOEC 2YASA 3WRVA 1XVVA 1O54A 2DPLA 3CEAA 3CR8A 3IQHX 2RG1A 4P38A 1Q16A 3WOVA 2FN9A 4GLOA 4MVJE 1CUGA 1HG0A 2CC2A 3HSKA 2G5CA 2O50A 1LRJA 1CS4C 3VGPA 3ELBA 1EE2A 2ORYA 4N49A 3ZUPA 1ZR4A 4NMLA 1GFIA 2E4YA 3EDRA 4FINA 1TJ3A 1GR1A 2LZ0A 4NJMA 4C4TA 4EL5A 3ZY3A 1RLJA 2ZSHA 2YXPX 5AFSA 2VBFA 2ZAMA 4TS9A 1FTGA 5T4EA 3PE4A 1JFLA 1HYEA 4XJTA 1PFQA 4Q4LA 1SO8A 1JVSA 3T1VA 2QTHA 3JU3A 4CL3A 1JSCA 1NDQA 1TLLA 2HF8A 2HXSA 1ZVQA 1EVQA 4XD7D 5CIWA 3PGMA 2NXWA 1JYFA 1KEEB 1ENYA 1QKKA 1RJ9B 2F1HA 2JD0A 1YULA 1WPRA 2OCGA 3C5HA 2A5LA 4EW1A 1JDPA 1T9HA 2PFKA 2ZRNA 5AOBA 3CW8X 1ZK3A 2R6JA 4PLGA 3RPEA 1JR4A 2X2OA 1RR6A 3C8UA 4G41A 4HH3C 1KDYA 1TF7A 3AXSA 2QTNA 1P4GA 5G41A 4EX6A 1K68A 1VHWA 2HJ9A 4MPRA 3BGIA 1LBTA 3ESYA 5E1MA 3U7GA 4FU0A 3NNDA 5DM4A 3COPA 1KF0A 3NDRA 2ECQA 2JHPA 3V1KA 1JAZA 1HDGO 4NENA 4BBPA 1T1JA 3CONA 3B1JA 1PAUA 2OBBA 4UM9D 4L7VA 1NAIA 1ZW1A 2W6CX 3E9DA 5KREA 3L7YA 5JVDF 2CJWB 4B4KA 2YWXA 4R8SA 4X61A 5FAXA 1RWVA 3H6HA 3RUDA 2H2AA 1SOWA 1DC8A 1H2XA 2DT5A 4F6RA 5K0TA 1WB9A 4TYYA 1E66A 2IZZA 3EDCA 4AJKA 1KH2A 3AIIA 1WHSB 4K9KA 5EJFA 3WQBA 2XMPA 3ODGA 4DQLA 3SHTA 1S9DA 2CVZA 2O4UX 5HILA 1DADA 4RK7A 1W25A 2GEJA 1VGRA 8MHTA 1ZPDA 2XB4A 3V4RA 2C4VA 2G0AA 4NCBA 3GJ6A 3K6SA 1YS1X 2R4QA 1RP7A 3KYDB 4XGIA 2IUEA 4ZOLB 3RYIA 1DARA 3AV0B 3SU8A 2XWQA 1IAVA 5GOZA 1TEVA 2FGJA 2JLQA 3SFTA 4W1PA 4P86A 3ZDEA 4RZHA 3LIIA 3ON5A 5F9FA 2DWQA 2FRXA 4WNIA 3SPXA 3ZOZA 2XW6A 4CDRA 2QMUA 3C7CB 1U3UA 2B9VA 3FRIA 3ZW8A 1M74A 3BSWA 5MFPA 2W2KB 1S8OA 4R05A 5TQ2A 2AOTA 2ZI5A 1TKCA 2NU6A 2IYNA 2CCGA 4MVJA 2NZ8A 1ZGGA 3DHNA 3IJRA 2B4AA 4WGGA 1HKUA 3KZNA 2VT7A 3WGTA 4BQEA 2F1IA 2OK7A 2FN8A 3L8YA 4QYXA 5K9ZA 1WJGA 1A4IA 1Y1SA 4UHDA 3GX1A 4JLBA 5ALUA 2PV0A 1M34B 4ZVPA 3E61A 5A7GA 2IDKA 3W77A 1OB5A 3T9BA 3HDVA 3UBMA 1AX9A 2PH3A 4LFBB 3KQOA 1Y9DA 3ZE1B 1NRJB 1R88A 3SMVA 1SCKA 2POQX 2XJ9A 4J43A 4RABA 4ZCQA 3TCXB 4XI9A 2EW2A 3V4FA 1ZAKA 2QVBA 3AW9A 5I9TA 1DCKA 5DP2A 2HHAA 3ND8A 1DI0A 3IEMA 2QRJA 1IN6A 4B7UA 2ZJFA 4HAUA 4HNTA 4TKMA 1AHNA 1CRLA 1T8WA 3RADC 2F1OA 5A3RA 3O3NB 1FIUA 2NU9B 4LZJA 4IF4A 4EHLA 1YQQA 1L7QA 1E98A 1MQSA 3VPAA 1QOZA 1P9OA 3AVTA 1RT9A 1Q0ZA 1A27A 2ZRDA 3E2MA 4LE1A 3RU7A 1R16A 3AM3A 2Q9CA 4DAOA 2X4LA 1RJWA 2W4QA 5H7XA 3U5ZB 2MMCA 1BKDR 2AJCA 3LA6A 4Y2XA 3VVLA 3ZZTA 3E0XA 4CMAA 4IH4A 4MJXA 4XASA 1BMTA 4MA4A 4WI1A 3W8FA 6ADHA 2CBZA 3UK0A 1Z6YA 3AY6A 2JFOA 4DV4B 2JAPA 3UO8B 3U37A 2GBGA 3VVMA 4NMMA 3QXHA 2QNIA 2X42A 1PT7A 1HOXA 4QRIA 4R1MA 4ENSA 4NK5A 3MJHA 3ZTYA 4MYDA 1CIPA 1NUTA 3RS8A 2ZRMA 4ZOEA 2J6IA 1ZD4A 2ANBA 1NU8A 2CWWA 4RFSB 1HDXA 4IJMA 3BKWA 3H5OA 5G0WA 1MB3A 3KXIA 3EN0A 2BRUA 2Q2WA 1PL0A 1BX3A 4B7CA 4E4TA 1WZ2A 5HGJA 3S2YA 3WLFA 6NULA 2AW5A 2VPTA 4MW9A 5GONB 3E5RA 5THXA 1QUEA 1UWVA 1D2NA 2JAHA 2G8NA 3NBQA 3SJCA 1DIBA 1GADO 2FUNB 2HLPA 2JBWA 3EVGA 1PK9A 3PPWA 1H2RS 2WWFA 4FONA 4PC3A 3LT1A 4UDNA 3X1XA 1V7QA 1V3TA 2XX3A 2OFFA 1MHTA 4DCCA 4V38A 3G13A 4OHOA 1UKEA 1R4NB 3PHLA 5DYYA 1FBTA 2QV7A 2X2FA 3OEHA 4ZQBA 4IP0A 4MS4A 3UUGA 1IFXA 4I2VA 4IIBA 3ZZ0A 1HE4A 2Q3DA 1R5NA 3WWCA 4LISA 2PWAA 3C6BA 1AGXA 1IAQA 4HNAB 3KQTA 4RANA 1NNUA 1DAMA 2HI0A 3FROA 4DLXA 1L7OA 3I3SR 1OXBB 3JAKB 3SSOA 4DCUA 5KYUB 5DPMA 3DOFA 5FPKA 3WB2A 1HT2E 1Y8QA 2J9XB 3L0PA 5ER9A 1HETA 3BWVA 5EP2A 2HXGA 4CW7A 4NJEB 4N03A 4Q12A 3Q7EA 1IIBA 5H59A 1BXKA 2M1XA 2AR7A 4UU1A 3ZY6A 3T5DA 1HOTA 3BF7A 3IAHA 4JMPA 1OH6A 3ENQA 5E9WA 1LFAA 1M72A 3VYWA 4ZK6A 3UMMA 1ZK4A 2PUEA 3THSA 4Y2SA 2DY1A 2AYXA 1RAIA 1RKXA 2XKAA 4OHCA 3WNVA 3Q10A 3X1ZA 4AMZA 2CDAA 1H6DA 1EK1A 3OD1A 1ZOLA 2BBTA 1GQOA 2OKCA 4HYQA 4ETNA 4N3NA 6REQA 2OBNA 4UEKA 5AJTA 4L4YA 1QO0A 6AT1A 2YRWA 5ALXA 2WIFA 1MW8X 2G9VA 2PPVA 3ADCA 2EHDA 2B37A 3OQPA 2NSLA 4ZARA 3E6AA 3H97A 2W2QA 1NN1A 3F6YA 1YACA 1CFJA 1YJ5A 1N5JA 2XKJE 2FHSA 4TKVA 1Y6JA 3E9EA 4XGNA 1BKSB 1VPWA 3TR0A 1XMVA 3X2FA 1IQUA 1U11A 2CNKA 3PNMA 4N39A 4EKIA 2ZJ8A 2GBCA 2QR2A 2QYHA 2AHRA 4I3HA 1NVXQ 1SKYB 4E08A 3EQ7A 4RYLA 3PIDA 2DPMA 2EZTA 2ENUA 2NT4A 3EGDA 3NH9A 3MYRA 4KQKA 5KNBD 2OV6A 1SULA 2O2JA 1TCUA 4FFRA 1M8GA 2XGSA 3RJTA 4HGYA 4JBLA 2BKXA 4QOGA 5T4BA 1MA3A 2XA1A 3PNKA 1E89A 2FOLA 4LC9A 3D9QX 5CX1A 3EZYA 2JFFA 1VBFA 3QX8A 5IVDA 3AEKB 3VDXA 2CL5A 5JZMA 5KQGA 3MWLA 1UBUS 4IDNA 2GTPA 1GSIA 4S04A 1JQKA 2VTBA 4Q6WA 2GJKA 4PSAA 3OWOA 1DIGA 2ATVA 2GN9A 3P9XA 4JYCA 3HMQA 4RKWA 3N70A 4ZVKA 4AS1A 2PUBA 1KIMA 2QU8A 4NFHA 1QIIA 2A88A 4JBHA 4MITA 3WMFA 3GCWA 1UBNA 2XTZA 1KOFA 3I09A 3KKLA 1THZA 1Q3TA 3EUEA 4LVCA 1INLA 2PEYA 3DNMA 1R0XA 2XVYA 5AMXA 4BVAA 3MD0A 3A1SA 4MX8A 2OVFA 4Y6LA 2I4IA 1I8TA 3EGXA 4AG6A 2OFPA 2QTLA 3FCOA 1T36B 1XMXA 2A5DA 4NAVA 2ODBA 4RJJA 3WV5A 2J3EA 1HSZA 2Q8NA 3RRXA 3W04A 3A3NA 5C3UA 5FJIA 3DWEX 1PIWA 3DR3A 3JQAA 4WFIA 1WIWA 3LUKA 2O1SA 3GB9A 3IKMB 1UPCA 4M38A 3QFTA 3IQXA 4WMLA 5CM9C 5J4KA 3BH6A 2HRQA 1BDJA 4ANFA 5J2TB 1QCYA 1WRBA 3CISA 4PRZA 2GEKA 3V46A 4X7RA 1TJPB 5IUNC 1CY6A 4K9RA 4YP7A 4ZYWA 3DLHA 4JX8A 4OQPA 5JSZA 1Z25A 3GNSA 1YCGA 3DT6A 1DTWA 4ID9A 3H5LA 2JLSA 1VHLA 3HH8A 1TYEB 1C3EA 1JB1A 3GZNB 2RFLA 5LP6C 5IJWA 4Z5XA 1U02A 1SXJC 3PRJA 2LXNA 1T6XA 1QGOA 1U7XA 3AIMA 1E2LA 3IL2A 4R01A 1F2UA 3LNTA 3HWSA 2E6UX 2Z5GA 1SCIA 2DE0X 3GLGA 3I05A 5EP1A 3ECCA 4KJZA 2EW8A 3QVLA 3N2KA 4C7KA 2A9RA 4Y2JA 1T1GA 3JASA 2FAXA 3M5PA 3P26A 4MEJA 4WEOA 2A9FA 1QLWA 3CVXA 4L5IA 4BWVA 1T2NA 4GR9A 2HADA 3MLBA 1K75A 4YECA 1EGMB 3AETA 5AYVA 2CJYA 1VL0A 4BNIA 3WMWA 3AEUB 1DV2A 3C1OA 4P4UA 2DPHA 1Q11A 1E0SA 2VQ6A 3EPRA 1XVIA 2FWBA 4XSVA 3GJTA 3CRQA 1R6XA 5E6SA 2XMZA 3E7DA 3RTCA 2ZYVX 2Z57A 3LA8A 4W7IA 1G60A 1WUYA 1YVDA 1H93A 4INJA 4LKRA 5ALQA 2I4NA 3LPDA 2BI7A 2PSDA 4RC9A 5L53A 4KR9A 4YAKA 4DM7A 4G5SA 3H5AA 4CXMA 5JCOA 1EFKA 1SXJB 4PC6A 1MABA 2P75A 1N3LA 5E6RB 4JQCA 4DLAA 2VNJA 1XROA 5AVVA 3AESA 5ALTA 4PGAA 5G0SA 1JKJA 1G6OA 4RXMA 2I71A 2QEQA 1K3UB 3HU5A 4NMWA 5EXDA 5B6JA 3SR4A 3OF2A 1JIQA 2O8CA 4MQMA 3TM4A 3K0FA 1IBKB 4MWBA 4NV3A 5AM2A 2F1RA 1XNQB 1YCDA 3G8YA 2XITA 3FVWA 3N2NA 1H8ED 2X7JA 3G59A 1E3MA 1NQ5A 1BE0A 2CFSA 1I3MA 2GM4A 5JSUA 4E12A 4K40A 1CUEA 5K7SA 3T5AA 1MO4A 2HK6A 2IPOA 2FWPA 2E37A 1OBOA 4HTFA 1TGYA 5LVAA 1HDEA 1DDIA 4GOJA 5EXSA 3A10A 3DBRA 1U4OA 3ZLJA 1V3QE 3VNBA 1PNQA 2WU0A 1WOMA 4ZD6A 4CTOA 4V0QA 1MD9A 3PPIA 2GR9A 2ZR9A 3EMBA 2A0XA 1EFHA 1JHRA 4YV0A 3ZWQA 5CYOA 3DPSA 1H6CA 2NPFA 4M1EA 3ASYA 1UOEA 4A7PA 3HA7A 3A05A 1ADGA 1T5DX 1I4EB 2WHEA 2X5OA 4GZ3A 1U0JA 3FOCA 1U0SY 3HKBB 4V0SA 1VKRA 1JWBB 1N2ZA 1YR1A 2AXQA 2MSLA 3ETHA 2B1QA 3OCJA 3BREA 2YXNA 4G0ZA 1OREA 5KHOC 1G4UR 1GZ5A 3CBQA 3OHSX 1YVUA 2ZBDA 1V26A 3FY4A 5EIBD 1J25A 4PAOA 1LDGA 1V6CA 1Z5OA 4NATA 2CE7A 1WW8A 3VNRA 4LTDA 3E3MA 2HO4A 3ZTWA 2AQHA 4KQGA