3T1OA

Mgla bound to gdp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
192
Chain Sequence
STINFANREINFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIGEVKGFKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Gliding protein mglA
total genus 60
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t1oA00
4U02A 3I62A 2FPLA 1TUEA 1Z6TA 4MKGA 5K8LA 5IT5A 1W4CA 3MWJA 3VR2A 2HJVA 3LBIA 2GZHA 4D82A 1NG9A 4BRUA 1E32A 1L4UA 1FFHA 5DNYB 1ZNXA 4LBWA 1GKUB 1DVRA 4OHZA 4EPXA 1A82A 1HEIA 3FWYA 3TAHA 5AJZA 3VHLB 3GEEA 4EFNA 3A6PC 1RRFA 4A2WA 4DLVA 2WWFA 2BJWA 4BGDA 1NNEA 3PXGA 2CLCX 2V9PA 2ZQ5A 5B58C 1LV7A 1TU3A 3EC1A 3QEOA 2BIFA 5HZKA 3Q7PA 1T3SA 4PPGA 5TARA 4LK2A 3FB4A 3HJNA 1NIPA 2IF2A 4PAOA 4Z54A 1P2TA 2PT7A 2GAOA 4F4CA 2PCJA 3THWA 3EX7C 5L3SB 1U99A 2IUSA 4LJ6A 3GJ4A 4A0FA 5E95A 4QG7A 4HLQB 4UNPA 5JJLA 3AUYA 3HDTA 5FTLA 5JI3E 4AI6A 4BRWA 1UJ2A 4FIDA 3SJBA 2ZRFA 1G4UR 2IHBA 3QG1A 3UIEA 3DKVA 1E9EA 2W6IA 2OCPA 2YOHA 4I1UA 3I5YA 4M1YA 4AYWA 3SYKA 3JZMA 1GZSA 3N2IA 3O8CA 1D9ZA 1XTIA 2P5TB 3GFPA 1Z0JA 1ETUA 4OHXA 3FMPB 2ZJBA 3GJ3A 2A9KA 2CLDX 4FMCF 4EPWA 4UNRA 2RKOA 1W0JD 4I81A 5C2JB 5JSZB 2V6JA 2UVQA 1E9BA 3C8UA 4D0GA 2J87A 3CPHA 1IAQA 1AKEA 4UXJA 3ICEA 1TQ4A 4QC2A 3U3OA 1E9SA 4F4IA 3A1TA 1XTKA 5EP4A 3BERA 4DXAA 2DFKB 3H1TA 1G3MA 2ZVQX 3NBZC 4JLPA 1G7RA 1LTQA 3SHFA 4QNMA 1VHLA 2ZI9A 3FFAA 2J41A 2OUKA 3N2EA 4HAZA 5IDVA 4LDJA 4FINA 4JVMA 1RYHA 2QP9X 4DLSA 3QKSA 2YINC 1KSGA 4PAQA 1IOZA 1Q1BA 4BFSA 2XSZD 4MKIA 4S35A 1G8YA 3W34A 2HXSA 2W2XA 4ASUA 4AURA 3THWB 2YOFA 3U7EB 4M1MA 1IY0A 1TNDA 2QE7D 4M0LA 1NLZA 5E7IA 3RABA 2AD1A 4O3MA 3Q9LA 4B73A 1U94A 1S9HA 3V4RA 3X1ZA 1VCIA 3LH5A 2IEZA 3OE7D 5FOTA 4GL2A 2QSZA 2ZETA 2CE2X 2GILA 1RW4A 3U7GA 3FPAA 1P2VA 3U7FB 4ZI2A 1SXJD 4B2IA 2WHXA 1NN0A 1WCV1 4QL3A 2REXB 3AKDA 4ITRC 1NF3A 3IO5A 1NBMD 4CEHA 2XOKA 2FA9A 3K0EA 3UPUA 3VAAA 5J4LA 1ZM7A 1JB1A 2ZRGA 2GVDC 1X1RA 3QBVA 3GEIA 4N0DA 3A1UA 2VSFA 1NJFA 5FUVA 2RHMA 2W2VA 3PUZA 1JPJA 4I1VA 5TV2A 1P75A 2J7PA 1O3YA 3ASYA 2ZAOA 3B9PA 3KQNA 5GJVC 5JS7A 2FDCA 5JWOA 4A6PA 1W2HA 2W2TA 2JASA 1YZUA 3QG5A 4AC9A 3CZQA 3MAAC 2VP2A 2GWHA 4PC1A 5JHHB 1MRNA 4D26A 4V0NA 3RC8A 2WSMA 3ND8A 3P4XA 1Q0UA 4PPNA 1LF5A 4AD8A 3UXMA 4AYXA 1FQJA 3X2SA 3BB3A 5J4KA 3BH0A 1ZM2A 4Q03A 2ODEA 3AF2A 2ZRPA 2F1IA 2QP3A 2W6ID 1DELA 3B78A 3QXXA 4IXMA 2CLSA 3MD0A 1DAMA 2XJ4A 3PJRA 3A36A 1E2NA 1MABA 3FHCB 3ZZTA 1J2JA 1UKZA 2YWGA 4C30A 4MYTA 3F8TA 4BEJA 1U0LA 3VHXA 1NSFA 2I4IA 3Q3JB 2A30A 1HURA 1Z2CA 1KZ7B 1DAKA 4HZIA 4CGZA 1EX7A 3IIMA 2VH5R 3KJHA 2VL7A 1UKEA 1KKMA 5BW8A 1ZVQA 3DEFA 1JJVA 2V8OA 2ZRLA 4HAWA 1UEIA 1KK1A 5G53C 4PQYA 4EKDA 1CEEA 5EUQB 3U3RA 3AP2A 2ONKA 4A9AA 4KBGA 1COWA 5GJCA 3BH6A 3V9PA 3AM1A 2ZJ5A 4DB4A 4JSTA 1XD9A 4A92A 2VHUA 2ZRNA 4MKFA 3VKGA 1Z5ZA 4NL4H 4Z8YA 2JJ8A 1AN0A 4TQAA 2QG6A 5CIWA 2FWRA 2QAGC 3A37A 3Q5DA 1LFDB 4QGGA 5JECA 1U98A 1FP7A 1MH1A 1OH5A 3CPEA 2C78A 1R0YA 3WXMA 4KFTA 4GZMA 5FBLB 1KSFX 5CM8B 4B3XA 3GLGB 1E3MA 3OAAD 1GL7A 2ORWA 3MLEA 5DLQC 3GLGA 4URZR 2NGRA 3EA5A 1XMJA 2OFXA 3PFIA 4RZXA 1VMAA 4YONB 3LW7A 5E7MA 3TNFA 4LBYA 4MDEA 1OB5A 5LB4A 1ZAKA 4KI0A 2KBEA 4KXFB 3REGA 4NCIA 4BLPA 3GLIB 3X1DA 1CXZA 2WKPA 4OQNA 4EJSB 2C99A 3ZZ0A 3QOFA 1E9DA 4YMVA 4GDFA 4EJSA 1FMLA 5FPSA 5HE8A 3BB4A 3HPRA 4KFSA 3KQUA 4WXRA 3HYTA 1U8YA 2ZAMA 2XOKD 1KMHB 5HCNA 1W4AA 3AKEA 3SFVA 3LW8A 2C9OA 3MJHA 1QVAA 4RSGA 3BBPA 2WAYA 3DO6A 4NBSA 2R6GA 4YC7A 3ADDA 2O8EA 4V0ME 1R8SA 1R0WA 4ZV4A 4DLTA 4DB2A 1NVVR 4IW3B 3AVWA 2IA5A 2JIZD 4IXNA 2LCFA 4C0JA 4HUTA 3U4QB 4JT4A 3IBYA 4Q18A 4HLCA 2F1JA 5G3YA 2QTHA 3BJIC 5G41A 2ZYUX 1BIFA 2VRWA 4HB4A 2VP9A 5GJBA 1XCGB 1IY2A 1Q22A 2DWOA 2V1UA 1KK0A 3BC1A 1TX4B 3CB4A 2A7QA 4V0LA 3UG6A 3VX4A 1UDWA 4BLSA 4DSTA 3CX6A 4PZZA 2ZU0C 4BZPA 4DIDA 1KO8A 3BD9A 4B47A 1VCOA 3TMKA 2J59A 5GJWC 4ARZA 1G18A 1WDTA 3GLFA 3QSYA 1DADA 3UMSA 3WP1B 5B64A 2GCPA 4XD7A 5B30A 2RMKA 4M1SA 5D3MB 1IN6A 4NDZA 4TTPA 4PXAA 4JIMA 3KJIA 3U7HB 2PLFA 3QPWA 3RNLA 1B23P 4FD2A 3LWNA 3KXLA 4W5HA 4KSBA 2WSSD 4B6FA 3U5ZB 2XNDD 2RGEA 2JLWA 3BFVA 1J99A 1OFIA 2QQEA 3PVSA 3SU8A 5J5CA 3KFXA 3BIFA 4ESVA 1HQCA 2VHQA 4JMPA 3S1AA 3H0KA 2ZUDA 2WJVA 4Q4AB 4IOKA 2QUZA 2KBFA 3DMDA 3IPYA 4A6XA 3P26A 1XXHE 2RGBA 5TMPA 1EGAA 4HI0E 2NO6A 4Q7KA 1X6VA 2GJ9A 3HYRA 8OHMA 1VTKA 3RC3A 5EP3A 1SVKA 1J7KA 5FOVA 4Q21A 1XTJA 1CU1A 3OIWA 3U4QA 1B0UA 2VA8A 2P3SA 3E2IA 3NH6A 2ZI4A 1OPXA 4MA4A 4L9SA 2Z4SA 3R8CA 2GXSA 4Q66C 4B44A 4ON9A 4Q00A 5DYGA 2G77B 3NEJA 1HA3A 1TEVA 4GP7A 3T35A 4TQ9A 2PZEA 1JQLB 1CJMA 4LWZA 3GQBA 1UM8A 4XVUA 5DSZA 3U44A 3KFVA 5FL3A 1N6NA 1YR9A 5JSZA 1OHHD 5CIQA 1ZW6A 4AKIA 1XD2A 4FMDF 1G3RA 2OFOA 1VIYA 3OIYA 4R7ZA 1NKTA 2WVJA 3SN6A 1R0XA 2YWFA 5FL7D 3TLXA 4KCGA 4CZ2A 2O8BB 2BCGY 1IN4A 2DBYA 2OG2A 2O8BA 4GNKA 3W9YA 1E9FA 3BS4A 4DLXA 2VF8A 3ZLJA 3P20A 3BWDD 2W58A 421PA 2ZYVX 4OQFA 3QIAA 2GXAA 1E98A 4XSHA 3PCRB 4PR0A 2XXAA 1Z3IX 4URYR 2ZE7A 3GJ5A 1NL3A 2YV5A 4CYMA 4RCZA 1NVVQ 2Q21A 4RD3A 4C0QC 4AYTA 4URXR 4QHSA 3EZ7A 3WP0A 1CLUA 4KBFA 1AZTA 2QAGA 4B71A 4V02A 4PC7A 4LJ5A 3B13B 3CONA 3A4LA 3DPUA 4LJ4A 3B1ZA 5FTMA 3CM0A 1UKYA 1E2PA 3NTUA 2H7VA 3AKYA 1JALA 3THYA 2FN4A 3U60B 3MWLA 2QGZA 2GZDA 1ZYUA 4JL8A 4K8OA 4TLCA 1Q3TA 2ZREA 5L3SA 3DOFA 3NHAA 3F0TA 2V7QA 5BQ5A 2SHKA 1W49A 2O8FA 2BKEA 5BYJA 3CF2A 2HCJB 1XXHB 1RFLA 1YR6A 5DISB 1N5KA 4IDNA 2JAQA 1LB1B 1FMJA 2QI9C 1VCNA 2XITA 4EQ6B 4L8GA 3AUXA 4OQXA 2WMNB 1LF0A 1WRBA 1MT0A 4HYYA 4LY6A 3I1FA 4NP6A 3I61A 2AD5A 3BORA 2XZLA 1BO6A 1Q1EA 1D6JA 5LDDC 2IWRA 5KNCA 1CJTC 2CNWD 4Q7MB 2GXQA 2IK8A 3O8RA 3GLHB 3CRVA 4PQFA 2IHYA 4OI4A 4BFXA 5KSYA 1AKYA 3AGPA 4XJXA 1ZD8A 3GMTA 1A7JA 1P5ZB 1KY2A 2PEZA 3DZDA 2QTVB 4M9XA 5H1YA 3SJAA 1ODFA 3UKDA 4NCNA 3RVBA 3BFXA 1OFUX 1TMKA 4LV6A 3WBKA 2XTMA 1C9KA 2FEOA 1Z0AA 3I72A 2NZJA 1NY6A 3OFND 4DKXA 4EJSC 3THXB 1KO4A 1DEKA 4UJ3A 4UXIA 4QFMA 3S1AB 4BPBA 3RS5A 4PHGA 2BBSA 4TMTA 2OM2A 3C5HA 5AJXA 1IHUA 1ZP6A 1ZBDA 4KAXA 5DN6A 4C3ZA 1EWQA 2R6CA 1CF4A 3LXRA 1VECA 1G7SA 1OF1A 3OZXA 3IQWA 3SHWA 2BDTA 1AIPA 3T15A 4CRWB 4Q9KA 3GFOA 3VR5A 3ZD6A 5JEDA 1KI3A 3C5CA 3W5IA 1JR3D 1Q21A 3IIJA 4QXAA 4AKGA 3VX3A 2F43B 1P61B 1EFTA 4PANA 4JLKA 4F38A 1N3BA 3B1YA 1FTNA 1ZM4A 4EFLA 2WJYA 3GLIE 1R2QA 2ZSAA 2BEKA 4TMWA 5BWMA 1GIAA 1N5IA 1EFHA 3AVXA 5FBVB 1N6IA 4EPTA 1W5SA 2QAJA 4MRVA 1GRRA 1Z0FA 1W0JA 2RGAA 2GJAA 2ZUBA 4FXPA 4KYUA 1XEFA 3P27A 4RFVA 3U44B 2VHJA 1Y63A 4B2PA 4MH0R 1OB2A 1E2KA 4HB3A 5EE1A 1T0HB 1ESNA 4DDWA 2ZRKA 4AG5A 1EK0A 1NJGA 5IK2A 1E0SA 1YHNA 5BXQC 2J1LA 1IN5A 4C0LA 3QNUA 1XCMA 2DFTA 4CW7A 3GJXC 3G5UA 4YLGA 2PEYA 3W3AA 4UNSA 1ZJ6A 2BV3A 1U8AA 1OT3A 4RD4A 3ZYCA 2F9LA 2ZVPX 3EA0A 2RB4A 4QBIA 4NZYA 3DVLA 1L4YA 5FTNA 2NZ8A 4R2IA 2ZRAA 3QF4B 3K0AA 2QPOA 1WP9A 1HT1E 1GAJA 4L9WA 4DBLC 2HT1A 3KUDA 1DTSA 4NCKA 5CB8A 3EWAA 3WMFA 1KDRA 5CDFE 1QG2A 1E1RA 3B8HA 1I2DA 4B76A 2QMHA 1LW7A 4BASA 4M22A 1J8MF 5LB2A 3ZJYA 1R5OA 5IRCD 2F9MA 3CF0A 5FOXA 4ASUD 2JJ1D 3R8FA 1NIJA 3G82C 4MUBA 1E2QA 2F43A 4EPVA 2WJIA 3R9IA 1W2GA 2I1VB 2PZGA 1SGWA 3HP1A 5FR1A 5F9FA 2ODWA 2WM9B 2OO7A 3W8NA 2P5SA 1BYIA 5C46F 1QZXA 1G8FA 4DLWA 5G3ZA 1X1SA 1Z06A 4OI0A 1G7CA 4Q1BA 3C4JA 2IC5A 4UXHA 6Q21A 4Q4HB 1SVSA 1SVIA 1TQ2A 2OBNA 1TU4A 2F7SA 1ZM9A 2GJKA 3LQRA 1X86B 2FFQA 1Z6XA 4JS0A 4LBVA 1KI2A 3FE2A 4TYPA 4Q9LA 4N3NA 2ZTSA 2DFNA 2ERYA 1M1YE 5DIFA 3ZVRA 4B75A 4BQSA 5AUOB 2QBYB 5KTYA 4A8JB 4IVQA 2PCLA 5KOYA 5JRZA 3JVUA 1FUUA 3KKMA 4DT1A 1BMFD 2GKSA 4G5GA 2KB0A 1WF3A 4P33A 5SZJA 2XZPA 4LZZA 4R2HA 3G0HA 2VBCA 4A4DA 3K70D 1I4DD 2ZE8A 3L82B 3VR6A 1NRJB 4C7OB 1QHXA 2REBA 3QXHA 1MRSA 2H17A 3K9GA 4GI7A 4NYJR 1XJCA 4RD2A 4HB0A 4RFSB 1ZD1A 2VEDA 2B6HA 4AG6A 1UEJA 1Z08A 1GSIA 3AH8A 4G01B 4Z1MD 5AWFC 221PA 5F3WB 1N25A 4RZUA 2J0UA 3GCGA 1XZQA 4AWXA 4ESHA 2BWJA 2QMUA 3T1QA 4CT4B 2BBTA 2J9RA 3TJZA 3VFDA 1LNZA 1XBTA 4EIWA 2OT3B 1YVDA 2G1JA 2WWYA 1G5TA 2IUTA 3N70A 4TTRA 4E07A 1SXJE 4XIGS 4M9ZA 2NIPA 4DLUA 4B3GA 1N5LA 2FFHA 2GEUA 4US0R 3T1VA 2R2AA 4PTLA 1MO6A 3FTQA 1W36C 1SXJB 2XX3A 2X77A 2QT1A 5HZHA 1P4SA 2DCUA 4PZLA 4B43A 2WBLC 3AKCA 3AVOA 3B85A 4QJ4A 4GPTA 3HU3A 4XVRA 2OEPA 2MSDB 3K0CC 5CB6A 1IN7A 4Q1AA 2J0VA 5JFGA 5JBQA 1P2UA 1OH6A 4KFUA 3KTAB 4JYCA 2AL7A 4IEEA 4Q1CA 4R71A 1YZKA 4YMTA 2ODNA 3PG5A 1W0KD 1G64A 5EP1A 4DC9A 2IS4A 1OLOA 3CH4B 1FL9A 1Q20A 3NHBA 2HXYA 4ZCIA 1XD2B 4PSKA 5CLQA 1JEEA 1TF5A 1GL6A 3DL0A 5EXTA 2R6FA 2QN6A 2DY1A 4EPYA 3NC0C 4TSFA 3U2QA 4DCNA 4HLUA 4WIAA 1AM4D 1AS2A 1M34E 1Z6YA 1ZUIA 2F3RA 1G41A 3FKSD 1E9AA 3KZ1E 4LHXA 2BJVA 1CJVC 4YXWA 3SFZA 3X1YA 1N6HA 1AQYA 3QJYA 1E9RA 4G5QA 1XEWY 1VG0B 3QPVA 1KJWA 1P7CA 4WOPA 5DI9A 1N6OA 2IF0A 3EARA 5A0FA 1XJQA 4JLBA 4JVNA 2FOLA 2D2EA 3GPLA 3GEHA 2P65A 4URUR 5C4GB 4FN5A 1QHGA 2AFHE 4MGKR 3MG9A 2EFHB 4PSAA 3BK7A 1F2UB 2J45A 4O2RA 1OIXA 3ZDQA 2DR3A 4IOLA 4ZCLA 2ZRJA 1SHKA 5TVKA 1II0A 1SKQA 2EVWX 1KMQA 2QMOA 5SZIA 1F48A 4H9GA 4JZKA 1Z22A 2G83A 1IXRC 2H1LA 1NN3A 3HWSA 3H2YA 1QBKC 3KJEA 4WXPA 4RKFA 2ZYWX 1EFCA 1CR1A 4RD1A 1Q1QA 3EW9A 4FWIB 5EE9A 4Y0AA 4KLZA 4WAUA 1XD8A 3AF4A 1I4LD 4GFDA 1EXMA 2IXGA 1RJ9A 1JEDA 4PC6A 3LRPA 2FPKA 3NIBA 2O8CA 3ECCA 3ZVMA 2WICA 3OESA 4NYIR 5BN4A 4K81B 1G1MA 1QVRA 2QMEA 1E2EA 1ZIOA 3L0OA 3CF6R 4IVPA 4ZKEA 5DH9A 1L8QA 4ARZB 1MABB 3ND9A 4PPQA 4RJLA 4TLEA 1PZNA 5EE5B 3NG1A 3ZH9B 4FMDB 5H68A 1YJ5A 2XAUA 3B5JA 4OI2A 3HPQA 4DLYA 1W7AA 1Z63A 1Q44A 4RKEA 2ZANA 1VYTA 3CWZA 3LLMA 3Q5EA 2EU8A 4Q7JB 2AK2A 3C14C 5JLJA 4GOXA 2CCGA 1O87A 2IYZA 2E9SA 2OZEA 1MR3F 4QJ3A 3P1JA 1ZC4A 4GOJA 1RPZA 1VG8A 2Q9AA 3CR7A 1Z6AA 4JLDA 2J46A 4GOKA 4XWOA 4HUQA 3T06B 2J3EA 4LJYA 1N0VC 1C1YA 3PEUA 1PUIA 5L8VA 1Q3HA 1BYUA 2X2EA 2C9YA 4LPSA 4LHZA 2JLUA 2ZR0A 1F2TA 1Z29A 4V0KA 4B74A 2JLRA 3AVPA 1E4YA 2EFDB 1OW3B 1E1RD 1CTQA 3CKLA 3QVUA 3FVQA 3U3MA 3VR4A 1OXXK 4ZI3A 1ONBA 1P9NA 5G40A 4BECA 5D3QA 1OH7A 1CRPA 2ZI5A 1WMSA 3EPLA 4F92B 3TUIC 3EPHA 1KTVA 1A2KC 1OHHA 1FX0A 1VCMA 4JJKA 1CP2A 3TW4A 2CL6X 4C0SA 3SOPA 1BS1A 3IILA 3IEVA 3KB1A 2NPIA 4WBSA 3GJ7A 4RZ3A 3RS3A 3IBGA 1G5PA 1G5RA 1WA5A 2O0KA 4A0GA 4OBEA 1KKLA 1DOAA 4HZUA 3R7WB 3FKSA 4B34A 2I3BA 1DAIA 1KDTA 2RHDA 2CXXA 3JZAA 2ZSEA 3CNOA 3I3SR 3T12A 4YXWD 1KSHA 2A3RA 2F1RA 5JS8A 1UBEA 1RE0A 4CDGA 4NCHA 3L0SA 2X2FA 2IYQA 1OKKA 1E2FA 1M74A 1H65A 5JHGB 5EZ5A 1V43A 5HKKA 2GNOA 2G88A 1E2HA 3GLHA 3QKRB 4IEIA 4TLAA 2H16A 2AN9A 1A4RA 1AJEA 4HSEA 4DIEA 3AVUA 5KU1A 3THOA 2GF9A 2V3CC 3OE7A 4HAXA 4LGMA 1XPOA 3BOSA 3OF5A 2Q3FA 4NYMQ 4A0RA 2DHRA 2HV8A 1Z2AA 1II8B 4D0LB 3T1TA 4QNRA 2DWQA 1KAOA 4Q1EA 1HV8A 3K0SA 1XDBA 4IHQA 1UF9A 1ZUHA 2W00A 2C8VA 5FUXA 1GRNA 3F5FA 3O8BA 2VP0A 3RYTC 4IVRA 3JVVA 4DCVA 3K0CA 2Z0MA 2ZR9A 2C03A 4QBFA 1KHTA 3EIEA 3I5XA 2XTNA 2BOVA 3Q8XB 3B2EA 4LYAA 4OI1A 1SVOA 1SZPA 3T34A 4P0TA 5BN5A 2WPDD 1TAGA 3V4FA 4OQLA 4Z1MA 2OBMA 3VNUA 4HEJA 2FGJA 3TQFA 3LBNA 3VR1A 4NYIQ 4F7WA 3MWKA 4LV5B 1GITA 5CLLA 4DSUA 1N6RA 2FG5A 2OE2A 3RS2A 3LD9A 2QPTA 1QF9A 2OAP1 2OLJA 1CBUA 1NLFA 5JWHA 5BYKA 3VKHA 4Q4HA 4XSGA 2K5UA 5CYPA 3HR8A 1JJ7A 1FQKA 3H4MA 2ZI6A 3FKQA 3P32A 4D0NA 1MV5A 3TBKA 1H8ED 1A1VA 3QBTA 1AA9A 4XD7D 2QY9A 4Q4AA 4W9MC 4CEJB 2FX3A 5AK0A 2DWPA 3NVAA 3U6BA 3LAWA 3I8XA 4TL7A 2JLQA 3CX7A 2IUUA 3PEVA 1PV4A 4M8NE 1G7TA 3I8SA 1Q12A 3CR8A 3M1IA 3RRZA 2NTYC 2VTKA 1H8HD 2CHQA 2VHCA 2CCKA 4A8JC 2Z43A 2Z4RA 3K0FB 4LRWA 5DHFA 1G6OA 3NBXX 4RD6A 4TYQA 1DAEA 2LKDA 1KNQA 4Y0VA 5DN6D 4JL6A 2FGKA 5J4VA 3W3ZB 3UG7A 1IJFA 3LO5A 3DOEA 2GA8A 4D80A 4F93B 1F60A 1Z47A 2GCNA 1E79D 2Q0HA 3SE0A 1GNRA 4JSYA 4FCVA 1R10A 2IYRA 2ZS7A 4E22A 3TGPA 3KQHA 1U0HC 2GESA 3K0AB 4LX0A 2PJZA 1F6BA 3FOZA 5AUNB 3PEYA 4M9SA 2GK6A 2QTFA 2VP6A 4LUCA 4YDSA 5L3QA 1MO4A 3UWOA 3OHMA 1KI4A 1XB2A 3IUYA 2GCOB 1XP8A 521PA 1IY1A 1KI8A 2ZJYA 3AGQA 3HU1A 1FPMA 3OAAA 3E70C 4NYMR 4II7A 4O0MA 3UANA 2BKUA 1Q57A 2O0HA 4PAMA 4TYWA 2N46A 4HAYA 4MYUA 3EZ2A 3ZVNA 4B48A 4JYBA 1ZINA 3RRNA 3C41J 1RYFA 1HE8B 3RWOA 3TSZA 5ELXA 4TYYA 2W0MA 4V0OA 3KDSE 1W36D 5CK4A 4IFEA 2R6DA 2B92A 4NMMA 4Q5IA 3SJCA 1S8FA 4IFBA 2WV9A 2G0TA 4HB2A 2C2HA 4BLTA 3AVTA 2DYKA 2Q3MA 1YR7A 2HUPA 4BFZA 5EJEA 4NCJA 5DE3A 4OJKA 2GXUA 2GETA 4J0QA 1AS0A 3SEAA 3RDPA 3VNVA 1RZ3A 3DM9B 2CJWA 1KSJA 2H92A 5B57C 1ZNZA 3TRFA 3ZD7A 1KI6B 4Q48A 1DAGA 5K8TA 4KLNA 4Q01A 5FOSA 4LI0A 2AKYA 1M8PA 2W6JD 1QHHA 4XWKA 2JJ1A 5GADl 1GM5A 2CVFA 1VYUA 1MOZA 2NO7A 4NH0A 4ZIRB 4LJ9A 3SJZA 2QGNA 1IQPA 3KXKA 3RAPR 2NO0A 4LJ8A 1RVDA 2GBLA 2RGCA 3D8BA 1SVMA 4RZ2A 2G9NA 3UWKA 2C95A 1HYQA 2GK7A 3IGFA 3RANA 1P9WA 2ZJAA 1OIWA 3SBDA 1CR2A 3ICQB 1XFAA 1VG1A 5FPTA 3T1OA 2FJUA 1DPFA 3GLHE 5J40A 2AWOA 3I73A 4US1R 4G3XA 1E4VA 3HU2A 2WKQA 3MWYW 3TSOA 2QA5A 2AXNA 1JNYA 5DI3B 3L43A 4CT5A 2JLZA 2D62A 4JLNA 4PHFA 1VPLA 2VIIA 4HLUC 2ZPTX 1UAAA 1MO3A 1GNQA 4QM6A 1CS4C 1F2TB 1SVWA 1GKIA 4TLDA 4DEXA 1US8B 1XMVA 3R20A 2OESA 3KJGA 1QHYA 2PJRA 2ZSDA 2REOA 5KNDA 4P3YA 1XX6A 2JCSA 2BMJA 4QJ5A 1W46A 4AIIA 2D06A 4DUGD 2R9VA 3KKNA 2FH5B 1M7BA 2J7PD 1CR0A 3EWSA 1RIFA 5KNBA 4GBMA 2OCYC 4YMUA 1SULA 3VKWA 4GSYA 4BFVA 4TZ0A 4UJ5A 3GJ6A 2EQBA 3PUVA 2NO9A 5GVSA 1OKKD 2CMKA 2WWGA 1IXZA 1T3HA 2QNRA 2Z83A 5IHPA 3A1WA 2OCBA 1G6HA 3RSOA 1U9IA 3CX8A 5M04A 4XWAA 5KSPA 1XMIA 4TWZA 1DO2A 5FBQB 2CK3D 1F3OA 4TL9A 4AKHA 3FFBA 4TLBA 4JKIA 3OIVA 3U3JA 1KDPA 1PLJA 4ZDKA 2HF8A 1D2MA 3CW2A 1P9RA 5HCIA 1MKYA 1GTVA 2A5JA 4P4UA 4RCYA 5BN3A 1NG1A 2QRNA 1YRAA 4DCSA 4JLJA 1AK2A 3MFYA 1T91A 1PUJA 5EP2A 3QQ5A 2X1VA 1P3JA 1N6LA 4PQRA 1IM2A 4NPHA 5A5GA 4ERNA 2BBOA 4JVSB 5EXXA 5JEEA 4UKDA 1D8TA 4MRSA 3PUYA 1RC8A 5JJKA 4RD0A 3BRWD 3LX8A 721PA 2GJSA 1E9CA 2IS1A 3RLFA 3QXJA 4BFYA 2VF7A 2AHOA 5L3QB 3KKQA 1NVXQ 4N1AA 3REFA 4KODA 1E99A 4ZDIA 4Q4JA 1QHIA 5EUMA 3VTKA 4DSOA 1NKSA 2EWWA 1QDEA 1JXOA 4Q19A 4D2IA 3SBEA 1UPTA 4PO1A 1YRBA 1RJ9B 2HCBA 2X19A 1E2LA 3SQXA 2KSQA 3R9WA 3FMFA 1NN1A 2V55B 4CVNA 2ORIA 1TADA 3K70B 1P6XA 2QQ0A 1X3SA 3K8YA 4B32A 1OYYA 2PH1A 1P2SA 2R65A 4YMWA 2W6JA 1LS6A 3L0PA 1TTTA 1YE8A 3ZGXA 1OFTA 1JAHA 5KPDA 4TMKA 4L4UA 2VP4A 1NY5A 4DJTA 2FZLA 5FTJA 2HEIA 1PLKA 1E69A 5AJWA 2R62A 4D4KA 1ZUNB 1ZRHA 3LX5A 4QHYA 3T5GA 2HYDA 2IYVA 2X8AA 3D6TB 3RWMB 2RCNA 3CIOA 5CITA 3Q7QA 3MUFA 3EPKA 2Q9BA 2WKRA 4NONA 4MGIR 2OHFA 5DO9A 2V7QD 1G3UA 2B8TA 2A5GA 1QHHB 3KQLA 1KI9A 1CJKC 1RRCA 4MDFA 2EFCB 2PX0A 2GCOA 2GBLC 4M53A 1YKSA 4GMXA 2WIAA 3KQKA 3ADCA 2WPDA 5H8WA 2QAGB 3GJ8A 2WJHA 1UDXA 4TMXA 3R9XA 1JR6A 2Q9CA 1EWRA 1OH8A 3Q85A 4HDQB 2A5FA 4L16A 1Z83A 1U90A 1W5TA 1CULC 3RSLA 3IIKA 2C96A 1CIPA 2BMEA 3AB3A 4P4SA 2WWIA 2JLXA 3SYNA 2MMCA 5SZHB 5FBRB 3A1VA 4NKRA 4C0AC 4KVAA 1DAHA 1H8EA 1F5NA 2EWVA 4QGFA 2GVZC 4DDVA 5DI3A 4H1UA 5LPNA 2CL0X 2AFIE 2NO1A 1R5NA 4BE7B 4P31A 2BM0A 3KL4A 1RRPA 3D7MA 3PR1A 3FMOB 1JPNA 1K8RA 2C98A 4KSCA 3MCAA 1A5TA 1KMHA 2AKAB 4GT1A 4A15A 3LVQE 4IDPA 3DDCA 1XTSA 4JLMA 2ZM5A 3WY9A 1S1MA 1N0WA 2C04A 2W0SA 3QKRA 2ANBA 5FUWA 1Q1ZA 2ZRBA 2WJGA 3QF7A 3CZPA 2CK3A 2GEVA 1ZU4A 2OXRA 3PENA 1N5JA 2D7CA 4BFWA 4IKEA 3PV0A 4C2TA 4BLOA 4TL6A 4HDOB 4QBGB 3WYFA 1SHZA 2IS2A 1OV4A 2G0NA 4AKEA 4US2R 2RH5A 1S3SA 1BOFA 1GNPA 2XNSA 3DM5A 3FMIA 4E03A 2IX3A 3RS0A 3LDAA 3ZS9A 5FR2A 5AJYA 5SZKB 4DLRA 621PA 1D9XA 2EFGA 3NDPA 3TR0A 3AEZA 3LXXA 2ANCA 4PSVA 3SI7A 4EDHA 2IWHA 4BFTA 3THXA 3SQWA 1VG9B 2XXAB 2C5LA 5HR5A 4U00A 1G20E 1ANKA 2V6IA 3HR7A 3CNNA 3CRMA 2XJ9A 2BCJQ 4MGYR 2F3TA 2DFLA 1KY3A 3TR5A 1SKYB 2O8DB 2A2ZA 3GP8A 3B1WA 5KPJA 5E7JA 1FTSA 3DHWC 3B6EA 1TPZA 2JLYA 3BXZA 4N0EA 2YKGA 2XB2A 2P0EA 1L2TA 2D3WA 4JKYA 3LVRE 5FH9A 1G3IA 3IO3A 1DARA 1JR3E 1GDDA 4M21A 4GRAA 2CBZA 5JRJA 1KAGA 4NHOA 4TSFD 3UK6A 3NH9A 1S9DA 2YVUA 3P4YA 4LC1A 2DPXA 1Z0IA 1XXHA 2VPPA 1XTQA 4IRUB 5J4HA 4CIDA 2GDJA 1OJLA 1BMFA 1CR4A 4EPRA 4ZDJA 3EZ6A 1XTRA 4B6EA 2BVNA 1W1WA 5AJVB 1II9A 4ZIRA 4A0HA 2BBWA 1WB9A 3NKVA 3F3YA 3TUJC 1US8A 2R44A 1S3GA 2B8WA 2FU5C 3THYB 4DEYA 3MSXA 2B21A 2ZITA 3CRW1 2D7DA 1KO7A 2I1QA 4Q9JA 2J5XA 4LSGA 3VMFA 4G1UC 3A8TA 1EG7A 5E3HA 4CEIA 4LCBA 4LJAA 2ASEA 2EYQA 5CDFA 3WMGA 1G8PA 1KOFA 3MRSA 4MITA 5C4MA 1M7HA 2RAPA 1OFHA 3PITA 3K09A 2CVHA 1G3QA 5TDHA 2J7KA 1NVWQ 1GRQA 3QXCA 1FNNA 3I92A 3WHKA 1CJUC 4DZZA 3O8DA 2HYIC 1ZNYA 1FP6A 5HE9A 4DCUA 1XEXA 3O47A 4KV9A 4LYJA 1GILA 3NEYA 4P4SB 4G5OA 1S2MA 3IHLA 2V54A 5EQTA 4U7DA 4WW0A 2O8DA 1HUQA 3IHWA 2IYUA 1DBSA 2VHTA 4TT3A 2ZUCA 2PMKA 2VLIA 1TF2A 3QF4A 4HAUA 5CJ2A 4ZO4A 4ZCMA 1H8HA 3GLGE 1ZCBA 2CHVA 3BE4A 3CRQA 2JJ2A 4I1SA 4OHVA 4YQFA 5JZVA 4NTZA 2OCAA 2RGNC 4BUJA 1OXUA 5KUTA 1V5WA 1M6NA 2OILA 1KI1A 1KO5A 1KNXA 5JMTA 4QGHA 4D25A 1HH4A 2H57A 5DYIA 1E79A 2ZE5A 5JWRA 1E2IA 3TQCA 3ZIAA 2P6RA 4A36A 1S0UA 2IYYA 2CEAA 2ZEJA 3LQQA 3BFKA 1T6NA 4MRRA 1XPRA 3C7KA 1QG4A 2JDIA 1DG3A 2A5YB 4QGAA 2L0XA 5ANRB 3PUXA 4KJZA 1FNMA 3A58B 5FI0B 4CF7A 1L7VC 1LY1A 4TTQA 3SDZA 5HPYB 5J4YA 2ZS8A 1W48A 4JL5A 4Q47A 1XU4A 4JLOA 1SKYE 2PX3A 4TQUS 4EQ6A 4C0BA 3CH5A 1E2DA 4XVQA 3K0FA 2AX4A 5CK5A 3TH5A 4Q9IA 3J81k 1Z0KA 1HE1C 1PJRA 3VR3A 2NQ2C 4WZAE 2RGXA 4G5RA 2PMDA 5E4FA 3TK1A 2KWIA 3B1VA 3OEHA 3QKUA 3OEEA 4JLAA 2JLSA 5KDLA 2XGJA 1G8HA 3EAQA 1ZU5A 3QE0A 4C2UA 2N42A 3QY0A 2ZRDA 3K9NA 5F9HA 1E2MA 4DT1B 4RY2A 1XEWX 2ZI7A 5FPYA 1U81A 1YZLA 3IPXA 1G291 1JQJC 1OXVA 1T5LA 1UFQA 3NXSA 1E94E 121PA 4KO8A 5D3MA 4DWJA 1N6KA 2D4HA 4JT2A 1AQUA 2NPFA 4HDCA 4I99A 1J70A 5FPHA 3E1SA 2QROA 3LFUA 4V03A 5TY0A 3Q72A 3V00A 2WWHA 4C0HA 1Z6GA 1GFIA 4RFSA 4Q4JB 3LBHA 4A82A 1JBKA 1KK2A 1W4RA 5KYKA 2ZRHA 1U8ZA 3SC3A 5L3VA 1WXQA 3B82A 1Z28A 4LPKA 2GHIA 2FFBA 1DE0A 3QI2A 3L0IB 5IK2D 2AWNA 5AUQA 4DDUA 4NYJQ 1GWNA 2AK3A 4MQBA 4L5BA 1WE2A 1IBRA 3A1SA 3PEWA 1EFRA 4OHWA 2ODBA 4KU4A 3M6AA 2FSIA 4LOAA 1NI3A 2P6NA 4W5JA 2NMVA 3CUEF 4EFMA 4M9QA 4ACBA 3T5DA 4JBXA 3SNHA 4YDHB 1R4AA 3UATA 5K8IA 3TE6A 2HJGA 2WIBA 2XB4A 2FE4A 2MSCB 3PQCA 3AF3A 2JGNA 3KKPA 3BGWA 2EFEB 3SR0A 1OSNA 2FSHA 4Q1DA 1Z8FA 2WMOB 4LHYA 2ZYTX 3FYHA 4AY2A 3X1XA 2ZI3A 2KJQA 1M7GA 3QEJA 4LHVA 2ONJA 4PX9A 5JCZA 4OQMA 1C4OA 2ZR7A 3SZRA 4C9BA 1HTWA 3T61A 2VO1A 3MMPA 1Z07A 2O8CB 4DHEA 4NU0A 4X8LA 2JJ2D 5TB5A 2CCJA 3ZVLA 5FPKA 3IQXA 4D81A 3K53A 5FOUA 4DLZA 2H8KA 2FEMA 4B2LA 3TKLA 1I4TD 4R98A 3DKPA 3ZS8A 2AR7A 2QORA 3C15C 3CNLA 1E0KA 3QPUA 4TZ6A 4TN1A 3D31A 1XJ0A 821PA 1E96A 2BHRA 3QVVA 3U61B 1IXSB 4X8HA 4TT3D 2ZE6A 4LYHA 4IDHA 3C16C 3AV0B 1G21E 1G8GA 3ASZA 4W5WA 1NBME 2WJJA 3OEED 4E5UA 3B60A 5FI1B 1NSTA 3KXIA 1E0JA 2QU8A 5FFMA 1UBGA 2FPMA 2BEJA 2MSEB 3CBQA 4PC3A 5L3RA 1LS1A 3GD7A 1W47A 2FFAA 2OXCA 3LNCA 3W6PA 1GP2A 4QBHA 3KTAA 1RRGA 2IYWA 2G3YA 1CRQA 5JCPA 1FUKA 2IW3A 2Z5FA 4FI3C 4CEIB 4HZUB 1OXTA 4H1VA 2GAAA 2YYZA 2ZS9A 2QL6A 3N5CA 2WTUA 2F55A 5KSZA 5EZ6B 4B33A 1QHNA 4C4PA 1HY3A 4E09A 3ZIAD 4UNNA 4TYNA 5KDOA 1J8YF 4F4JA 1GKYA 2YC2C 3LLUA 2YC4C 1NMYA 2IL1A 3A4NA 3UMRA 1T3LA 2JA1A 2WZQA 1KJZA 2RGNA 1DO0A 1YZNA 1AGRA 2N1BA 2ZJZA 3L8ZA 3QKSB 4Z51A 1ZNWA 1T4GA 1YU9A 1IN8A 1AS3A 1D2NA 3FHOA 4FW9A 4HATA 3VU9B 1SVLA 4KITB 2YWEA 1PVOA 4POAA 4EUNA 1E1QD 1UKVY 2ZRCA 3CLVA 4ZDWA 4A2QA 1EFUA 2IYTA 2O0JA 4HUQB 1NP6A 4D4JA 3ADKA 3QKTA 1GOTA 3WRYC 1NVUQ 4MYCA 4NE2A 2ZSFA 3DMNA 3K09C 4IOJA 4JJZA 5C18A 1E0AA 4LYFA 1FOEB 4ABYA 3OIUA 2ERXA 4BZXA 3WNDA 3AVYA 2HDNB 2VSOA 2JIZA 1P62B 3RS7A 1F2UA 3EZ9A 4B3FX 1UBFA 2HT6A 4AK9A 4MKHA 3EIQA 1ELOA 2ZJ8A 5H70A 4MGZR 2YNMA 1XMSA 2TMKA 4MUAA 3FHTA 2PL3A 4EAQA 1KO1A 4WZ6A 1I2MA 5FUYA 5C1BA 4GMDA 3NDBB 1NBMA 3AVVA 2CHGA 4R9UC 1WBBA 1K5GA 3EPJA 4A1FA 2KI5A 2DB3A 3FGNA 5AUPB 3B1XA 1W44A 1SXJA 1KK3A 3K9HA 4GP6A 2ZSBA 4IJMA 4JBWA 3LV8A 3WHLA 1R7RA 4ZPXA 1FX0B 2BMDA 1A2BA 2Q6TA 3PIRA 2BMFA 3W6NA 5B2ZA 4XTCS 2ORVA 4JVLA 4OJQA 3BAFA 2JDID 1G9XA 1R8QA 4FWTA 2NG1A 4C0KA 1U9IC 2FMXA 1P73A 4O2LA 1N6PA 5LBIA 1M2OB 3WBJA 1EFRD 1T9HA 5IF9A 2C77A 1XEXB 3A4MA 1OXSC 1G16A 3AF0A 4UQOA 3EG5A 4V0MA 1GG2A 4X8MA 5CM9C 3TSWA 3I4LA 4OK5A 2ZIAA 1TUIA 5P21A 4A2PA 4BLQA 5KSOA 1S1CA 2ZJOA 4DVGA 2HLDD 4B3DA 3B9QA 2UKDA 2IYSA 2P67A 2IYXA 5KDDA 2ZJ2A 1BH2A 2V4ZA 4PHHA 2XTZA 2WOJA 4FCTA 1UBCA 4MRNA 1EESA 2QBYA 4KVGA 5AR1A 1X8LA 1ZC3A 2BC9A 1TQ6A 4FCWA 3ADBA 4BZQA 3TAUA 2O5VA 2IBMA 2C9CA 1DAFA 1ZM3A 3ZZUA 4D4LA 3K1JA 2IXFA 1E2JA 1JR3A 4D4MA 4XTRA 1U2RA 1Y3AA 1R0ZA 4D6PA 2GZAA 2YZ2A 3H84A 5UKDA 4PPFA 3AQ4A 2B7BA 2GTPA 3KKOA 1KYIA 1ZIPA 4HLDA 3U6KA 1R5BA 1YZQA 1KZGB 2ZROA 2CNWA 5A4JA 1OYWA 3X1WA 2ZU6A 4M1WA 3R7WA 2A78A 2MMGA 1VDZA 2RGGA 3E5HA 1OE0A 1GUAA 2YHSA 2OBLA 3D3QA 1TEXA 3NBYC 4FMBB 5KO2A 4FMCB 4I1OA 2QZ4A 2FF7A 4M2LA 1U0JA 2ZRIA 2NOAA 1DS6A 1TF7A 4W7SA 2CDNA 5KHOC 1KJYA 3NWJA 1COWD 4PHTA 1T5IA 1FZQA 4ILEA 4KFRA 3U3KA 5LD2B 4M1KA 1X8KA 5CJPA 2QRZA 3AP1A 1GVNB 2FSFA 3DZ8A 5DGXA 1T8TA 2F1HA 3QXSA 1X8JA 3OEHD 4ZKDA 1KDOA 3NC1C 4PFSA 4P4TA 2H5EA 3EASA 2YWHA 1E1QA 4GZLA 3KUCA 2VYFA 4JLVA 4KYIB 2VP5A 2CJWB 2G1KA 2R8RA 5FOWA 5CYOA 2QPAA 3GFTA 5HTKA 4OKSA 4A8JA 3RS4A 4IDOA 1NMZA 4LC0A 1T8UA 2ATVA 3UMFA 4RVCA 2IXEA 4L15A 1E2GA 2E1RA 1K6MA 1XNJA 3NBFA 5J47A 2P6UA 4TL8A 3ZQJA 5LD2C 1Z0DA 2VSXA 1AGPA 2JEOA 2J0QA 1IONA 1XWIA 4YMSA 1K5DA 1VKJA 4Q02A 1S4QA 4I4LA 3CWQA 1JXMA 4CEHB 4DRZA 3WYAA 2Z6VA 4Q9HA 2AXPA 1IJEA 3SS8A 2FSGA 4BLRA 2D74A 3ONWA 2VQSA 4IOMA 1HT2E 2ATXA 5EXSA 4PC2A 2IS6A 1XRJA 4KHZA 1ZD9A 1II8A 4WZBE 3AP3A 3EC2A 4DUGA 4LJ7A 1ZMXA 3QENA 1P60A 2OFWA 2Q3HA 1CKEA 1DG1G 4Q1FA 2W83A 4OK3A 5DHAA 3OFNA 4F91B 2R6AA 1NMXA 4CEJA 2PZFA 4S2EA 1T0JB 4OK6A 2O8FB 3H86A 4BEBA 3GLIA 1HQYE 2WAXA 3FDIA 5F98A 4M4SA 1RKBA 4Q4LA 4LV8B 2HLDA 1YZGA 3RHFA 3ETLA 3WRXC 4BWYA 2WOOA 2KE5A 2WWWA 3WNCA 2A5DA 2YOGA 2F6RA 3KX2A 1KI6A 2IEYA 1D2EA 1OIVA 5K8UA 4K46A 1W36B 1ESMA 2O8EB 2ZXUA 1E6CA 1G4AE 2WSSA 1VIAA 2XNDA 3K9LA 4UNQA 4ACAA 1KGDA 4BFUA 2GEDA 1AZSC 3MGCA 1JECA 3B7GA 3VQTA 4DDTA 4TMVA 5EE0A 2XEXA 4XH9B 1N2CE 1W4BA 3I32A 2D2FA 4LHWA 2QM7A 2OV2A 3TIFA 3EIHA 4OL0A 4IDQA 3L2OB 4Q7LA 1SXJC 2FNAA 4HAVA 5EE3A 2LWIA 3IDQA 1XZPA 4WVFA 1JAIA 2QT0A 3PUWA 4MRPA 2QM8A 3GJ0A 3SYLA 1J90A 1LVGA 1G19A 3TVTA 3VU9A 2JATA 3TVDA 4OYHA 3CO5A 3GLFB 4B35A 3W8RA 4Z8XA 2J0SA 2YJTD 1YQTA 2OSBA 1P72A 2QENA 1WQ1R 4DSNA 5HKKD 3W90A 1G17A 5JJIA 2EW1A 4WA7A 2UZIR 5FBWB 4G0NA 3WNBA 3TW8B 1S96A 2CE7A 2FV8A 2QSYA 2GF0A 4DCTA 2HF9A 2GJ8A 2QP4A 3M0EA 2B7CA 2XSZA 3W6OA 4B3BA 2CL7X 1TQDA 3LA6A 3L8YA 3TUZC 5EXPA 1NN5A 4JBYA 3IEUA 3WMEA 1EX6A 1UADA 1YZTA 4M1TA 2QE7A 4PO8A 5FL7A 2XZOA 4M1OA 1XCPA 3EXAA 3RRMA 4U5XA 1BKDR 2BM1A 1VHTA 1SQ5A 1PLLA 4URVR 1XPUA 4URWR 1KIMA 2UZ3A 2GRJA 1FW6A 3AF1A 1N0UA 1MO5A 1W0KA 3RRYA 4TMZA 2OLKA 3BB1A 1KI7A 4LBZA 3BH7A 3GLFE 2OAQ1 2G6BA 3LY5A 2IYLD 4QKQA 2ECKA 3W5JA 2QEQA 1WBDA 1XF9A 4PO9A 4O25A 2E87A 3ZQ6A 4MYHA 4XOIA 5F2EA 2WWXA 3EZFA 2JLVA 1ZCAA 2LKCA 2O52A 2Y8EA 4C7OA 1GL9B 2FZ4A 5JI2E 2P2LA 1TL7C 2V1XA 3M4YA 4G5SA 3WYGA 1R6BX 2PLRA 4QOSA 3K70C 1QRAA 5GVRA 1NLYA 3CPJB 4P32A 1D5CA 2PT5A 1JI0A 4B3CA 2IT1A 2H18A 4QM7A 5FTKA 2RGDA 5TXGA 1YR8A 1QHSA 4QHTA 4QRHA 1VYVA 4X8OA 2EYUA 2J0UB 3CRRA 4OHYA 2ZRMA 3KB2A 3MJRA 3AVQA 3IKJA 2PBRA 3QUSA 4PZYA
chains in the Genus database with same CATH superfamily
3SYRA 1O95D 3ZPXA 3OMLA 3AI2A 3O31A 4P5DA 2ORED 1VBFA 4P22A 1Z6TA 2I1WA 4QDZA 1W4CA 3MWJA 1NSYA 4G0PA 3SX2A 4D82A 4F86A 1Y5NA 4TV8B 3VDXA 3W5DA 1E32A 1WD5A 4Q15A 3TI9A 3AB8A 3OCXA 4CKWB 2DT5A 4WFJA 2PAFA 3QUCA 5DNYB 4N8EA 1ZNXA 3NV9A 4WBNF 2BHTA 2R11A 2GK3A 6LDHA 5BN1A 4LRXA 1A8HA 1A82A 1TO6A 2PUGA 3HDGA 1L5FA 4G07A 3PUJA 3WSWA 2I8CA 1PTJC 3DMYA 3GEEA 4EFNA 3EIUA 5L7TA 1NLMA 2X1LA 3HVIA 4LWQA 5EQJB 3GFGA 2CJYA 4BGDA 4ZV9A 1NNEA 1N9ZA 1PX2A 5FLKA 3PXGA 3F5SA 3JQQA 2X3UA 5DGIA 2C7PA 1DKOA 2J67A 3D9QX 2V7BA 3OZIA 10MHA 3NTRA 1OXBB 3VHXB 2PL1A 2BIFA 3AUSA 1OI4A 3MTIA 3VC2A 2ZSKA 4RDIA 2IZ1A 4ZAGA 4BE4A 5TARA 1Q50A 4Q7EA 3FY4A 1U7ZA 2ZG6A 3FB4A 4LK2A 2LRHA 3GWZA 5FP0A 3ZNQA 1YKGA 1GFWA 4DDHA 4MKXA 2XIJA 2VWHA 3KXDA 5J9FA 1N2CB 3I2KA 5ALKA 3RQIA 4O4IA 1RD4A 2VJPA 4LZJA 1I1HA 2QTWB 3ON5A 2D5AA 4KDFA 2Z4TA 5KTOA 2QYTA 4ZYUA 1JEAA 3K5IA 5JCJA 4IV0A 3EX7C 1U99A 1Z25A 1M73E 4HQRA 4A0FA 1D5WA 2ZKIA 2X0FA 1M8JA 2FZVA 3LBFA 4B6GA 3OE4A 4QPPA 5JJLA 1BEEA 1G55A 2EF0A 5FTLA 5JI3E 1T5DX 3TOZA 4COOA 3JD4A 4UDXX 1SU8A 3CUWA 3LCJA 3LECA 2W8ZA 1T9GS 2C92A 3SJBA 4BTLA 5CEEA 2ZRFA 3PCTA 2HREA 4K2AA 3S2UA 1FVXA 2OCPA 4F4HA 1AXGA 3L0CA 3FIUA 2QF7A 3AUJB 1T2VA 1XF1A 1J22A 1NQAO 2O2GA 1GAXA 1MLDA 3EG9B 3N2IA 3ZE6A 1AF7A 1UXJA 3HM2A 2CVZA 1E1CA 1Z0JA 1V35A 3OM0A 2I4MA 4OHXA 3HK2A 2R86A 4C0SA 3KVOA 3P45A 2J4CA 3A7DA 3JZFA 2CLDX 4X62B 1Z56C 3OPNA 4FMCF 2P41A 2RKOA 4AY3A 5K3SA 3TQTA 4EHFA 1W0JD 4MS1A 1QP7A 2QUBA 1TKCA 2I29A 3B6KA 4LZPA 5JDCA 1I5OA 3C8UA 1H5QA 1E7SA 2J87A 3CPHA 1NONA 1CUZA 4UXJA 1N34B 2KMLA 2H1CA 3A6LA 3IB3A 1E9SA 1PNVA 3LGXA 1V37A 2BEWB 2DPHA 3BERA 1M5RA 5AI4A 5E8JA 4YAWA 4DXAA 1YDFA 3LQKA 3BTVA 1SUPA 4JLPA 4ZO6A 3L6EA 2NUBA 4MI6A 1MAUA 4JUAA 3FFAA 2ZI9A 4QNMA 7REQB 2OUKA 5IDVA 2DHQA 2CJPA 3SQDA 2XXAA 5HJ5A 2XECA 1SUBA 1E3JA 3L84A 1IOZA 3W79A 3OBIA 4ENQA 3WIBA 3EODA 2HXSA 4ASUA 1CYDA 3PR3A 3S1LA 3WLQA 1REQA 2NTVA 3HXPA 1TQ8A 4ITUA 5LKRA 4V0QA 5BSFA 4XGNA 5TJHA 2WJWA 5HBGA 4DSAA 2NPOA 4B73A 4J8PA 1U94A 4M9CA 4RSRA 2IEZA 3OI7A 3B6IA 1C0EA 1EK5A 4TQGA 1ZN9A 2XMPA 3RVNA 3GIDA 3ZU5A 1RABA 3I0NA 2G28A 3FYCA 3U7FB 3V8VA 2WQ7A 1U63A 2YMPA 4H59A 1U7WA 5CX1B 2OM6A 4UEWA 4DLBA 1QOPB 4B2IA 5LP6C 2WHXA 3ZD8A 5B2EA 3LP6A 1WCV1 4DM3A 4BZWA 3A9VA 3AKDA 2VXOA 2W90A 3IO5A 1GQRA 1NBMD 2ZB3A 4GOND 4J9VA 3G88A 2IV2X 2C2WA 1IDOA 4GBED 1CLEA 3DLAA 1MZPA 3R6WA 3JZIA 3NM4A 4OA8A 4RU1A 3UPUA 4WNYA 1CNEA 1ZM7A 2A88A 1JB1A 2ZRGA 1GPMA 3GHYA 5AQEA 3QBVA 4BTVA 5K6AA 3VH3A 3A1UA 4GG1A 1Z8NA 2BHSA 2OSVA 4XYMA 3PUZA 1JPJA 2C5GA 5BNWA 1P75A 1O3YA 4GQIA 4BYMA 4CHGA 8ATCA 2FDCA 1NXVA 1VFNA 3M5DA 2XDQB 4QUIA 4HDNB 5ERXA 3CZQA 2CYCA 3MAAC 2VP2A 1JHOA 2GWHA 3E53A 4IGKA 3AL3A 1MRNA 3LKDA 4JBNA 3I6MA 2WSMA 3RC8A 3P4XA 1Q0UA 5AHRA 2ZDGA 2XWJI 2YIJA 2V9ZA 1J42A 4HX2A 3J80A 1R9GA 3RVJA 4B46A 5J4KA 1ZM2A 2QYHA 3HFGA 1Q0TA 2ZRPA 3KOZA 4S1NA 1U04A 4ZMBA 3FJYA 1M2JA 5DM0A 3JYNA 3RFVA 5L4SA 2PJUA 3VSDA 1DELA 2W6OA 3B78A 2QRUA 3EOZA 3IQFA 2B0JA 4IXMA 1B6RA 5C8DA 2XJ4A 3OP4A 2WVGA 3KUKA 4RV5A 3ZZTA 1WXHA 4BPRA 1OC2A 2R1TB 5EJAA 1A3CA 2CMDA 2P11A 4F1JA 1UKZA 3IAFA 4MWOA 4OBXA 3IBFA 3IKVA 3WBFA 3ZLUA 1USGA 2I4IA 4AMYA 3Q3JB 4XWGA 1RM0A 1Z12A 2A30A 5EPEA 3ODPA 3ORYA 2G71A 4EZEA 3DZFA 1DAKA 3MTEA 3DDOA 3WLFA 4QT4A 2VBIA 2GEJA 2VH5R 1D4FA 1YA8A 3KJHA 3S2FA 4W7IA 4HKTA 3ZDAA 4ECEA 4UMEA 4WVLA 5HRCA 1DWQA 2V8OA 4E33A 1MJ5A 1H94A 1UDCA 2J4FA 3H99A 3IFSA 4AKIA 1JDBC 2P40A 4A5OA 1OBVA 1R12A 4I1RA 5EUQB 1UUFA 2CFOA 4LXXA 3N76A 2HJHA 1VBNA 2K6GA 3ZWWA 3AM1A 4JSTA 3OFJA 4RY9A 1VIDA 2VHUA 1U7HA 3IOCA 4EGFA 4NL4H 3I1IA 4IQGA 3QVSA 3OQIB 2HJRA 4QLOA 4TQAA 2B98A 5IJZA 1O97D 2QG6A 5C8XA 1GCGA 2I4RA 3OQIA 3E7PA 5C8YF 1F5SA 1LFDB 4MMXB 3F6PA 1KYQA 5ESRA 1D6NA 1U98A 2FVYA 2JKYA 1Q1AA 3T5BA 2C5EA 1BOOA 3WZ2A 4S04A 1OH5A 4M8IA 3PE6A 3QX3A 3QMWA 1FUYB 3DEAA 5IJAA 4GZMA 3FSGD 3GFVA 5CM8B 3GLGB 1WHTA 2JFUA 2PZJA 5I4CA 3SVLA 1GL7A 4FFBB 3GLGA 1TDJA 1D1TA 1LPOA 4JN6B 1MNQA 1M8FA 3EA5A 5JPCA 1GEGA 3U26A 3JVIA 1VMAA 4FZ3A 4RTJA 5E7MA 1TKBA 4LBYA 4W8HA 1U31A 1UXGA 4JDUA 1ENPA 1Y8ZA 2WZDA 3W0LB 4BLPA 2PGLA 3NGLA 1N0IA 1QIHA 4Q9AA 3UUFA 3X1DA 1KC3A 5EWJB 4OQNA 3EZYA 2GWRA 4B40A 2IKQA 5C81A 3P9KA 3FLMA 2P9EA 1V1MB 2XR1A 1PV2A 3KSRA 3QOFA 2VAMA 4FGJA 1FMLA 1NOKA 1QUFA 3JQFC 3KQYA 3OJCA 4H35A 5FPSA 3HPRA 4OAQA 3UH1A 2D5LA 3FD8A 2PVSA 4OMCA 4DDMA 1VPWA 1ACLA 2ZAMA 4Y2GA 5HCNA 1W4AA 5C51B 1NFRA 1BWRA 3MJHA 4Z9YA 3OPYI 1XE3A 2POCA 3H0CA 4K9PA 4RSGA 3BBPA 1TKAA 2R6GA 3O91A 4DNXA 4ZYZA 2O8EA 4YI3A 2SNIE 4ZV4A 1XDWA 2Q29A 5FX2A 2V5UA 2H29A 2IA5A 4PFKA 4C0JA 2E5LB 3RC7A 3U4QB 4JT4A 4Q18A 3M49A 4HLCA 4P84A 1HDXA 2BPOA 2CFTA 4WDQA 4BMOB 2QTHA 3BJIC 5G41A 2ZYUX 1M2VA 1V39A 2BN4A 2C4NA 2VRWA 3OX2A 1N2SA 4WX2B 3OEWA 1B8PA 2I9PA 4IIUA 3BVPA 4U2FA 1N2HA 2E4WA 1FRZA 2Y9MB 5D87A 1DU4A 5M29A 1Q22A 4BYGA 4MNTA 1KK0A 2D4AA 1TX4B 2QAIA 4V0LA 2WUDA 1UDWA 4J1TC 4MYRA 4R51A 5DT9A 1R16A 4AM8A 4BLSA 4EAAA 1SC1A 2OG1A 3HCBA 4PZZA 3RAJA 3M9LA 3NYRA 4DIDA 3TLJA 2NYUA 1VCOA 2LD4A 3TMKA 1Y8RA 4XUEA 5DTIA 2RK6A 3F5QA 4HNQA 3MTQA 2A1TS 1GQQA 1TW3A 4V0RA 4EKYA 1GYQA 4RF3A 1BN7A 2FW1A 3FNIA 2BUCA 5F7ZA 1P80A 1E3DA 5FTWA 2XHZA 1ZDMA 2QN7A 2YBDA 5IANA 3CY6A 3GEGA 3U7HB 3RFXA 3RLIA 4KZKA 1B23P 1DEHA 3LWNA 2QTMA 1YZ3A 2PT6A 4KSBA 4W5HA 4CQMA 3PPXA 4ZOQI 3IRVA 2D7JA 2BZ1A 1AKVA 4UFOA 3D7RA 3I9V6 2RGEA 2IZ0A 2JLWA 1CY6A 1K2WA 1TT5B 2X5OA 3MFQA 2PH7A 3ICWA 1OFIA 4X54A 4ND6A 2J3KA 3SU8A 3SY8A 4FNAA 1E8MA 1JDSA 1NYRA 2C3MA 2P9YA 3R4VA 3BIFA 5B1DA 1D1SA 3OA0A 1YVUA 4I9UA 1OC4A 3IAM1 4JMPA 2ZUDA 3GRPA 4NFYA 4IOKA 1D7OA 2QUZA 3ZWKA 3ABQB 4HVTA 3TKYA 4AF7A 3PPYA 4YFVA 4A6XA 1L5MA 2OBXA 4HI0E 3QFSA 1N36B 4O4JA 4DADA 8OHMA 2VPQA 4XM1A 3TIGA 3TEJA 5A5EA 1SVKA 3DZHA 1NULA 2ZJ4A 4R01A 1QB8A 1UWLA 3ZV5A 1T0BA 3NH6A 4GDMA 3F78A 3PXBA 4L7QA 4BMVA 4IX9A 3T52A 4YUAA 3FUUA 2A1TR 3KVYA 1PQUA 4LFAB 1CUYA 1KC1A 4ON9A 5DNVA 5DYGA 3WL3A 4RH1A 4NE7A 1S2GA 1YCDA 4FQ8A 4GP7A 4Y1GA 2HWYA 2PQ2A 3QPDA 1EPUA 1T0PA 1CJMA 2OO5C 1PWHA 2FRXA 3INNA 2AJTA 4RELA 2BFFA 4B2YA 4MR7B 5ILOA 2I0FA 2OMEA 1N6NA 1YR9A 4Z4GA 1NJ5A 3VA7A 2P7HA 4KIGA 1KVUA 1E3SA 5EMKA 1LBQA 2O2YA 2OD9A 3K0HA 2AFVA 1F7UA 1G3RA 1G59A 4RXMA 1PWXA 4ZVOA 1JSLA 3JQ9C 4LJKA 4Z9AA 1VIYA 2Q5IA 2XNHA 2X4GA 3OIYA 4GR9A 4HFMA 2DZDA 4R7ZA 4X1OA 5BVHB 3FTPA 2YWFA 3RSGA 5I6DA 3A9TA 1W29A 2RG1A 4G4JA 2O8BB 1T3ZA 2BEWA 4MPRA 3RYFB 3PFWO 2P9HA 3OJWA 3V4OA 3W9YA 5EUBA 4ZYVA 5FLYA 4U9HS 2UXBB 1FYEA 5KVVA 3ZXUB 4AZTA 3ANSA 3H5VA 4PV7A 4OQFA 2WVHA 4AP6A 4INPA 2ASVA 3VU3A 4AURA 1FW8A 1VHQA 1OZGA 1Y6ZA 3D64A 3INYA 1Z3IX 2X22A 3JASA 2H8GA 4H27A 4ILKA 2FFJA 4C4XA 4DA7A 4YRZA 1O9GA 2VCHA 1AOXA 4MROA 3IMCA 4RCZA 2H59A 1LJLA 2BFAA 3AF6A 3IE2A 4MV4A 4RD3A 4EA8A 4AYTA 4URXR 3GU3A 3EZ7A 3K0BA 1HE2A 5JMWA 5T3UA 1CLUA 3RRBA 5TEWA 3SMVA 4B7UA 1DDIA 2QAGA 4YN3A 3UC5A 4B71A 3F67A 1U02A 1I51A 2Y1KA 4ARUA 4IJUA 2VDMB 2K7ZA 4HWRA 4ZO7A 1QE5A 1R3DA 1DRKA 4MVJG 3B13B 3DPUA 2EP8A 1M2NA 5FTMA 1IPHA 3B1ZA 2AR9A 1R00A 3KS9A 1W4ZA 3ZY4A 1K7CA 1TJ4A 3DBRA 3E6AA 5C31A 1JIIA 2K4MA 4B3TB 4R8RA 3MWLA 5AKZA 5HXAA 2R5NA 4JL8A 1FDTA 3VPCA 5L3SA 2MSLA 2C61A 2Y0DA 4OIMA 4C4TA 4EP1A 2BH2A 3IH5A 3R6LA 1HT3A 1RFLA 3D7LA 5DLPA 3R3YA 5DISB 1S5PA 3R77A 1FJHA 1KJNA 1GGHA 3AHDA 4BX0A 1L4KA 2XXBA 1N5KA 1FFDA 1LB1B 2QI9C 5C5EA 2MJLA 2XITA 5HOQA 2AZ4A 2FUNB 2NUTA 2BELA 2G5CA 1PQPA 3SZ3A 4HYYA 4WRRA 4YCJA 5HMMA 3QVXA 5JDIC 4JAVC 2ZIVB 1Q1EA 4M0DA 3ROFA 1DFGA 1QHFA 1SUSA 4AULA 4BJ1A 4ENRA 1T4DA 1X7GA 2VJAA 1ORVA 1FDSA 4B83A 7ABPA 4DJAA 4Q7MB 2IK8A 2FP4B 5DN9A 3CRVA 5IKOA 3O8RA 3CURA 2EFJA 3O4JA 5ITZB 1JKJB 3DPIA 1YKFA 3DZDA 3TIXB 2QTVB 3DFZA 3SJAA 3L7JA 2C7OA 4FOOA 1Z5WA 2M9MA 3BFXA 2AKEA 3PFBA 4JU8A 1C9KA 2AUMA 1JYSA 2A0UA 2NZJA 1KQGA 3LUPA 1KO4A 1RAAA 3A25A 1O96B 5TF4A 1R0CA 5CEFA 1YDGA 2V6BA 3PLRA 5A0TA 2OM2A 3C5HA 1ZBDA 1JG7A 2UYGA 4YJFB 4EJ2A 3SBOA 3QJ5A 1CF4A 1G7SA 4B7XA 1OF1A 3T15A 3KZMA 2BDTA 5HS6A 3UOAB 3LCVB 3LOPA 4J4BA 3GFOA 2XA1A 5F76A 2DTDA 1NW5A 1CF9A 1RWXA 2HIMA 3SJ7A 1IU9A 3T7AA 4C4SA 4TN5A 1LPPA 1OCEA 3C5CA 3GEDA 4EB3A 2PR2A 1JR3D 4UPVA 3LRXA 3IIJA 3ZJTA 3VX3A 5REQA 3AZQA 4K6GA 2BEVA 1EFDN 3BXXA 2PU5A 3FZQA 2Q1TA 4H6VA 5E1BA 4DG8A 2SKCA 5CB4B 2IEIA 4YCNA 2ZAYA 2YJZA 1FTNA 3B1YA 4EFLA 2IVZA 3GLIE 1R2QA 1E61A 5AP9A 2OL4A 2ZYDA 1N5IA 5FPQA 2LIPA 1JSXA 1N6IA 3BE5A 2FZKA 2QAJA 3DTYA 4Z2YA 4PN3A 1W0JA 1ZN2A 2ZUBA 4IQFA 1ICEA 1D04A 1L7BA 1OJ7A 2B4KA 1KXZA 2WJZB 1FDVA 4RFVA 4ROTA 2JIOA 2WHQA 4MH0R 4F6RB 2VC2B 1WOYA 4HB3A 1U5AA 4RW0A 1Q14A 1VA4A 1ZMTA 2EKPA 3EZLA 3QK7A 4LZAA 4MIOA 1ESNA 2P9ZA 3O73A 4JCOA 4KOEC 3RUFA 1UMCA 1USIA 5IK2A 1E0SA 2XUFA 2J1LA 4QYTA 2AOVA 2W22A 5HFJA 4C0LA 4EHKA 4LCJA 4H7EA 5F7XA 5T6BA 3ORRA 3W3AA 4R5MA 3IOYA 2A0KA 1LWNA 3TXYA 2C4TA 4RD4A 5KNBH 3LDUA 5EHXA 4G84A 4HMPA 3BQ9A 1IJBA 1J2YA 2EV9A 3ITEA 4IIXA 3T4PA 4E1AA 4B3SB 1L4YA 2ZRAA 5DX1A 3B2NA 1SHUX 3DTVB 1I33A 1F0KA 4TUYA 4L0CA 5KSWB 4NCKA 4CV3A 1C14A 3EWAA 1E7YA 5CDFE 1QG2A 1V1MA 1Y1SA 1KYWA 5HJ2A 1YDMA 3R7FA 4B76A 4HEA1 3ZH2A 4XPZA 2XDAA 3K9FC 2HA5A 4XCVA 5IC6A 1LBTA 1IZ9A 1FNCA 1C2TA 2ROQA 5LB2A 1CUXA 3OM8A 4BP8A 3B51X 3W7VA 2IUYA 2O7NA 5FOXA 3RE1A 1OGIA 2D0IA 1NIJA 3DHYA 1TAQA 3UO8B 3ED5A 2BDUA 5H4GA 4ZMRA 4NBNA 5REQB 4D45A 1BG6A 2WJIA 1KHHA 3VC7A 2IOFA 1I7PA 1SGWA 5FR1A 4BWFB 1F8XA 1ZIDA 1PYGA 2ODWA 2ET6A 1WHTB 3CEJA 3MLBA 2OP1A 1SZDA 4JOCA 1YD7A 4PZCA 5JSYA 2A0FA 3ZZMA 1C30B 1U4SA 4LJRA 2LV8A 1Q1NA 4QUGA 3JAKA 4OH7A 1WW8A 3QYJA 5G3ZA 4DLWA 1ZL2A 2NTNA 2WWVD 4IPTA 3CYFA 2ZZKA 1K2VN 5JAOA 1ECPA 4UVDA 6Q21A 4Q4HB 4C07A 1SVSA 3T41A 1SVIA 1GD1O 1TQ2A 3BMQA 3R3JA 2F7SA 1SD2A 4PLZA 2FFQA 3LT2A 1YIDA 4JS0A 4YGYA 3A4TA 2FUEA 1YHZA 3QQPA 4Q9LA 2GBIA 1VZ3A 2ZT8A 2DFNA 5IVHA 2ERYA 5AO9A 2QBYB 1IG0A 1EG2A 2E4XA 4B75A 2V5VA 2KS6A 5KTYA 5DCLA 3OO1A 1QH1B 1HG0A 1RNLA 1TLFA 2PCLA 1MXHA 5IWAB 2C82A 2VDUE 4ZAXA 4YAEA 2CXOA 3BRCA 3OWOA 1WDLA 1PEYA 4A5SA 3KKMA 1VL1A 3ICPA 5EIHA 3CVXA 1BMFD 2R00C 3LOUA 4O1HA 3PB3A 4RLQA 2G1AA 4P33A 4E1VA 1NUTA 2GUGA 5CNMA 3EEYA 4XIFA 1QFZA 1RRVA 5FFFA 2HH9A 1L5WA 2AGVA 3L82B 2Y66A 4IUDS 3VR6A 4C7OB 5B12A 1NXSA 3OLZA 5AM4A 4X1IA 4YS6A 1QGDA 3HGTA 4BV9A 3NT2A 3K9GA 1XJCA 3M6LA 4AKTA 4ID9A 2HMTA 3JQ9A 2XODA 3E7DA 2GAIA 3NNDA 3DAYA 1ZD1A 2PGDA 1TAUA 3L7LA 3SF8A 2ZGVA 1UEJA 3IT2A 1Z08A 3E9EA 1KMCA 4J0DA 3R0ZA 1ADBA 3QWAA 4BCCA 1LTKA 1YJAA 4KQCA 5HVNA 5ADUS 3S4YA 1VSQA 4ZRDA 4RZUA 5IC4A 1ULHA 2J0UA 1X7WB 2VJDA 1AT1A 3HDQA 4AWXA 2BWJA 2GD2A 1C0KA 1MEEA 2ZVDA 3C97A 3D8TA 1JAZA 4KPGA 4LTNA 4CT4B 2Q9UA 6REQA 1ILEA 1RWBA 4N5MA 3TM5A 3G2JA 4OYRA 1SMKA 2WWTA 1DX6A 2HWWA 3N07A 4FDTA 5K4AA 1BE6A 3MJCA 1KVQA 1DZIA 2Q2NA 2ZXFA 2EKLA 2IUTA 1SG0A 3T3NA 1NWHA 4TROA 2WMYA 4IRXA 1L7XA 3AFOA 4IF4A 4M9ZA 3N2GA 2OBYA 3STHA 1UIMA 1JFSA 2NIPA 2FMTA 3QLTA 1BVYF 2XGGA 2GEUA 1C1DB 1FA9A 2PYIA 4CM6A 3HJCA 4MPPA 4PTLA 4BWVA 1DIBA 1MO6A 2FKNA 1RWOA 2QT1A 4S1VA 3QBJA 3P2OA 3RIGA 3OZDA 1IXKA 3BRWA 3ZNNA 2RSLA 2WBLC 3KPYA 3TCXB 2D13A 2D1YA 3NUGA 4M0KA 4YUWA 1ZQ1A 3HU3A 4XVRA 3FCAA 2MSDB 3K0CC 4NBWA 4DSZA 1GGJA 2J0VA 5JFGA 1IZYA 5F5LA 1O0CA 4K0KB 1WMEA 3N8KA 3QVGB 3FH0A 1CZOA 4JU9A 2J5KA 3ROXA 1UPAA 4JYCA 1SHLA 3W6ZA 1FDUA 4R71A 1Q0PA 4NJEA 1M1YA 4JP5A 4M49A 4YMTA 2ODNA 4KAFA 1DX9A 1TLTA 1W0KD 3U39A 3LPNA 2EX1A 2IS4A 3STUA 4I6EA 1XQ6A 3CH4B 3R4CA 1HPLA 1Q20A 1TZJA 1XU9A 4MLPA 2A5LA 4YACA 4ZP1A 1SOAA 3TW6A 5K3BA 3HDJA 2OXTA 5M5BA 3QYPA 5CLQA 1Z33A 1TC2A 1J2EA 1TF5A 1AUQA 1JDZA 2GHTA 3DQQA 4HNGA 4L3OA 4MP8A 5EXTA 1HTBA 2DY1A 3THRA 4EPYA 3L4JA 4URHA 3QEBZ 2P4UA 2A0XA 5TQ0A 1L5ZA 5IAJA 4C87A 1M34E 3M70A 4UU7A 4ZQBA 4JASB 3HMKA 1E9AA 4XR4A 4Y2UA 1T9ZA 1ZISA 3VU0A 1IUNA 4G0UA 4JR2A 2HDWA 4OJNA 4TTAA 5B55A 2B8EA 1IBSA 2BJVA 2PYDA 1CJVC 1HETA 3RWBA 5E9WA 3MWEB 1ZJWA 1N6HA 3QJYA 4R9NA 3QPVA 1VG0B 4WOPA 1KJWA 2PUTA 4X61A 3RTGA 3OSZA 3FHLA 3HC7A 1IUKA 1AQNA 3VJRA 1DT3A 2H52A 4B9EA 5JO9A 1XQXA 2VKQA 4IIGA 2O23A 3DOHA 2Q1UA 3VAZA 3BJRA 5A1TA 2AMLA 1M2FA 5CBPA 1UJ6A 1ZHHA 2PLAA 5I48A 5LA6B 4IYRA 4NZ9A 1VKOA 3OC6A 3BK7A 4OL9A 3V5NA 2WYVA 3OC0A 3ZDQA 4ZCLA 4CMKA 1ACJA 5TVKA 1SKQA 4Z9BA 1TGYA 1TCAA 5SZIA 8MHTA 3DV0A 4F21A 4H3KB 2FW0A 5JG7A 4IV5A 1VCHA 3RIXA 2OD2A 2RGYA 4S1OA 3KJEA 2O6HA 4P98A 1VJRA 1ENYA 4L1KA 5KCMA 4EG8A 1CR1A 1B41A 3E7WA 5B3JC 5BNZA 3EW9A 4FWIB 5EE9A 1AF4A 4Y0AA 1XVAA 3AF4A 3ZHQA 3PQ6A 4GFDA 5B6JA 5EIEA 2OUIA 1SXQA 1O8BA 2Q6KA 5CFNA 4PY2A 3V97A 5BY2A 2Q8QA 3LRPA 1GUDA 2FPKA 1LVUA 3ECCA 2RI6A 3NIBA 1VLLA 4IGEA 1Z82A 3S40A 3WLAA 3WGVA 2O7SA 1ZIOA 4IVPA 1MABB 3UOWA 9GPBA 3BULA 1GTSA 1PZNA 2ZBRA 3EE6A 1YJ5A 4Q6BA 2G9UA 2LP4Y 2XAUA 4RA6A 4JODA 1IZ0A 4DA9A 3E3MA 3Q12A 2ZANA 4GZ5A 1K6XA 2HRBA 2QIPA 1J8QA 1XLTC 4QRIA 2E9SA 3FNEA 2X8JA 4K6MA 5E1DA 3G49A 2AOUB 2RHGB 4WY5A 3SJUA 3BFPA 3CR7A 1KGSA 1LC3A 1Z6AA 1KAQA 1POWA 3HB1A 3PNLA 2QNIA 2I6GA 4MUYA 4AXBA 3GY0A 4MUMA 1GYRA 4HUQA 4XWOA 2MOKA 2J3EA 3QV2A 1EDEA 4R8LA 1PUIA 4RHUA 5L8VA 3JALA 2X2EA 3O0TA 3O8LA 2D1TA 1P8JA 3Q7IA 1F2TA 3H8SA 5K51A 1UPXA 4V0KA 4FYYA 2XT9A 4CT0A 2JLRA 5DTRA 2NSYA 3RODA 1E3IA 2EFDB 4FDUA 4KN5A 4Y8VA 1A8PA 3VR4A 1WSAA 3FVQA 4ZI3A 3DBLA 1OH7A 1P9NA 3GPIA 1U0TA 2J07A 4BECA 4AY6A 4ZZ3A 1AB5A 1WMSA 1K5HA 3ZTYA 5EJ9A 3GOHA 1KTVA 1A2KC 1OHHA 3KTOA 2QR2A 2CL6X 4CF6A 3DUFB 4OXKA 4TS1A 3UHPA 2IQIA 1UBJS 5CD1A 1PSZA 2NU7A 3SKVA 3DV2A 3FUXA 4OQ4A 2CFCA 2CXQA 2DPLA 3IBGA 3UHJA 3HA3A 5LLTA 5I7EA 4ZANA 2GLTA 3FDJA 1T35A 2AXEA 3UHAA 1SCNE 1P1KA 1DAIA 1KDTA 5LBUA 4KQHA 1C1DA 5KYGA 2ZPAA 1NTRA 3CNOA 4JUBA 1ISRA 3H2HA 1C9YA 3CNQS 3FVWA 4C29A 1EP9A 5BWOA 4E32A 4YXWD 1KSHA 2A3RA 2F1RA 4DYHA 1UBEA 1RE0A 2HQBA 1P6UA 2V6MA 3L0SA 4EEXA 5BMVA 5LWHA 1J1ZA 5GAJA 4OU4A 1OKKA 1YC5A 5A5FA 3ZWMA 1KOJA 1UODA 4DBVO 4MYSA 5IG2A 4DKJA 4LFBB 4YPFA 5EZ5A 4C7BA 4CM5A 4FGWA 3KHUA 2GNOA 5HKKA 1L4NA 3SICE 1E2HA 1C2YA 1PDVA 3GLHA 3QKRB 5HJ7A 5C52B 1IBKB 1A4RA 3M4XA 4QJBA 3RAGA 2Q8PA 1QYXA 2C8LA 5H3LA 3KXPA 3MT9A 2B7LA 3BOSA 5JVDF 2Q3FA 4GVPA 1SD1A 2JVIA 1VHDA 3KKZA 2HV8A 4IG4A 4HXEB 4KP7A 3IIIA 5E3IA 3QITA 3T1TA 3TL6A 1RYYA 1XAJA 2QNBA 2XEDA 3ROGA 5KYVA 3X1MA 2QN8A 3K0SA 3FWNA 4R1TA 3DLCA 4BNIA 4RC9A 4IHQA 1HLFA 3NI2A 1FUEA 3AKZA 4WK2B 2QRLA 4QATA 3R7NA 5FUXA 1GRNA 1U9YA 4BNTA 5JV5A 1IDN1 4IVRA 3JVVA 2BH9A 4PYQA 1GY8A 4DCVA 2ZR9A 1SXPA 3EIEA 4XXHA 2J3LA 3Q8XB 3NVMB 4EITA 4UMDA 1SZPA 3T34A 5BN5A 2YFHA 5BO5A 4DCJA 2DR2A 3V4FA 2FW8A 1VPDA 2OBMA 1H0SA 3EG9A 4HH3C 4HEJA 2GJ4A 4FDAA 1KJJA 4TTIA 4LEIA 2QUAA 1UMDA 1ZPDA 1BXGA 1T1GA 4F7WA 1BEZA 1N6RA 4QUEA 3L8CA 2VZLA 4N39A 3N39C 3LD9A 3WAGA 1XTZA 3MBOA 4J6EA 3UB3A 3FG9A 2OLJA 3CRZA 2DFPA 2QR5A 3EXHB 3M5WA 3UMGA 4M76B 5JNUA 2PUJA 3H1PA 3VKHA 2INGX 4GF5A 4KVZA 4O4HF 1KFJB 1K7XB 2QMYA 4P4LA 2ZI6A 4YDRA 4D0NA 4OXNA 2HEGA 5FBHA 1F4LA 1E59A 1VPTA 4UAJA 2Q6VA 3ROPA 1TCVA 3QBTA 1UQTA 3EQZA 4XD7D 3ZBPA 4AT1A 2BFCB 1A1VA 4TKMA 3ETEA 2QY9A 4PNHA 3KNZA 4O4HA 4CEJB 2ZJ6A 3ABZA 1SK8A 3HACA 3QWHA 5F12A 2QN3A 2QD3A 4YCLA 5ICGA 3IUEA 3JYHA 3CX7A 1E1YA 3VYWA 1PV4A 3ZLVA 2DLDA 1Q12A 2Y1XA 3QVLA 1KJ8A 4YO8A 2W5UA 3BGOS 4XGIA 4QD3A 4OP2A 3K0FB 2G5PA 4LRWA 1N5RA 2J3HA 2XUIA 5LYJF 1DAEA 1IHYA 1T5BA 2FGKA 4JL6A 1NAIA 3PXDA 3QHPA 1J49A 3REOA 4ME6A 3UG7A 4CKBA 4BXOB 1NUUA 2PBFA 2Y92A 3QOWA 3D0OA 1WZ2A 2GA8A 4L50A 4F93B 1EWTA 2W42A 1MIOB 4JY7A 3OWHA 3FYSA 4JSYA 3SAJA 1YZVA 3VKFA 4FCVA 1R10A 4X3PA 4E22A 3TGPA 4ZHQB 1VIVA 1O0SA 4GI2A 2C8KA 1U0HC 2GESA 2ISSD 1LZLA 5EYPA 5IAEA 3WDSA 2ZJ1A 4J3FA 2J08A 3MCTA 3RUIA 1U7TA 2NU9A 5EUCA 2C2ZA 3PEYA 1ZH8A 3CX3A 3PJGA 2GK6A 4G1CA 4DC0A 1GEEA 1XAGA 4YDSA 1A4IA 3OT5A 5I47A 4RQTA 4WE3A 3F2IA 1IWOA 1LQUA 3LUDA 3KWFA 1J0DA 3OHMA 3CIFA 1KI4A 2I6XA 1FP1D 3V4PB 3FWZA 3NM6B 1IY1A 1U1DA 3DYIA 4NMHA 2QZSA 5ECWA 1EWYA 5HIKA 5LVAA 3OAAA 4LWOA 3KQTA 4J29A 4LI3X 2CV2A 1BMDA 2A0WA 2HIGA 1JE1A 2B9VA 1P1IA 4QOGA 4TYWA 1SRQA 3WK6A 3M82A 4G9BA 3WYBA 1TYZA 4MYUA 3ZVNA 4JYBA 1ZINA 1TQHA 2HQOA 5BT8A 3GROA 4QPJC 4HPWA 1ECLA 3KDSE 3FJOA 1ODSA 1WMBA 1O95C 1QB7A 3QW4B 2R6DA 1T4CA 2XUGA 4QOEA 5ER9A 4W4TA 3Q3VA 4ZEXA 2QN1A 1R4NA 2TECE 3UGJA 1LLDA 2G0TA 3IA7A 3KR0A 4HB2A 3RU7A 3R74A 2AOXA 3U31A 3U80A 1M8KA 4LNUA 4N7BA 2YL2A 4F60A 1VRVA 4DG5A 3G6WA 2H1IA 5D6OA 3WLEA 5I7AA 3BHNA 4J0QA 3T3PB 1EJ2A 3VNVA 3MCWA 3TDNA 1N78A 1N3LA 3DM9B 3DSRA 1JZSA 1DAGA 1WMAA 1HFWA 4EVIA 1ZJJA 1RU3A 3I9V1 1NV9A 3ZV3A 5FOSA 4F4UA 3IAAA 4Q3EA 4RPCA 1M8PA 3RS8A 2VXYA 2ZIUB 4OU5A 4YRAA 1GM5A 1M5UA 3IVRA 2O57A 3TTTA 5EYPB 2NO7A 5JDCC 1XRLA 4NH0A 5EVCA 4C5BA 3COPA 2E1PA 2G7MC 2QGNA 3FPKA 3OZRA 4W1RA 5T4HA 3RAPR 4BMXA 2GDZA 3R2JA 1JU4A 3JQBA 5JNVA 1SVMA 2LTAA 1BHQ1 2ZUTA 3NLLA 2X0RA 2AUNA 4HDMB 4KWTA 1HYQA 1G66A 2DX7A 3VKUA 5WRFA 1W75A 3TD2A 2XUHA 4BVLA 2B69A 1G63A 1S3FA 1OIWA 1P7ZA 1E18A 2HSEA 5CGZA 4BMCA 2FSPA 1JU3A 4JQYA 4KPYA 1SURA 4BN4A 3JWIA 1Y1KE 3CWCA 3GLHE 2W9XA 3EY4A 1VPVA 3I73A 3Q0EA 4FOSA 3FWPA 4YVFA 1S2OA 2X9LA 3WADA 1IZ8A 1F38A 5KYNA 1DXYA 1UKCA 2AXNA 4RJ2A 4J2TA 2PRZA 1XNQB 3L43A 1OPRA 2OV8A 1Q84A 4KXNA 2A14A 2PX6A 1H4VB 4PPYA 1UPCA 4P3XA 3VR5H 1GNQA 3NHPA 4RZQA 2G9QA 5DYYA 4F0JA 5I9NA 1F2TB 4ZTZB 1D1QA 1GKIA 3KYDA 4TLDA 4DEXA 4EVRA 1XZBA 3U1BA 2IY8A 1IOLA 3LWBA 3QVKA 1PVVA 4MGEA 4RTNA 2W4IA 5ALEA 4M36A 1TTPB 3UQYS 3T5AA 1OXKB 1LLCA 2VBFA 1FVFA 1XX6A 4P3YA 5A06A 1PNQA 2UZ1B 1I4EB 3H04A 2GN1A 3H8JA 2R9VA 3KKNA 3RT1A 5AW2A 3R7SA 5JDIA 2PRIA 3OFSA 3WLOA 3F97A 3LYUA 3WO1A 1ZCFA 2OENG 5A4IS 3SQMA 1QM5A 4GSYA 3OLCX 4BFVA 3DWFA 2D1RA 3GJ6A 3HCRA 4J4TA 2IOFK 1I2BA 5LQMA 1XEAA 3PTZA 5HILA 4PN7A 3P71T 3LQFA 4L0QA 1HORA 4ZFNA 5ITWA 2MSWA 2NVBA 2OCBA 4LDAA 4E88A 3RSOA 1U9IA 4KLAA 2F90A 4MV8A 3USCS 3TOVA 1RHMA 4TWZA 4A23A 1WVIA 1DO2A 2C54A 3QE3A 3GCDA 3EBOA 5E4JA 3HJAA 3FFBA 4TLBA 3OIVA 5DTQA 1KDPA 2AG6A 1L4EA 1I7NA 1IBMB 1MKYA 2QG9A 3GCXA 2JCGA 3HUUA 3QU2A 5BN3A 3LC7O 4HCJA 3LYLA 3BA6A 4LYEA 3KPVA 3P9NA 3PHJA 3TYXA 1T91A 5EP2A 1H4TA 3WWEA 4ONEA 3HADA 2X1VA 4R8MA 1G5QA 1XMPA 5T8KC 3IAM6 3MJFA