3T1OA

Mgla bound to gdp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
192
Chain Sequence
STINFANREINFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIGEVKGFKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein mglA
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 60
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t1oA00
3BIFA 1ESNA 4C2UA 3X2SA 2RGGA 1NMXA 2OZEA 1UKVY 2SHKA 4RSGA 4CEHA 5KOYA 4G0NA 4IEEA 3RLFA 1J2JA 5FOVA 4L8GA 1T3LA 2VLIA 1XBTA 3OAAD 4FWIB 4JZKA 1ZUNB 1JQLB 3I1FA 4EJSB 4IFBA 1GOTA 1W46A 2JJ2D 2NTYC 2ZJBA 4L16A 3ZIAD 1Z8FA 1MV5A 3LX5A 1MABA 3DZ8A 1E0JA 4JL5A 2ZYUX 4PQYA 3K9NA 2A5JA 5G53C 1OB5A 4D81A 2JDID 3E5HA 1U9IC 1FOEB 2NQ2C 4Q4HB 2AHOA 5GJVC 4JBYA 2IS2A 2O8EA 1YZNA 3GCGA 3MSXA 4LJ5A 3CF2A 4E03A 2JAQA 1IN6A 1CU1A 3LY5A 3EZ6A 1EFUA 4XH9B 1Q20A 2ZRJA 2IYYA 2A5FA 4IEIA 4LV6A 5EQTA 3SI7A 2C78A 3UMFA 2ZRHA 3VX4A 4B3FX 3SYKA 4OI4A 2A3RA 3FOZA 3P4XA 3WRXC 3VU9A 3OE7A 5LB2A 1ZAKA 3AVWA 4DT1A 2CVHA 1X8LA 4XOIA 2GDJA 3U4QB 1IHUA 2IYVA 1M7HA 5DI3B 4QOSA 4DCSA 5KSOA 1CRQA 1CXZA 3EIHA 2ONKA 1NLYA 1NY5A 2WWWA 4K46A 4U02A 4HEJA 5FBVB 1WXQA 2FSGA 1G7SA 1NSTA 1NI3A 2W2XA 3L2OB 3QNUA 1SHKA 2Z4RA 4ZO4A 4Z51A 4ZDWA 2RGBA 3OEED 3CZQA 4PPNA 1N5JA 2QPOA 3U7FB 2ZAMA 3HU3A 4O0MA 1R6BX 3AKEA 3FTQA 1K5DA 1E2EA 1G21E 3ICQB 3LO5A 2RGXA 5DGXA 3WP1B 3TW8B 2JJ1A 1S4QA 4PO9A 2QAGB 3K0AB 3EZ7A 3FHOA 2REOA 4ITRC 4M9QA 2A7QA 1XTIA 2VBCA 4OJKA 4UNRA 1CBUA 1Q57A 2B92A 2GCOA 2IL1A 2WJVA 3PVSA 1Z47A 1UKYA 2Z0MA 5AJZA 1ZUHA 2YZ2A 1XXHA 1XTJA 3O8CA 5C4GB 2PZFA 3WXMA 1W36B 4X8MA 1TQ6A 1VIAA 2BVNA 2J59A 3WP0A 2IUUA 1D6JA 2HLDD 3ZVRA 5DYGA 1YZQA 4W7SA 1N6LA 1B23P 3L8ZA 4PANA 1RPZA 2OBNA 2V8OA 1NN1A 1KMHB 3NC1C 3I62A 3CF6R 2WSSA 1N0UA 3R20A 2W2VA 4JS0A 2P2LA 3RYTC 2Z83A 5FUWA 5LDDC 3CRQA 2A9KA 2GILA 3C15C 4GFDA 4KXFB 3W3ZB 3GLIA 1MR3F 2ZVQX 3KKPA 5AUOB 3SBDA 3AKDA 3NH9A 2IS4A 1VTKA 1QG2A 2WOOA 3PUYA 4PTLA 4F7WA 1R8SA 1RC8A 5JRZA 1ZU4A 5J5CA 2IF0A 1ONBA 2XJ4A 4TMZA 1LFDB 2HF8A 4TLBA 4R71A 5TXGA 2RGDA 1ODFA 4FCTA 1JR6A 4CZ2A 4TMTA 3H0KA 4JVLA 3ZD6A 4XSGA 5L3QB 4KFUA 3SJCA 4AIIA 3EA0A 1ZINA 2NO1A 2MMCA 1CR0A 1EG7A 2ZRNA 4Q1EA 1KI8A 3F0TA 2F9LA 2QPAA 3C8UA 3MRSA 5FPSA 1E0KA 1E69A 2NOAA 1F48A 5CIWA 3WYFA 1XPUA 3FFBA 3R9XA 4C0JA 2R8RA 3IKJA 4JJZA 4M1KA 4QG7A 3TNFA 2WWXA 5DSZA 2VP9A 1G8YA 3EC1A 4HB2A 3FMFA 4JLMA 4A0GA 3RSLA 4W5HA 4C0SA 3P1JA 5GADl 4R2HA 4D26A 5DN6A 2IUTA 2P5TB 1JXOA 3EWAA 3KQUA 1KI7A 1KO8A 4RD3A 4GOKA 3WNCA 3VR3A 3L8YA 1H8EA 2IWHA 4Z1MD 1XD2A 1OHHA 2W58A 1Q1EA 2ECKA 4JYBA 1SVSA 3EWSA 3B1ZA 3TVTA 3NC0C 1KDPA 2QEQA 1YE8A 5D3QA 4EPRA 3PEVA 1PUIA 3BH6A 4DXAA 3TMKA 1I4TD 2IS6A 3VR2A 3CNOA 1E1QA 4BEBA 4QXAA 3H2YA 3NEYA 1YR7A 1IN7A 4Q7MB 3U3RA 1LV7A 4DCUA 1G3RA 1W48A 1XTSA 1TF2A 2V6JA 2VQSA 3MJHA 3N5CA 2P0EA 4KYUA 4RFSA 1KSFX 3NEJA 4UXJA 4LWZA 3WMFA 1A4RA 2VP5A 2XSZA 5TB5A 3K70D 3IEUA 5EP2A 1M8PA 3BJIC 3D3QA 1H8HD 2RH5A 5LBIA 3A36A 4EAQA 1HA3A 1U8AA 3GLHB 4ZCMA 2ZR9A 1UBGA 1G4AE 4CIDA 2BDTA 4LV8B 3CX8A 4M1MA 2EFDB 1CJMA 4GNKA 4I81A 5HZKA 3KJGA 4NHOA 4IFEA 4ZI2A 1NSFA 4DEYA 1E9FA 3CB4A 3ECCA 1OXTA 2CMKA 3PFIA 1QHNA 5FTLA 4AKHA 2GESA 1GKYA 1XFAA 1GFIA 3ICEA 3QI2A 2ZVPX 1MO6A 4AYXA 2J0QA 1DAEA 3UMRA 2ERYA 5FBWB 1D9XA 4BLPA 4CYMA 1EESA 1II8A 1EGAA 4PC6A 4B3BA 2QA5A 3RWMB 2REXB 3OEHD 1AIPA 2QSYA 3B1VA 2FFAA 5H68A 2QZ4A 3O8DA 1KO5A 1VG1A 2WIBA 3U7EB 1E4VA 1D2MA 5KDLA 1U0JA 1PLJA 2BHRA 4BWYA 4NCNA 4A8JB 4BEJA 1BMFD 3CX7A 1D9ZA 4IXMA 4M2LA 4NYMR 4JVNA 5DHFA 5AUPB 2EU8A 1GAJA 2B7CA 4KVAA 1E79A 3EXAA 3K0CA 2AL7A 5FL7D 3Q85A 1KJYA 1NBMA 2WAYA 1TEVA 3QY0A 3BFXA 3NBXX 2J0UA 4FIDA 2JLQA 4EPYA 2ZJOA 3TGPA 4LK2A 1SGWA 3PXGA 4A15A 4PZLA 3D8BA 3W6NA 2G6BA 4FN5A 1C1YA 1KI1A 1VCMA 1WB9A 4UKDA 4MYCA 1WDTA 3ZQ6A 1N5KA 1Z0DA 5H8WA 2NO6A 4DSNA 3DEFA 4C0BA 1IONA 1P72A 1G291 1R10A 3HYRA 4NKRA 1YRAA 2EFHB 1AZSC 4V03A 3NBFA 4DCVA 2N42A 3WMGA 5EXPA 5HR5A 1SVLA 2IYWA 3RRMA 2O8CB 1G41A 5G3ZA 2Q9AA 2V3CC 1CULC 4M0LA 5F9FA 1DAMA 1C9KA 3AV0B 5BN5A 2GTPA 1MO3A 5B58C 1Q3TA 1ZM7A 2O8FB 3KXIA 4GMXA 5DE3A 1YKSA 5JJLA 3AVQA 1XU4A 2WWFA 5E95A 4LHWA 2OCBA 1G17A 2PT5A 4OBEA 3CLVA 4UJ3A 3B78A 2CHGA 4V02A 3GLHE 1OH8A 1Z6YA 2A5YB 2IA5A 3QENA 2N46A 4F92B 2AN9A 1Q1QA 2GXAA 2CJWA 3L0IB 2CL7X 1KTVA 4F38A 3EW9A 4OQNA 2OLKA 2PMKA 1IJEA 4TL9A 5CK4A 2WWYA 2ZI7A 1UF9A 1E2FA 2ZSEA 1RJ9A 2CDNA 1BO6A 3U2QA 4GP7A 5SZIA 2BBOA 4XWAA 3EAQA 3ONWA 3QOFA 1W47A 2AR7A 3FGNA 3GJXC 4YLGA 3QE0A 3ZS8A 1KO7A 2VP4A 1TTTA 3U60B 3RS4A 2G0NA 1EX6A 3AF1A 1KDRA 1TADA 3THYA 3HYTA 5L3SB 1VCOA 3TSWA 1M74A 3K09C 2FFBA 3Q8XB 3AQ4A 1ETUA 3E2IA 1OXVA 1ZD9A 1HE8B 2W00A 3KL4A 4H9GA 5DYIA 3TQCA 1SXJC 2OHFA 4DDVA 1JB1A 2DWOA 3BFKA 1XMIA 2FZ4A 4MGZR 4DSTA 2FFQA 2FJUA 3A37A 4F91B 4FMCF 4PHTA 4QBFA 4LJAA 3EZFA 2JIZA 5E4FA 3ZVLA 1N6PA 3EPHA 5CITA 4C0AC 4AURA 3FKSA 4O25A 1ZM3A 5DO9A 1KY3A 4GZMA 4G5OA 2BM0A 1W0JA 2V9PA 1JQJC 4RFVA 2XNDA 4LI0A 1T4GA 2XEXA 5JI2E 3ZVMA 3THXA 4DHEA 2JJ8A 4HUQB 2IEYA 4DDUA 2I3BA 1U2RA 1T0HB 3IO3A 4NDZA 2W0MA 1X3SA 3QG5A 2ANCA 4M21A 3QIAA 1P2UA 4QNRA 3A4NA 4DT1B 4U5XA 1MO5A 3QKSA 1U8ZA 2CHVA 1FNNA 4TYNA 5DISB 1D2EA 2GF0A 4CF7A 2BKEA 2IBMA 3LAWA 3NHAA 4US2R 1DG3A 1F2TB 2QP4A 3AP2A 3LVQE 2DHRA 1DE0A 3SJAA 1W4CA 3QXXA 5BW8A 1GRNA 2IYUA 4TZ0A 4X8LA 5KTYA 2O8DB 1RIFA 4BLRA 3UPUA 4M9ZA 3HWSA 4JLJA 3VR5A 2G1JA 2G0TA 2OLJA 5JBQA 3FKQA 2JLSA 2JLXA 2QSZA 4PQFA 3MWKA 4TSFD 4UJ5A 3U3JA 1BS1A 1DAFA 3IDQA 3QF4A 1W36D 4URUR 2MMGA 4Q7KA 2E9SA 3I73A 2QMHA 5TY0A 1OH7A 1ZMXA 2J3EA 2ODNA 4ARZB 4DDWA 3TLXA 4JKYA 3G82C 3UMSA 3C4JA 4A9AA 4DLSA 2GCOB 5TARA 3IUYA 4LHYA 1XXHB 1GITA 4Q9LA 5JZVA 1E9AA 3PUXA 2QE7A 4OJQA 5KDOA 1XJCA 2XTZA 3ND9A 2VA8A 1N6NA 4IKEA 2WKPA 3VHXA 3FFAA 5HE9A 4HLQB 4KBFA 2IYSA 4GT1A 1BKDR 4YONB 3TAHA 1NY6A 3TK1A 1R5OA 1W4AA 5DI9A 3GEIA 2NPIA 2JASA 2X1VA 2WZQA 3BOSA 4B3GA 3GLIB 4ZDIA 4P4UA 3L0OA 1HH4A 3BH7A 3MWYW 1L7VC 1CLUA 2V7QD 2XTNA 1XZQA 4M1YA 2GRJA 1XTRA 3Q3JB 3QPVA 5EXTA 4EPXA 3QKUA 4EPWA 2OFOA 2VHTA 4O2RA 2ZSFA 5C46F 4TTPA 5JHHB 2QBYB 2WPDA 4FXPA 1AQUA 1Z0AA 2HXSA 1G1MA 4ACAA 1W49A 1GUAA 2DPXA 2DFTA 3AGQA 1E96A 3LXXA 1UKZA 3GLFB 2FG5A 1DAKA 5EP1A 3GMTA 1E98A 1E2QA 1UDXA 2QNRA 2DFNA 2ZSAA 2HCJB 4JLVA 5GVSA 4Q48A 2OBMA 4TL8A 1JBKA 3DKPA 4BQSA 2YVUA 4TMKA 4V0LA 5L8VA 4FMDF 3MGCA 2QP3A 4TQUS 4BLOA 1LF0A 2XB4A 2CLDX 2IXFA 4ILEA 4EFNA 2F55A 1SXJA 2HT6A 4PZZA 3BB4A 5JJIA 4IDQA 5G41A 3VNUA 1R7RA 2ZUCA 2DBYA 1Z0FA 3OIWA 2CNWA 4LDJA 3SFVA 1E4YA 5CYOA 3ETLA 2WJHA 2P65A 2JLRA 1Q44A 4F4CA 4OHZA 3R8CA 3SJZA 1UFQA 5UKDA 3CW2A 4IVPA 2LCFA 3KFXA 4EPTA 2H7VA 2REBA 3KQLA 2F1IA 3N70A 2FPMA 1J8MF 1E2IA 3B1WA 4JT2A 4Z8YA 1N6KA 2QMEA 4II7A 4U7DA 3SYLA 3SDZA 5IT5A 1G3QA 2VHJA 2WICA 4RY2A 2JLUA 1W7AA 4AYTA 1Z22A 4P4TA 2A30A 1IJFA 2GXUA 1EFRD 2FFHA 4GRAA 2P6UA 2YYZA 1KNXA 3KB2A 4RVCA 4ZKEA 4ASUD 3CUEF 1XXHE 3ZYCA 2YINC 4PPQA 4EUNA 3PEYA 4IHQA 3DL0A 2O8BA 1FFHA 1T9HA 3B85A 4C7OA 2BMFA 1P9RA 3K53A 4NBSA 5D3MA 3UIEA 1VCIA 3W8NA 2D7CA 4CRWB 3IPYA 2V4ZA 4DBLC 2PX3A 2BC9A 4PZYA 5G3YA 3NTUA 2EWWA 1HE1C 5CM9C 3X1XA 4DCNA 4TTRA 4LC0A 4Q66C 1ZM9A 2NZJA 3OFND 4Q03A 1UAAA 3EZ9A 1MO4A 2B21A 1OIWA 4MGYR 3ZGXA 2CEAA 3GLIE 2KI5A 2VEDA 2QN6A 4BPBA 1XP8A 1Z63A 1D5CA 4LYHA 3WYGA 1OH5A 1NJGA 2JLWA 3QJYA 1TMKA 4OQFA 4YMUA 3THWB 1NG1A 4MGIR 3UWKA 1FZQA 5EE0A 1CIPA 3GJ8A 1QHYA 1U90A 2HCBA 2F1JA 3CPHA 1II0A 1E2NA 3I8XA 1T5LA 2GWHA 2WWHA 4JJKA 5JJKA 4RZXA 4P31A 1YJ5A 3GLFE 5ELXA 2UKDA 3OAAA 3FMPB 1CJTC 1G5PA 3B7GA 2VO1A 1NIPA 2IC5A 2C96A 2GJAA 4IDNA 2XTMA 1JAHA 1AQYA 3DPUA 4YMTA 4DIEA 3A4LA 1AN0A 1E2LA 4ZV4A 2F7SA 1LW7A 1JJ7A 3U44A 2GBLC 1XEXB 4KFTA 1FX0B 2VH5R 1AS3A 2X19A 3WYAA 2OO7A 1E9DA 1JEEA 5DH9A 5JWRA 2H16A 4KBGA 2X2FA 1V43A 4HZUA 1KMQA 3N2EA 4IOKA 1FMJA 4JBWA 5AUQA 1FP6A 1NVXQ 4Q4JA 4MA4A 2AWNA 1E2MA 1HYQA 2QY9A 4IJMA 2G1KA 3CRVA 2ORWA 1S9HA 3HDTA 2CCGA 2FOLA 4HAWA 5F98A 1Z0IA 1SQ5A 2RKOA 1W4RA 4G1UC 3DM5A 4DKXA 1NVVQ 1WBDA 4RCZA 4F93B 4PQRA 1N5LA 1XNJA 1D8TA 2L0XA 5EP4A 3VKWA 4A82A 5J4VA 3UATA 1OH6A 5FH9A 5BYKA 2AD1A 2IK8A 2AWOA 1G4UR 2W0SA 2J46A 3IO5A 5AJYA 3CZPA 3QKRA 3MWLA 1VHLA 5AK0A 1M2OB 1I4DD 3VR1A 3KXLA 2PZGA 1U0LA 1RFLA 1ZNXA 2ANBA 2VYFA 1WRBA 2C95A 2OAP1 3AVXA 2ZJ5A 1OIVA 3TVDA 3RSOA 3OEEA 1NLZA 1G8FA 2WAXA 5EE5B 4JMPA 3B1XA 1HTWA 1A2BA 1LS1A 1RRPA 1XDBA 3HP1A 5BYJA 2AK2A 1XEWX 3ND8A 3D31A 3VHLB 1SKYB 1P61B 2ZPTX 4CEJB 3TJZA 4Q9IA 3FMOB 2V55B 3M1IA 4OHVA 1KKMA 3HR8A 5BQ5A 3A1VA 3LBIA 1RJ9B 5CDFE 1CF4A 4I1SA 3BB1A 3S1AB 1G6OA 2W6JA 2ZXUA 2CHQA 4A2PA 1E3MA 5J47A 2UZIR 4PPGA 4KFSA 4I4LA 2HJGA 3EPLA 3CNLA 2PCLA 2CE7A 4BLQA 3T1VA 4DLZA 2ZSDA 3CONA 5FBRB 2I1VB 4MKIA 4B71A 1XD8A 2KE5A 2QT0A 3QQ5A 4Z54A 1SVWA 5FFMA 4ZI3A 5B57C 2JLYA 4RZ3A 5CB6A 4URVR 5BN3A 3KTAB 1QBKC 2ZJAA 3P32A 3QXJA 2WJJA 4UNPA 1KZGB 1QHHB 4PAQA 1S96A 4IXNA 4XSHA 5H70A 3MD0A 3QPUA 1SULA 1WCV1 3SBEA 4BGDA 2VSXA 4V0ME 3T5DA 4A4DA 3EARA 1ZJ6A 3KZ1E 1BOFA 1PUJA 1NBME 3KJHA 3NH6A 2NZ8A 4WOPA 3M6AA 2FNAA 2VP0A 2RHDA 1COWD 1VG0B 5JEEA 1ESMA 5DIFA 3PUVA 2RHMA 4WZAE 4XTRA 5B64A 4P3YA 3EPJA 2Q6TA 1UDWA 4Z8XA 3DHWC 2GEUA 3WBJA 1RVDA 4LX0A 4DUGD 2ZEJA 1X1RA 3IIKA 1P2VA 1Y3AA 3MFYA 3BBPA 4BECA 1YR9A 4WXRA 1FUUA 4P4SB 4NYJR 1A2KC 1YU9A 4MKHA 1XZPA 3R8FA 4QC2A 3K0CC 3TUJC 1RRCA 4DLYA 4TMWA 5EZ5A 2EFCB 4Q4LA 4DRZA 2C77A 1VKJA 5TDHA 2OCYC 4PR0A 4B2LA 2DY1A 2GBLA 2XOKA 3VQTA 2XITA 4JBXA 4FD2A 2BJVA 2CK3A 2Z6VA 1OFTA 4LY6A 2Q3FA 4PFSA 1P62B 1Q21A 4B73A 1E32A 4HLCA 2KB0A 3PV0A 4X8HA 1VCNA 1XWIA 2ERXA 3OIYA 1DADA 1FTNA 1JNYA 2A5GA 3FYHA 2ZRGA 2FPLA 5AJVB 3AF0A 1SKYE 2GKSA 1Q0UA 3QVVA 4IDPA 4RKEA 1XMJA 3L82B 1KO4A 4Q9HA 3Q7QA 4EJSC 1J70A 4DLXA 4PC7A 3CNNA 4LHXA 4PC2A 4TWZA 2HT1A 4FINA 2LKDA 2QMOA 4NU0A 4B48A 2F1RA 2B8WA 4KJZA 2X77A 5KUTA 1JR3E 1KNQA 2C5LA 1T5IA 3LBNA 3B2EA 4GSYA 3CWQA 4JLNA 4MRNA 1MRNA 4R98A 5A0FA 4B47A 2ZAOA 2F43A 2PJZA 3IQWA 4Q18A 2FPKA 2GK7A 2J7PD 5A4JA 1U94A 4G5QA 4M9SA 1H8HA 2ZU6A 3EIEA 5FTJA 1U0HC 3VR6A 3B9QA 5FR2A 4TLAA 5JSZA 1VPLA 4Q4AB 2R9VA 1TX4B 1T8UA 1ZC4A 1XX6A 3LLMA 4A0FA 2AKYA 5FOXA 4RD0A 1LF5A 4A92A 4KITB 3KX2A 3A58B 4QHSA 1US8A 2OXRA 3IIMA 1WQ1R 3N2IA 1TQ2A 3E1SA 3EX7C 1Z08A 2GNOA 1SZPA 1SVOA 3RNLA 1AK2A 4XIGS 1GKIA 3AVPA 2BMDA 4IDHA 3KQHA 3SOPA 3QKTA 3PCRB 3X1DA 3A1UA 3FE2A 1OKKD 2C2HA 1MH1A 1NKSA 2H1LA 4RD4A 1LVGA 4TMVA 3U3OA 2C04A 1CKEA 1G3MA 3C16C 4PPFA 4RCYA 1OB2A 4Q1BA 1VYTA 3OEHA 4PHHA 2TMKA 1E2HA 4M8NE 4CEIA 2XXAA 4WVFA 1H8ED 1XMVA 2BBTA 2J41A 2Z43A 1OHHD 1E0AA 4GZLA 1OE0A 3LQQA 4PAMA 3U3KA 2FWRA 3LVRE 4HSEA 5KNBA 4D0GA 3K0FB 3B9PA 1JPNA 1CR1A 3D7MA 5L3VA 2IYLD 4OI1A 4C0HA 2AFIE 4WZBE 3BD9A 4GOJA 1Z6XA 3BXZA 4O2LA 5HKKD 3AVUA 3SNHA 4YMSA 4QBGB 4URZR 4M9XA 2FEMA 2ZRPA 4G5SA 1GVNB 5FL7A 1CEEA 4Q5IA 4TLCA 5JS7A 1DAGA 1DAIA 2YWEA 1ZUIA 2FE4A 2ATXA 4C9BA 5IK2D 4Q1DA 2Q0HA 1OIXA 1AZTA 5E7IA 2VF8A 2XSZD 2OSBA 1T6NA 3L43A 2G88A 3CO5A 4DEXA 1E9EA 1E1RD 2QG6A 3V00A 3DVLA 5SZKB 5SZJA 2Q9CA 1AKEA 1M6NA 1XB2A 3GLGA 2WV9A 2ZYTX 2ZJYA 3HU2A 4ZIRB 4CVNA 3Q5DA 1PVOA 4C7OB 1L4YA 5J40A 2H92A 2WKRA 5FOSA 4NYIR 4PSVA 4WBSA 3P4YA 4OI2A 4OYHA 1P2SA 5HPYB 5JWOA 1IY1A 2XJ9A 1NJFA 1JPJA 1F2UB 2H8KA 4NTZA 4R2IA 4MKGA 3U3MA 3AH8A 1CS4C 4BFXA 5KSZA 2OG2A 1QHSA 3PITA 4KODA 4NCKA 4XTCS 1IM2A 1KDTA 3T1OA 1WF3A 2ZS9A 1UEJA 1ZIPA 5FI1B 3RANA 1T3HA 1T8TA 2YKGA 4EJSA 5EJEA 3DO6A 3PJRA 4GL2A 2ZRBA 5FL3A 3AF4A 5AWFC 4JLKA 4LHVA 1G3UA 2GEDA 3VKGA 4LBZA 3RRNA 4I99A 3K9GA 3R7WA 1CR2A 2IS1A 1LNZA 2ZIAA 4AG5A 1N6IA 4D82A 3R9IA 121PA 4JLAA 1EK0A 1G8PA 1YQTA 3NIBA 5F9HA 1KK2A 1NBMD 2OILA 4L9SA 1CJUC 2ZR7A 2GF9A 3CH5A 1K6MA 1TU4A 2ZRFA 4JL6A 1I2DA 3W90A 4DZZA 4EQ6B 1N5IA 2CXXA 3GJ4A 4PO8A 1TU3A 2OV2A 4WXPA 1PZNA 1S3GA 1VG9B 4OQLA 3RVBA 2XB2A 3F8TA 1CJKC 1N6RA 1Z6AA 4QJ4A 2A78A 2VTKA 4QJ3A 2J7KA 2GAOA 4QGGA 1S9DA 4NCIA 4HDQB 1AKYA 4CEHB 3FB4A 3DOFA 3TKLA 3NWJA 2QU8A 3DDCA 4B3XA 2P3SA 2ZJ2A 3UXMA 1G64A 3C41J 2YHSA 2P67A 4NZYA 2K5UA 4B74A 3U4QA 1Z83A 1S1CA 1GL9B 2QMUA 2C98A 3KDSE 5DI3A 1MABB 3TSZA 3BB3A 1OFIA 1XCGB 2R6AA 4QGFA 2WTUA 1W5TA 3ASZA 3RDPA 3WNBA 1EFHA 1I4LD 2J1LA 3KKQA 2VHCA 4DB4A 2O8EB 5BWMA 4Q00A 1O87A 3TQFA 2ZRKA 3GFPA 1JJVA 2OBLA 2GVZC 1ZRHA 3M4YA 2JCSA 5IHPA 1IN4A 4NE2A 3BH0A 2DR3A 5FTKA 1OLOA 3EC2A 4C0KA 4AK9A 1G18A 4MRPA 1S0UA 2ZM5A 3LD9A 4JL8A 2GVDC 2QAGA 4KVGA 4S35A 4A36A 3K0AA 1TL7C 4TYPA 4ZCLA 4BUJA 1R0YA 4XVQA 2AXPA 3MJRA 2XNSA 4US0R 4IVQA 4OQMA 1PJRA 3VU9B 1JR3D 4D4MA 4TSFA 1DOAA 4PXAA 1P3JA 3AVVA 4AY2A 3GEEA 2D4HA 3U61B 2NPFA 1CRPA 1TNDA 4KV9A 5CK5A 3K0SA 2MSCB 4Y0VA 3J81k 5FPTA 4CDGA 4Q02A 4MGKR 3FVQA 4JLOA 3QBTA 1OXSC 4IVRA 3T06B 3QSYA 2ZR0A 1Z6GA 4KU4A 2NO9A 1OFHA 3G0HA 3BK7A 1KMHA 1KO1A 2KWIA 4W5JA 3SQWA 4HB3A 3JVVA 4A8JC 4DLVA 3AVTA 1AJEA 4LUCA 4F4JA 3CF0A 3KUCA 1YZLA 3C5CA 5LB4A 4G3XA 2WMNB 2V1UA 2BWJA 1IY0A 1AM4D 3JZMA 4BZQA 4BFYA 1GDDA 1NVUQ 2JIZD 4OK3A 1SKQA 4B43A 1KK0A 4XJXA 3OF5A 4Q1CA 3WHKA 4N3NA 3I4LA 3RS0A 4LOAA 5EE1A 3Q5EA 2JLZA 4NONA 1UBFA 4JVMA 3BE4A 1NMZA 1VDZA 2O0KA 4BRWA 5FPHA 3UG6A 2V7QA 4NPHA 3GPLA 3SQXA 3SS8A 4TMXA 2GK6A 4OHXA 4JLPA 1R4AA 2W6ID 1U98A 4W9MC 4LV5B 3AKCA 3QXCA 4D0NA 4QBHA 1P60A 2PH1A 5KDDA 4GDFA 3SEAA 4KO8A 2ZI9A 1EWRA 5LD2C 1KJZA 1GP2A 2WHXA 2WOJA 4QBIA 3FMIA 2R65A 3G5UA 1HQYE 1P75A 3W3AA 2Q21A 4KSCA 5JECA 2EYUA 1XJ0A 3FDIA 2FDCA 1UPTA 1OF1A 1IAQA 1NG9A 4EDHA 1AGPA 2VIIA 3WRYC 3T5GA 2BCJQ 3LXRA 4C0LA 2BCGY 3OHMA 3RC3A 5J4LA 4NH0A 2AXNA 5KSYA 1XCPA 4XD7D 1X8KA 2QENA 4B34A 4UQOA 4V0KA 2GCNA 3KB1A 3K1JA 1X1SA 1KHTA 3IBYA 2QE7D 5HCIA 2QI9C 4C0QC 4M1TA 2CCJA 4PAOA 3UG7A 1K5GA 1VMAA 2O0HA 3WNDA 4AWXA 4YQFA 1G7TA 5JRJA 4Q9KA 4YXWA 3CX6A 4AYWA 1W5SA 4Q47A 2R62A 4D25A 1E9RA 2ZJZA 2J0VA 1RKBA 3GLHA 2QP9X 5J4YA 3A1WA 4M1WA 4YMVA 4ZIRA 4Q1AA 2RMKA 4Q19A 2OT3B 3ADBA 1OFUX 3F3YA 1XD2B 3AVYA 3GJ0A 4OHYA 2F43B 2MSDB 1ZD1A 3T61A 3QUSA 2ONJA 2IHYA 4M1OA 2J5XA 2OESA 4E5UA 4QNMA 2GZAA 2VRWA 1J8YF 4D80A 4KCGA 3KQKA 3PIRA 3HU1A 2ZE8A 1W1WA 2BMEA 1GIAA 3TH5A 2QGZA 3NBZC 1YVDA 4DVGA 3KQNA 1GL7A 2WPDD 4IW3B 2ORVA 1W0KD 1E2GA 1X86B 2OFXA 4B75A 4LPKA 1FL9A 3LV8A 3M0EA 1F6BA 1VG8A 1KKLA 5KHOC 3MLEA 1R0WA 1IBRA 2H57A 4RFSB 4TT3D 3D6TB 2CE2X 2FU5C 4HATA 2D2EA 3WY9A 4KLZA 4DLRA 5CM8B 3IIJA 4NMMA 4E22A 3B82A 5TVKA 3GFTA 4A8JA 3AUXA 2H17A 3L0PA 2PT7A 4LHZA 3E70C 4GBMA 4LJYA 3NBYC 1D2NA 1LY1A 2GHIA 1NN5A 4QL3A 4D0LB 3Q72A 5EUMA 3ADKA 1E94E 5FUYA 1ZD8A 4QM7A 1BYIA 1E2DA 1HEIA 1KI9A 2C8VA 4JSTA 4RJLA 3V4RA 3QBVA 4TYWA 2ATVA 2WBLC 4TTQA 1NL3A 5CB8A 1VECA 1II8B 2HXYA 5HZHA 1HT2E 4XWOA 2GAAA 1J7KA 2AFHE 4DDTA 5FPKA 1G16A 1E2PA 2HDNB 3W34A 2EYQA 3DM9B 3JZAA 2JJ2A 4NYMQ 4QFMA 1ZYUA 4D4KA 3ZIAA 3P27A 1HURA 4KHZA 4LBYA 3SE0A 1NLFA 3BFVA 4NCJA 221PA 5AUNB 2O8FA 3RS2A 3CPJB 4J0QA 3T34A 4BFVA 2YOHA 1AS2A 1IXSB 1F5NA 3TR5A 2DFLA 2F3RA 2ODWA 2W2TA 4LSGA 2JDIA 5JFGA 2P6RA 3ZD7A 4Y0AA 1MRSA 3GLGB 1IQPA 1GNPA 4QJ5A 4URXR 1GKUB 3RABA 5K8TA 2P5SA 2PZEA 2BBSA 2J0UB 4GI7A 2QAJA 1TUIA 1S1MA 2VPPA 2QROA 4LJ4A 2BEJA 2EFEB 4HLUC 2BBWA 4BFWA 1TF5A 1QF9A 4BASA 4H1VA 4B32A 3KXKA 1DTSA 1R5NA 4M4SA 5BN4A 4TL6A 1NF3A 1N0VC 4M53A 2R44A 3OESA 2EW1A 5JMTA 5H1YA 1SVKA 1T3SA 3U7GA 3NXSA 2OAQ1 4Q7LA 2ZQ5A 3MWJA 3CH4B 5G40A 4ZKDA 5L3SA 4RKFA 2AD5A 4YC7A 3AEZA 3B5JA 2RGEA 1M1YE 1Y63A 2VHUA 2GZHA 2ODBA 2E1RA 1TQDA 1IY2A 1M7GA 1ZCBA 4N1AA 4PHGA 3UWOA 2C9OA 1G5RA 3NDPA 4MUBA 3K70C 2FGJA 5FTMA 5J4KA 4RZUA 4ESHA 3R7WB 1U99A 2ZREA 4K81B 2CJWB 1PV4A 2HJVA 4D4JA 4AKGA 2VP6A 2DB3A 1XRJA 2Q9BA 2WSMA 2ZU0C 1IN8A 4K8OA 4MYTA 2ZSBA 2VL7A 2QGNA 2YNMA 1FQKA 2QT1A 3WMEA 2WIAA 3DMDA 4HAUA 1W2HA 2DFKB 1M7BA 1NVWQ 1XPRA 1Z2CA 2YV5A 5CJPA 1ZBDA 3KFVA 2PMDA 1KSHA 4HUQA 3MG9A 1RRFA 3CPEA 2PBRA 4XVRA 1S2MA 2BIFA 2WKQA 3AP1A 1DG1G 3OIVA 1G8HA 4N0EA 3THYB 1COWA 1U8YA 1KIMA 4B6EA 1QRAA 3TR0A 1O3YA 3BS4A 1QVAA 2HLDA 2KSQA 1R0ZA 3GJ7A 2EQBA 2XGJA 1ANKA 3AB3A 3P20A 3RWOA 2J45A 2PLRA 3MUFA 3ZJYA 4FWTA 4R7ZA 1F2TA 1QDEA 1Z5ZA 3IBGA 4DUGA 4LJ9A 5F2EA 5HE8A 2O8DA 3CM0A 4BRUA 3ZZUA 1FUKA 5FPYA 2F9MA 1XCMA 2PEZA 3GLGE 1YRBA 4ESVA 3DOEA 1WA5A 1E9BA 1E0SA 2QPTA 4MRVA 3NDBB 3LA6A 3T1TA 3AVOA 3GQBA 2LWIA 3OE7D 4MQBA 1TQ4A 1DAHA 1ZW6A 721PA 4B2PA 1WBBA 1IXZA 1SVIA 2WJGA 4WW0A 4QM6A 2CCKA 1FMLA 3VAAA 1KOFA 1NN3A 3THXB 2GJ9A 5CLQA 2W6JD 4RD1A 3VR4A 4ARZA 1E9SA 4QRHA 3QVUA 4B33A 2EVWX 3NVAA 3SC3A 1FP7A 4TZ6A 3ASYA 2X8AA 5E3HA 1OSNA 4UXIA 5F3WB 2C9YA 5DNYB 1GWNA 2NMVA 1OYWA 3AUYA 3CRW1 1ZU5A 3QKSB 5JCPA 2YWGA 1AGRA 1OV4A 1ZNWA 1ZVQA 2GEVA 4S2EA 1FNMA 4WA7A 4C30A 3C14C 3AF2A 1R5BA 5JHGB 5KYKA 1ZM2A 1BH2A 1KGDA 1OYYA 3NHBA 1UJ2A 3I3SR 2AKAB 2JJ1D 2OUKA 2FEOA 4ZPXA 3REFA 3TE6A 5FUVA 4OQXA 3OIUA 5GJCA 4DSUA 4WAUA 3X1YA 2ZI6A 4HLDA 4LJ6A 4Z1MA 3W9YA 5IF9A 4LYJA 4A0RA 5C18A 1W44A 3K8YA 2DWQA 3X1ZA 4HLUA 5E7JA 2BOVA 1F60A 2DWPA 2J7PA 2W83A 3QF4B 4BLTA 3IEVA 5DHAA 4KFRA 5FOTA 2IYQA 4TYYA 2B7BA 4QGHA 4XWKA 2ZRAA 4MRSA 3SN6A 4DSOA 1XPOA 4MDFA 1P73A 1G9XA 3U5ZB 1V5WA 2ZUBA 4B35A 2QBYA 1WMSA 1M34E 5C2JB 1GL6A 4PHFA 3EASA 2ORIA 3FPAA 4W5WA 2WSSD 521PA 5KSPA 3GLFA 4NP6A 2IEZA 3ZVNA 4B3CA 1XEWY 2ZE6A 4DC9A 4EFLA 1QHGA 2ZE7A 4C3ZA 4JIMA 2Q3MA 5HTKA 2FX3A 3O47A 2BMJA 1NN0A 1UM8A 1YHNA 4P33A 2BJWA 4MITA 4BFSA 4LYFA 5EZ6B 3RC8A 4LJ8A 4RZ2A 1P9WA 2XOKD 2FN4A 3VFDA 1OKKA 1A82A 2YJTD 2NO7A 4US1R 1U9IA 1EFTA 3KKMA 3GP8A 2RCNA 2CK3D 4MUAA 2VSOA 2IXEA 1BYUA 5JEDA 3KKNA 2I1QA 1PLLA 2FSIA 1G6HA 2Z5FA 4MKFA 4WZ6A 5P21A 3EA5A 5B2ZA 4O3MA 1S3SA 1JECA 3PR1A 4I1UA 3RRYA 2JLVA 3PUWA 4HYYA 1L2TA 1Z3IX 3BGWA 3NKVA 5HKKA 2KBEA 2ZI3A 2V6IA 4PX9A 3RAPR 5JS8A 2OXCA 1P6XA 3CRRA 3I5XA 1JAIA 1A5TA 4JKIA 5DN6D 2XZLA 4HDCA 4BFTA 2BM1A 4UXHA 2QTFA 1E2JA 4AD8A 3A6PC 4ZDKA 4A6XA 2JEOA 2OM2A 4D2IA 1Q22A 1SVMA 4LC1A 2WJYA 3FWYA 2GZDA 2J9RA 5IK2A 2FF7A 4BE7B 3DMNA 4UNSA 3SFZA 4JLBA 1Z6TA 4V0NA 3UKDA 1TPZA 3O8RA 1G5TA 1CR4A 1SXJB 2ZI5A 1II9A 1VHTA 3U6BA 3T1QA 1DS6A 1XEFA 1BMFA 3RRZA 1AS0A 1E1RA 2AX4A 4TL7A 2GCPA 1KI3A 1E99A 4L5BA 1GRRA 2GXSA 1J99A 4TQAA 5KNCA 1E1QD 3AF3A 1JXMA 4TLEA 3VNVA 3IPXA 2QAGC 1RYFA 3SHWA 4GPTA 2FV8A 4LZZA 3TIFA 4QHYA 3WBKA 1E6CA 2XX3A 3TRFA 3K9LA 5K8UA 1XMSA 1BIFA 3SU8A 2VSFA 2CLCX 2EWVA 1QG4A 2RAPA 2B8TA 4JYCA 2BV3A 4LBWA 1H65A 2ZUDA 1W36C 3FHCB 2NG1A 5IDVA 5CDFA 1KAGA 3THWA 3PQCA 1EFCA 2HYIC 2FH5B 2IYXA 2ZS7A 1OXXK 2RB4A 2R6GA 1UEIA 3A4MA 3Q9LA 3TBKA 4POAA 2ZJ8A 3I72A 2FGKA 2ZETA 4LGMA 421PA 5TV2A 1DBSA 1N25A 5SZHB 2R6FA 2O8BB 5FOUA 3GEHA 4ON9A 3VTKA 1KI6A 3BERA 5D3MB 5FTNA 1YZKA 1NMYA 1I2MA 4URWR 4V0OA 3BORA 3DKVA 3FHTA 1G19A 1RRGA 1YZUA 2XZPA 3PEUA 2WVJA 1PLKA 3PEWA 2PLFA 2G77B 2HF9A 1XEXA 1FX0A 3CIOA 5CJ2A 1QHIA 2ZI4A 4V0MA 2IT1A 2F1HA 2WWGA 2ZTSA 1Z07A 3ZS9A 3CKLA 1SHZA 4Q9JA 1ZCAA 4ZCIA 3LFUA 4G5RA 3MAAC 4LCBA 1GNQA 2X2EA 4DLTA 4EPVA 3KUDA 3ADCA 4HB4A 2ZYWX 2D62A 1CTQA 4TQ9A 2ZANA 4MH0R 1VIYA 2FMXA 2FZLA 4PO1A 1UKEA 1UBCA 4XVUA 1R8QA 4N0DA 4QHTA 1GSIA 4BZXA 4D6PA 4KI0A 2C99A 3MMPA 4LJ7A 1OXUA 3F5FA 1JEDA 2RGNC 3AM1A 4F4IA 4Q4HA 1K8RA 1E79D 2CVFA 4HZIA 5FBLB 2PX0A 1N3BA 4HAZA 1G8GA 3KJEA 2OE2A 3EZ2A 3LWNA 1NVVR 3REGA 4L9WA 2WJIA 3SZRA 2N1BA 3RS5A 3H84A 3NG1A 3O8BA 3W8RA 5AJXA 2LKCA 1AA9A 3ZH9B 4LPSA 4CT5A 1SXJE 3B60A 3BWDD 3U44B 4CT4B 4DCTA 5KU1A 1P4SA 2QL6A 1RYHA 4ZDJA 2ZRCA 1IXRC 5LD2B 4JT4A 4MYHA 5EE9A 2MSEB 3A1SA 1Z28A 4Q01A 1FW6A 4HZUB 1HQCA 1G7CA 3CBQA 6Q21A 2CL0X 4Q4JB 2IW3A 4IOMA 1TUEA 2G83A 1GZSA 1EWQA 1LTQA 1A1VA 4CEJA 4C4PA 3PG5A 1GTVA 1NIJA 1CJVC 5B30A 1ELOA 5BXQC 4OK5A 3C5HA 1A7JA 2F6RA 5AJWA 3S1AA 1DARA 2IX3A 2GETA 3ADDA 3QEJA 2Q3HA 4EKDA 3LDAA 2IYRA 1OJLA 4E07A 3OZXA 5IRCD 1Q1ZA 2ZRIA 1G3IA 1W4BA 1XJQA 4FI3C 1IN5A 2A5DA 1ZNYA 1JR3A 2JATA 4U00A 3VKHA 3BC1A 2NO0A 2ODEA 2A2ZA 2D74A 1P2TA 2R6DA 4DLUA 4L4UA 3ZDQA 1DEKA 2R2AA 3QKRB 4KSBA 3B6EA 3I5YA 5J4HA 1ZIOA 3KTAA 3ZQJA 1XF9A 4Q21A 4KYIB 2R6CA 2IXGA 2HUPA 1QHHA 1FTSA 1ZM4A 3H86A 1Z0KA 3RHFA 1DO2A 1YR8A 2GJKA 3T12A 1RZ3A 2ASEA 2GXQA 3WHLA 1ZP6A 4IOLA 4AG6A 4FW9A 1N6OA 1KK1A 2UZ3A 5EP3A 1HY3A 2BEKA 3K0EA 5GJBA 2QQ0A 3GD7A 1GG2A 5KNDA 4X8OA 3CR7A 3HR7A 5FUXA 3LNCA 2QTVB 1KJWA 2V54A 3LH5A 4AKIA 4BZPA 4I1VA 4FMCB 1ZC3A 4ERNA 5C1BA 1ZNZA 4PC1A 1WE2A 2G9NA 3T15A 1G7RA 4L15A 1YZGA 2VF7A 4MRRA 4Q1FA 1X8JA 1JI0A 4URYR 4WIAA 4BFUA 2RGAA 1EXMA 1Z2AA 2WM9B 4PC3A 1OPXA 4P4SA 2IWRA 1YR6A 3QXSA 5TMPA 4YDHB 2IF2A 1J90A 1Q1BA 2CL6X 5HCNA 3TUIC 4LYAA 5KPJA 1P5ZB 1Z29A 4HB0A 4RD2A 2W6IA 3B1YA 3R9WA 2C9CA 3SYNA 2IYTA 3JVUA 3FKSD 3T35A 4QKQA 3EPKA 4C2TA 1U81A 1WP9A 1NNEA 1MOZA 1W0JD 2E87A 5EXXA 2XNDD 4JSYA 5CIQA 5JI3E 1YZTA 2YC2C 3W5JA 2OCAA 5CLLA 3TUZC 2CBZA 3B13B 3ZZTA 5L3QA 4A2QA 3HPQA 2ZYVX 1LB1B 3BRWD 4DWJA 1KY2A 3UANA 5JLJA 2QORA 4OHWA 4DIDA 3QXHA 2KJQA 1Q3HA 1QVRA 5JWHA 4Q7JB 4OL0A 1NRJB 2IYZA 3A8TA 4YMWA 2UVQA 5FOWA 1KYIA 1VYVA 2DYKA 4NYJQ 4QGAA 5E7MA 3VX3A 1XTKA 3ZZ0A 2C03A 5K8LA 1KI2A 4KLNA 1KSJA 5ANRB 5L3RA 1DO0A 2PEYA 4ACBA 5FI0B 1T0JB 5AR1A 2OEPA 2RGNA 2YC4C 4NCHA 8OHMA 3ZLJA 1DELA 4HDOB 2NGRA 2IUSA 2QM7A 2ZRMA 2G3YA 1Z0JA 2YWFA 4XD7A 1XD9A 1UBEA 4P0TA 1KAOA 2JGNA 5FBQB 1KI4A 4PSAA 2ZE5A 3UK6A 2GJSA 3IHWA 2D2FA 1EX7A 1FQJA 1NP6A 1RW4A 3KJIA 5FR1A 4M1SA 4AKEA 2WMOB 1L4UA 1UADA 2QRNA 4BFZA 821PA 4AI6A 2QRZA 2PJRA 3MCAA 4Q4AA 621PA 1P9NA 3SR0A 4B6FA 4CW7A 2F3TA 2QM8A 3LBHA 1FPMA 1E9CA 2D06A 5KPDA 3I8SA 3HJNA 4IDOA 5DLQC 2FA9A 4LBVA 1Z06A 1KDOA 2VP2A 3Q7PA 4TN1A 4B3DA 4B2IA 2D7DA 2OFWA 3PUZA 3CRMA 2GJ8A 3CR8A 3GJ5A 4TYQA 2HEIA 1W0KA 2PL3A 1LS6A 2BKUA 1EFRA 4G01B 3DZDA 4A6PA 3AKYA 5K8IA 3IILA 4ASUA 5EE3A 2VHQA 4HUTA 4TT3A 3VMFA 2XAUA 5GJWC 4P32A 4OKSA 1Q12A 1TF7A 2OCPA 3K09A 3LLUA 4EFMA 1GM5A 2IHBA 1QZXA 2YWHA 2PCJA 3QF7A 4MYUA 3SHFA 3KKOA 1F3OA 3K70B 1IOZA 3I61A 4UNNA 2WWIA 1L8QA 3IQXA 3QG1A 5KO2A 4E09A 2O52A 2ZRLA 3K0FA 2YOFA 2HV8A 3THOA 4A1FA 3OFNA 4DJTA 5JSZB 4FMDB 2CLSA 3W6OA 4NL4H 4I1OA 4GOXA 4HAXA 2HYDA 1KSGA 3LQRA 1X6VA 1US8B 1T91A 4CGZA 4PSKA 3AGPA 4HAVA 3AP3A 1XTQA 2YOGA 1OW3B 2O0JA 3I32A 2GA8A 2JA1A 3P26A 2B6HA 1R0XA 2NIPA 3TW4A 4JLDA 1W2GA 4YXWD 5CYPA 1CP2A 1SXJD 4B44A 2DCUA 3BAFA 1N6HA 3K9HA 4FCVA 3RS7A 3IHLA 2CNWD 1P7CA 1QHXA 5JCZA 3CWZA 4CEIB 2XXAB 4IOJA 4ABYA 3TSOA 2QTHA 3V9PA 4FMBB 2QUZA 3B8HA 1C4OA 1VYUA 1TAGA 1HUQA 1KK3A 2V1XA 3IGFA 5EUQB 4EIWA 4MDEA 2FSFA 1E2KA 4M22A 3I92A 2P6NA 2ZITA 4HAYA 4A0HA 3U7HB 3SJBA 2QQEA 1JALA 2J87A 1R2QA 3TAUA 3PENA 4RD6A 1OT3A 4IRUB 3L0SA 5C4MA 4OK6A 2KBFA 1F2UA 4H1UA 5EXSA 4YDSA 2EFGA 1GNRA 4DB2A 4JVSB 1GILA 4HI0E 2FSHA 3GJ6A 3H4MA 1KZ7B 4AC9A 3GFOA 3LW7A 1DPFA 1MKYA 3W5IA 4TLDA 1MT0A 3X1WA 2O8CA 1DVRA 3RS3A 3V4FA 4DLWA 5M04A 4LRWA 4KAXA 3QEOA 2H18A 3EIQA 3HPRA 2ZROA 1G20E 1S8FA 2XZOA 4OI0A 4G5GA 2ZRDA 4NYIQ 4GP6A 2I4IA 3A1TA 2RGCA 1N0WA 2Z4SA 3W6PA 4BLSA 2J0SA 4UNQA 2O5VA 1HV8A 3H1TA 3EG5A 5A5GA 4R9UC 3C7KA 4FCWA 1KI6B 5LPNA 4B76A 4EQ6A 3GJ3A 4D4LA 1N2CE 2Y8EA 5GVRA 3LW8A 1B0UA 1GRQA 1TEXA 3LX8A 4GMDA 3LRPA 2D3WA 1NKTA 1RE0A 2ZS8A 3QPWA 4A2WA 1HT1E 2AK3A 2H5EA 3U6KA
chains in the Genus database with same CATH superfamily
1QNFA 3BIFA 3RV4A 1Z56C 4C2UA 2FSUA 3MPOA 1ISPA 1NMXA 2OZEA 2SHKA 1EFLA 3KBBA 4Y7DA 4G0NA 4MEJA 4B5KA 3E27A 5HCUA 2FHPA 3QNMA 4FWIB 2VYND 4JZKA 3TXAA 4B4WA 2JAWA 1ZA1A 1JQLB 2G9ZA 2BPOA 4EJSB 1ADJA 1GOTA 1W46A 1Z2OX 2JJ2D 3BXFA 4HVAA 4MTLA 3ZIAD 4ZYWA 2ROQA 1TEZA 1EWVA 2VC2B 4W1QA 2J6HA 2Q8QA 3DZ8A 3NDJA 5ITSA 3AO0B 2CHUA 2LCQA 4BCBA 3P2JA 4PYLA 1NNLA 3AF5A 2JDID 4K6OA 4TXNA 1BKSB 1FOEB 2JCXA 3EBLA 5AM4A 3R6WA 4ZARA 3HKCA 3MSXA 3K1AB 2L82A 2ODQA 3CF2A 3P45A 3PFKA 4PTYA 1FDVA 4ZQGA 4B8YA 2DKNA 3TRIA 1IN6A 4XW2A 2B0JA 4ZAZA 1USGA 3MJSA 4ZP1A 2D1TA 2P75A 1CY8A 2O2GA 3HGTA 5DEOA 3OCVA 3BIWA 1Q20A 3FAKA 2ZRJA 5E1DA 2X9NA 2IYYA 1R6TA 3I2FA 4IEIA 1GN9A 3FVRA 4RJ2A 5EFZA 3OECA 1GUYA 2IP4A 4RH0A 4F1KA 3VX4A 3FTEA 3D0OA 3EOBI 4UUMA 1DC4A 1QLHA 1Y1SA 5CCXA 3EHEA 2GPSA 4IV0A 1VSUA 4IUBS 2H1CA 3NASA 3AJEA 4Y6SA 2WWRA 3OQNA 1REQB 4XR4A 4AUMA 4Z5XA 1KQOA 4FEEA 4BNJA 4IO0A 1C2YA 5AI6A 2PSDA 1SBNE 4DA8A 3QZUA 5BVHB 1IHUA 2J3JA 3O4JA 1YBVA 1M7HA 4EYOA 4CM8A 2GAIA 1L9KA 3KRTA 1CXZA 2PZLA 1KQNA 4EEKA 2R96A 3TDKA 4B84A 2WKSA 5FAKA 4J8PA 4BWVA 2VHZA 2ZDQA 1V2GA 1G7SA 2W2XA 3A6KA 3IBTA 1QYVA 1SG9A 1Q7TA 1SHKA 1ST2A 3QNUA 2RGBA 2BGUA 2HJWA 3CZQA 3CNQS 1N5JA 2QPOA 3OEED 4O0MA 3ZDAA 5IYZB 4FYKA 4MV7A 3RG8A 1PWXA 1K5DA 4PVDA 2XT6A 3O3NB 4O1IA 3DUFA 2XZTA 3UK0A 3FCSB 3RFCA 4FWBA 3LO5A 3EIWA 2NO4A 2RGXA 4LZPA 3TW8B 4L08A 2JJ1A 1BHSA 1PGQA 5AW9A 2JARA 2V7WA 4MCJA 1JHAA 3DZFA 1WMEA 2REOA 4K7JA 5BRJA 1XTIA 3L6RA 4UNRA 1DKOA 1ORWA 1DXHA 1Q57A 2A1TR 2KW5A 2WMDA 3UWDA 3UMJA 4CKXA 1JLKA 2AQIA 2PJDA 2Z0MA 3BGSA 4QU8A 5AJZA 4Z86A 1XXHA 2EG9A 2Q3LA 2CVQA 3V7NA 3KEFA 1NPDA 1RBYA 1JN0A 3M6MD 3EF0A 4X8MA 2BVNA 2QVCA 3ERCA 1VIMA 2ZTVA 3WP0A 1U8CB 1ZK1A 3OFJA 4B8WA 4DVJA 1OV6A 4GHWA 1D6JA 3A2NA 5FWDA 3HYCA 5DYGA 3ZJTA 3KAKA 3QMPA 3GFRA 1IXYA 3HFJA 4L8VA 3V5NA 5ECDA 5A4AA 2H0QA 2OBNA 1KFJB 4L22A 4FFLA 1NN1A 3NC1C 3KUKA 3ELBA 3MGBA 1NKVA 1K9VF 3E48A 3R20A 5K45A 3UK7A 2OV4A 5LDDC 3GRUA 3B3JA 5AFSA 1QGZA 1EQUA 1T1EA 2GILA 3C15C 3B53X 3PR2B 4QYXA 4HNVA 4MICA 5B4UA 5L53A 2OV1A 3Q3CA 4CIXA 3K9CA 3R40A 3FSGD 1CUEA 5FFNA 4KIWA 3FCEA 4REQA 5MF6A 3D6AA 4AZSA 4EUKA 5KTOA 5J5CA 2IF0A 3QUBA 3K4PA 4V0RA 1Z5OA 5H80A 3UMCA 2ZOSA 1XKQA 3Q3IA 4RULA 3VZDA 4KO4S 4QYIA 4V1CI 3KYDA 4CZ2A 3CLRD 2GPTA 4XSGA 5L3QB 4K9SA 4MQFB 4KFUA 2R6ZA 1O95A 2EC5A 3C74A 3EF3A 3LG2A 3QFRA 4HPWA 1ZINA 4JENA 2NO1A 7REQB 4C4YA 2YFQA 3C8UA 3LDFA 4NU8X 2WEKA 3C3KA 2IXTA 2V6MA 3CN9A 4EHFA 4YDQA 2FXIA 5IZCA 1XCLA 2R8RA 1QQTA 1RKUA 3KT8A 3L4BC 3NNDA 5HK9A 4EKEA 5HDBB 2ALJA 2VP9A 2G7ZA 4A0GA 1FFXB 4Y2JA 4E33A 2YXNA 3L7BA 4BMOB 3NOQA 2QUIA 3T9AA 3HV2A 1MGOA 3EUWA 2OMEA 3IKLA 4KQMA 4GWKA 1V4BA 2OR3A 1KO8A 2WZCA 3NIWA 3WNCA 2VDRB 4D57A 1W35A 3GEGA 5DWQA 4MUGA 3VR3A 2IWHA 1H8EA 5T4BA 2PUDA 4XEHA 5I9SA 2HV9A 2BM9A 2POQX 2JIPA 2W58A 5ECGC 3TW0A 4AN4A 4AZ3A 1D7OA 5EPOA 3WIDA 3SQMA 1L7RA 1ZMOA 2AW3A 3QKWA 4LF4B 3WC4A 5D3QA 1NXXA 4GLJA 5CFPA 2CHFA 4UASA 2FF5A 3WLFA 5THXA 2A88A 2BZGA 4BTLA 3ZGZA 1E1QA 2VCHA 4XX1A 1KFEB 4QXAA 4OOEA 1YR7A 3F3KA 2IOFK 3FJYA 4K6HA 1LV7A 4BYMA 3HJUA 1Z68A 2I6UA 1W48A 3N6RA 3I9V6 1XTSA 3P2KA 4ZWNA 3ZH2A 3BCUA 2XCRB 2V6JA 3MJHA 1C8BA 2J9FA 3KEOA 3BSWA 1CK4A 3FGOA 4BJ6A 2VT2A 2Y1WA 3IP1A 3L6OO 1H1LA 3UQZA 2VEOA 3QGMA 4YWJA 1A4RA 2IZ1A 5B6PA 2VP5A 4WGFA 5TT0A 1KU6A 5EP2A 1M8PA 5EHNA 3ZXIA 2Z6AA 3CWCA 5J2UA 4DRXA 1HA3A 3VR6D 1U8AA 1KYQA 3ORRA 3WWOA 4ALIA 3D0KA 3G2QA 4D1YA 3WGQA 3EYWA 4WA8A 3E3AA 3CVJA 3ON5A 1FJGB 2FQXA 3GAFA 3B5IA 3OPYI 4X6UA 1BKYA 4HDSB 3CX8A 4RJKA 2EFDB 2VDNB 1U6KA 2BHSA 3TZHA 4I81A 1X1QA 3ZW8A 1BQ4A 3OCWA 1T3TA 4YV2A 4RTSA 2CYAA 5AKLA 4M9RA 4AKHA 1MX1A 1K63A 1FBNA 3KSBC 8MHTA 2WHRA 1PS8A 4KWEA 3AUAA 2MIIA 4DTIA 2DE0X 4I4TF 2WFLA 1E66A 3WZ2A 2BGWA 4BLPA 1H22A 4LXUA 4DIKA 4O4HF 1YRQA 4PC6A 1PNVA 5DRYA 3RSFA 4OHCA 4KN6A 3OTHA 1T8SA 5I51A 2DLNA 2C9DA 3B1VA 2GNPA 3DWEX 3H05A 4H4CA 4O08A 2QZ4A 3H7AA 5TR9A 3RBVA 3C8DA 4DN6A 4F9FA 5JTTA 3S8YA 3P0IA 3NUQA 4ZANA 5KREA 1VG1A 1NYLA 3U7EB 1QIMA 4RU1A 1V6CA 2GPWA 1E4VA 2Q0SA 1KDVA 2CNOA 5BMVB 4IIJB 5K3FB 2BHRA 4BWYA 4Q7QA 2C7PA 4A8JB 2ZTLA 4OJYA 5AUPB 3MN1A 1ZLXA 5JFTA 1LX7A 1GAJA 2B7CA 4IJ6A 4JC5A 4KWHA 3R09A 4TXHA 1Y8CA 3KYCB 4B9AA 3EOAI 1QZZA 4IKPA 3MERA 1KR2A 3QY0A 5E4JA 2W6OA 3RUPA 2BL4A 2GD2A 3P2MA 5A06A 2K2QB 3T54A 3IR5A 4LK2A 5JXIA 1VJGA 3IHKA 3R6TA 3IAM1 4J3NA 3OHSX 4PZLA 3B6IA 4DV7B 3ZCPA 2YBEA 1FMTA 5A62A 1WDTA 4GLOA 4UM8B 2HR1A 3P94A 1WY5A 3G5TA 3H4TA 2YY5A 1BROA 1UMCA 3UA4A 1VLJA 3AHDA 5LNK6 2WIGA 1R10A 3HYRA 4V03A 3UFBA 1I5OA 1AZSC 1EWKA 2GR9A 1E6KA 5EHGA 5CDHA 2N42A 5JE8A 3VVBA 5KJFA 1U6JA 2BH2A 4MVJM 4JP1A 1SVLA 2IYWA 4RF2A 3PA6A 4MX8A 5JNTA 2BEUB 5F9FA 2FMKA 3ZV7A 1V45E 1VA5A 4K3VA 5COAA 4UMEA 3SAJA 5BN5A 2ERCA 1XZDA 2QN9A 3DZKA 5B58C 4V24A 2ZYHA 2PVSA 1CDEA 1XU4A 1YJCA 1PR1A 3ESQA 4KQWA 3G02A 2RAUA 1G17A 2LUOA 2PT5A 3K2IA 4YP0A 1ZOPA 3ZVKA 1OH8A 1Y8RB 1XVAA 2EJCA 3GLHE 3U1VA 2A5YB 2O05A 2Q6OA 2GYUA 2N46A 2B36A 2AN9A 2BZ1A 5CBKA 4F92B 2FZKA 4N82A 4EBBA 4KGDA 2CJWA 1OBHA 1XK6A 3KT3A 4F38A 3EW9A 4OA5A 5C7LO 4FKMA 4U6NA 1JAYA 2GZMA 4H7DA 3VPCA 1L7EA 4TL9A 2W9XA 2VJDA 2WAOA 1PE0A 1CY2A 1Q2XA 1Z4JA 3TQRA 2R66A 2X7XA 1UF9A 1E2FA 2V5VA 3B38A 4WDRA 2O1XA 3WV5A 1PFVA 4EFDA 3U2QA 3HZZA 3ZI7A 3Q12A 3Q1LA 4WXEA 1B8NA 2GAJA 3B20A 1KS9A 3DLIA 1D7AA 2I7DA 3D0RA 2VJLA 3COWA 2QI9F 4GP7A 4NG4A 4QXOA 4ZOQI 2CUNA 4R5MA 4UDYX 2C92A 2VDUE 3H1BA 3M6LA 2AR7A 2DTXA 2D54A 1KO7A 4D9GA 1O4VA 3EA4A 3FRHA 1IQ0A 1A77A 1JRLA 1WEKA 3AF1A 1TADA 3C98A 3GFVA 3Q0EA 4CDMA 1GUBA 4WDQA 5EEGA 4HGNA 3WGNA 3WK8A 4WOCA 3HYTA 4HD8A 3TNLA 3TSWA 4Y6QA 1Q1NA 4YJ3A 2QVYX 3SHQA 2W93A 4QUIA 1KAQA 4UNIA 2J9YB 3Q8XB 3AIIA 3AQ4A 3I23A 4BJHB 4FFBA 2RARA 3GA7A 3L0ZA 1ETUA 1CZKA 1U3UA 1ZD9A 1HE8B 1EP1B 2XZDA 3KL4A 4G0ZA 4IYRA 3WGJA 1O57A 3NOXA 1JB1A 1I1NA 1MENA 5DNEA 2C2BA 4NK5A 3EH1A 4ILKA 1PS9A 1NUUA 3FHLA 3L8CA 4LG1A 4MGZR 4EHHA 1AHNA 3BQ9A 3MGKA 3P9KA 5K6TA 4CM9A 5KMGA 1H66A 3ZBPA 1SCDA 1G60A 4LF7B 5CXXA 4QASA 1QIHA 4KN5A 5E4FA 4ZJYA 2DSTA 3HHPA 1N6PA 4KN9S 1J8QA 1KY3A 1MJGA 2EERA 2BM0A 3BTVA 3DKIA 4GZMA 4GSLA 3RVQA 1W5BA 4A10A 1ID8A 4DV5B 3WZMA 4CXMA 1RYZA 1E6UA 1YMUA 4LI0A 1VKZA 1Y4AE 3MELA 4QT4A 3SZ3A 2XWSA 3M2TA 3OHPA 5TF0A 5ITVA 4DDUA 4IGAA 1T0HB 4O4JA 3CLSD 4PBSA 3IA2A 4DY6A 2X8JA 3QIAA 1P2UA 1Z7BA 1TECE 3GGCA 2ZVDA 1T2CA 1NOJA 1WO8A 4IZOA 4DT1B 3VC1A 1NZFA 1Q92A 2CHVA 1FNNA 4PBTA 4E12A 3GLQA 3ZK8A 1EJ2A 3QITA 3S8EA 1M33A 4US2R 3SJAA 4KXUA 4WLFA 4ZVPA 1HT0A 2NVOA 3F1LA 1CQIA 3IJRA 4X8LA 1EUCB 1RIFA 3IBCA 3UPUA 1QE3A 4KR3A 2OHJA 4JLJA 1JHXA 3LDUA 4JB2A 4MLCA 1XZKA 5ALQA 4UOEA 4UUAA 1T9GR 3RFUA 3HJTA 2CNNA 3FN4A 2Y6UA 1T5SA 3QNWA 4PQFA 1JAXA 4XSVA 2MWMA 1RTTA 3ONEA 4TSFD 3DLAA 2QVLA 4QUDA 1LI5A 5B6IA 1EIWA 1OY1A 2MMGA 3NHWA 4Q7KA 5CVDA 1N8KA 2E9SA 5DBOA 1S5PA 2BTQB 3N2GA 5BV8A 3LQ2A 4AZWA 5KYXB 4MTCA 5AI0A 2RGRA 4UQLA 3RB8A 4D74A 4DDWA 2B1JA 4ARZB 3TLXA 3KHUA 2P6MA 5AW3A 2F67A 3FBGA 4HBGA 3UJ7A 4BBJA 4LX8A 2C4WA 1SXHA 1YBFA 4HAOA 3UJ8A 4A9AA 4DLSA 4QQNA 3PX7A 6YASA 4N0MA 4H0CA 4Q9LA 3F98A 1GITA 1QX4A 3UHAA 4AROA 2JBHA 2JHCA 3DGEC 5DULA 1F8YA 4OJQA 1WTCA 1RSZA 4IKEA 4GOND 1L5LA 3FFAA 4ARVA 1YJ8A 1MTOA 4IF4A 4N3GA 4JR1A 4JC4A 4BO8A 1V96A 4Z7JA 4KBFA 1L5GB 2OAEA 3AEYA 1BKDR 1M1XB 3IUPA 4J0KA 4YONB 3TK1A 4DQXA 2NM0A 1RQ7A 3KAQA 4RPIA 1QP8A 2R68A 3OY7A 5CHEA 4BP8A 1K66A 2DCMA 3GEIA 3EVGA 3I2KA 2WZQA 5CBPB 5EJ9A 4MB2A 4C22A 1L1QA 2BW0A 1LPOA 4P4UA 4PCAA 4PGMA 3EMKA 4WN9A 3L0OA 4YAEA 4ZDIA 3PYMA 4MZXA 2F9FA 3A14A 3PDIB 3DAPA 4WNAA 4Z7NB 1KEUA 4MW6A 4M1YA 2FPIA 2GRJA 3QPVA 2XLCA 3Q2OA 4P98A 4HQLA 4W9NA 4EPWA 1AKVA 5IAOA 5DOVA 1HORA 1QTRA 1XU7A 2JLBA 2ZSFA 2DLDA 3C6MA 4L2IB 4TTPA 1KQFA 4FXPA 3B9RA 1NQVA 2PLAA 2ZG6A 4ACAA 4OEHA 1G1MA 2CC2A 1SM4A 2IVZA 5AKHA 5G0TA 2JGIA 2ZT5A 1H3NA 2V5AA 2WWTA 2XMCA 1E96A 1HDYA 3AGQA 3C70A 1D1SA 3D1VA 2I7CA 3LXXA 1YJQA 4FZ5A 4LE2A 5FWNA 3LT5A 2QNRA 2DFNA 2SCUB 3KOXA 4RJJA 4YRPA 3F8WA 5GVSA 4DUZB 3D3JA 4K03A 3ICWA 4BQSA 4E1AA 5TVGA 1WJGA 1VJ1A 4V0LA 5L8VA 1C4XA 2HHJA 3R9XB 3HYSA 4TQUS 3VO8A 2CLDX 3PHCA 3FYSA 1U9JA 5KQRA 1SXJA 1QDLB 1E4OA 3BB4A 5JJIA 4IDQA 5G41A 1R7RA 3K9FC 2DBYA 1Z0FA 1YKFA 4I7EA 4DR2B 2ETXA 4R8SA 3SFVA 3BN3A 1TE2A 4CMCA 4F06A 5T3YA 3H97A 1YDHA 3ETLA 4GECA 4IJUA 4NVRA 2X76A 1PFQA 4XGIA 4E0BA 1E3SA 3EVZA 3OU6A 3MNFA 3QIVA 4G9EA 5UKDA 3DL2A 1HQDA 3FFTA 3N8IA 3EUAA 5KYYB 3BHNA 3F6SA 4PLYA 1FJHA 1UMDA 2OQRA 3I30X 2J08A 3KFXA 1K68A 2H7VA 3GF4A 2DPYA 2I3DA 1NBWB 5NLLA 2F1IA 4R6XA 3T41A 4PFJA 1J8MF 3EGDA 4TKUB 3KZXA 4DCMA 4OM7A 5HZGA 4U7DA 2F1KA 5IANA 1ESZA 4RS3A 3SE7A 2PHZA 1GYRA 1LEHA 3SDZA 3ZCTA 3T7SA 1W7AA 2QVBA 1Z22A 4P4TA 2A30A 4Q34A 1IJFA 5D00A 2GXUA 4AYTA 3I1IA 2FFHA 1JHDA 3TTXA 5HXAA 1T1IA 2JFWA 3CR3C 4WKNA 3EDOA 4ZRMA 5BP7A 1XXHE 3TCKA 3PEYA 3WK6A 2PANA 2YN0A 3REQB 3PYXA 3B85A 4D0RA 1P39A 5HW0A 1P9RA 3K53A 5D3MA 4P82A 2ZAIA 1PWZA 1RQNA 1MF7A 1VCIA 2D7CA 3W8NA 2V4ZA 1F3LA 2FEWB 3IDSA 5CA1F 2BC9A 2COEA 2Z9DA 3JWIA 2M2IA 4O4LB 1TMOA 2OQVA 5LLDA 3RH0A 3E84A 1TJNA 4LC0A 1XNQB 2PXAA 3OFND 2NZJA 3BMQA 4PLHA 3I39X 4OXKA 3EZ9A 1ILWA 3AESB 4R05A 5G1NA 4EECA 5CT5A 4CKBB 4EY4A 1UBSB 5CFZA 1LVUA 1VDMA 2YL2A 3ZY3A 3G0GA 5T41A 1BA3A 3ZV4A 3DC7A 2Q5HA 3WBFA 2G4CA 1PFUA 2R6R1 3A4VA 1RWMA 2QYHA 2QN2A 5DXFA 3TD9A 4R0VA 3IFSA 2JBAB 4KRXA 1XP8A 3E3LA 3OO1A 3F7TA 3HC7A 1H2HA 4QOGA 1OH5A 1NJGA 2EGHA 4PLPA 1TMKA 2WIFA 4YMUA 1J42A 4FB4A 4OG2A 3UWKA 1LBEA 3ZGNA 4FZJA 1D6NA 1MNQA 1NW4A 2WUGA 4JR2A 3UO8B 5CYGA 1QHYA 3LIPA 3CPHA 2HF7A 4FSDA 4NIMA 1U2GC 3RVMA 1RWBA 1E2NA 1CVLA 3I8XA 2VUHB 3LHFA 3HCRA 2WWHA 4GPIB 4ZVMA 2Y27A 5HMLA 4IHKA 3GLFE 4EO9A 5HJ5A 1H5NA 3OAAA 1MEOA 3FMPB 5KX5A 2QL7A 1X7XA 2QRPA 4YIHA 4GLLA 2C96A 5AK3A 1FVOA 4OSEA 1OVGA 2WHQA 1JAHA 1M6EX 3O4VA 4KEAA 5HG0A 5HOEA 5KYGA 3ETDA 3COVA 1M76A 3FUUA 4DIEA 1E2LA 4ZV4A 2F7SA 4LJLA 1WABA 4BO0A 1L4BA 2DSNA 2QYTA 1G42A 1T9DA 1XDZA 1P4AA 3AW8A 3R0XA 4MDHA 4TWJA 4U6QA 5EWMB 4FYHA 4YP6A 3K0HA 3HQ4O 4NU6A 3VU0A 5DH9A 1RM4A 1TI7A 3DMGA 3O0DA 3EGWA 1U8EA 1V43A 1KMQA 2H00A 4HZUA 1FMJA 3H0CA 2E0IA 2RFLA 3PC4A 4JBWA 4HCJA 4LSMA 3ZK9A 3C8MA 1V7PC 3E5MA 3I9MA 3LP6A 4MA4A 4BX9A 1CZLA 1HYQA 2PQ6A 4QREA 4WINA 4IH1A 4M3NA 2ORWA 4RH3A 4KYTA 4RF4A 3TB4A 5EMNA 4FJ0A 3F67A 1S9HA 2XT0A 4HAWA 1LTHR 5F98A 3AI7A 2A1UA 2RHOA 2V7PA 2Y6VA 2E21A 3CF4G 3FPFA 1AOXA 3OLQA 4Y67A 3JARA 2PGOA 5JTUA 4OQEA 1NVVQ 4Y98A 4B82A 1Z12A 1ONNA 4N6OA 1PR6A 4FLEA 1W6UA 4P4GA 2L0XA 4XUCA 5EP4A 4F93B 1P3Y1 2NXEA 2PY6A 2QUAA 3D2AA 2UYYA 3BWXA 4CIVA 4OLBA 5GINE 2QTZA 1WEHA 2W0SA 1BXKA 4ADSG 1I2CA 1VPEA 1C0LA 3L6UA 4GM0A 3MQ2A 4FC6A 2X6RA 1M2OB 1HSZA 5LP6A 1S7GA 5K6AC 4EG4A 2JIMA 3KXLA 1U0LA 1ZJ4A 5BR4A 3MUEA 2DTDA 4UBIA 4JXZA 2C95A 5KQLA 1LA2A 2ZJ5A 4KDFA 2LXNA 1G0NA 1JVBA 3IIIA 5DK6A 1H4VB 1NYRA 3TVDA 4G8DA 3ZTYA 1G8FA 3GRRA 1YA8A 3PFWO 4JMPA 1SAYA 1RRPA 3IYLW 2Q2QA 2YV2A 3TCXB 3D31A 1SKYB 3I6IA 1GZVA 1LPAB 1P61B 3NBKA 4GSKA 2QZ9A 1DUVG 4WJKB 2VOEA 3FMOB 5D6NA 1M5UA 2BFDB 3LO8A 3VZRA 4BNDB 1I4EB 1RJDA 4UOQA 1B8PA 4CJXA 4FYJA 2GB4A 4TX1A 1SOAA 1AX9A 1CF4A 4LCEA 2W6JA 1XVIA 3X0DA 4A2PA 2JC3A 4CMHA 2YTZA 4NESA 4TSRA 3T5AA 3TJRA 5B37A 2NT4A 4J6EA 1QRUA 2QJFA 5GOZA 5DNVA 2CE7A 3ZPXA 2Q99A 3D3KA 1B76A 1G8MA 1LNQA 2ZSDA 1NOIA 4DLZA 3U7QB 1F7VA 3QA3E 2I1VB 4X63A 3IMGA 2KE5A 5G0UA 4Z54A 4PIMA 4L78A 4QUAA 1OI7A 3ZCSA 5FYDA 4EG3A 3ZN2A 4OV6B 2IOHA 4YB8A 4URVR 5BN3A 4LYEA 1YZ3A 2BFBA 2XB8A 2ZJAA 3G0CA 3KTAB 3M6VA 2PSFA 2WJJA 1TAHA 3GNQA 4EQZA 1LBHA 2RG7A 4FDVA 3ANTA 1S96A 1UIMA 2OO5A 1A9XB 1UR5A 1NRXA 2VWGA 4REMA 4UFNA 1X7WB 4A6EA 1IBMB 4Y9RA 4KFCA 4I55A 1MD9A 2YICA 1HG1A 4OXYA 4Z3OA 3EARA 2CKDA 3NH6A 4XPIB 3KJHA 3ZG6A 2FAXA 1RPTA 2JFBA 3ER6A 4HNAB 4WOPA 4EJFA 2FNAA 3TQQA 2A9RA 1DC3A 3HRHA 2W2KA 3O6VA 3GVIA 3D3WB 1ESMA 4R31A 5AW4A 5JEEA 3I58A 3WX0A 5SY4A 5FJJA 4MVCA 1SC3A 1V41E 2GQ0A 2YJ4A 3PUVA 4NULA 3FI0A 1OLXB 2NQTA 2Q6TA 3GHHA 4Z8XA 3WAGA 2IX9A 1UBMS 3DHWC 2GEUA 1C2TA 1JU4A 1ZCZA 4DUGD 1KERA 1X1RA 4CQMB 2AB0A 1BEEA 1KVUA 3KAPA 4CMBA 4TYMA 1LK7A 2OKCA 3LT2A 4G0XA 4S1OA 4BECA 1YR9A 2W7TA 4OA8A 3TLGA 1D2GA 1FUUA 2RGYA 4I14A 3E7WA 4KK3A 4NYJR 4P4SB 2YIMA 2COKA 3NHLA 4DRYA 1XQ1A 5EZ5A 4PNPA 4GXNA 4CKEB 4Q4LA 4D45A 1C50A 1Z0ZA 3BDVA 2CB0A 4OB6A 4UVDA 4X94A 4D5GA 1VB3A 5CLIA 2FN9A 2JHGA 3D6UA 4PR0A 2YS7A 3OZTA 2GBLA 1F20A 4NQRA 3YASA 3L7IA 4ZVSA 3RSSA 3ANSA 2XVYA 1EDEA 5AXBA 2CXHA 4EA9A 2LIPA 3UEOA 2HO4A 1Y4ZA 1RP1A 3EY9A 3PEEA 3R3HA 1E32A 2FRDC 3V2UA 4B73A 2XRMA 2OORC 2Q6VA 5IAJA 2C29D 1JG4A 2AT1A 4GE3A 1QQ7A 4E5NA 1VHQA 4PZ9A 1DADA 1U3VA 4QEDA 2ZRGA 2FPLA 3U1BA 2FPSA 3AF0A 3FETA 4IINA 2X9QA 4X3CA 3KWLA 3QVVA 5DHSA 3PHJA 3NZEA 1HDEA 4HPXB 4JJ8A 3OTOB 3KR2A 1A98A 1YB2A 2H9YA 2WUDA 3ZW7A 1XKTA 1KU0A 1QK5A 1VBMA 1J70A 4MV5A 4ZI7B 4MPPA 3I05A 1G20A 5E1BA 4Q3EA 3ZTTA 1Y5RA 2H0RA 3P0FA 2ZUTA 1BEUB 2B8WA 2D0DA 4KJZA 2SKEA 5EKXA 5EJ7A 5IW8A 1Z75A 1T5IA 3LBNA 4QA9A 4B47A 4MRNA 4R98A 3ZE2B 3KAJA 2M98A 2XE6A 2VZ9A 1Y82A 2JFPA 2PJZA 2BRUA 4Q18A 3TRHA 3ROKA 4B3JA 5CEFA 1JF8A 3B6ZA 3HEBA 4TKLA 4Y1RB 3ETEA 4G5QA 4WY2A 2ZU6A 1X7YA 3EIEA 3E9MA 2ZIVB 1E1CA 1R00A 1WXEA 2H1IA 3H2IA 4FUQA 3VKFA 1N92A 1QIDA 1MQSA 4M83A 3TOSA 4YV7A 3AOGA 3MS4A 1EYZA 2WA2A 4IX1A 3C1AA 1VPLA 3O21A 4N6NA 2R9VA 4LF8B 1TX4B 3U80A 2QX8A 2Q50A 5AM0A 2PZMA 2GO7A 2AKYA 5FOXA 3IUJA 3VBCA 4A92A 4KITB 4U2GA 2F62A 3T3EA 2VNIA 1PEKE 4LXGA 2OXRA 1KETA 5E8RA 4ML3A 4HQ6A 3FR8A 3E1SA 4FI3F 1ADFA 4BQEA 1Z08A 2GNOA 3SDSA 3D59A 4IDDA 4Q4CA 1JLLA 3RNLA 1AK2A 1SQ0A 5HKLA 4AKSA 1GKIA 3BK1A 5JD5A 1WDMA 2AMLA 4MO2A 4X84A 1H93A 5AYVA 3QKTA 3JQBC 4FGWA 3M2PA 1QG6A 2RJOA 4JCOA 4W9RA 4TMVA 4BLQA 1KMCA 4ZYUA 1LVGA 4X1IA 3U3OA 4W8OA 1HI9A 1ZI6A 5AVOA 4NR0A 4F56A 4URFA 3I9FA 4ZXPA 4FLMA 1SBZA 3U26A 2ONZA 3OEHA 1EWTA 3R75A 1CQJB 4HNQA 3F1KA 1PWHA 2IZ0A 2TMKA 3NUGA 4M8NE 4EJMA 3HXTA 4EGAA 2J41A 2Z43A 3I1YA 3T5TA 1E0AA 1SUBA 3CKYA 4FGZA 5AVQA 1OE0A 3VI3B 3AETB 2CMFA 1MEEA 1CYDA 2JI9A 2EOAA 4KDRA 3D0QA 3B9PA 1NUAA 1UJNA 3E15A 2APJA 2A35A 1UKBA 4A03A 1GQOA 3D4BA 5L3VA 3H42B 2RC6A 4GOJA 2JD1A 2Q0QA 3BXZA 4NFSA 3SNHA 3VC2A 2Y1LA 4KN8A 4URZR 1TJ5A 3UCFA 1GVNB 5FL7A 2FK8A 3FXAA 4AF7A 1ZESA 3D8HA 4J9UE 4TRMA 5MFZA 3VDMA 3FOEC 3A2MA 5ALOA 5BMVF 1LFAA 4XYEA 1P5HA 1WAMA 3BK2A 3KP1A 1ZUIA 1EM8A 3PC3A 5AO9A 1YI8A 3O8OB 1C8KA 2ATXA 4QGBA 3JWHA 5G1OA 4AXBA 4K0RA 1FJXA 4NMHA 1AHHA 4Q1DA 4EHIA 4Q9AA 1OIXA 3WSVA 3GUHA 5CA0B 1I4WA 4TKVB 2Y1OA 4TTAA 1XOIA 3OZSA 1S89A 1T6NA 5JANA 3ICOA 5F7JA 3ZDRA 2XTAA 2BGRA 1E1RD 1RBMA 2QG6A 5EIFA 3V00A 3DVLA 1EUQA 2CT8A 3GNTA 4V38A 5AVZA 2QQGA 3H9JA 2WV9A 2G4VA 1SELA 2E89A 2HBQA 2MYPA 4XCQA 5I9BA 3STXA 1WB4A 2ONCA 3HU2A 4UPDA 3TG8A 1MC4A 4UVEA 5KOJB 1PVOA 2HI0A 4PYJA 1W19A 3ENWA 5BOVA 4C7OB 3ZYZA 1ZSNA 4Y2HA 1KEEA 1OWPA 3OIGA 4PSVA 4S05A 1F0YA 3OM9A 3UK2A 1RKVA 1Y33E 1OAOC 3RC2A 1WZ2A 2YX1A 3FCXA 1DKQA 1JPJA 1F2UB 5CAEB 1QYWA 4C7KA 5JCJD 4QDJA 2JK1A 4RTKA 5M29A 1ZHOA 3O4FA 4U2CA 3CG0A 2J8ZA 4HX2A 5FORA 4W4TA 3B6JA 4HEA6 1QHSA 8LDHA 1IM2A 3LBYA 4AMZA 5KOHB 1UEJA 1C1DB 3G13A 3RANA 3LUDA 4ERXA 3UMYA 1T3HA 1T8TA 3KD2A 5B1EA 4Q05A 4O02B 2YKGA 3DO6A 1USVA 3MTGA 1WS6A 4RJIA 3OOWA 1EZ4A 4CKYA 3DOIA 1ADBA 2Q0XA 3A05A 3OM8A 3OWHA 5AWFC 4KXXA 1GCGA 1T0BA 1G3UA 2O20A 2GEDA 2O8VA 2ON6A 3NHMA 2J67A 1NHGA 5AKKA 1Z73A 2QVZX 4I99A 3K9GA 4YUAA 1L7QA 1LQUA 1N57A 1FIUA 3ER8A 2WNHA 5KQGA 4BQIA 3I3OA 121PA 3EY4A 4JLAA 1EK0A 1RKQA 3TIIA 2AQKA 2B78A 3FIUA 2JF0A 4ZQCB 3EWNA 4E1BA 1I0LA 3W90A 2ZRFA 4EQ6B 5A71A 1N5IA 3C3BA 1V4VA 3DP7A 1RQRA 4UCFA 1H2ZA 1NU6A 1TU3A 1VE7A 1VG9B 1Z3CA 1ONPA 2X14A 2EEZA 2BSAA 4QDZA 2XGMA 3HBFA 4KLRA 5LNK1 3DO5A 2XOXA 2PMWB 2VDOB 3UENA 1SQGA 3TN7A 1C8VB 3KVOA 1AKYA 1JEYB 1JLRA 1B3RA 1Y8QA 1FQOA 2FW1A 1PNQA 3TKLA 1ZKDA 3MCZA 5CIYA 3HB4X 3PVZA 2G67A 2A84A 1JBEA 1NDUA 3OE5A 1TVMA 4DIFA 2CV2A 2D0OB 1QS0A 2NZ2A 1URPA 4M9UA 5C32A 2R1ZA 2CW5A 3U40A 3QWFA 2FXVA 4B74A 3S2IA 1Z83A 2PH5A 3VUEA 4JH0A 2QMUA 4HWSA 2C98A 1SUAA 3ELDA 1MABB 3FNQA 3KDSE 3MJDA 4KTTE 2YJ3A 2QZJA 4YI3A 4DPKA 2PUGA 2O2EA 4QGFA 2AN4A 2O3TA 4Z7OB 2KLBA 1EVLA 3DCIA 2JIQA 4DB4A 4TPKA 1BCSA 3I1JA 1VXRA 4P7FA 4X6YA 5JNLA 2AMJA 2O8EB 4NCAA 3RAGA 3WLAA 1AXEA 1DXYA 1O87A 1ML3A 1QR6A 2WJZB 2XYGA 4HDNB 5THQA 3TGWA 2OBLA 3ZDFA 2J3LA 4F12A 3M4YA 2P2YA 2ADOA 3T7IA 1C41A 1ENOA 3WSTA 2HWUA 4I5EA 3I9OA 2XH8A 4CDRA 5ICFA 4S2UA 1BQEA 1I36A 1MV8A 3BH0A 1G59A 4C03A 3Q0TA 4O5AA 3U17A 2VJMB 1T8RA 2FX5A 4AK9A 1G18A 3FUWA 1S0UA 4B0PA 2BGLA 2QAGA 4GI5A 2PNJA 3K0AA 3WLNA 5EJFA 1RWKA 2FN8A 2A0WA 4ZCLA 5ULLA 4BUJA 2H3HA 4GR4A 1OT5A 4OH7A 1FP1D 3MJRA 4XVQA 4UM9B 4K9KA 1LPSA 4GMGA 3IALA 2UDPA 1LZKA 3AVVA 1P3JA 4QSMA 4RVHA 4E32A 4BNGA 1ENZA 1WUKS 2NPFA 1CRPA 5FFFA 2HHLA 4KV9A 4EB8A 3PCTA 3BEDA 3VRHA 1N0HA 3OOHA 1PSZA 3JV7A 4QVKA 5GPBA 4ZGGA 5E8JA 3FRIA 2VQFB 2XRZA 2VAMA 1AGXA 1OXSC 2WSLA 3RPEA 3T06B 1E3WA 1ZCFA 4H4DA 1UM9B 3ENKA 2BH9A 1MX5A 4AMBA 1YUNA 2QVXX 4YAGA 1JQKA 2KWIA 2VYVD 3DA8A 3ODPA 1UPBA 4KR6A 4H60A 3JVVA 4H7KA 4KXNA 1UBLS 3RIHA 1WCIB 4KAAA 1AJEA 1TCUA 5K6RA 3AR8A 3LZCA 4IICA 1PIWA 2WMNB 4A7PA 2V1UA 5IVKA 1WMFA 2Y71A 4ZOCA 2ZBRA 1SIUA 1UXKA 1Y4SA 4MWDA 4BFYA 2IW1A 3PTLA 4YP9A 1SKQA 3HWWA 3DDOA 1Z4KA 4TGLA 2WRZA 3N0VA 4GLBA 1MC5A 4RH1A 5DBFA 2D00A 3DCNA 3I4LA 3B3AA 5FQNA 1E63A 1LDNA 3R8XA 4QLOA 4FYWA 5JIBA 3BXGA 2F17A 1Q7RA 4X92A 3GYBA 2I2AA 1TZCA 1M5RA 2QS9A 4CQMD 3A27A 3VUFA 3GRCA 4RIIA 4CPDA 3HP4A 1SUDA 2X2PA 4X95A 5FPHA 3NANA 1WDWB 4OHMA 5TQ0B 3UG6A 4NPHA 1ILEA 3SQXA 2D7JA 5F3DA 3DDSA 1NZJA 1ISIA 2FMUA 4MULA 2BR3A 1EVQA 2EW8A 3KLNA 4ER5A 5ALUA 5K20A 2GMWA 2C7VA 2K2WA 1TGVA 2W6ID 1U98A 1W5EA 5F5LA 3U9TA 2H2WA 2I4NA 1MMFB 3UT5A 3QXCA 3R3UA 2QG4A 4K1LA 3U4DA 1VP9A 1GGHA 3RAFC 3SEAA 4KO8A 1YIOA 3BMOB 1CUSA 1QFYA 5A3SA 4TWRA 1SCNE 2NU9B 2XCSB 5EWLB 3DUWA 1O94C 4MARA 4JNKA 4IMPA 3NV7A 1IVSA 2NXWA 4NOKA 4X45A 4F60A 4ETNA 3B2NA 2XMDA 2GPNA 3CO0S 3HZOA 3JWEA 4R9NA 1DWQA <