3T1OA

Mgla bound to gdp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
192
Chain Sequence
STINFANREINFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIGEVKGFKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Gliding protein mglA
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 60
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t1oA00
1XBTA 5H70A 5B57C 3KFVA 3AVWA 2GVDC 2FF7A 2RHDA 3K09A 1CIPA 4AYXA 3C4JA 4M9XA 3U3OA 3ICQB 3JVUA 2VHJA 2W6JD 3PUXA 2ZJYA 5G53C 2QSYA 2JJ2D 5SZJA 2HCBA 2AKYA 3UANA 2XZLA 2XEXA 4Q21A 3CLVA 1AGPA 3AVXA 1CR0A 1E9FA 1G7TA 2I3BA 3U44B 4AKGA 4P32A 3QXXA 1GAJA 1YRBA 2JLSA 1G3QA 4DRZA 1NF3A 1XTKA 1LF5A 2CEAA 2GILA 4G5RA 3GEHA 1YZGA 1KDPA 3MD0A 5B58C 3CZPA 4BRUA 1VCMA 3G82C 6Q21A 4Q5IA 4XH9B 2CVHA 1X8LA 1CP2A 5FTKA 4CEIA 1RJ9A 5AUOB 2FFBA 5IK2D 3HPRA 2QAGB 2VHQA 4BEJA 2HXYA 1OLOA 1Z0IA 5FTJA 2YWFA 3FTQA 3AF3A 1G9XA 4TYPA 3CM0A 2Q6TA 2LWIA 1T4GA 4IDHA 1WCV1 4RD1A 2EFGA 5J47A 5E4FA 1GKUB 4N3NA 2CLSA 2HF8A 4DLRA 1Z0AA 3BFXA 2FMXA 3HYRA 1KDTA 2WMNB 2DBYA 3DMNA 2QY9A 3IILA 3WYGA 4JLPA 4Q9LA 3BH6A 2JAQA 4GFDA 1G18A 2Q0HA 2ZJOA 4EUNA 3TLXA 3BFKA 3ASYA 3PXGA 3X1XA 1OXVA 3PUVA 4JL6A 5EQTA 1RRCA 4OL0A 4OJKA 2ZSDA 3NKVA 2PEZA 3MWJA 2WJVA 4MGYR 4S2EA 1G7SA 4BRWA 3RS5A 4OQMA 4EPTA 1YR6A 2HV8A 3RC3A 4IOJA 1Q1BA 1KY2A 5JECA 2RCNA 3CX8A 1MR3F 1KKLA 2HUPA 2G0TA 4QNRA 3T61A 4DEXA 3WY9A 3VTKA 1UKYA 3LQQA 4MDEA 2WPDA 1VCNA 1M6NA 3RS0A 1E99A 1W5TA 4G5SA 1Q22A 1VG0B 3NTUA 1P61B 2OCYC 1VYUA 3GLHE 4IRUB 5KSYA 2SHKA 4LBWA 5F9HA 2OO7A 4HUQA 1DG1G 1G3MA 1C1YA 3SZRA 1KZGB 3LAWA 4LPKA 4QBGB 1ZD1A 4Q47A 2NO1A 2RH5A 3OAAA 4OI1A 1YR7A 4TMWA 5L8VA 2GJ8A 1F5NA 3QJYA 4URXR 1LB1B 3ADDA 1JECA 3FOZA 4GP7A 2RGNA 2C9YA 4DHEA 4ESVA 1YKSA 2WOOA 3DKPA 4BZXA 3R7WB 4DSOA 2IC5A 2P6UA 5FUWA 2QMUA 2AD5A 4RY2A 4Q7KA 4JL8A 3TVDA 2BHRA 5FL3A 2UVQA 3VR2A 4KJZA 2NO6A 4B74A 1H8EA 1NN3A 1X1SA 2IF0A 1KTVA 3DM9B 4HAVA 4Q7MB 1I2DA 3AVTA 4JZKA 2J3EA 4PO8A 3E1SA 3VNUA 3IQWA 2G9NA 1T5IA 2EFDB 3Q5EA 5JRZA 1SVMA 5EE5B 3TAHA 2J7KA 2A5YB 2ZR0A 3L8YA 3NWJA 1VKJA 4MRRA 5DNYB 5L3QA 3CR8A 4TTRA 4FMCF 1K5GA 1U81A 4Q1EA 3FFBA 2FZLA 4D81A 2V4ZA 3OEEA 3U6KA 2V8OA 4FXPA 4AIIA 4U02A 4A4DA 4Q18A 4P4UA 4MKGA 5GJBA 2KBFA 2X8AA 3B7GA 1I4TD 4LV6A 3WRYC 1U0LA 3RWMB 2Z4SA 4IOLA 3R9IA 3VX3A 2GEDA 2AX4A 2OFWA 4B6EA 1HV8A 4PHTA 2WWYA 1YE8A 4ACBA 2JCSA 3CPJB 2ZJBA 3OE7A 2VQSA 1KMHA 3BRWD 1A5TA 1CKEA 1L2TA 5DIFA 1W4AA 3RS3A 2ZM5A 1UJ2A 3THYB 4Q1CA 4M0LA 1GDDA 4DLTA 3Q3JB 5FPKA 3P26A 4HAZA 3IEVA 821PA 1E69A 1GKYA 4GDFA 3UIEA 1FTNA 3HU3A 4MQBA 4NYMQ 1NIJA 5FOWA 1MO3A 2ZROA 4LJAA 5FTNA 2YV5A 5CK4A 3CX6A 4OQXA 4E22A 1AA9A 2RGBA 5LD2C 2O8BA 1W1WA 4WA7A 3CF0A 4LYAA 3TSWA 5E7JA 4AG6A 4OI4A 2PBRA 1ZM4A 2JATA 3OIYA 3I32A 3GLFA 1E0AA 5TMPA 5LB2A 2DWOA 3QKSA 2HJGA 5DI3A 2ZRBA 3KJIA 2A78A 1SXJD 1I2MA 4WZBE 4PZYA 1UDXA 2QU8A 1E2DA 4A2WA 4JVLA 4PPQA 3WNCA 3IEUA 1WA5A 2C95A 1D5CA 1P9RA 3FGNA 4LHXA 4M53A 2NPFA 1W36B 1XD2B 1XMJA 4JLBA 1S2MA 1WMSA 1JR3A 1LVGA 2IEYA 1P9NA 4BUJA 2QL6A 2WAYA 1WQ1R 1E2KA 4PZZA 2YKGA 3EX7C 2FSIA 5FUVA 4R2IA 3AKDA 2H57A 3SE0A 4K46A 5E7IA 2RGEA 3A4LA 3PR1A 3GJ5A 2VP0A 2ZRNA 1NNEA 5SZIA 5CJPA 3AGPA 2C04A 2VP9A 2XXAA 2ZRKA 3TH5A 1BIFA 1EWQA 1P7CA 2ZSFA 1TX4B 1P4SA 4PQFA 3SJZA 4PPNA 1Z08A 4KCGA 1XDBA 2BMFA 3DHWC 3IHLA 3HP1A 4TMTA 4L9WA 1B23P 1GVNB 2GZAA 1WF3A 2KI5A 2C96A 3M6AA 4RCYA 3D31A 2R2AA 2QNRA 1ZVQA 3I61A 1Y63A 3X1DA 2MMCA 3RVBA 1EWRA 4EPRA 1EFRD 1IQPA 2KSQA 3SI7A 2VEDA 3K53A 1FX0B 3GD7A 4FI3C 5JWRA 2VP5A 1N3BA 1PVOA 1P60A 1ZUNB 2FJUA 4WIAA 4CT5A 4P0TA 4M9QA 3LVRE 1NN0A 1ZCAA 2EWVA 2C5LA 3B6EA 1U8YA 4JLMA 5JS8A 1UPTA 3U2QA 3FPAA 2BJWA 1S9HA 1WDTA 2WWXA 2ZS8A 2IYRA 3BXZA 3FFAA 4M1OA 4XD7D 2XAUA 3LXXA 1KJZA 4DVGA 2ZYTX 3L0SA 3PITA 4OHXA 1FQKA 5BYKA 3QPVA 3O8BA 4DDWA 1YHNA 3OZXA 5CDFA 3GLIE 4DUGA 3U61B 1IY0A 3HR8A 1G64A 2ANCA 4Z1MD 3P20A 1NBMA 3RDPA 1V5WA 3Q72A 4EQ6B 2RAPA 3C7KA 3DO6A 1KZ7B 3A8TA 2BBOA 3L0PA 1QDEA 1XMIA 4OHWA 4QG7A 1Z28A 2AXPA 4N1AA 3O47A 4EJSA 4TYNA 1UBFA 5J4YA 3E2IA 2FNAA 4US1R 1RVDA 1ZM3A 3MLEA 2ZJ5A 3N2IA 5FL7A 4ZKEA 4MDFA 3SJBA 4MITA 1IXRC 1CJMA 2F43A 1JR6A 4PHGA 2VL7A 5JCPA 4JKIA 121PA 1OIWA 3D7MA 2FSGA 4XTCS 4CEJA 1PLJA 2FFQA 1I4LD 1Z8FA 3NG1A 4X8LA 4D6PA 2J87A 4JBXA 3IBYA 5A5GA 3PEVA 3K0FB 3CH5A 2ZR7A 1EFTA 1EG7A 2WAXA 2O8DB 1GTVA 2VP2A 2H18A 4UKDA 5CYPA 4MKIA 2P3SA 4NCKA 4PPGA 4OHZA 1R8SA 5A0FA 1CEEA 1IY1A 1JPNA 1N2CE 2GCNA 4ILEA 4KODA 4GMDA 1QF9A 2VP6A 1A1VA 2DYKA 4P4SA 2OCAA 5TV2A 3TAUA 4Q00A 4R71A 2LCFA 1YZLA 2IHYA 1H8HA 4A82A 3THXB 2QROA 2V3CC 2O52A 4IDQA 1M2OB 5H1YA 1DO2A 2ANBA 2OXCA 4DIEA 2IS6A 1U98A 5C1BA 2CNWA 1N5KA 1IHUA 3KKNA 3B60A 2FSFA 4LJ5A 3KUDA 2XSZD 4IEEA 5KDDA 2XTZA 2FV8A 1R7RA 1FTSA 3EZ7A 3TBKA 1JPJA 2FN4A 2JDIA 3OIVA 1QHHB 4RFSB 2IWRA 3QVUA 2BM0A 1MKYA 4JYCA 4QL3A 2GK7A 1KI7A 3A6PC 3THOA 4M1MA 4A6PA 5KSZA 3P4YA 4AD8A 3SEAA 1ESNA 1G5PA 1G4UR 1R0ZA 4XWKA 4B3GA 2OAQ1 1L7VC 3CKLA 4XOIA 1IOZA 2QMOA 4FCWA 5DGXA 1G1MA 1P62B 3OHMA 2ZXUA 2JIZA 5IRCD 1SVIA 2J5XA 5DHAA 1G8HA 4CDGA 2O8EB 3WXMA 4B47A 3ZVLA 3K0AB 1LNZA 4US0R 2BVNA 2GCOB 4Q1DA 3TR0A 3I5YA 1OXSC 2ZI3A 2FDCA 2O8CA 3B78A 4I81A 2LKDA 1DAHA 1DAKA 4BLOA 2XNSA 2R6FA 3KJHA 1XEFA 4D0LB 1M7BA 4ZIRA 4DWJA 3LLUA 3KX2A 4LV8B 2O8FA 1G20E 1ONBA 1MT0A 4NONA 2J0UB 1P2SA 3MMPA 4ZCLA 4I1OA 2ONKA 3B1YA 3K8YA 4PTLA 4HSEA 2CHGA 3CUEF 5KUTA 5HKKD 4B3CA 3QVVA 4Q02A 3O8CA 3VKWA 2IEZA 1SVLA 5TDHA 2PZEA 4PR0A 4M8NE 5BN3A 1IXSB 4LJ6A 3IIKA 3MWYW 1HEIA 2XTMA 4DCNA 1UBCA 2ZJAA 3AUXA 1E2JA 5GJCA 2YWHA 1RC8A 2AHOA 4B6FA 2A3RA 5TVKA 4ABYA 1UFQA 3GEEA 1ZU5A 3KKOA 3OEHD 3RSOA 4V0NA 2MSCB 1COWA 2OILA 2A5GA 4DLXA 3WMEA 5KOYA 3A1TA 3CZQA 5FR2A 4QJ4A 5P21A 2C2HA 4U7DA 1VHTA 1XF9A 4W5JA 4D0GA 2ZQ5A 1Q57A 2QTVB 4V03A 3SOPA 3SHWA 1N6IA 1TQ2A 3FKSD 1PLKA 3PJRA 2OFXA 2REOA 3MGCA 4OYHA 4P33A 2WTUA 2GEVA 1JB1A 3FDIA 1TUEA 4QJ5A 3QXSA 4TSFA 3VHLB 4ASUA 5JBQA 1XPUA 3ZIAA 2QENA 4XSGA 1SXJB 4C3ZA 1TL7C 2JGNA 4L16A 1U94A 3CRRA 1W0JA 4IDNA 4OK6A 4ZDIA 1Z06A 5FUYA 4QNMA 1Q21A 2WSMA 2XITA 1KK1A 3BOSA 1XMVA 1ZUHA 1P75A 4I1VA 1DAEA 3LW7A 4NL4H 3HR7A 3ZH9B 4MUBA 1DAGA 1BMFD 2F1IA 3L0IB 5DSZA 2Q3MA 3T06B 4B71A 2WZQA 3KFXA 2QM8A 1E9BA 5DYGA 1Z6AA 5AR1A 1J90A 3S1AA 3LX5A 4Z51A 1YQTA 3QQ5A 2RGAA 2GEUA 4PFSA 3UMFA 4QM7A 1N0UA 3OFND 3IIMA 3TUZC 2WKQA 1G19A 1M8PA 4TMZA 4Q66C 4V0LA 2PCLA 3TKLA 3I73A 3VAAA 4C7OA 2ZRIA 4JLOA 1CTQA 1TQ4A 2W2VA 4X8MA 4KV9A 1DOAA 2IW3A 3QF4A 2WJJA 1XXHB 3P1JA 5FBQB 1S4QA 2X1VA 1DVRA 2GJSA 4WBSA 4OHYA 2ZE7A 3PIRA 3KTAA 2PX3A 2XJ4A 3LFUA 5H68A 3AF2A 3BE4A 4GOXA 1OXTA 1CULC 2WMOB 3HPQA 5KNBA 1G4AE 1N6PA 1QHXA 4BLSA 2JJ1A 3FMFA 2H92A 2IXEA 2FX3A 1Z0DA 2ZRPA 4RZXA 5C2JB 2BIFA 3P32A 3PUZA 3G5UA 4Q1FA 2QP3A 1E2LA 2V9PA 2Q9AA 2EFCB 2WJGA 5JS7A 4YMSA 2RHMA 1F2UB 3N70A 4DLWA 5FFMA 3CH4B 5DN6A 4HDCA 4JYBA 2ZYUX 3H1TA 1XCGB 4CGZA 1E94E 3HJNA 3PENA 3TNFA 1D6JA 3DDCA 3RRYA 1W0KD 2ZRFA 3KKPA 3DOFA 4M9ZA 5G3YA 4BASA 2WWIA 2WSSD 3BWDD 4DCSA 3ASZA 5AJYA 4BECA 1P73A 4I99A 1OFIA 1DG3A 3I8SA 5AJXA 721PA 1NSTA 1P2UA 1T8TA 4DJTA 421PA 1SKYB 2AD1A 4D2IA 2EYQA 1TQDA 2PH1A 4FMCB 2IS2A 4H1UA 4NCIA 1FNMA 5GADl 1ZC4A 1N6OA 3ONWA 3LWNA 2IYZA 3U7HB 4A15A 1IONA 4QJ3A 1P2TA 5JSZB 1VCIA 4M1KA 4BFUA 1J70A 1E2PA 1US8A 3OF5A 4B48A 3DKVA 5G3ZA 1OYWA 4ZPXA 3RHFA 1E0JA 4D4MA 4TLEA 3NBFA 3GFTA 4QGHA 2FPKA 1JJVA 1M7GA 3MRSA 1OB2A 3CBQA 3I72A 5L3VA 3CW2A 4H9GA 2FWRA 2W6ID 4A36A 4V02A 3ZGXA 1NKTA 3A1WA 2QI9C 4TT3A 1G8GA 1G6OA 4OBEA 2VRWA 2FGJA 2GZHA 1P3JA 1XTSA 2FE4A 5CITA 2HYIC 2ZE8A 1S3GA 3I8XA 4URWR 3VQTA 2W6JA 1ETUA 3BH7A 2QPAA 2C78A 2JJ2A 2GESA 1OH5A 2G1JA 3QKUA 3T15A 4A8JB 1W36D 4KLZA 3TGPA 5F98A 4HB3A 3LH5A 5E95A 2DR3A 5HE8A 1N6KA 3MUFA 1XNJA 2XB4A 4C9BA 3JZMA 3PVSA 5HCIA 1ZYUA 3UMSA 1AQUA 4TTQA 4HATA 3RS4A 2OG2A 1SVOA 2P5TB 2OZEA 2FA9A 4LHZA 1SZPA 1U99A 1FX0A 4FMDB 1RYFA 4JLVA 3EC1A 5FOVA 3X1YA 2QRNA 4AYTA 4PAOA 1GM5A 4YDSA 2AK2A 4PXAA 1ZNXA 4C30A 3K9LA 3GFOA 4RKEA 5M04A 1OJLA 2IUUA 1E2NA 4V0KA 4A0RA 5BWMA 1TAGA 3LLMA 4FN5A 3MCAA 3QKRA 5J4VA 5HPYB 2YJTD 5DE3A 3GJ0A 2GJAA 2ZPTX 5FBVB 2C03A 5IDVA 4OK5A 4PC3A 4DSTA 2BCJQ 4PC1A 5EJEA 2OBLA 1E2GA 1NMZA 3AVQA 1HH4A 2ERXA 2EW1A 2DFKB 1HA3A 2J7PD 2O5VA 1XP8A 3I62A 1CJUC 2ZREA 4RZUA 1EX6A 1KSHA 3SJAA 4PZLA 4D4JA 2FH5B 1FMJA 2Z43A 1Z3IX 1UADA 4ZV4A 4O2RA 2ZRLA 4B73A 4RD3A 4IVRA 3G0HA 4F7WA 1IY2A 1E2MA 3GEIA 4FWTA 2QMHA 2R6AA 3UWOA 4AK9A 4LSGA 5EE9A 3X1ZA 2J0QA 4KBGA 2PZFA 2QAJA 4C0HA 3Q8XB 3U4QB 2WIBA 5SZHB 2G0NA 1E1RD 1J7KA 1TQ6A 1X1RA 2CLCX 2ZR9A 1UBEA 1VG1A 1NL3A 1GKIA 1NN5A 1S9DA 4KYUA 4HZIA 5FI1B 1T5LA 1NJGA 4Q4JA 2A30A 2IYLD 3BGWA 1KNQA 2ZVQX 1X6VA 4TZ0A 2B8WA 4KHZA 4NYJR 3FYHA 3T1OA 4A6XA 1W5SA 2FFHA 5K8LA 4RD2A 1Z22A 3BIFA 2V54A 2GWHA 1T3HA 3OIUA 2ZU6A 1XEXA 3EWAA 1F2TA 5C18A 1XEWY 2GF0A 1K8RA 1MABB 5AUPB 3JZAA 2OCBA 3M4YA 4BLQA 1KI3A 1R6BX 3CWZA 3GLGB 2I4IA 3HDTA 4BQSA 2JLYA 2H7VA 4G5GA 4NBSA 3AB3A 3AP1A 2FPMA 1S3SA 1OKKD 1II8A 2WJYA 4Q9IA 1TMKA 1MO5A 2P67A 2IA5A 4TL7A 3ZZTA 1RRPA 4XWOA 2H17A 3WHKA 4A0HA 3AGQA 1S1CA 5BN4A 4BFSA 1HT1E 3VU9A 4MGZR 2JLQA 5JLJA 1G8YA 5FPTA 4QHSA 2VHCA 4D80A 3OESA 3B9PA 3R8CA 1E98A 1OF1A 3LO5A 3UG7A 1TU4A 2ZRAA 1L8QA 1TU3A 2ATXA 4LYJA 5KNCA 1XMSA 4LYHA 1G6HA 4AG5A 1E32A 2DB3A 3AVOA 1U8ZA 1CJVC 3KJEA 3IPXA 4XVUA 3U7EB 2Z83A 4LC0A 4YXWA 3GFPA 1OH6A 3L8ZA 4IOKA 2N42A 4Q4HB 2YNMA 5KO2A 4HLCA 2QAGC 3AUYA 1GZSA 1G7RA 5FPYA 4PSAA 3SC3A 5D3MA 2YOHA 2PX0A 3BC1A 2P65A 3GLHA 4JLKA 1E0KA 5ELXA 3A4NA 2AWNA 4NKRA 5JFGA 1CRPA 4G5OA 3DM5A 4URZR 3EXAA 2A2ZA 5IT5A 5KHOC 3C16C 1RYHA 4PC7A 1GITA 4QOSA 3WBJA 4A2PA 2C8VA 4ESHA 4Q4LA 1QRAA 5FI0B 3T1VA 2Q21A 1HURA 1OW3B 4HZUB 3QXHA 2V1XA 3NC1C 2QGNA 3SR0A 2VF8A 3AF1A 1YZUA 3KXLA 4KVGA 4BFXA 1JAIA 2CVFA 2WWFA 3LVQE 1KO5A 2YZ2A 4X8OA 4NCNA 3KUCA 3BB3A 2BM1A 2N1BA 4Z54A 3SYKA 1R5OA 2WPDD 1WXQA 5CM9C 5CYOA 1EK0A 3DPUA 2EQBA 3FMIA 2F3RA 4XWAA 5K8TA 2GCPA 4TQ9A 1OSNA 5CJ2A 1SXJE 2G3YA 1E1QA 1G3UA 3M0EA 1SQ5A 4Y0AA 1NVVR 3U3JA 1T0HB 2OM2A 2HYDA 3VNVA 2ZRGA 2YINC 4ARZB 3B1VA 4H1VA 1BOFA 2CCJA 3FMOB 2ZI6A 3RLFA 1XFAA 3UPUA 2BMEA 3DOEA 2ZUCA 4EPXA 5L3SB 4LGMA 1BKDR 1XTIA 1Z0JA 2WOJA 4M2LA 2P6RA 1WP9A 3EA5A 1GL9B 5FOTA 4DT1A 3L82B 3I1FA 1UKZA 2EFHB 4DLUA 1KI6B 2C9CA 2FZ4A 1JQLB 5UKDA 4CIDA 1Z07A 2W83A 4UJ3A 1H8ED 1ZAKA 1JXMA 3RANA 4DB4A 1XXHE 2D3WA 3EA0A 1W47A 2EWWA 3B1ZA 5HCNA 2OCPA 1AQYA 2YWGA 4LCBA 5EUMA 2PL3A 1NP6A 1M34E 1ZP6A 4IHQA 4LK2A 1OHHA 3FE2A 1OIVA 3LBNA 3SFZA 1PV4A 4CEHB 4KSCA 4ZDJA 2WBLC 1OH8A 2ZJ2A 1WBDA 4C4PA 1KI1A 2QZ4A 3QSYA 4TL9A 2DCUA 1N6HA 2VF7A 3THWA 1NVXQ 3NH6A 2UZIR 1E79A 4PO1A 4GZMA 5TY0A 5DYIA 2D74A 1EFRA 3NHAA 2CL7X 4PQYA 1EGAA 4JT4A 4ZKDA 1UAAA 1MRSA 4LHVA 2H16A 1A4RA 1KNXA 3BH0A 1W4RA 2HLDD 2OUKA 3OE7D 5AUNB 4B76A 1FW6A 1DPFA 2KJQA 3EAQA 4YMVA 2QQEA 1TF7A 2ZRCA 3QF7A 3EPJA 2PMKA 2JEOA 2OXRA 3CR7A 4IDOA 4TWZA 4RCZA 3MWLA 3WP1B 1KYIA 2P6NA 2OBMA 1Q1QA 4PSVA 3CNNA 3TSZA 1N6NA 1SKYE 2J59A 4Z1MA 4V0ME 3AV0B 5HE9A 3NH9A 1LY1A 3MG9A 1RRFA 1GL7A 1BO6A 4GP6A 3AF4A 2ZUBA 2XZPA 3SU8A 5GJWC 3SJCA 4BWYA 2Q3HA 4KSBA 3EG5A 3GJ6A 1P2VA 2CL6X 4F4IA 2HF9A 4L9SA 2RGGA 4DLSA 1IJEA 2CXXA 4QM6A 3NC0C 1O87A 1II9A 2IK8A 4LHYA 3B5JA 4Q4AB 1W44A 4A1FA 4IW3B 3FKQA 3BORA 4FIDA 4B3DA 3Q85A 1Z0KA 5K8IA 2NO0A 4W7SA 1VG8A 2E9SA 5K8UA 3K9GA 1Z5ZA 5E3HA 4LRWA 3CWQA 5CLLA 3T1TA 2X2FA 2YWEA 3K9HA 1LTQA 4M21A 3MFYA 5CB6A 4G5QA 3K1JA 2WWGA 5G40A 3PEUA 3CPEA 1FNNA 5JWOA 1D9ZA 4PC2A 3RAPR 4C0JA 1GIAA 2OT3B 1W2HA 3C41J 3GCGA 1W36C 1D8TA 1OT3A 3NBXX 1N5IA 2QMEA 2QBYA 3NXSA 1AS2A 5KPJA 3KXKA 1GWNA 3F5FA 4FCTA 2ZANA 2BKEA 2CJWA 1BS1A 1GSIA 3GLIA 2PJRA 1ZU4A 3MJHA 3PG5A 1I4DD 2D06A 4JKYA 2IYYA 4HLDA 4GOKA 4M9SA 3NBYC 1T0JB 3AH8A 1ODFA 2DWQA 2DWPA 2MSEB 1NLZA 2OE2A 2PLFA 4JSTA 2BBSA 3TIFA 5KDOA 1OFTA 3T12A 1ZNYA 2XOKD 3MJRA 3QIAA 4DSNA 4YLGA 1MV5A 1KI2A 3ADKA 2QQ0A 3LXRA 4HB0A 2GK6A 1OH7A 2JJ8A 3D3QA 2EFEB 1U9IC 2GBLC 3LX8A 4JVNA 4LJ4A 4LOAA 4CEIB 1RJ9B 3NDBB 4PANA 4F4JA 2F1HA 1GRRA 1D2NA 4M1WA 2YC2C 4TMXA 4ZO4A 2ZI5A 1Z6TA 3PUYA 3R9XA 3BAFA 2ZTSA 3TK1A 4GMXA 2JASA 1NLYA 221PA 3CO5A 3T34A 4MUAA 1XCPA 1YR8A 2BV3A 4A92A 1AZTA 4MYUA 4Q48A 2DFNA 2ZAMA 1XRJA 3T5GA 1M74A 2GF9A 2JLXA 3U44A 2ZJZA 1EESA 4JLNA 1CLUA 4F4CA 4IXNA 3ICEA 2NQ2C 4BFVA 4E07A 4OI0A 3WHLA 5FL7D 4XIGS 1J8YF 4I1UA 5LB4A 3D6TB 2QT1A 1FUUA 3A58B 5GJVC 2DFTA 2V6IA 2ZI9A 4NDZA 3KKQA 1SULA 3V00A 1NG1A 3SYLA 1IN8A 4HB4A 1E4VA 1NI3A 4GZLA 2HXSA 3B9QA 2E87A 4IKEA 4MH0R 3VKHA 4R9UC 1AIPA 1TF5A 1VG9B 4DEYA 4GBMA 4GRAA 2PLRA 2PCJA 2QAGA 5JI2E 4YMUA 3C14C 4RD6A 3ND8A 4URVR 2QE7A 2BCGY 2EU8A 2REBA 2ZUDA 3CNLA 3U3RA 2QA5A 3B85A 2GKSA 5CIWA 3RS2A 1ZC3A 4OQLA 3GLGE 2DY1A 4C0SA 4HI0E 1YJ5A 2X19A 4M1SA 4AKIA 3ZD6A 1YZTA 1YZNA 5TARA 1AN0A 3JVVA 4GNKA 4KYIB 2IL1A 1G5TA 2TMKA 1H8HD 3KKMA 1Q1ZA 4HAXA 1YRAA 2GZDA 2K5UA 1U0HC 4HUQB 1T3SA 4ZI2A 3EASA 1B0UA 2Y8EA 4A9AA 2CNWD 2JA1A 2R6GA 4DSUA 2F55A 4ZI3A 1CRQA 2Q9CA 4K8OA 1KY3A 3FKSA 4HB2A 2NTYC 2JDID 2B6HA 4BFTA 4C0QC 3IO5A 1G3IA 1GNQA 3UG6A 3BBPA 1X8KA 2GAAA 5LDDC 2BEKA 2FOLA 1IN6A 2QP4A 1IXZA 1TEXA 2F9LA 1ELOA 5JJIA 2OV2A 4HAUA 4B43A 5KTYA 3WMGA 1BMFA 1OV4A 2RGXA 2F1JA 3QBTA 2WWHA 4QFMA 3RRZA 4F38A 5CIQA 2J45A 1UDWA 3LRPA 4MGKR 2CK3A 2NZ8A 5J4HA 4Q7LA 5HZKA 4B3XA 1ZM9A 2VHTA 1DELA 1ZMXA 5BXQC 2OLKA 1ZIPA 1T91A 3QUSA 2QN6A 3KZ1E 2IYWA 2OESA 3ZVNA 4D0NA 2VYFA 1K5DA 1KSJA 1L4UA 2ZE6A 2ATVA 3OFNA 5L3QB 2D62A 1OPXA 2YC4C 1ZM7A 3EZ6A 2R9VA 3RYTC 2OEPA 4O25A 3VHXA 4PPFA 4TMVA 3ETLA 3W6OA 2BWJA 3PFIA 3NBZC 3R7WA 4UXHA 1YU9A 5DO9A 4RFVA 3FHTA 1CR4A 2NOAA 1R4AA 1NMYA 4KFSA 1VIAA 3K0EA 1JEDA 3VR5A 3H2YA 1DTSA 2NPIA 3SQWA 1WBBA 1NY6A 1KSFX 2OSBA 1S8FA 4C0AC 1KMHB 4E5UA 1LFDB 2MSDB 3QE0A 4QC2A 4ITRC 1QHGA 1CU1A 4B32A 3L0OA 1UEJA 1AZSC 1IM2A 2XNDA 4LI0A 1CF4A 2CCGA 2ZVPX 2ZYWX 3QXCA 1R10A 3SFVA 4KBFA 5AJWA 3SYNA 2IS4A 4ON9A 1COWD 2Q9BA 5L3RA 1KAOA 1OXXK 1TADA 3I3SR 2AL7A 2RGCA 3KB2A 1HYQA 4M1YA 4RZ3A 3AKEA 1Q12A 2O8BB 3QEJA 1V43A 2H1LA 1KIMA 1A7JA 2HDNB 1W0KA 3MAAC 3GLFB 3IPYA 4TSFD 1ZW6A 3QKSB 4D4KA 4D25A 4Q9HA 5DI3B 1R0YA 2V1UA 3RABA 1VMAA 2OBNA 4QGFA 1P6XA 1W0JD 5EP4A 4B34A 1KI4A 4CRWB 1RFLA 2O0JA 1Z47A 2QT0A 3KB1A 4OQFA 4KFUA 3BS4A 4W5HA 3THYA 3K70B 2IUTA 3B82A 4LYFA 2VLIA 4JJKA 4NZYA 4AKHA 3GJ7A 3P27A 1QBKC 1NKSA 2BC9A 1E9EA 3DVLA 3EIEA 1SXJC 2V7QD 2IYVA 2HCJB 4FINA 1N5LA 3TQCA 4TYYA 3SHFA 3AF0A 5EP3A 4GL2A 2G88A 1FQJA 1NSFA 1U0JA 5EE0A 3ADBA 2XXAB 1J99A 1KJYA 3MWKA 3W8RA 4FMBB 2VA8A 2Q3FA 1DS6A 3LBHA 4MRVA 4U5XA 1LS1A 3R20A 3RRNA 2A7QA 3Q7QA 1MO4A 4YQFA 1HTWA 2LKCA 2BEJA 1BH2A 2IYQA 4KO8A 2ZAOA 1NIPA 4UNRA 5FUXA 4DIDA 4F93B 3O8DA 2J9RA 1E96A 1XD2A 2GXQA 2KE5A 2OLJA 1HQYE 2W2TA 4G1UC 4IVPA 4IVQA 2D4HA 4LC1A 5FTLA 2ZITA 3N5CA 2F9MA 2J41A 1ZUIA 1AM4D 3PEWA 1XZQA 2GVZC 2WKRA 1ZIOA 1KGDA 1AS3A 1UKVY 1KO7A 4LWZA 2GTPA 5JI3E 1EXMA 3WMFA 3GQBA 1E9SA 2D2EA 2NGRA 3EIHA 2PEYA 4IEIA 1RRGA 4EPVA 2WV9A 2D2FA 2ZI4A 4GPTA 4PQRA 3EW9A 2ONJA 2R8RA 1DAIA 1DO0A 4B75A 5BN5A 3H4MA 4YDHB 4F91B 3K0CC 3CRVA 4Y0VA 3VR1A 3EPHA 5DN6D 3CF2A 3A4MA 1U9IA 2G1KA 2GBLA 1GILA 3KQNA 4BLPA 2OFOA 4EJSB 1EFUA 4KXFB 3HU2A 5EXPA 3W5JA 2J0SA 3LQRA 1SKQA 4FW9A 2ODWA 1FFHA 1HT2E 1VTKA 3PV0A 4IDPA 5EXXA 4IOMA 4C2TA 4UQOA 3KQHA 1CJKC 1NVUQ 1R0WA 2BBWA 3W90A 2W00A 3LD9A 4LDJA 3RC8A 4KITB 1FL9A 1F60A 3I5XA 4CEJB 1JALA 1M1YE 1FMLA 2ORIA 4Q1BA 4V0OA 3UWKA 1ESMA 1AGRA 5IK2A 4JLJA 1TF2A 5JWHA 2JLWA 4QRHA 2WKPA 2ODBA 4PAQA 4QBFA 1KOFA 1S1MA 1E0SA 2IXGA 2VTKA 4ERNA 1Z63A 3WP0A 2IBMA 5F2EA 1IJFA 1EFHA 1XJ0A 1ZCBA 4ACAA 5AJZA 5DISB 5KDLA 4POAA 2DPXA 4EQ6A 3T5DA 3GP8A 1FP7A 3AKYA 1AJEA 2C98A 1RKBA 4P4SB 4YMWA 2IUSA 4TT3D 3M1IA 5FR1A 1Z2CA 3SS8A 1F6BA 2RKOA 1T9HA 4B2PA 4DLZA 3AM1A 1J8MF 2X2EA 3TSOA 4MRPA 3ZS8A 1VIYA 3LV8A 1XD8A 4ZDWA 1DE0A 5AJVB 2IX3A 2GRJA 4UJ5A 4WOPA 2GXUA 2EYUA 5J5CA 3UKDA 3VMFA 3VFDA 3PCRB 2AFHE 5EZ5A 4TL6A 1CJTC 4UNNA 4O0MA 2V55B 2QORA 2ZRHA 1OKKA 1G21E 1S96A 1DAFA 3K0FA 2ZEJA 3WNDA 4ZDKA 2CHQA 1T8UA 3ZD7A 2O8DA 2VBCA 1GG2A 4L15A 1G17A 4BLTA 4HDQB 4D4LA 4A8JC 1EFCA 3SBEA 2W58A 4HDOB 2IYUA 1OB5A 1A2BA 3WBKA 4D82A 4EJSC 4NYIR 2DHRA 1DADA 4MRSA 4R98A 5B2ZA 3THXA 4MYCA 1KK2A 4HLUC 4OI2A 4NYJQ 2D7CA 2ZS7A 3HU1A 3LBIA 3BERA 2O8CB 4FWIB 4C0BA 2W0MA 2R6CA 4NYIQ 4Q19A 2Z5FA 4TL8A 1ZD8A 3VR6A 3W6NA 3V9PA 4JIMA 5FOXA 1G8PA 2WJHA 3PQCA 4ZIRB 3QNUA 5KU1A 2ZSEA 1QHHA 4PAMA 2HJVA 4RFSA 4DLYA 1RW4A 4TN1A 2FEOA 2WM9B 3CRQA 4QBHA 1N0VC 2O8FB 2A5FA 4LJYA 1NY5A 1XB2A 5KSOA 1ANKA 4B44A 4JT2A 4S35A 2IT1A 1HE1C 3F8TA 1D2EA 3OIWA 1XPRA 4F92B 2VP4A 4XSHA 2G77B 4JL5A 4NMMA 1G41A 1FP6A 5BW8A 3C5HA 1ZBDA 2O8EA 4WZ6A 3QPUA 4TQUS 2JLVA 1MO6A 1YZQA 2D7DA 3SNHA 3K0AA 4AC9A 2GCOA 3KL4A 3TRFA 2W0SA 4NTZA 1GFIA 5JJKA 3NEJA 1KAGA 3A36A 2J46A 5CK5A 2G6BA 2PMDA 2JLUA 3P4XA 3FWYA 4LJ9A 3AVVA 4A2QA 2VH5R 3DZDA 2ORVA 3WYAA 4KFRA 1EX7A 3K9NA 5JEDA 4PO9A 3ZVMA 3ZYCA 1XTJA 3DZ8A 5DHFA 1G291 2CHVA 2BMJA 2J0UA 1F3OA 3AP2A 3C8UA 4L4UA 1A82A 1P5ZB 2PZGA 2GAOA 4XVQA 5F3WB 5C4GB 5FTMA 2FGKA 4US2R 4AI6A 4YONB 5J4LA 1LF0A 1JBKA 4LZZA 4IJMA 1SHKA 4NHOA 4EIWA 1D9XA 3A1UA 3AVPA 3I4LA 1XPOA 2R44A 3V4FA 5JEEA 3SN6A 4TLAA 3FMPB 4MKFA 1G16A 3REGA 3A1VA 5JJLA 1IBRA 3LW8A 5LD2B 1U90A 4QGGA 3U6BA 2IHBA 1K6MA 4MYTA 4LX0A 2ZI7A 3CRW1 1SHZA 5FBWB 4B3BA 3NIBA 3EPLA 4N0EA 4JSYA 3X2SA 4L5BA 4AURA 3U7FB 3FHOA 4Q9KA 5J40A 3S1AB 1RPZA 4LUCA 1E4YA 4YXWD 4KLNA 2HT6A 3B13B 3ZJYA 3OAAD 1GNRA 1KKMA 4IFEA 3J81k 1XEWX 2O0HA 4MKHA 3W6PA 5BQ5A 3ZDQA 5GVSA 4BFZA 5KYKA 1XCMA 4C7OB 1E9DA 3QEOA 1VHLA 4JJZA 4NP6A 4PHFA 3QF4B 1NVVQ 1SXJA 4OHVA 1FUKA 4BPBA 2PT7A 2FSHA 4GT1A 3TW4A 3EC2A 4NCHA 5EP1A 3VX4A 3KTAB 3Q7PA 4DDUA 1KK3A 1TPZA 1HY3A 4G3XA 3IHWA 4DB2A 1AKYA 1JEEA 4BEBA 1W4BA 1Q44A 4R2HA 1P9WA 1N25A 3CNOA 2AWOA 4RSGA 3AVUA 1G3RA 2ODEA 3T35A 1VYVA 3CONA 2ORWA 4QHTA 2HLDA 4NYMR 1KHTA 3ZZUA 1WE2A 4Q7JB 5JHHB 4X8HA 4RD0A 3C5CA 4CVNA 3GLFE 4WXRA 2A5JA 5FPHA 2C9OA 1D2MA 2P2LA 3OEED 5JHGB 2VHUA 1VCOA 3ZQJA 5EE3A 1ZM2A 4MGIR 4AWXA 1E1QD 4QKQA 1XXHA 4BZPA 4P31A 3KQUA 1X86B 3NDPA 4L8GA 2ECKA 2YOGA 3W9YA 1JR3E 4Z8YA 2B8TA 1O3YA 4FMDF 4DC9A 2BKUA 4OKSA 5JMTA 2CMKA 3UATA 2NO9A 2QG6A 3NVAA 5FOUA 3GJXC 2YYZA 5LPNA 4UXIA 1E6CA 1N5JA 2WJIA 3QXJA 1YR9A 2JLZA 1TEVA 3K0CA 1E9CA 3DL0A 1CBUA 2UKDA 3W8NA 4YC7A 1DBSA 1CR2A 5EXTA 3B2EA 1AKEA 4XD7A 3WRXC 1Q3TA 1AK2A 1US8B 1W49A 1MOZA 2WHXA 2I1QA 4UXJA 4WZAE 2IS1A 2WICA 4P4TA 1M7HA 1DAMA 1PUIA 4HAWA 5EE1A 5AUQA 1UEIA 3U60B 1F2UA 5FH9A 2QM7A 1W46A 3REFA 4LBVA 3QPWA 4G01B 3CX7A 2AR7A 2AXNA 2GETA 1GUAA 2AFIE 3FHCB 1GOTA 3AP3A 4HAYA 4KFTA 1FOEB 4P3YA 5EZ6B 4NPHA 4J0QA 2REXB 1WB9A 1OFUX 1XJCA 3H84A 4WW0A 2FEMA 1OHHD 2KB0A 4N0DA 3B1WA 2AN9A 2RMKA 3QI2A 3U3MA 2ZE5A 4WVFA 2VPPA 4GSYA 3BK7A 2HEIA 2YVUA 4AYWA 4EKDA 2ZRDA 3QOFA 4V0MA 3GJ8A 3I92A 2ZSBA 2XZOA 3K70D 1JR3D 3NEYA 3N2EA 1IN5A 1E79D 4KAXA 2DFLA 1YVDA 1N0WA 5JSZA 1OFHA 5CDFE 3IGFA 2EVWX 5FPSA 2V6JA 4UNPA 2XOKA 2VSXA 1NBME 2O0KA 4DCTA 3IBGA 4MA4A 2RB4A 1E2QA 3IKJA 4NE2A 1J2JA 1ZRHA 2WWWA 4W9MC 3VKGA 5DI9A 2GJKA 3QKRB 4Q03A 4NU0A 4BFWA 1KI8A 4UNQA 1XZPA 5AK0A 1A2KC 5EP2A 4EDHA 2GJ9A 1IAQA 3CB4A 3TQFA 1W4CA 2XJ9A 4CW7A 1HUQA 2QPTA 4U00A 1GRNA 3AVYA 2QTHA 3AEZA 3ND9A 1P72A 1UKEA 1E2HA 4HYYA 1QVRA 4LY6A 4A8JA 2CE2X 2XSZA 2FG5A 1HE8B 2MMGA 2QEQA 1SVKA 1TNDA 2CBZA 1GL6A 1Z0FA 4O2LA 1XU4A 2IXFA 2JLRA 3KDSE 4K81B 5JRJA 2XGJA 3R9WA 3GMTA 2VSOA 4HLUA 1RZ3A 1NG9A 5C46F 3B8HA 1Q3HA 1UBGA 5ANRB 4E03A 2E1RA 4FD2A 1IN7A 2FPLA 3BJIC 4OJQA 1NRJB 2ZRMA 2A9KA 2CDNA 5DLQC 1CXZA 1ZJ6A 4BFYA 4DUGD 3VR4A 1QVAA 4KVAA 3H86A 1NBMD 1XTQA 1DARA 2BBTA 4Q4JB 3KXIA 3W5IA 4BGDA 3ADCA 1SGWA 5J4KA 4RVCA 4OQNA 1E9AA 1NMXA 4DBLC 4XJXA 4URYR 1YZKA 1XWIA 2ZSAA 2IYXA 1CR1A 4JMPA 4EFMA 1XEXB 1F2TB 4DDTA 3ZZ0A 1GNPA 2ZYVX 1Z6YA 2UZ3A 1PZNA 2P0EA 1QG2A 2ASEA 3MSXA 1NJFA 1NN1A 3UK6A 3EZ2A 3QG5A 2B92A 3VR3A 2F1RA 1KSGA 5HKKA 4NH0A 1DEKA 3EWSA 1NLFA 1II8B 2Z6VA 1ZNWA 3U4QA 4PX9A 3C15C 3K09C 5SZKB 5TB5A 1L4YA 3CPHA 3AKCA 5FBLB 4O3MA 1SVSA 4DCVA 4HUTA 2ODNA 1JJ7A 3IIJA 1R2QA 1VYTA 4JVSB 3VU9B 2XX3A 4A0GA 4FCVA 3F0TA 3L43A 3A1SA 4KU4A 4M22A 1KJWA 3EPKA 4JBWA 4WXPA 4RKFA 4BLRA 2Z0MA 3OEHA 1JQJC 5F9FA 4DDVA 3EIQA 1FPMA 2QP9X 1XX6A 1Y3AA 2H8KA 1PJRA 1II0A 1MABA 4GI7A 4AKEA 2J1LA 3EZ9A 3T1QA 1LW7A 3UXMA 2GXSA 1E2EA 3GLGA 4JLAA 1KO8A 1GRQA 1Z6XA 3QG1A 1R5NA 1BYIA 1KMQA 8OHMA 2ZETA 1JAHA 3EZFA 4LJ8A 4DLVA 3IQXA 4EAQA 4LHWA 3ECCA 5D3QA 1T6NA 1NVWQ 1Z2AA 3W3AA 2AKAB 5HZHA 3TUJC 5D3MB 1U8AA 4I1SA 3GLHB 4ZCMA 2J0VA 5AWFC 3Q9LA 3TUIC 4CF7A 2FU5C 3SQXA 3W34A 2GA8A 2ZU0C 3PUWA 4EPWA 4LBYA 4PSKA 2H5EA 4M1TA 2QPOA 4TLBA 3GJ4A 5KSPA 1E9RA 3BB4A 5TXGA 1RE0A 3CF6R 2CE7A 1C4OA 2HT1A 2R6DA 2JIZD 1Z6GA 1R5BA 3QKTA 2R62A 4RZ2A 1QHYA 3LNCA 1X8JA 2ZIAA 2QE7D 1KO4A 1TTTA 4RD4A 4TLDA 1Z83A 2F3TA 4PHHA 4EFLA 3BFVA 1KI9A 1U2RA 3PEYA 3IUYA 1CS4C 1PLLA 4CT4B 1C9KA 1XJQA 2GXAA 3ZLJA 4Q4HA 1E2IA 1QHNA 1RIFA 3F3YA 3H0KA 2BMDA 1Q20A 3V4RA 1UM8A 5HR5A 2XTNA 4URUR 2N46A 1FZQA 2ZS9A 2X77A 4G0NA 1N6LA 3E5HA 3EARA 5IHPA 5LBIA 4LV5B 2VO1A 3U5ZB 4W5WA 4LBZA 3TVTA 1QHIA 5EXSA 2CCKA 4QHYA 5IF9A 3DEFA 2RGDA 3R8FA 3RWOA 4Q9JA 2OAP1 3QY0A 4HZUA 1XTRA 5CB8A 4HLQB 4II7A 1X3SA 4JS0A 3TJZA 2IWHA 1ZINA 5EUQB 3IDQA 3U3KA 4MYHA 2VIIA 3LDAA 3Q5DA 4QGAA 3ZQ6A 1AS0A 4CZ2A 4DT1B 4WAUA 4AY2A 2IYSA 1KK0A 1OE0A 1Q0UA 3FB4A 2IYTA 2C99A 4IFBA 4NCJA 4EFNA 3ZS9A 4MRNA 5B30A 5E7MA 1OYYA 2QTFA 4A0FA 1F48A 3CRMA 2RGNC 1BYUA 1Z29A 1KDRA 2CL0X 2NG1A 4GOJA 2CK3D 4KI0A 4BZQA 2OHFA 2V7QA 2A5DA 5FOSA 2NIPA 5DH9A 1E3MA 1ZNZA 2BOVA 2GNOA 2VSFA 4YMTA 2KWIA 2WSSA 1MRNA 2IF2A 3L2OB 4B3FX 4ASUD 3RNLA 2QGZA 3ZIAD 4ARZA 621PA 2QUZA 2B21A 3AQ4A 3HWSA 1LV7A 4LJ7A 2FFAA 1G7CA 3GPLA 2P5SA 3THWB 4HEJA 5H8WA 5L3SA 1S0UA 2BDTA 5JZVA 1XD9A 4TTPA 1WRBA 2YHSA 1G5RA 2CLDX 1KI6A 3BD9A 1TUIA 4TQAA 1W2GA 2L0XA 4B35A 5KNDA 3X1WA 4PC6A 5CM8B 4BE7B 2ZRJA 2G83A 4Q1AA 2AK3A 4Z8XA 5HTKA 3SDZA 5FBRB 3SBDA 2W6IA 4TYWA 3RS7A 3FVQA 1R8QA 5BYJA 4JBYA 2XNDD 3LA6A 4XTRA 3QENA 5A4JA 2C77A 3LY5A 2F7SA 4EPYA 1VPLA 4C0LA 3O8RA 1ZD9A 4CEHA 1N6RA 4D26A 1W48A 1JI0A 3NHBA 4LPSA 4B33A 2I1VB 5G41A 4C0KA 4ZCIA 1OXUA 2NO7A 3D8BA 5B64A 1OIXA 2YOFA 3TW8B 521PA 3K0SA 1PUJA 4QBIA 3IO3A 3QBVA 5C4MA 2XB2A 2W2XA 4QXAA 2GDJA 2JJ1D 4CYMA 4TMKA 1QZXA 4TZ6A 1Q1EA 3E70C 4JVMA 4JLDA 1VECA 4IXMA 4UNSA 2WIAA 3KQLA 3HYTA 1W7AA 2BJVA 2B7BA 4XVRA 1VDZA 3U7GA 1GP2A 2B7CA 1KO1A 2PT5A 3KQKA 1QHSA 1UF9A 4B2LA 5KPDA 5CLQA 3RSLA 2ZJ8A 4C2UA 4TLCA 3B1XA 3TE6A 4RJLA 2NZJA 2J7PA 4DXAA 2QRZA 3K70C 1IN4A 4OK3A 2QBYB 2ERYA 2F6RA 2GHIA 3RRMA 3KJGA 2R65A 2CJWB 3GJ3A 2F43B 3GLIB 2WVJA 4DZZA 3ZVRA 4M4SA 4Q4AA 3TR5A 2KBEA 4TYQA 1H65A 2PJZA 3TMKA 5GVRA 4B2IA 5JCZA 1SVWA 1HQCA 3DMDA 4E09A 1T3LA 1E2FA 1E1RA 1KDOA 2QSZA 4Q01A 3WNBA 4DCUA 3W3ZB 1R0XA 3CIOA 1MH1A 1JXOA 4R7ZA 3WYFA 4DKXA 3A37A 1G8FA 4I4LA 1LS6A 3UMRA 3BB1A 2NMVA 1JNYA 2Z4RA 1QG4A
chains in the Genus database with same CATH superfamily
2FY8A 5EJ5A 3FZQA 2WYOA 2ROQA 1N2HA 3N0RA 1ORIA 2ZPUA 2X3YA 2EEZA 2O3RA 5F33A 3OT1B 4FWBA 1T8RA 3C4JA 4AU1A 1L5FA 5EZYA 3T9BA 4K26A 3R7LA 3ICQB 2W6JD 1DXYA 1LCIA 3PUXA 1R88A 3FI0A 4EI8A 1USVA 3OLWA 2QSYA 4Z7NB 2ZDGA 4KX5A 2HCBA 4MMZB 4R2LA 1KXZA 3F5QA 2NU9A 2QSUA 1E3SA 2XUJA 3Q8WA 3H19A 1E9FA 3UWPA 1RRVA 4M8IA 4O2BF 3U44B 2C29D 1JDBC 5AM1A 4P32A 1IZYA 4EYGA 1YDMA 1GAJA 1JPUA 5IUKC 2DHDA 4ZYVA 3EMDA 1OROA 2DFPA 4B4DA 2VDWA 3S29A 1Y82A 4UPDA 1OFGA 1NXOA 2TMYA 3B9BA 3ZKWB 1T9BA 4Q5IA 4XH9B 4PS0A 4M88A 2PUCA 1X8LA 2WT9A 2HPVA 4CEIA 4CCAA 2XF2A 4KXNA 3DEHA 5IZCC 4BEJA 4CL2A 2FRDA 3PGLA 2HUNA 5FTJA 1JHXA 2G1AA 4GNRA 4I55F 1B8UA 3CNQS 4TYPA 3TM4A 3CM0A 5LQNA 5B2EA 3PXUA 1QIIA 1T4GA 4RD1A 2FEAA 1EA7A 4YRRA 2YASA 4XDYA 2EFGA 3IEMA 2PHZA 4B85A 1A9PA 1V1MA 1X80A 3P97A 1VSVA 2FP3A 3WGTA 3T3OA 4N3NA 2HF8A 1SK8A 4N65A 2GFQA 4Z3OA 4REOA 3BFXA 3LHSA 5EPOA 3SF0A 2WMNB 1DRKA 1ACMA 2PKXA 4C88A 4MPJA 3DMPA 1HT0A 4LJKA 1I3LA 1X42A 4L74A 1MVOA 1Q7EA 2DHCA 2DRIA 5C34B 1G18A 2Y0EA 5EIBD 2QSJA 3ER6A 5KOHA 1CDZA 2W6NA 3QELA 4WFQA 2A33A 3EGDB 2Q5QA 2I4TA 2ZYRA 4UHCA 3P2MA 5KWJA 2GBCA 3IALA 1R9JA 2ATCA 5EQTA 2HTEA 2IXBA 5TQ2B 3NKVA 4H6XA 3LECA 2HQBA 1F2DA 4J7CA 4I4TB 1ZL0A 1G7SA 4PX5A 4Y6QA 3NHWA 3SYRA 2GHTA 4HTFB 3VAZA 2DXIA 4UHJA 1JVSA 2QY6A 4K9KA 1MJFA 2ZYAA 3HB5X 4Q1VA 4V39A 5JECA 1M83A 1H85A 1H2EA 2HUPA 2A4KA 3IOCA 1YL6A 1FUYB 5F3DA 2ZQZA 2VQDA 4M7WA 1BWQA 1A9TA 3LQQA 2WD7B 3RC9A 3OC0A 1VCNA 2ZIXA 3O0DA 1M6NA 4KIJA 4MDEA 5K3FB 2AEEA 1W5TA 1Y1TA 1K5HA 1YS7A 3PICA 4FT4A 5IW8A 4D42A 4D79A 2X4IA 4DG5A 3S7TA 1DC4A 1Z4NA 4YRGA 2JAXA 5C51B 3TTWA 2SHKA 5F9HA 1DG1G 1YBMA 2GASA 3SZRA 3S70A 4OHFA 1DNPA 4CR8A 1U9YA 4WOBA 1Z7GA 4DGQA 4H4CA 3BD6A 4ZODA 1T4MA 4RORA 3R0ZA 1MJHA 4OI1A 2W22A 4GWLA 3ZHCA 4JI8B 1ACJA 2A3NA 2GJ8A 1F5NA 3OX2A 5EKDA 1T5TA 1U7HA 2YHAA 1R8JA 1O96B 5A7FA 5FA5A 1RYYA 1PJTA 1ISFA 3S40A 1SQ0A 1NQWA 1YKSA 2JCYA 1H2XA 2I66A 2Q5EA 1DRJA 2Z09A 2P6UA 2WWRA 4J7XA 4KFCA 1N9ZA 3BMOB 4JNCA 2J3DA 5EJMA 4UDYX 3H5LA 1C9JA 1ODIA 2VT6A 4Q7KA 3EY4A 4JL8A 4WLFA 3W9SA 4CLHA 3TW0A 1M5RA 5FL3A 3A2MA 1RWMA 1EXWA 1K4YA 1FSPA 2NO6A 4WESA 4B74A 1WXDA 1T5HX 2QQGA 2V98A 1KTVA 2Z9BA 3E23A 1GNLA 5HJ5A 2JIPA 2K2QB 3L0YA 4HAVA 4JJ4A 2EBHX 4NE7A 4OQEA 1Y48E 4MVJD 4D56A 2IBTA 3TNLA 2J3EA 3PC3A 4UATA 1KS9A 4P3KA 5JRZA 4MWOA 2EGUA 2QN9A 3DDSA 5C8YA 4FNGA 3IAS6 1N8SA 2YNMD 3B3JA 4FMPA 1QLWA 4EGQA 4UTPA 4MDHA 2ATEA 1DJLA 2D5LA 4R01A 1Y8RA 2FZLA 4D81A 2SICE 2V4ZA 5KTRA 1JFFB 3C87A 4FXPA 4ZA2A 1KAEA 2FR1A 2PV7A 4AIIA 4U4AA 2PSFA 2QTMA 2V4MA 4A4DA 3P2YA 1BMDA 1Z37A 4M37A 4BB6A 5ICMA 2WLSA 4HADA 3GAFA 5BT9A 4BB0A 1U2GC 1MB2A 3WWEA 3RU9A 4EO4A 2NTVA 5T67A 2ZBEA 3V4LA 4DCCA 4RHEA 2QX8A 2GEDA 1UL1X 3FOAA 3PFNA 3O8LA 4FFMA 1G8KA 4JB8A 4HNVA 1Q7TA 4R1NA 4ACBA 4B46A 1HK7A 3CPJB 3OEYA 3BG5A 4F2GA 4YUXA 3RT7A 4G2TA 2C1XA 4DQDA 3WSVA 5IJ0A 1L2TA 3I4FA 1ZD4A 3OBIA 2BLLA 3CR3C 1VRWA 1TIPA 1IWBB 1SA0A 2IHVA 3CLTC 2PQ0A 3JQAD 4HH4A 1TUGA 3Q3JB 4L5YA 1GRVA 1V8DA 3P26A 4HAZA 4FIZA 1PEDA 4R8MA 5FPKA 3IEVA 1E69A 3HBLA 3AIKA 6REQB 4F3RA 1WULS 4PZDA 5CTJA 1FTNA 2FX2A 4NYMQ 1MH9A 5FOWA 3TNDA 1MO3A 3EFBA 1ZD2P 6ADHA 1QHFA 2PFGA 4BO2A 5JJ5A 4QXPA 1KS2A 3GEBA 3KYCB 3CX6A 5CK4A 3DMHA 5ALZA 1QPZA 2PL1A 2IDJA 1V7CA 2EDCA 1PV1A 2BFOA 3KZVA 3PYXA 3Q11A 1YA6A 1E64A 1W1WA 1WU7A 1SVNA 3LG2A 3N0WA 4XGKA 3SAJA 5BUQA 3DB1A 4ZEOA 5E7JA 1XC7A 1RYNA 3VNBA 1RHUA 4RIIA 1TLLA 5BSFA 4C22A 3ZX5A 4UOQA 2IVZA 1NQOA 3H1BA 2BZSA 3QKSA 1UOPA 3CG4A 4RS3A 4E08A 4UBLA 1IM8A 1I2MA 1SXJD 1HGXA 4PZYA 3DWEX 4X91A 4F4HA 1WCWA 1E2DA 1E6LA 4FCCA 4PPQA 4PVDA 3OY2A 2QVZX 1KZ4A 4NU5A 3CZMA 1P9RA 3FF1A 1MAVA 3WC4A 2UV8A 4PIPA 1XMJA 1E1YA 4XWTA 1WTAA 4K05A 3VUFA 3QEMA 2IEYA 5TS3A 3ZG6A 3RF6A 5IARA 3KV1A 4BDSA 1WQ1R 3LUCA 3EF1A 3FYTA 2R1VA 4N0MA 3EX7C 4CU2A 1SOWA 3GZTB 4FT2A 4R2IA 2H57A 5E6UB 1RR6A 2GM4A 2BEVB 4TUYA 4JLUA 4IPTA 4NPAA 1KRHA 1JYEA 3TEJA 5GIOE 1VHWA 3GOQA 8LDHA 4GX5A 3FBWA 5ITZB 1Z2EA 1ZUWA 3GJ5A 2VP0A 5KBYA 5D01A 1ODLA 2C04A 2INGX 3ANXA 2ZRKA 3AU9A 5KINB 1XIVA 1EFPA 1BIFA 1K68A 1PTKA 2XQFA 2YMLA 2ZSFA 1PZEA 5BN5B 3I2FA 4WZAA 3REQA 5LXTA 4NC9A 3G7UA 1EEXB 3ML1A 3OJLA 3WIVA 2H31A 4BVFA 1XTUA 4L9WA 3W4JA 1MCZA 3M6AA 4M54A 2EZ8A 1HLFA 3FYSA 4M0CA 4KE6A 1WZNA 2G5GX 2G9VA 1KJJA 2Z3VA 4EPRA 3FPLA 4NFHA 3C5WP 2KSQA 4UUQA 3SI7A 1SCIA 3K53A 4UPVA 5JWRA 3BQMB 2CB0A 2VP5A 1FYXA 1F6WA 1SU7A 4M6WA 3IT0A 5E2BA 1ZUNB 4CT5A 1KFJB 4MHOA 4P0TA 2AUTA 2M6KA 3LVRE 2QBYA 1P8JA 3B6EA 1U8YA 2PGAA 2BJWA 1WDTA 4CLXA 4HDMA 4MJXA 3LXXA 1KJZA 3RJZA 5B58T 2ZYTX 3R0JA 1M0EA 3PITA 4Y1GA 1AY0A 1FQKA 3NHSA 4HWKA 3RROA 3QPVA 1YZFA 1GGEA 1DINA 2ZIVB 3AM5A 3O8BA 4ARBA 2C88A 3AJ8A 2PM8A 3GLIE 1G64A 1FYFA 3FSGD 5DLDA 1Y81A 1Z2DA 4YWJA 4AQDA 1NBMA 4IQGA 4Z1MD 3QJGA 4EQ6B 1BC5A 4BVJA 3DO6A 2VTBA 1XMIA 1M10A 1M0TA 1NHWA 2V97A 2YS6A 4TVOA 1FVFA 4QUHA 2G4CA 2J5RA 2QD1A 3O47A 4EJSA 1UBFA 5J4YA 1F4PA 4RVHA 5T4EA 2P6OA 5LMZA 2CXUA 4NJEB 1ZM3A 1GZ4A 3N2IA 2A9OA 1QDUA 2E6UX 3OQIB 3SJBA 3D9QX 4MLDA 3JSAA 3V6MA 2OV3A 2BD0A 2MTBA 3DNMA 4J49A 4LRYA 5K3CA 3ZW9A 3AY0A 5LZ5A 1JR6A 2WTAA 1MJGM 3D0RA 4RC9A 5EWMA 4WCFA 1KY5A 5EHGA 2ZIGA 4TV8F 4J0EA 2Y66A 4AJLA 3TQHA 1Q0PA 3NG1A 1JLLA 1U11A 1YCDA 2JFWA 2B0JA 4JBXA 5C1IA 1MHPA 3QEKA 3K0FB 3CH5A 4R1OA 2HR1A 1EFTA 1LRKA 3MNFA 1XVLA 4JC5A 2NV2B 3OJWA 1GTVA 2Y77A 4ZEWA 5SY9A 2VP2A 2O8DB 3LL4A 3UTDA 3DE7X 4L7VA 1JIUA 3FTDA 3UWSA 4OREX 4PPGA 1R8SA 5ELLA 1IY1A 2BN4A 1U3FA 2XBUA 3FDFA 4AJEA 1CNFA 2FSVA 1GLGA 1XYYA 1B2LA 3DMRA 2FUCA 4AF6A 4JD5A 4OQZA 5ALDA 2OCAA 3T95A 1A50B 4Q00A 2DT8A 4EY7A 4ZCTA 3NEPX 2IHYA 1H8HA 3NORA 4ALNA 4Z86A 2O52A 4DYDA 4IDQA 3VO8A 5H1YA 2ANBA 3HBMA 2DLDA 1U98A 1GAXA 4AZWA 1TEZA 2CNWA 1IHUA 3D3JA 3DE5X 4NZOA 1OX5A 3HXOA 1YVPA 1EU1A 3B60A 1M2VA 4YJ3F 3T3GA 2CSUA 2FMTA 1I01A 2XSZD 3AHIA 5EKSA 3R3YA 1DEOA 5IFLA 2FV8A 5KDDA 2CUKA 2O48X 4P7FA 1JPJA 3OIVA 3IQFA 1NTOA 2IWRA 4KAFA 3I5AA 4RF2A 4A3SA 1L9XA 2GK7A 2OXIA 1KOGA 1ZH6A 4ZV7A 2EFYA 4P0QB 4A6PA 1ZOSA 2P3OA 3EDMA 3QU5A 3FPFA 4OJYA 3BE6A 3L4JA 1SELA 1G5PA 3LBFA 1H3EA 1VL0A 3IESA 4MDYA 2RI0A 1MC5A 4MVJP 1O6CA 1BS2A 3AUTA 1I30A 1DJNA 4RTOA 3F74A 4BNYA 2Y0BA 4JJ6A 3UYKA 2J5XA 1XZKA 2Z9CA 4W9NA 1NXVA 1TT5A 3WXMA 2AS0A 2JI8A 2HA4A 1NI4B 3PYMA 1TLTA 1FVXA 3QOWA 4US0R 2BVNA 1A4XA 3AEUA 3QMMA 5ECWA 3PE6A 3PQ8A 5EIBC 2LUOA 3WWZA 3I5YA 4AO7A 2FDCA 5I7OA 3PE4A 4XX1A 1DC5A 2LKDA 4I81A 4ND3A 1F06A 3JYPA 3MTGA 1FFXA 4N3AA 3OCVA 4B0OA 3RUHA 1M7BA 4D0LB 1JIIA 4HT3B 5AVQA 1T5DX 4HQ0A 3LLUA 3KX2A 4DA8A 3CVUA 5EQDA 4BNUA 4ER6A 4DQLA 4NONA 3DR3A 3ZWKA 5DW3A 2O8FA 3DD1A 2J0UB 3MMPA 2J6IA 2ONKA 4PTLA 4HSEA 2RI1A 1ZW1A 3K2QA 2PUHA 2XR1A 1XO1A 4II2A 1IEVA 2CL5A 3CN9A 1MBZA 3ZI7A 2W9XA 1G0OA 4HNRA 4N5NA 1D1PA 1S8NA 1AC5A 2FP4B 2AXEA 3WDKA 1O94D 2WUDA 2Z6AA 1NU6A 2OCGA 4KRGA 3IIKA 3MSCA 1FDOA 4DCNA 2XTMA 3USZA 1D1QA 3F4BA 5CBPB 4IY1A 4L6IA 5AJUA 5GJCA 2PBFA 2C59A 1S02A 2WU0A 3A4TA 3E9NA 5C31A 4DRXB 2AHOA 5CVDA 5EHIA 3H99A 3T9CA 1EP2B 5CNJA 2YQ4A 4HWOA 4QUJA 4ZREA 2BR3A 2HMSA 3WBBA 4AJNA 2WD7A 3LKVA 3OEHD 2MSCB 5EXDA 3MS2A 2OILA 2VDLB 7MHTA 2VYNA 3QVWA 4YCBA 3WMEA 4F56A 2BFFB 2Q5JA 4CXMA 3A1TA 2NU8A 5TEWA 1OLXA 1YB6A 2F62A 3R2JA 5EWJB 5HZGA 4MWEA 1XF9A 5ICEA 4C3OB 1X9IA 1Y0BA 3LOQA 3SHWA 1N6IA 1TQ2A 3C7AA 1W8DA 1A95A 1PLKA 3G89A 2V65A 3PJRA 1J00A 4OYHA 4P33A 2GUGA 2BTQB 1AUOA 2FVXA 2GEVA 1JB1A 3NWOA 4QDTA 3QXSA 5DV9A 4E2YA 1E3EA 2IY9A 4D6XA 2BFCA 2COKA 1ZO8A 1ZH4A 2PKWA 4XSGA 4ZOEA 3ZWAA 4C1NA 3JWGA 3U4QA 2HA6A 3BSSA 3F6BX 1XDGA 5IWAB 4CT0A 3GU3A 1GPJA 4QU8A 2UXBB 4YAEA 1QIJA 3AOEA 4QDUA 4H0NA 1GCOA 2P9QA 1ZEJA 2XITA 1OWPA 2VA9A 4ND5A 1KK1A 3GWZA 3NJ8A 4WN9A 1I7NA 1P75A 1XA0A 1DAEA 3KKEA 3ZH9B 3RFFA 2YNMC 5IT4A 6CHYA 2Q3MA 1M6VA 4L3WA 1DKUA 3G7NA 4HYEA 4DADA 3C3BA 1UC8A 3IHKA 4IMJB 5DYGA 5FWXB 1W85B 2V5UA 3IMFA 3EDRA 5ALYA 3PGVA 5E1OA 5E3IA 1NWHA 4DA9A 4FSDA 4ZI7B 5J1SB 3UV7A 4B40A 2C7GA 4EB6A 4Z51A 2RGAA 4DV0B 2GEUA 4X1YA 4PFSA 4CFYA 5H9VA 5T3UA 1JW9B 1N0UA 3CZ9A 3IIMA 3OFND 4RVGA 2WKQA 3IP3A 3A2NA 3NDIA 4YAWA 5GGYA 2V7UA 3FRIA 1T2NA 4Q66C 3NGXA 4V0LA 3PNYA 2D2XA 3VAAA 4BVLA 4BBZA 1CQJB 3KT3A 1KORA 1GA4A 1ONNA 1V4NA 2W2VA 1XZ8A 2VKQA 3GRRA 2IW3A 3HNPA 1AB6A 2I3ZA 2YBEA 3LQFA 1X7ZB 3LDGA 3P1JA 2B5WA 4PG4A 3BD7A 1S4QA 3L6DA 3S2ZA 4CQMD 1JHUA 4ZT4A 3PRHA 2FUG6 3N2KB 4GMFA 3KTAA 1NQVA 2CFIA 3EDQA 1OI3A 1YA4A 2EZ9A 4N3GA 5H68A 2GHQA 5CT6A 4GOXA 1PJAA 4MCIA 4BFLA 2ZM6B 1H1LB 2WMOB 3RV4A 1E1CB 4KO1S 3L4BC 4NATA 4JI1B 1N6PA 4CMBA 4CNBA 5AJHA 2ZJFA 5EAIA 2H92A 2IYEA 3JWEA 2OCIA 2OXTA 1XEAA 2G63A 2ZRPA 3QVSA 1W1IA 4JROA 4X20A 5LOVF 2I0FA 4BU1A 3TLCA 4DR3B 2AMVA 1DIRA 3JCZA 2DKOA 5DLYA 4NULA 2P3LA 1BQEA 1JX6A 2O20A 1C7ZA 1G5FA 1WW2A 2PR7A 2Q9AA 4RK5A 5CFOA 3PB3A 4CUJA 2RJ3A 1VKHA 4MPTA 1F2UB 3DBVO 1V7ZA 4C14A 2IYPA 3H6KA 4XGQA 3G5MA 2VZLA 2XMSA 3DKIA 3GBSA 1QCZA 3H1TA 1Z25A 1O9HA 1PGPA 2NZWA 3TNFA 5K0SA 2W48A 3RRYA 1A04A 2YHUA 4BASA 1UFRA 3DOFA 3HCAA 5LA6A 3BWDD 3M1AA 5AJYA 4ZTBA 3HN7A 2H9AA 4I99A 1ARZA 1OFIA 3IVXA 4B7CA 4KXYA 1NSTA 1P2UA 1X3LA 4R1QA 3RRJA 4DJTA 4EGSA 4YP0A 1I3OA 3HY3A 2JCXA 2AD1A 4WNIA 2JGDA 2QTRA 4WJLA 5FA8A 1HM5A 3USES 1ZDMA 1ZOLA 4K3UA 5KMGB 3LLVA 1Z5WA 1KEEB 1QX3A 3AESB 1ZC4A 3LDUA 3EH1A 3U7HB 2IYZA 5K6RA 1P2TA 4L0DA 4PRLA 4P7BA 3DKVA 5G3ZA 2FZ5A 2AT1A 3DT6A 2ZBUA 4FFNA 5B36A 3O9MA 4IGFA 5I7EA 4EKIA 2JI6A 1M7GA 1OB2A 3CW2A 1K4MA 4H9GA 5T3YA 2W6ID 4HXGA 3CE6A 3D0OA 3A9TA 5E4JA 5HKLA 5C81A 5EMNA 2QI9C 4PG8A 2EJVA 2IVFA 2WP8J 5G4KA 3NP7A 2C4MA 2B6NA 3LP6A 1XCOA 3NFYA 2VRWA 4J75A 2RG1A 4K6GA 2XYRA 3TNJA 2GZHA 3OOWA 3MQFA 3Q6IA 5AW9A 1XTSA 5CITA 1L8OA 5ENDA 4ANFA 5A4FS 5K8JB 3I8XA 4URWR 4OGLA 4B31A 3M6IA 4HRYA 1ETUA 4BP3A 4R83A 4LY9A 4CCWA 2XBLA 2Y1FA 1A9RA 1BDBA 1AZWA 2C78A 3MXTA 3GC6A 2G1JA 2IJGX 2P91A 3HLKA 1DT3A 4R2JA 3T15A 1CY4A 1N1EA 1OX4A 1U65A 1X77A 1XZNA 4IIBA 4YECA 2DR3A 2WIGA 5HE8A 3TTXA 3E27A 1Y5NA 2HSDA 2HRRA 1XNJA 1NE2A 1XCJA 3D1JA 3UICA 4K1LA 3WICA 5HVNA 2QS9A 4S1TA 4LNHA 1ZYUA 2O2CA 2I6FA 3OPNA 1AQUA 4HX5A 5F51A 5C7LO 5LQDA 4F96A 1R8YA 2OHJA 4EPTA 3V8VA 1K6IA 2R5WA 3DMFA 4GICA 1DFIA 2GD0A 4FC6A 4CMGA 2P1DA 2MT9A 1AXEA 1ZUNA 3CYFA 4PAOA 4AYTA 4JYPA 4M1QA 1GM5A 1NHGA 3E9RA 4PXAA 1ZNXA 4BNVA 1LI4A 2HGSA 1OJLA 2VHVA 2IUUA 3VZDA 3II6X 4V0KA 4A0RA 5BWMA 1TAGA 3LLMA 3RTBA 4Z3KA 3MCAA 5J4VA 1V16B 4GBJA 1Z26A 4CWAA 1Z5UA 2YMQA 3INYA 4O2AF 3I9LA 2H65A 4ZTUB 2XBMA 1T3ZA 3ESQA 3ZCRA 4PC3A 2ZWIA 2PNJA 1WCIB 2XLBA 4ZD6A 2AOUA 2GMWA 1ODKA 2B2CA 4MWSA 4ENPA 2X1MA 1C1DB 4Q4CA 2RAUA 1RT9A 2VFAA 4LA4A 2JEYA 1HH4A 2ERXA 4ENRA 3DMGA 1TJPB 3LCCA 3PDIA 3T5TA 3V8NA 2O5VA 1BGVA 2J7PD 5DLPA 4DIMA 1XP8A 3DXXA 4C4OA 5TC4A 4NBNA 2BFBB 4H27A 3I62A 1XZDA 1I6MA 2ZAYA 1KSHA 4ISCA 1GUDA 4D4JA 3UGQA 1LDYA 1IOLA 5LQKA 4TKUA 1JDSA 1M2NA 1XTBA 4ZV4A 2PRSA 2HHLA 3G0HA 1QCYA 1V1JA 3W2HA 4ETNA 2QMHA 2KX7A 1AMUA 1NA5A 3LS2A 1EDZA 4K6KA 1HT3A 3R3VA 4NDNE 1YZYA 4LSGA 3X1ZA 4KBGA 2PZFA 1FS5A 2QLMA 2FQYA 1TC2A 1E1RD 1J7KA 2JRCA 2VPWA 2CLCX 2CY0A 5CGZA 4FU0A 3SFTA 5I7VA 2DSTA 5ICCA 1USGA 3LF2A 1OI4A 2F3SA 2YFHA 5IBRA 3RIYA 3EG9B 3B5EA 1S9DA 4KYUA 4QUGA 2ZBDA 1JQEA 3NFRA 3M4ZA 2Q28A 1XVIA 2EW8A 2FEXA 3AHJA 3I6YA 3M5PA 4Y2UA 1KDVA 3WMXA 4NYJR 3KETA 4CCYA 1HTTA 1RP7A 1W5SA 2D54A 2P0AA 3GFFA 5K8LA 1Z22A 3GAZA 3O9ZA 3QWHA 2P78A 1TA4A 5FWDA 4U7JA 3QRWA 3EOBI 2Q3BA 2ZU6A 3MWEA 3TMYA 1XEXA 3HXLA 2I3DA 1LVHA 3ABIA 1XEWY 4U9UA 1ODSA 2QJRA 5ERGB 1K8RA 1MABB 4Z0NA 3SK0A 3WBFA 5AUPB 5HYVA 2OCBA 2APJA 2VT3A 2FSSA 1KI3A 3JQ9A 2N1MA 1R6BX 3M4YA 3AUAA 3HDTA 3W9BA 4BQSA 3GLGB 2H7VA 2ZUSA 3AB3A 4L02A 4RIHA 2Q3CA 4YREA 4LQDA 5L4NA 1DBQA 3EXHA 1ULBA 4RJKA 3M5CA 3DLAA 2WJYA 2CSXA 2AOVA 1DX4A 3EULA 1PGOA 2BI8A 5CB4B 3ZWCA 1E6MA 4TS4A 4I3HA 2IA5A 4R16A 1MN6A 3B52X 1PSZA 3ZZTA 4CQLB 5F77A 1G20B 4XWOA 3UOAB 1ZOOA 2R1TB 2QUAA 2HIAA 1XQXA 1S1CA 5THKA 5B7QA 1UWCA 1GAWA 1XTZA 5FPTA 1C5KA 3JD4A 1KJIA 1LPMA 3MW8A 3B9PA 3O93A 3OESA 1GDHA 3KUXA 1ZZGA 3LO5A 4Y67A 4Z9FA 4KR9A 2BGKA 2OB2A 4O4JF 1RAEA 1TU3A 4LYJA 4ZT5A 4CM9D 1XMSA 5KYTA 2YJ3A 3IV9A 4CKBB 2WSIA 4PO3X 3W77A 1Y1QA 2ZZMA 3KJEA 4XVUA 2Q6OA 3OT4A 3OZIA 5DDIP 4YXWA 3HJBA 1OXBB 4U7FA 1GN8A 3GFPA 3WLJA 3A3OA 5JVDF 3GRVA 1KPHA 4B6OA 2HPZA 1JLSA 3FTEA 3FSJX 2LNDA 3L07A 3AUYA 1GZSA 5DRTA 4GPZA 5KWIA 4XZ3A 3JARA 4KXQA 1GA1A 4MICA 3JAWB 4MWTA 1LI7A 3SC3A 5D3MA 2B83A 2P65A 3LC1O 5EERA 1Y6GA 5ECYA 1KTIA 1XDSA 4ZHQB 2JLAA 2XQKA 5JFGA 2LZ0A 2XW6A 3DM5A 5DCYA 1PZFA 1XFDA 3EXAA 1UBMS 4K9NA 4I14A 4UUAA 5IT5A 5IVPA 1JL3A 3C16C 1U7UA 4E46A 5DB4A 3IXLA 1XVUA 3WBJA 2GPNA 5CEFA 3I6ZA 5ALIA 2R7LA 2UZ4A 3L40A 3T1VA 1QYIA 4HZUB 2BJHA 4CG1A 1A3CA 2QGNA 2RK4A 3DEIA 3MFQA 1ATZA 4MW4A 4D3YA 4YJ2A 3MT0A 5DULA 2ZOSA 3NRCA 2H4XA 4BFXA 1K75A 3OA0A 1NQTA 1TK9A 4C3VA 1P44A 2X1HA 2G9ZA 2YZ2A 2PRKA 3L7JA 3KVVA 4HDAA 1LEHA 4EJ0A 2BM1A 3NTXA 3BWEA 4NOKA 5D87A 2WPDD 1WXQA 3HJAA 2BHNA 5CYOA 3DPUA 4UTXA 4XWAA 2F3RA 5LP6A 4MTLA 4TQ9A 4Y0NA 3RAJA 3VHLB 3OKAA 4IP0A 3STUA 4D0RA 3E3LA 2IHZA 4DV5B 2YZ7A 4N41A 2WF5A 3Q40A 3DV0A 3WADA 5JOQA 1SQ5A 4Y0AA 5ED4A 3TKAA 1NVVR 3DMTA 2PZ8A 3WI7A 4PG7A 1W76A 2QLJA 3Q3GE 1H93A 1MC8A 4K03A 2ZRGA 5I8ZA 1BVYF 2F3UA 3SYTA 2YINC 3VPSA 2IZ5A 1PWHA 4ARZB 5IH7A 4Y2GA 2J8ZA 2BTQA 2H48A 3GFSA 4H1VA 1BOFA 3M1LA 1H66A 4BRZA 1YI1A 4F04A 3FWKA 1HEYA 5FFNA 1QPBA 3KAJA 1Y98A 4DHWA 2WDZA 2G9UA 3SMQA 3DOEA 4LGMA 4UE2A 2X5XA 4WKPA 4YQYA 3EA5A 4E5YA 4XUCA 4XR9A 3I1FA 5DYWA 5HRAA 4ZI7A 4N7RA 3IMKA 3EODA 4IDFA 4KGZA 3WK7A 1VBKA 4JWKA 3LKBA 1GAEO 1C3LA 4YQZA 5BSRA 3OQHA 3T6KA 3TMAA 1W30A 1ZAKA 2W6ZA 3EA4A 3LUGA 4PLCA 3WLNA 4YAKA 1OCEA 4NENB 1LFAA 3H2IA 1WUYA 1U1DA 1W85A 2A92A 4P81A 2OCPA 1BS9A 1ISJA 1BWRA 1P5HA 5IKMA 3GRZA 1NVDA 4LCBA 1C41A 2JCVA 2JBWA 5ICFA 4ZVUA 1M34E 2ZCUA 3ILSA 3OCJA 2XMZA 4GRIA 4TV9A 3TZLA 2PG3A 4F46A 4YMLA 5AVZA 3VJLA 3LBNA 3ZV4A 3LHDA 1PV4A 2G80A 3DEYX 2JD1A 2ZJ2A 1XROA 1HDYA 1KI1A 1PBTA 3WLFA 1QO9A 4TL9A 4O4HA 5KVAA 1D6NA 2CN1A 4BNJA 2RC6A 1NVXQ 3NH6A 4FE3A 5C5EA 2QLFA 4TM7A 5AM4A 5E1DA 1N3IA 2F1OA 3C3AA 4YBZA 5HDQA 5FUQA 3E61A 1LBQA 4WNAB 3JQEA 3BCHA 3ETDA 2W2NA 4BTEA 2CL7X 3V7UA 2V6BA 5KZMB 2JJYA 3IV6A 1CVIA 1PL6A 2ET6A 1K0UA 2B1QA 2DJ5A 1QC5B 4LHVA 4RLFA 2GPSA 2HLDD 3TFQA 4ALLA 3OE7D 4B76A 3LC2O 1FW6A 1VLZA 3IAUA 1DPFA 1JDJA 3EAQA 4HL6A 3UW3A 3TAXA 3I42A 3ELYA 2QRUA 2ZRCA 3QF7A 1U1IA 2PMKA 3FY4A 2XWQA 4IDOA 1L7AA 4IQFA 4OHUA 3W9UA 3HWX1 1KYIA 1RC0A 2OGTA 2P11A 5J9FA 3ZCSA 1Q1QA 3OF3A 2ORYA 3U1VA 3P0JA 1C0EA 2IHNA 4QUIA 4NESA 4ZQFA 3EXG1 3RAEC 3I1JA 2SCUA 2V6MA 1LY1A 1IULA 4N7JA 3ZK7A 1RRFA 2DG2A 5KYWA 1ABEA 2NU7B 2CB9A 1A71A 5BSVA 2XZPA 3SU8A 5EPUA 1HDOA 4EK9A 2QDXA 3GJ6A 3QUQA 1JFSA 3T7CA 2Q5OA 1U8FO 2CL6X 1TZKA 2E1PA 2XB6A 2HF9A 3BULA 2RGGA 4L9SA 1ZNQO 4RE6A 3E0XA 1O87A 3RBXA 3Q0IA 3VNSA 3EXIA 4BX9A 3FKQA 5BV2P 2IY7A 3BORA 3MM4A 4FIDA 1A9OA 1RWQA 2W43A 4AY4A 2LDXA 2NO0A 2R11A 5LMUB 3K9GA 4NAVA 4P5DA 1K66A 1RWOA 2O23A 4RK7A 1Y9ZA 1Z5ZA 3AONB 3REOA 5E3HA 4LRWA 3CWQA 1TTHA 2B1GA 4EO9A 2X2FA 2YWEA 2Y9PB 3H9EO 2Z57A 4QE3A 2FR0A 5IKPA 5K0TA 1TMGE 3O8NA 1CEYA 5HIJA 4P5EA 1QUEA 1RJWA 3IELA 4MVJM 4GOMD 1CRLA 4QOHA 5LQCA 4ZGWA 4PC2A 2IDMA 2R6HA 3UAYA 3UAVA 2ACVA 2DR2A 4HNHA 3C41J 1M1YB 4YHBA 2ONYA 4W9RA 4LY3A 2Q4BA 3AWDA 4Q3DA 1Z4MA 3FYCA 2QMEA 1XKQA 2FZGA 1AS2A 1B74A 3NXSA 4IIDA 4BMYA 5KPJA 1LGYA 2QAIA 4FFPA 3K7EA 1GWNA 1M2JA 4BEVA 1FA9A 3F5FA 2G28A 5TSDA 1QCDA 3FJOA 3R7AA 1L8LA 3UJNA 3PG5A 2XF8A 4X63A 1Y1SA 4JFAA 4K9SA 4KGDA 2PH7A 4JKYA 2VPXA 9MHTA 4D6YA 4QPCA 4BKRA 1MDBA 3MMNA 3AETB 3NBYC 5DFAA 1ODFA 2DWQA 4N5LA 3TGWA 2Y0DA 5EA2A 1WVIA 3USCS 5FNVB 3H5VA 5B3JA 3TIFA 5K03A 1KYZA 4PYMA 5D5PA 2A59A 3ZXIA 2VT2A 2XMDA 3OG9A 4MZXA 2N3ZA 4KIUA 2O7VA 2YDYA 4M87A 4YLGA 4I9GA 1WHSB 5A5FA 1KI2A 3ADKA 3SJUA 3VH1A 2YRWA 5FI5A 1ZQ1A 4CV1A 4LJ4A 2EFEB 1XE3A 4MJ3A 3WGJA 5IJWA 3NDBB 4F45A 1OASA 3S5JA 3RE1A 2BM8A 1D2NA 2GZRA 4TMXA 3V8RA 4J43A 2QTAA 2JRLA 3R9XA 4UDNA 3VC7A 3BAFA 2Q4EA 3TK1A 1JBEA 1RHMA 3PPXA 221PA 5AKEA 1WCYA 2VC2B 2JZCA 4FFLA 3TS1A 2BV3A 3O8OB 4GBED 4IDCA 4TSRA 2DMRA 3HXTA 4A92A 4X7BA 1AZTA 3NEAA 1N2CA 1GGFA 2DFNA 1JDUA 3LUAA 2MU1A 4MQEB 4QO7A 3T5GA 1W4ZA 1J2YA 2GF9A 3CB2A 2H6EA 4Q12A 1NX6A 3UXYA 2NQ2C 4X3CA 1FE8A 3PD7A 4ZOLF 3VVBA 4E07A 1E3JA 3L8CA 4FX2A 3TSCA 2R8XA 5JZOA 1EUCB 4M38A 5HMLA 1CY8A 1IN8A 4GUAA 4BCBA 4R51A 2PYZA 2HXSA 1PR5A 4IKEA 2YICA 5CFNA 3IVGA 2PLRA 3B6ZA 4DAEA 2GPJA 2PCJA 1SOAA 2I2FA 3VYSB 4YMUA 2JH3A 3J80A 5IN5A 1LJ8A 2AEFA 2IPXA 2B0CA 1U7PA 2IZ0A 4JH0A 1TTQB 3HY6A 1M5UA 3ZYZA 2V7BA 2EU8A 3KR1A 2X4LA 3WZLA 4DR5B 1GCGA 4Y6RA 4LRTB 5CIWA 4OQLA 1RCFA 5H7XA 1PFKA 3RS2A 3GLGE 4H0CA 2X19A 4M1SA 2O3SA 4ZVNA 4HF7A 5I7SA 1H6DA 1MNQA 2W2QA 4MV5A 4GNKA 2X8BA 2BR5A 3VDQA 5D8DA 4E5DA 5LYJB 1ZKDA 2TMKA 1WF6A 4FOOA 4LY0A 4RBNA 5D85A 4L2IA 1Q1ZA 1RLMA 5A9TA 1AXRA 1YRAA 2OQRA 1F6DA 3LOUA 5KX5F 2X0IA 2HFKA 2X9VA 3QU9A 4V0SA 4RSHA 1ZA1A 4WLUA 1OWOA 1KFEB 1I8TA 3T38A 4A9AA 1PK9A 1YFKA 4MWDA 4MR8A 4L4RA 4ZI3A 1T2FA 4V1CA 1POXA 1S2NA 4TKVB 3N8KA 1JDPA 3F7TA 4L73A 3NV9A 1SU6A 1VLHA 1XZHA 2JDID 4Y1EA 5H81A 3STXA 3U3ZA 3FPJA 4ECAA 2EIXA 1ZN9A 3C3WA 1WHTB 3GCXA 5AI4A 4OA5A 2YVAA 3TJRA 1BX1A 2JVIA 3K32A 1X8KA 4WJKB 4XUGB 3UG6A 2ZIZA 1V25A 3L77A 2G1UA 3DV9A 3J81A 4CR7A 3T0FA 3AR3A 1FNDA 4I1PA 1JUDA 2F9LA 4TMYA 1F38A 5FEUA 4EHLA 1ZD3A 4HAUA 1EBBA 5TPZD 5KTYA 2RHBA 2WJZB 1VI6A 2G07A 3OM8A 4HN4B 3EXFB 4NR0A 4DEVA 3NRJA 4CKZA 4MR7A 1UEXC 1IXYA 2WWHA 4QFMA 3G2QA 5ILQA 4F38A 3N2GB 5DGHA 4PYJA 2J45A 3W5UA 5J4HA 2CK3A 2NZ8A 2I71A 2Y1DA 2F59A 1WXWA 3MA0A 2VHTA 4EG6A 3QP9A 1ZIPA 3K6SA 1P0IA 4XX0A 1UBRS 2QN6A 3KZ1E 2OESA 2KM1A 2ZBFA 2YXEA 2EKBA 4OBWA 4FSHA 1A7AA 3U16A 5L3QB 1PDVA 2ZE6A 2FW7A 1DB3A 4ZAGA 4AT1A 3IAHA 4ZJPA 3KQQA 3KUUA 1H2WA 3EZ6A 3VU3A 3RYTC 1UPCA 2BH2A 2WZDA 4M0KA 1R4NB 5DXAA 3RYFA 3DBOB 4ND8B 3OTOB 4PPFA 2ZYSA 4TRJA 5JQGF 1AF7A 2XT0A 3L8EA 3FPKA 1WZEA 3HXPA 5AQEA 5DO9A 1RIIA 1VJCA 3DOOA 4OLJA