3T1OA

Mgla bound to gdp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
192
Chain Sequence
b'STINFANREINFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIGEVKGFKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein mglA
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 60
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t1oA00
1NIPA 4R9UC 4TYPA 3ZS9A 2WJYA 1IJEA 1G8GA 4Q4JA 3LW8A 4GRAA 521PA 2WWXA 2FDCA 3GLGB 2B7BA 2WKQA 2WWWA 4RZ3A 1P2VA 3L43A 3NBXX 4A0RA 4XD7D 1OKKA 4FD2A 4EJSB 3BERA 1COWA 1OJLA 4RD2A 4OK3A 3B1XA 2JLSA 4M1TA 1SGWA 3D31A 1WQ1R 3MJRA 4IDQA 2ZIAA 3N2IA 3M4YA 1F5NA 3GMTA 1SVKA 2P0EA 5EP4A 3I62A 5HCNA 4YC7A 1DBSA 3GJXC 1VYUA 3BB1A 4TL7A 3KL4A 2WPDD 1CR0A 2NO7A 1VECA 3FTQA 3PXGA 2JLVA 3OEEA 4G5SA 2FV8A 4HAWA 3W3AA 4ZKDA 3CPEA 1WBBA 1XEXB 4Q02A 4CT5A 4L5BA 3NH9A 3I5XA 3Q7QA 4G3XA 2OM2A 3B2EA 1N6RA 3SJAA 3QXHA 1E32A 2Q6TA 4NZYA 3LXXA 2GRJA 3LY5A 1G6HA 4O3MA 4AYTA 4Q7MB 3WBJA 1VG0B 5SZKB 4JL6A 3QNUA 3NIBA 2CCKA 4XIGS 1Z47A 1W5TA 2FPMA 3L0OA 4YQFA 5FOWA 4ZKEA 2NPIA 4Q1AA 3EW9A 3KUDA 1Q1QA 3VHXA 4CGZA 2XJ4A 5EQTA 2WAXA 1F2UA 2WWGA 2VP5A 4JLNA 1JB1A 2EFEB 2R62A 5K8LA 5KHOC 1WP9A 3PCRB 1PLLA 1X8LA 2V8OA 2ZE7A 3H4MA 2ATXA 3EA5A 5K8TA 1RC8A 4QHTA 4Q1FA 2LWIA 4W5JA 4UNNA 3F0TA 1ZUHA 3QIAA 2GEVA 3X1DA 5FR1A 3N2EA 3AP1A 4PAQA 1NN5A 1U0JA 4BGDA 2D4HA 3THWA 4D4LA 4ZDJA 2CK3A 4KXFB 2WMNB 3QY0A 2ZJ2A 4IVQA 3CNLA 3EZ7A 3BIFA 1XB2A 2HEIA 1UAAA 1AM4D 1R0XA 1WCV1 2ZU6A 4I99A 5AJWA 2YINC 1OXTA 1CJVC 5AJZA 3TW4A 4WIAA 1E2LA 4ESHA 1E0KA 3MLEA 1S1CA 1DE0A 1DG3A 1YR7A 4M1KA 2OFXA 2DWOA 1X6VA 5KSOA 1Y63A 8OHMA 2HDNB 4OQNA 2BBTA 2QBYB 3TSZA 3BH0A 1JJVA 4OYHA 2ZSDA 1AZSC 1ZP6A 2CLCX 4LYJA 2JJ2A 5GVRA 4DVGA 3KB2A 4F38A 3GEIA 4AYXA 3RHFA 3VKWA 3QPVA 1N6KA 4WOPA 1D2EA 1XTJA 4B6FA 1ZM9A 4NONA 2A9KA 2ZRNA 3QKRA 4TYQA 3HR7A 4DC9A 5KPDA 3QENA 3IHWA 2P6NA 5JZVA 5FTMA 2ZE8A 1GAJA 3CM0A 3VX4A 3X2SA 1J7KA 3RS2A 4BFYA 3AH8A 3UMSA 5HTKA 2ZRPA 2NZ8A 3PVSA 1E2HA 2ZRIA 1N5LA 4HDQB 4LJYA 3TQCA 2ODBA 5L8VA 1E2IA 3DVLA 1NIJA 1ZUNB 2FH5B 4OHYA 1CBUA 2OV2A 3LBNA 4U5XA 1ZU4A 1SVLA 4Q4JB 1LF0A 2ZRJA 4DT1A 2NMVA 1NY6A 4C0KA 4C0QC 5BXQC 3WRXC 4FCTA 1OT3A 2IUUA 3GJ0A 5AUQA 3MRSA 4BLSA 2P6RA 3QKSB 4PAMA 4EPYA 3SFZA 1BYUA 1L8QA 1MKYA 2VQSA 3KKQA 4G1UC 1R0WA 4OL0A 1EFTA 3K9GA 3ADBA 1U8YA 4QC2A 2O8CA 5HE8A 5CIQA 4Q66C 4MUBA 5CM9C 2UZ3A 1P3JA 1X1SA 4AURA 4AKGA 4FCWA 1KMQA 4Q4AA 3FKSD 5FUVA 3VQTA 1JAIA 2GNOA 2GXSA 1H8HA 1GOTA 3TH5A 1MT0A 2ZRKA 2OCPA 1W4BA 4I1SA 1R6BX 4BRWA 3L0SA 3RANA 4A0FA 5A4JA 3BD9A 5GJWC 3N70A 1IY1A 2R2AA 3FPAA 3GCGA 4M1OA 5SZJA 3SJCA 2VRWA 1J2JA 4B71A 5A5GA 1E1RD 1XCPA 1L7VC 1VG9B 3C16C 3ZQ6A 2HV8A 2PLFA 3FOZA 1AKYA 3SN6A 1P9WA 2OUKA 2WICA 1AK2A 5J40A 4ACAA 2ZE5A 2VSOA 2G1KA 1E9SA 2GZDA 2YOHA 4V0OA 1ESNA 1G7TA 4XVQA 1XEWY 4PPGA 4RJLA 4AK9A 4B2PA 4BE7B 4WXRA 1S8FA 5JSZB 4BFZA 2AK2A 4BFWA 4IRUB 4TWZA 1ZVQA 1XX6A 5LBIA 1ZC4A 5FOSA 2JATA 3CR7A 3THWB 1Q12A 2YC2C 4AKIA 1E69A 1Z6YA 4LRWA 5CK5A 3RDPA 4D4KA 4LV6A 4BFXA 1ELOA 5TDHA 3U6KA 4LC0A 1DADA 1OXSC 3GLFE 3G82C 3RNLA 1P9NA 4NTZA 4Q4HB 2J41A 1W2GA 1E9AA 1RW4A 2OEPA 3A1WA 1E9CA 2A2ZA 1CRQA 5D3MA 2RGCA 4B3GA 4BRUA 2WWHA 1EG7A 4NCIA 1KY2A 4HAYA 1A1VA 2IBMA 2V3CC 5JHHB 3QKUA 4Q4LA 2PLRA 2ZAOA 3ETLA 2YJTD 2ZJYA 2WKRA 4PHHA 3CBQA 1M7BA 1JNYA 4URUR 1GDDA 1UFQA 5AWFC 4D4JA 3K0SA 4DDTA 1XZQA 2MMGA 2P65A 3A8TA 4HZUA 5AK0A 1E1QA 5JFGA 1AZTA 2JCSA 2PCLA 1T0HB 3D6TB 1KK3A 1YR8A 1UKYA 1NNEA 2F3RA 3SEAA 2IXGA 2WIAA 3U4QA 3Q5DA 4JKYA 4QL3A 1VCNA 4IDNA 1NLYA 4ZIRB 3QEJA 1FZQA 3IKJA 3HWSA 1K8RA 4IXNA 3VFDA 3WMFA 1KY3A 4P33A 5L3VA 1T5LA 3GQBA 3H0KA 2PBRA 4Q21A 1RFLA 1NRJB 2B6HA 3L8ZA 1GUAA 1RJ9B 3P32A 5KYKA 3ZDQA 1SXJE 4BPBA 5BN5A 2BKUA 4M53A 5E95A 4HUQB 3TUZC 3KB1A 2C98A 1W5SA 2FFQA 2J46A 2WOJA 3EWSA 2WWIA 2O0KA 1EFRD 3O8DA 4YMVA 2FFAA 1Z22A 4YDHB 1DAHA 3AVWA 2J1LA 5AUOB 3P20A 3PUZA 1KO7A 1FUUA 1QRAA 3BOSA 5AUPB 1U9IA 3UK6A 1P75A 1G7SA 3WBKA 1NN1A 1YU9A 5JECA 3DL0A 5DIFA 4QBGB 3AVPA 2AKAB 2VHTA 3FMOB 4R2HA 5EXPA 1XD2A 1SKYB 3LQRA 4PC7A 1TUEA 2OBLA 2WSMA 3LV8A 1NBME 4Q7KA 2WV9A 5B64A 1VMAA 4B33A 4BLRA 4Z8YA 2QQ0A 2W6JD 2YWFA 4JZKA 2GDJA 3ZZTA 3K0CA 4TYYA 2JJ1D 5J5CA 4A1FA 2VEDA 3QSYA 2FFBA 1T0JB 1XD8A 2H7VA 3KFXA 3R7WA 4FI3C 3RRMA 2PX0A 1G7CA 3H84A 4LCBA 5EP3A 4IXMA 4A2WA 1JI0A 2MSCB 3GLHB 1ZC3A 5IK2D 5FBVB 4JLVA 3ZIAD 5EP1A 4JVLA 4Q01A 1EX7A 1RRGA 2IWRA 1FX0A 4AG6A 1N25A 1W46A 2DY1A 4F4JA 3OF5A 1J8MF 4M8NE 1RZ3A 4AKEA 3VR6A 4B76A 2CCGA 4HB3A 4O25A 5FI0B 5CYOA 2WJGA 3ASYA 1N6PA 3WXMA 4LK2A 4I1UA 1LTQA 4LJ4A 1UBGA 4NYMQ 3QJYA 4EUNA 2JLYA 3R9XA 4FIDA 2ZSBA 4BZQA 2J7PD 2R6FA 5D3MB 3RSLA 4Q00A 4JLOA 4KVGA 1YZTA 1FMLA 4JLMA 1W4AA 1BOFA 1GNRA 1SKQA 3QOFA 2V7QD 5CM8B 5KSZA 4URWR 1YR6A 5FH9A 1IN7A 4MH0R 1JPJA 2DFKB 2B92A 3A1SA 4XWAA 4NCJA 4CT4B 3U44A 1L4YA 5A0FA 1L2TA 1BMFA 1XTIA 4L9SA 2CEAA 3U4QB 1Z0KA 4TN1A 2XITA 3THOA 2GCOB 2JEOA 3BWDD 5FL7A 4F92B 1XTSA 4EDHA 4UNRA 1G7RA 3W6PA 3W9YA 4ASUA 4JLDA 3LO5A 1T3LA 2OT3B 4FMCB 4GSYA 2O8DA 2JLZA 5E7IA 1KSGA 1E2MA 1MRSA 1R5OA 2YHSA 3BXZA 3AUYA 2ZM5A 2ZI6A 4A8JC 5B57C 3UPUA 3IEVA 4A36A 4D2IA 3U7GA 3SYLA 4K81B 3WNCA 3DO6A 2ZVQX 1XMJA 1IOZA 1E9EA 1E0JA 2ORWA 4NCHA 2JLWA 2Q9AA 4P32A 3SS8A 2FF7A 3QXCA 1MR3F 2ZI3A 5F9HA 3X1XA 2ZVPX 4DLUA 2ZRHA 2IYUA 1R4AA 1Z6GA 5DN6A 2XTMA 1XTRA 5FBLB 1OYWA 1YR9A 2CXXA 3SI7A 2N42A 2PX3A 2RMKA 3ZVNA 3A1TA 4RD4A 3GD7A 2AN9A 3TVTA 5KTYA 2SHKA 3CZPA 3C5CA 2XXAB 1IQPA 1M1YE 2EFGA 2KE5A 4KFRA 4MYHA 3W3ZB 3GLFA 2EFCB 1XD2B 4ON9A 4Y0AA 5P21A 3B13B 3MUFA 4CEHA 4NP6A 3IIKA 2FE4A 1AKEA 1FOEB 4POAA 3AVXA 2IK8A 4PTLA 5JMTA 4A6PA 1Z6TA 1TTTA 1HYQA 1NY5A 2EFHB 2QAGA 3I8SA 3UWOA 4M1WA 5DHAA 4JSTA 2PJRA 1R0ZA 2HUPA 421PA 1Z08A 4CDGA 3KZ1E 2FU5C 1DARA 4HB4A 1JEDA 1NSTA 1JQLB 2JAQA 2JASA 4M0LA 4RFVA 3ZVLA 1S96A 2WOOA 3WMGA 4D81A 5L3SB 4EKDA 1Z5ZA 4PHFA 2A5YB 2OCBA 4FMDF 3EZ2A 3L82B 3M6AA 3O47A 1FP6A 4C7OB 1US8B 1KAGA 3NKVA 4Z1MA 3WHKA 2GK7A 4F4CA 3CH5A 2ORIA 3QVVA 3BBPA 3BGWA 5G3ZA 1P7CA 4CF7A 1RE0A 1UEIA 2BCGY 4OHWA 5FOVA 1P4SA 1AA9A 3NVAA 1EFCA 1PUJA 3VMFA 4MQBA 5J4YA 2O8EA 3GLIA 1EWQA 5IT5A 4NE2A 4XOIA 1NJGA 1HT2E 4LJAA 4RVCA 5TXGA 1NLFA 3RS3A 4E07A 2C77A 3K9HA 1CS4C 4ZV4A 2G3YA 5C4GB 1P2TA 3OEHA 2ZS9A 3S1AB 3NXSA 2CHQA 4W5WA 5EE3A 2ZJAA 2P6UA 3ADCA 1XPUA 1OXVA 5FOUA 4P4UA 4PSAA 5KDLA 1S3GA 4D6PA 1X1RA 1OYYA 1YRBA 4HAZA 1GP2A 2DWQA 1QHXA 1BIFA 3LA6A 5IF9A 2ZR0A 4LJ9A 4G5QA 3DZ8A 3HJNA 4Q1EA 3U44B 4PFSA 2IYQA 4IDPA 1LV7A 2HYDA 2ZUBA 5CIWA 1QHGA 4LPKA 2BBOA 2QSZA 2D06A 1XFAA 2NIPA 2VL7A 1KO5A 3SDZA 3K70B 4KHZA 2E9SA 1EFHA 3A36A 3ECCA 3UG7A 5E3HA 2P5TB 1J99A 2VSXA 1LF5A 2QPOA 3K9LA 2NPFA 4CEJB 1OF1A 2IHBA 3I8XA 3RRYA 3OFND 2W2VA 2BWJA 3GFOA 1DAEA 4BEBA 1XJCA 1PLJA 1VG8A 2O8FA 1XCMA 1OV4A 3EIEA 2FX3A 2R6GA 3MSXA 4GP7A 5FBRB 2RHMA 5KU1A 2HLDD 4TYNA 1V5WA 3BAFA 4TL9A 5CDFA 1LFDB 4DLSA 3KXKA 3W5JA 3ZD7A 1KJWA 4MKGA 4S2EA 5CB8A 2XOKD 1KDPA 2IEZA 3ZD6A 4WZAE 1K5GA 3VR3A 1E0AA 5JCPA 5DGXA 1RRPA 4DSOA 1DOAA 1OE0A 3EPJA 2W00A 4MRPA 4QG7A 2RCNA 5CJ2A 2EWVA 1KO1A 5BYKA 4MDFA 2RKOA 4ZO4A 4XTRA 2RHDA 2PH1A 4QJ5A 3RYTC 4B2IA 4C4PA 3GLFB 1HE1C 1M7GA 3U2QA 4YXWA 2QORA 4TLDA 1G4AE 4MDEA 3WRYC 4A0HA 1Z0DA 2IF2A 1LW7A 2NTYC 3D8BA 4DRZA 1G5PA 2QMUA 2C2HA 1ZRHA 4B3XA 4DZZA 4XVRA 3GJ3A 1VCIA 2OFWA 3QKTA 3TGPA 2HT1A 1ONBA 5KPJA 2VP6A 3TSOA 4O2LA 4YMTA 1JPNA 2Z0MA 3IUYA 4OI4A 2V6JA 4FWTA 1GWNA 5CK4A 4DXAA 4MRVA 2IS1A 2OO7A 4NHOA 1A2BA 2QUZA 3LVRE 4BASA 2VF8A 1NN3A 2O0JA 2AHOA 1PZNA 2P67A 2UKDA 3A58B 3AF2A 3TW8B 4P4SA 3NHAA 4AC9A 2ZR7A 1KSHA 1D2MA 3AKDA 1Q1ZA 2MSEB 4MRSA 2GJSA 4XD7A 3SJZA 2XSZD 4Y0VA 3SU8A 3CH4B 1G18A 4B75A 4M9ZA 4D0NA 4X8OA 2Q21A 1N0WA 4Z51A 3LX5A 3VU9A 3REGA 1D6JA 1EK0A 1F48A 5M04A 1FQJA 1G6OA 4ZCMA 3Q9LA 2JLUA 4DLXA 4Q9JA 5E7MA 2WPDA 3B6EA 2OFOA 1T8TA 5BN3A 3QBVA 2PZGA 1SXJB 2BM1A 3CRMA 3DM5A 4JVNA 5DLQC 1M34E 3PEWA 3QE0A 4JLPA 3L2OB 2VHUA 1ODFA 2F6RA 3V9PA 1WB9A 5LD2B 2IEYA 1E2JA 1PV4A 2LKCA 4DEYA 4XH9B 4QXAA 4UXHA 3VX3A 2HJVA 4TTRA 2KJQA 1K6MA 4GOJA 4TL6A 1OHHD 3QXXA 2HF9A 2F43A 2ZRLA 2WJJA 1XRJA 4LHYA 4RCZA 1HA3A 4OQMA 2ZU0C 4NYIQ 4IJMA 4PC3A 1KI3A 1UBEA 2WSSA 3QVUA 2XB4A 3AB3A 1ZIOA 1FFHA 1FPMA 3B7GA 4Q1BA 5DI3B 4UJ3A 4EFMA 5L3RA 1KI6A 4PO9A 3LNCA 1P73A 1XPOA 2G1JA 4EFNA 1VDZA 3DMDA 3IDQA 2WJIA 1PVOA 4RD3A 1H65A 2R44A 1G8PA 2IWHA 3EPKA 1NMXA 1IBRA 4TMZA 5C4MA 3SQWA 2C9OA 4IDHA 2AWOA 1YE8A 3Q5EA 3ZLJA 3FVQA 2KBFA 1CP2A 5KDDA 1B23P 3T5GA 1DTSA 3ASZA 2H17A 2VP0A 4K46A 2BJWA 1WXQA 3FKQA 1IY0A 3AP2A 1JEEA 4Q19A 4YLGA 3SBEA 1OKKD 1XPRA 3RAPR 3HU1A 3IIJA 4KYUA 1KZ7B 1COWD 1SHKA 2G0NA 3IQXA 1YVDA 2JDID 2W6ID 4KVAA 3LQQA 3OE7A 2WHXA 4HB0A 4CEIA 2ZRCA 5EZ5A 3BJIC 1MOZA 3JVVA 3EIHA 1HUQA 4LBYA 3GFTA 3PG5A 4XWKA 3B9PA 2WM9B 1SVIA 1J90A 1N6OA 2KBEA 5E7JA 2AXNA 4P0TA 1DVRA 1KMHA 2F7SA 3GJ5A 2R8RA 1SVOA 4G0NA 4DWJA 3FHTA 2GEUA 2HCJB 3Q3JB 4KU4A 1F2TB 3EC1A 1T5IA 1W7AA 4RZUA 2VP9A 1N5JA 1KZGB 1SVMA 1GFIA 1OW3B 2E1RA 4ZCLA 1Z2CA 5F98A 3AVOA 1CF4A 1HURA 4MGIR 4P31A 2QRNA 1PUIA 3C41J 3MAAC 3Q85A 3TVDA 4M1MA 2Q0HA 2QEQA 4Q9LA 2QI9C 1MABB 3AF4A 2ONKA 3GFPA 4PHTA 2D2FA 3B1YA 1LY1A 3K09C 4TLAA 3WY9A 1HY3A 3ND8A 1Q21A 1OB2A 4MRNA 3TK1A 4KBGA 2NO1A 5DH9A 5EE0A 4W7SA 5FPTA 2IYSA 1VHLA 4P4SB 1NMYA 4FMCF 2QROA 3U3MA 2J59A 4TL8A 4WZBE 1EESA 2I1QA 3T06B 2WWFA 3VU9B 2XNDA 1O3YA 1Z2AA 1W44A 1ZNZA 5DNYB 4MGKR 1U0HC 1HEIA 4ZCIA 2D7DA 2CLSA 3SYNA 3ZZUA 2CK3D 3F5FA 5IRCD 3VKGA 3KUCA 4EPWA 1E98A 1OIXA 3A4LA 4EFLA 2BBWA 1RVDA 4XTCS 3TAHA 4D82A 2VIIA 2WVJA 2O0HA 3TRFA 3QF4A 4TSFD 4TLBA 1GIAA 2GF0A 3NEYA 2PCJA 2Z4RA 4BWYA 3AEZA 3TR5A 1ZM4A 3EG5A 3PITA 5CB6A 4B34A 4C0AC 2QGNA 3B5JA 3SOPA 2W2TA 4EIWA 3T1VA 3TUIC 4KYIB 1OIWA 1ZMXA 2IYZA 2ZANA 2R6CA 4QBHA 3LX8A 3BB3A 1AS2A 4BLPA 5CLLA 1AQYA 3P27A 3CIOA 5G40A 4B3CA 3NDPA 2J0QA 4DDWA 1KI6B 2QPTA 3QBTA 5SZHB 4Q9IA 3IBGA 5J4VA 4OHVA 3IBYA 1QDEA 2AX4A 1JALA 5J4HA 2NO0A 5AJVB 5BQ5A 4DSNA 4ZI2A 2QM8A 4PSKA 4H1UA 2KI5A 1R0YA 3CPJB 3KJHA 1G17A 2NO9A 4AI6A 2ZRFA 1GITA 2NOAA 3IIMA 4LHVA 2ZI5A 1XXHE 2ASEA 2ZAMA 1QHIA 2HCBA 3OIVA 1WE2A 1QHHA 2AL7A 1F2UB 4NMMA 4A9AA 1ZD8A 1F60A 1VIYA 5EE5B 4Z8XA 1Z0IA 1DO2A 1HQYE 1S2MA 3FHOA 1OXXK 1XWIA 3FYHA 4AD8A 4EPXA 1U99A 2QNRA 2X19A 1A5TA 4ZDKA 1KI4A 3I3SR 1A2KC 3K0EA 3V4RA 1Z0FA 4JL8A 1HH4A 2NQ2C 1JR3E 1KMHB 2OCAA 4IHQA 4GP6A 5EP2A 1OXUA 1E79A 1W0KD 1E2FA 2ZS7A 5K8IA 2YOFA 2ANBA 3E2IA 4OQFA 4R7ZA 3U3KA 5B58C 4JBWA 3G0HA 2FZ4A 3EC2A 1II8A 4NH0A 2BBSA 2JLXA 2C78A 1TU4A 2BIFA 2QT0A 4GNKA 1CKEA 3ICQB 4C2UA 1UKZA 3PUWA 2AD5A 2MMCA 4D0GA 2E87A 3LLMA 2BKEA 4I1OA 1B0UA 4MRRA 3AF0A 3MGCA 1T3SA 1E3MA 2YNMA 1PLKA 2OLKA 2H1LA 2IC5A 1EWRA 2IUSA 2L0XA 5H68A 1D9XA 2DFTA 3DOFA 4DLTA 4GDFA 4HAVA 4BFUA 1S9DA 1RRCA 2WJHA 3OIYA 2X2FA 2OE2A 3QKRB 4KLZA 2WWYA 2J0UA 2CMKA 4PR0A 4PC6A 2ODWA 4BFTA 5G3YA 1ESMA 4C2TA 1FNMA 1X3SA 3EZ9A 3WNBA 5JEDA 2CNWA 5FPYA 4FMBB 5BYJA 1EFRA 2QTVB 1D9ZA 4DKXA 1UADA 4LSGA 4QNRA 5JRJA 4U7DA 1P61B 3HPRA 2N1BA 3QXSA 4NU0A 3QF7A 2QENA 3GLIE 4QGAA 3RABA 1JXOA 2OZEA 4QGHA 4B74A 4GMDA 4TLEA 4ZDWA 3ZZ0A 4WAUA 4JSYA 2WMOB 4H1VA 4DT1B 2ZRBA 4NYMR 2F1HA 3QF4B 3K1JA 3TMKA 1H8ED 4PANA 2ZI7A 2OXRA 3BK7A 4RFSA 5J47A 4DIEA 3WP0A 4II7A 3LW7A 4EQ6A 2LCFA 1CTQA 2F9LA 2VPPA 4LZZA 1F6BA 1KI1A 3AUXA 3LVQE 3O8RA 2QG6A 2IA5A 3KJIA 4TTQA 3T1TA 3AV0B 2O8CB 1FL9A 2ZRMA 1GKYA 1E1QD 2J45A 4HZIA 2QZ4A 1VYTA 1W36B 3AM1A 4OHXA 3NG1A 2JJ1A 2O5VA 4Q4AB 2BJVA 2OBMA 3ADDA 3CNNA 4A4DA 4C3ZA 2YWHA 1CR4A 3KFVA 4HSEA 2RGXA 5EE1A 2QSYA 5L3QA 4WW0A 5FPSA 2A5FA 2BMEA 4MYTA 2GILA 1KI2A 1T9HA 5IK2A 1ETUA 621PA 3ZIAA 4QFMA 3C4JA 4B73A 1Z83A 3EASA 3E70C 1Z63A 1OH7A 4TMXA 4LHXA 1KDTA 4M9XA 5EXSA 2A30A 4IOJA 5CDFE 2J3EA 1S0UA 2CL0X 3MD0A 5BW8A 1QHHB 3KQHA 1NG9A 1CEEA 1UPTA 1VCMA 1DAIA 3SR0A 1R5NA 2J7PA 2YYZA 4V03A 1R8SA 3EX7C 2JIZD 1A82A 4A8JA 1E9RA 1I4DD 1OH8A 2XEXA 2C8VA 2IL1A 2GETA 2V7QA 5D3QA 4F7WA 1ZJ6A 1QBKC 4HLCA 4PO8A 5KNBA 3CF6R 4JMPA 2GAOA 1YZNA 5CLQA 5HCIA 1YHNA 2FSFA 2F1JA 2VSFA 4PO1A 2CE2X 3CNOA 5GVSA 2X1VA 3W5IA 2C04A 1AS3A 4LYHA 3B60A 4PQRA 4EPRA 2OESA 1IHUA 5H70A 1CLUA 2QMHA 2AFIE 4RKFA 3LXRA 3RSOA 2VP2A 2ZSFA 1VPLA 3BFXA 1HTWA 1S9HA 3U7FB 2GZHA 3W90A 4HZUB 4DCUA 3KX2A 1R8QA 4V02A 1TPZA 1G21E 3UANA 3AF3A 5JS7A 4QGFA 2CVHA 1GM5A 221PA 1J8YF 3HP1A 3NC1C 2PZFA 4FN5A 2XX3A 4Q48A 2ZI9A 2ZXUA 2RGAA 1JECA 1CJMA 4R98A 1ZIPA 3DEFA 4S35A 1G20E 1MO6A 1M7HA 2R6DA 5AJYA 1YQTA 2GK6A 2JGNA 3J81k 3QPUA 3K8YA 3P4YA 3RC3A 4MITA 4B32A 2EQBA 2IYXA 5CJPA 2YV5A 3MWKA 2QTHA 4MKHA 2FGKA 1XXHA 1Z0JA 2G77B 1VKJA 4G01B 4EQ6B 3TNFA 2F1RA 1KO4A 2YZ2A 2ZYWX 1Z8FA 3HU3A 1GKUB 3O8BA 3CLVA 1XEFA 4WVFA 1DAMA 4LBZA 1E4VA 5FBQB 4F4IA 5JCZA 2B21A 2O8BA 1FW6A 1NKSA 1CXZA 4DHEA 2OAP1 3X1ZA 4OI0A 1VG1A 2IF0A 2V1XA 1UBFA 1W0JD 2VBCA 5J4LA 3WNDA 5HR5A 1Q22A 4A2PA 1JR3A 2WAYA 4KLNA 3RC8A 5LB2A 3REFA 3JZMA 2IYTA 2VYFA 3THYA 4XWOA 2QP9X 1KKMA 1GILA 1CR2A 2C95A 2V6IA 3CRVA 1DAKA 2FSGA 2Z83A 4IOLA 4B44A 4DCNA 2NG1A 3D3QA 3K70D 4KFUA 2XJ9A 1P9RA 4GOXA 5JI2E 1KJZA 2YVUA 4ASUD 3WMEA 4DEXA 4QBIA 3OAAD 3EPHA 4PHGA 1M2OB 2CCJA 1R5BA 3HYTA 2FJUA 5HKKA 1KI8A 1X86B 2GVDC 1G3RA 1TEVA 3ZH9B 2GESA 5AUNB 3FE2A 3ND9A 5F3WB 2ERYA 1IXZA 3AVUA 4G5RA 1NLZA 3BRWD 4UNPA 1Z6XA 5DYGA 3R7WB 2PMKA 3CWQA 1XEWX 2V1UA 3KXIA 5SZIA 2WKPA 3I4LA 3EWAA 2O52A 1XJ0A 3PFIA 4PPQA 2BMFA 1FX0B 3CRW1 1OSNA 1JBKA 1W47A 1E99A 4LV5B 3RRZA 3T1QA 1TQ6A 1YRAA 2B8TA 4OJQA 4P3YA 2BM0A 3VR5A 1SVSA 2JA1A 1G41A 1XU4A 1W4CA 3BH6A 3CX7A 4NYJQ 3I72A 4FINA 1HT1E 4NBSA 4LJ7A 3IQWA 5JS8A 2Q9CA 4IOKA 3SYKA 2ECKA 1RPZA 4US2R 1IXSB 4B43A 3CO5A 1XBTA 1Q3TA 3VR1A 5BWMA 2XGJA 1G9XA 2R65A 3NTUA 2OSBA 1QHYA 1ZAKA 4RZ2A 4BLTA 4ITRC 2BVNA 1UF9A 5JWOA 5KDOA 4LC1A 1XNJA 4PZZA 5UKDA 3K0AA 3PJRA 1S1MA 4ZPXA 3EXAA 3OFNA 2IS2A 4B48A 2IYLD 2RGGA 2Q3HA 2XNSA 3IO3A 4IFBA 2ZSEA 4C0JA 3CX6A 4JJZA 5FTNA 2R9VA 3W8RA 4QM7A 4BZXA 5K8UA 4OI2A 5KUTA 4TQAA 3GLGA 2HYIC 3QG1A 3HPQA 1IN6A 4HUTA 2CL7X 1GNQA 3TR0A 5DI9A 3ADKA 4ESVA 1NP6A 2ZYUX 4EPTA 5JJIA 5EJEA 2ZJBA 4HB2A 4HDCA 4QOSA 2Q3FA 2G9NA 3CW2A 2RGNC 3T1OA 2O8DB 2CHGA 5KSPA 2QTFA 4WZ6A 1ZCAA 4JLBA 4R71A 1DELA 2ZUDA 2QPAA 2W58A 3AKYA 1Q57A 2F3TA 2IUTA 2RGBA 4GFDA 1N6HA 1C9KA 4ILEA 4DLRA 3U60B 2P2LA 2ZS8A 4DLYA 2Y8EA 1XXHB 5B30A 1P6XA 1SXJD 2RB4A 4ACBA 3C14C 1U8ZA 2BOVA 1XEXA 3OEHD 4JYBA 4LYAA 4OK5A 5FI1B 3TBKA 2QAJA 5TMPA 1NVVQ 4M22A 5EXTA 4H9GA 2OILA 4AYWA 3MWJA 4US1R 1N6LA 1HV8A 1UM8A 5EE9A 2BC9A 1XTKA 4LDJA 1LS1A 3SFVA 3V00A 5KNDA 2CBZA 2UZIR 4URXR 1TF5A 1QVRA 2FEMA 3KXLA 2REOA 2X2EA 1NKTA 2BHRA 2DWPA 3I1FA 4FXPA 5E4FA 1G8FA 1AN0A 4JBYA 3DM9B 3THYB 4CRWB 3A4MA 3I61A 3FHCB 3FGNA 2ZROA 3K0FA 1IM2A 4NYIR 4FCVA 1ZBDA 1TEXA 2HT6A 1QF9A 4CEHB 3CWZA 4N0EA 5FR2A 1G3UA 4KCGA 1PJRA 5TVKA 1IXRC 2GEDA 3E5HA 3IGFA 4KFSA 1CJUC 2GVZC 4URVR 1EXMA 1P60A 4Q9KA 3T35A 1SQ5A 2DYKA 2QAGB 1G64A 5DO9A 4CIDA 1NBMD 2A3RA 5F2EA 1SXJC 4GT1A 3WYGA 3KJGA 4L4UA 2WZQA 4OI1A 4EJSC 3ONWA 4TMTA 3TKLA 5LD2C 1CU1A 3M1IA 5DHFA 3OHMA 4KSBA 1CRPA 4Q1CA 4QKQA 4B3BA 1X8JA 1OFIA 2JLRA 5FTLA 4EAQA 1KHTA 6Q21A 3KQKA 1YZUA 1E2NA 4Q47A 3BE4A 5C1BA 4DUGD 2QBYA 1QHSA 1FTSA 1G8HA 1BS1A 1GG2A 3DOEA 2KB0A 1GRQA 3VNVA 2XZPA 1OHHA 5DISB 2O8EB 3GLIB 1MH1A 1BKDR 3LFUA 1TMKA 1ZCBA 5C46F 3BC1A 3QEOA 3VKHA 4YXWD 2ZYTX 2N46A 4MYUA 2BMDA 2PJZA 4TZ6A 1N0VC 4J0QA 3Q7PA 1S3SA 2D62A 1ZM3A 3T34A 4EPVA 2YKGA 4OQXA 2EFDB 1N5IA 2X77A 1IN5A 5EUQB 2QE7D 3B1ZA 3LH5A 4KITB 1WF3A 4TQUS 5FOTA 3IILA 2AFHE 3MWLA 1YKSA 4OKSA 4TT3D 2BEJA 1M6NA 2XTZA 4TMKA 5EZ6B 3NC0C 4JVSB 3UMRA 1E2DA 1CR1A 4M1SA 4M4SA 3IHLA 2ANCA 3EZFA 3SBDA 1GKIA 3EZ6A 3K09A 4LY6A 4GMXA 1VIAA 2KSQA 2W83A 2DR3A 3CB4A 1XP8A 3K9NA 4US0R 4C9BA 3PV0A 4DCTA 3O8CA 2C9YA 2V55B 3R8FA 1U2RA 1E2GA 2HXSA 5GJCA 1YZKA 2QU8A 1OFTA 3L0IB 2JDIA 1DG1G 2W6IA 3QKSA 3WHLA 2WJVA 4AWXA 3R9WA 4HYYA 5IDVA 2GBLC 3SC3A 3A6PC 2YWEA 4PQYA 1DS6A 2ATVA 2H92A 1E9BA 1UKVY 3NBYC 4X8LA 2O8FB 3RRNA 3QQ5A 2DFLA 3AKEA 4N0DA 4IEIA 4B3FX 1AS0A 3TQFA 3GJ4A 2GF9A 4V0MA 2J0SA 1FQKA 2AKYA 1G291 5CYPA 2FOLA 4Q7LA 1GL6A 4PAOA 2YWGA 4NL4H 3I32A 3B1WA 3HR8A 4K8OA 4WBSA 3W34A 2K5UA 2V54A 2FEOA 2OAQ1 3UXMA 1G16A 3M0EA 1G5RA 4UJ5A 2A78A 2Q9BA 4DLZA 1ZNXA 1Z28A 2FA9A 3B78A 3PIRA 4JVMA 4L15A 4PZYA 3C7KA 1ZNYA 3AGPA 4UNQA 2PZEA 2NGRA 3OEED 2WSSD 2TMKA 4HLDA 3VAAA 4V0LA 3K0FB 3U5ZB 5TY0A 2PL3A 2C99A 4AKHA 3QPWA 4XSHA 4DDUA 2ZUCA 2KWIA 4JT4A 3NH6A 5JSZA 3N5CA 4HLUC 1WA5A 2VP4A 2A5DA 2GJ9A 3AVTA 3DZDA 2ZE6A 2ZJZA 3GJ6A 2DBYA 3KKPA 1AIPA 2VF7A 3PEYA 2BMJA 5JJLA 1TF7A 5HZKA 1A4RA 2YOGA 3SQXA 1ZM2A 1E9FA 1HQCA 1C4OA 4QRHA 3L8YA 1R2QA 3DMNA 4Q4HA 5AR1A 2PMDA 3H2YA 4TSFA 3MFYA 5FFMA 3ICEA 5JWRA 3OE7D 3VR4A 5J4KA 1E2QA 1KO8A 1RYHA 4NCNA 4QNMA 5FPHA 1MO4A 2PEYA 1I4TD 3B85A 5AJXA 1TQDA 4WA7A 5TARA 4DB4A 1N3BA 4KSCA 4DJTA 2QRZA 2FNAA 3NWJA 4RCYA 4U00A 3WYFA 3DPUA 2IHYA 4WXPA 1OH5A 4JYCA 4JT2A 4URZR 2JLQA 1NJFA 2B7CA 4HEJA 3W6OA 2GTPA 3B82A 3WYAA 2AWNA 1Q1EA 1Z3IX 3FKSA 1DAGA 2CDNA 3ZVRA 1U0LA 1G3IA 2ZI4A 1KSJA 4PPFA 2DCUA 2EVWX 2P5SA 1KIMA 4ZIRA 1II0A 2GZAA 2G0TA 4FMDB 3AP3A 4LBVA 4LOAA 1G8YA 2QA5A 4A92A 1KNQA 2F43B 2JJ2D 1I2MA 1UJ2A 3UATA 5FPKA 2ZRGA 1E1RA 3EARA 2GJKA 3KKOA 1R10A 1CJTC 3T5DA 1DAFA 3GJ7A 1RJ9A 4KJZA 3CONA 1OPXA 4YONB 1VTKA 4DSUA 1AQUA 4HUQA 5FUXA 2ZYVX 3DKVA 5EUMA 1WMSA 1T8UA 1N0UA 1XMVA 1KJYA 2G6BA 2FPKA 1XF9A 3FDIA 1F3OA 4G5OA 4TTPA 2XNDD 3CUEF 1IJFA 2IXEA 4N1AA 5EXXA 5JEEA 2AD1A 3EAQA 3SZRA 3EA0A 4I4LA 3SJBA 2IX3A 4MA4A 2ZETA 1T3HA 1FNNA 4JIMA 4D0LB 1ZINA 2A7QA 4IKEA 4UKDA 1W0KA 3SHFA 1WDTA 3U7EB 5JLJA 4DCSA 2BCJQ 2HXYA 1GNPA 4HLQB 4M2LA 4MKFA 3T12A 4E22A 1TX4B 4BLQA 4XJXA 1P72A 5KNCA 2EYUA 4Q5IA 5KOYA 3L0PA 4LJ8A 3HU2A 5FUYA 4PPNA 4CEIB 2RGEA 5KO2A 3KQLA 2HF8A 1GVNB 1T6NA 2F1IA 2AXPA 1KTVA 3NHBA 3R20A 1N5KA 3RWMB 4I1VA 1IAQA 1TL7C 4L16A 1W36D 1IY2A 3PUYA 2XZOA 3QG5A 2GXQA 2FSHA 2AK3A 3CKLA 2QQEA 1GRRA 1VCOA 3P26A 3EPLA 2C96A 1H8HD 3ZGXA 4IDOA 1ZD1A 4V0KA 2ORVA 2I4IA 4DDVA 3VNUA 2OBNA 4DLWA 4YMUA 1Z0AA 1RIFA 1U8AA 3GLHA 4GZLA 4KODA 3GPLA 4QHYA 3GP8A 4IVRA 1OB5A 2RAPA 4XVUA 2Q3MA 4DB2A 4BLOA 4OBEA 4LJ6A 1I4LD 1JQJC 4PC2A 2J9RA 1QVAA 1G1MA 1T4GA 2IS4A 5TV2A 3UWKA 2XZLA 3AKCA 2W2XA 3P4XA 1MRNA 2J87A 2VHJA 1KK0A 3AF1A 4ZI3A 3B8HA 4FW9A 2J0VA 1KYIA 1D8TA 1DPFA 1H8EA 4P4TA 4QM6A 3QI2A 2VHCA 3HYRA 1W36C 5C18A 1Q44A 1SZPA 2OXCA 4GBMA 4PXAA 1NF3A 4CW7A 1E79D 3PUVA 3RS5A 1GTVA 2FSIA 5GJBA 1P2SA 4HAUA 2D74A 4V0NA 4OJKA 4W5HA 4TZ0A 4OQLA 1YZLA 4LJ5A 2GCOA 4DSTA 4I81A 4E09A 1G5TA 1KI7A 4NDZA 3KTAA 3SNHA 3BORA 1I2DA 5FL3A 2ZRDA 4U02A 2OCYC 1RYFA 4DIDA 3BFKA 1AJEA 1DEKA 2D2EA 3TLXA 2W6JA 4IEEA 3UG6A 4W9MC 3GLGE 1A7JA 1OLOA 4BZPA 1UKEA 2CVFA 1E2EA 1ANKA 1AGRA 1NG1A 1BYIA 3PR1A 3FB4A 2C03A 4QGGA 1FP7A 2CNWD 4IVPA 4NKRA 2GCNA 4HATA 2JIZA 1Z06A 3OZXA 1ZU5A 4HAXA 1ZYUA 3SE0A 2GKSA 4BUJA 3Q72A 4RD1A 3NEJA 2QM7A 5HZHA 1X8KA 2P3SA 4JLJA 1E94E 4X8MA 1W49A 3CF0A 2BV3A 1W4RA 1Q3HA 2ZSAA 4KBFA 3FMIA 4RSGA 3A1UA 1FUKA 3CF2A 2XXAA 1Z29A 2G83A 4LV8B 3RS7A 2V4ZA 2CLDX 4MYCA 3WP1B 1KK2A 4JJKA 3AVYA 2H57A 2Z5FA 3TJZA 2Z4SA 3ZQJA 4R2IA 3W8NA 3FMPB 3KKMA 5C2JB 1G3MA 2H18A 2RGDA 3OIWA 3THXA 1OH6A 2IYVA 4ERNA 1KOFA 1NI3A 4D80A 4MUAA 2QGZA 721PA 1Q20A 1LS6A 3LRPA 1W1WA 4RKEA 821PA 1GL7A 1MO3A 1II8B 3IO5A 1TADA 5DE3A 3ZYCA 5L3SA 2GA8A 3CRQA 3DKPA 2H5EA 4O0MA 3RS0A 4C7OA 3BH7A 1US8A 1YZQA 3Q8XB 4LYFA 1JXMA 3UIEA 1CIPA 4B6EA 3E1SA 1TQ2A 3IPXA 1C1YA 5LPNA 3I5YA 3KQUA 2QMEA 1ZW6A 2PT7A 2C9CA 1N6NA 4TMWA 3AQ4A 4L8GA 4LX0A 5DSZA 1KSFX 2IXFA 3V4FA 3MWYW 4XSGA 4YMWA 121PA 4LPSA 2J0UB 5TB5A 2CJWA 3C15C 3F3YA 2J5XA 3AVVA 3X1WA 2ODEA 2ZJ8A 2OG2A 3QUSA 1P5ZB 3S1AA 1YZGA 2I1VB 4C0BA 4D4MA 2J7KA 1Z07A 3I73A 1U9IC 3JZAA 4Q9HA 2QN6A 3C5HA 2VO1A 4NYJR 4A6XA 4KV9A 1G19A 4BQSA 3OESA 4GL2A 2UVQA 1W0JA 3H1TA 4QJ3A 1NN0A 4Z54A 1II9A 3PENA 3JVUA 1UBCA 1ZUIA 4JL5A 4CVNA 2DB3A 3MJHA 1SULA 2OHFA 4RFSB 5DYIA 3EIQA 4A0GA 3GJ8A 2A5GA 4G5GA 1Q0UA 4B47A 1ZM7A 3KTAB 4IOMA 3MCAA 3K0CC 3B9QA 3CZQA 4IW3B 4CEJA 5FUWA 3UMFA 5HPYB 1KK1A 2BEKA 3OAAA 2GXUA 3RLFA 4C0HA 3ZS8A 3VTKA 5IHPA 1L4UA 4LUCA 1Q1BA 4NCKA 2H8KA 4TLCA 2IYYA 3P1JA 3B1VA 4YDSA 4URYR 1TQ4A 1KNXA 5G41A 1BMFD 2EYQA 1W48A 4QJ4A 4KAXA 1WBDA 2B8WA 1QHNA 2IYRA 4F93B 1BO6A 2FGJA 2G88A 4LI0A 1XMSA 1E0SA 2OLJA 3NBZC 4JLKA 5L3QB 3GEHA 3TSWA 4TYWA 3RS4A 1QG2A 2H16A 5FL7D 5H1YA 2ZITA 4LGMA 4Q7JB 4JBXA 3VHLB 5H8WA 1YJ5A 3LBHA 4RZXA 2ZTSA 4PC1A 1GZSA 1FMJA 4BFSA 1OFUX 2FWRA 4KFTA 2WIBA 2AR7A 3LLUA 4D25A 3F8TA 4PQFA 3CX8A 2GAAA 2I3BA 1GSIA 2ZREA 3FFBA 3SHWA 2RH5A 1XZPA 4QHSA 3NDBB 4V0ME 3TAUA 2VLIA 2RGNA 4BFVA 3BS4A 5KSYA 1U98A 3AVQA 1NVWQ 2D3WA 2DFNA 2ZPTX 4A8JB 1NVVR 5ELXA 3I92A 2WBLC 2FG5A 2VTKA 3LDAA 4GOKA 4TMVA 3VR2A 2PT5A 1JAHA 2ZEJA 5DN6D 4LHZA 4L9WA 1KI9A 1XD9A 3THXB 2C5LA 1XCGB 4C30A 3K53A 2FFHA 4M1YA 1JR3D 3BFVA 4RD0A 1U81A 2DHRA 3K70C 2VHQA 2X8AA 3KJEA 2MSDB 4RD6A 4B3DA 1LB1B 5B2ZA 2DPXA 4HI0E 4F91B 1RKBA 4MKIA 1KDOA 1CULC 1O87A 3A4NA 5JWHA 1R7RA 3RVBA 4OK6A 1GL9B 1IN8A 1E6CA 1GRNA 1OIVA 1QZXA 3AGQA 4JKIA 3R8CA 4ABYA 5HKKD 4GPTA 4ARZA 2GJAA 1MO5A 5HE9A 1XDBA 3CRRA 3KKNA 4C0SA 4PSVA 5GADl 4M9QA 4E03A 3CPHA 1E9DA 1WRBA 2XTNA 2R6AA 3IEUA 5JBQA 4B35A 2QL6A 1E2PA 2HLDA 1NL3A 3C8UA 1ZD9A 1M8PA 2CJWB 2QP3A 2VH5R 3PEUA 5LB4A 1SXJA 1XMIA 3U61B 3H86A 2ZR9A 2XOKA 4Z1MD 4TQ9A 4B2LA 4A15A 5CITA 1J70A 4EJSA 1QG4A 2ZQ5A 2CE7A 1JJ7A 3A1VA 4A82A 3X1YA 1KDRA 2VA8A 5ANRB 4E5UA 1LNZA 1VYVA 2V9PA 1P62B 4N3NA 4YMSA 3U3OA 4X8HA 1E2KA 2EU8A 4KI0A 3TE6A 1NVXQ 5FOXA 5GJVC 1TAGA 1EFUA 2GHIA 1TU3A 1E4YA 1NVUQ 3KDSE 3T15A 4O2RA 3KQNA 4GZMA 3TIFA 3U7HB 1BH2A 4BEJA 1D5CA 2W0SA 2LKDA 4HDOB 3PUXA 3U6BA 1CJKC 4NPHA 3NBFA 4AIIA 1G3QA 3PEVA 1XJQA 3DDCA 5DI3A 2QAGC 3MMPA 2GXAA 4CZ2A 1U94A 4ZDIA 3FMFA 4D26A 3RWOA 3PQCA 2IT1A 2Z43A 2O8BB 2XB2A 1FTNA 2IW3A 2FZLA 1U90A 1W2HA 1E96A 2BDTA 4OHZA 1MV5A 1KGDA 3GEEA 1G4UR 1S4QA 2QT1A 1NBMA 4JLAA 4Q1DA 4M9SA 4UNSA 2F9MA 3R9IA 2GCPA 4GI7A 3CR8A 1VHTA 3LBIA 1TUIA 4KO8A 3TUJC 5JJKA 1P2UA 2Z6VA 3G5UA 3MG9A 2F55A 1M74A 3LWNA 1UEJA 3U3JA 4MGZR 4LHWA 5F9FA 4UQOA 4QBFA 4Q18A 2ONJA 2A5JA 1SVWA 4IFEA 4JS0A 3T61A 5LDDC 2XSZA 4A2QA 1N2CE 2FN4A 2ZRAA 3LAWA 1K5DA 3W6NA 3D7MA 4DUGA 1ZNWA 1AGPA 5JI3E 1D2NA 2HJGA 4CYMA 1OFHA 1JR6A 5JHGB 3FFAA 1EX6A 1TNDA 2REXB 1HE8B 4MGYR 2GBLA 1F2TA 2YC4C 3QXJA 5JRZA 2ERXA 4LWZA 4M21A 1NMZA 3ZJYA 4RY2A 5G53C 1SHZA 2GWHA 1V43A 2JJ8A 1SKYE 2QY9A 3DHWC 2IYWA 2FMXA 3UKDA 2FPLA 4PZLA 4C0LA 1UDXA 3HDTA 2QE7A 2CL6X 1UDWA 1MABA 5FBWB 2NO6A 3A37A 4TT3A 1Z6AA 3OIUA 1TF2A 2GJ8A 4LBWA 2REBA 2EW1A 2ZJOA 4AY2A 2CHVA 4UXIA 4DCVA 3LD9A 1LVGA 3GLHE 2WTUA 4FWIB 1RRFA 1IN4A 2W0MA 4AG5A 2IS6A 1KAOA 2ODNA 4PX9A 4BECA 1T91A 1KKLA 3ZVMA 3BB4A 3K0AB 1N6IA 3IPYA 1IONA 5FTJA 3U3RA 1EGAA 2ZJ5A 4ARZB 5BN4A 4Q03A 1XTQA 2EWWA 1NSFA 2D7CA 2XAUA 2PEZA 4UXJA 2NZJA 1DO0A 5FTKA 1Y3AA 2QMOA 3FWYA 4DLVA 4HLUA 4DBLC 2QP4A
chains in the Genus database with same CATH superfamily
1N9KA 2OV3A 2RAVA 1BRTA 1IJEA 3BCRA 3K35A 1JXQA 1G8GA 4PGHA 2B37A 4Q4JA 4XB2A 4GRAA 4RM2A 1L7EA 2XTAA 3GLGB 2FDCA 1UJ5A 2WKQA 2WWWA 3GRVA 1P2VA 4RZ3A 3V46A 3UB4A 1JFFB 3FBTA 3NBXX 4ITVA 2X13A 4WACA 5AOCA 4YIHA 3MF4A 3U1BA 4E15A 3BERA 5HX7A 3ROEA 1D1SA 2VVTA 2Y1DA 3GLUA 5F1KA 3TYXA 4OK3A 1I10A 1X8XA 2JLSA 2R96A 2IUFA 3Q9NA 1SGWA 3D31A 5HF8A 1PGNA 4MWCA 4NXMB 1S2OA 1FMFA 2WLSA 3M4YA 2K6GA 1SC6A 3GMTA 4I4TB 2O2GA 1FDTA 3HP7A 1EUCB 3BB1A 1F4LA 3S2ZA 1KVRA 1MAWA 3V4PB 1UL1X 4UBJA 2NO7A 3LY9A 1VECA 4YR9A 2JLVA 1LSSA 3OEEA 4G5SA 4KMSA 2E2WA 2ZBFA 4NNPA 1O2DA 4KXWA 5AVWA 1WBBA 4CT5A 1M1NA 4JUIA 1K7SN 5CD9A 1FYXA 4QXPA 3I5XA 2CXOA 1Z16A 1FVFA 4RTOA 3GH3A 1Y0BA 1BOOA 4BNDB 1N6RA 1BC5A 1RT9A 1ST2A 2PA0A 2RHCA 3ABIA 3D02A 3HNRA 2Q6TA 3QXHA 2KYRA 4L50A 4MPTA 2FDXA 3LY5A 3H5IA 4Y30A 1G6HA 1QUEA 1CK4A 2XXBA 4GQAA 4AYTA 2E82A 4O3MA 2X3YA 4JL6A 3INGA 1NMSA 2CCKA 4XIGS 1T1RA 1N5DA 1PJLA 2FW0A 4E2XA 4FFBA 2X9GA 4YS6A 1EAYA 2EGHA 3IA7A 5FOWA 2NPIA 1I2CA 2ZBGA 2YZKA 4Q1AA 1Q1QA 2HTEA 4W63A 1OYOA 4K87A 5EQTA 2BFPA 2VXCA 2NUTB 2EFEB 2HA6A 2R62A 4F9FA 3E03A 5K8LA 2YFQA 1KVQA 1L4BA 1X0XA 5KHOC 1GHTA 5BQ3A 2V8OA 1X8LA 8ABPA 1AMNA 4YRNA 4JXZA 1C30B 5BSVA 2LWIA 1F8FA 3RHSA 2BKLA 1LBEA 3DF7A 3X1DA 1H3NA 3N2EA 3AP1A 4FT4A 4MB0A 4PAQA 3Q3IA 4Z99A 1WUKS 2D4HA 1M67A 2JFYA 3FPKA 4DIFA 4XWYA 3ASVA 2CK3A 1XWFA 3QY0A 5IEBA 1DJMA 3RS9A 2ZJ2A 1ZCFA 3JYOA 4ARVA 2HEIA 4RGBA 3GIDA 1UAAA 2H5LA 1AM4D 1WCV1 3LFHA 4I99A 5AJWA 4ALMA 1XTVA 2PZAA 4L07A 1CEQA 1E2LA 3Q40A 2UZ0A 3A06A 1NR1A 4Y9RA 3Q6IA 4JP5A 2PANA 3PXUA 1DE0A 2XDWA 2DSTA 3DH0A 4QPPA 3RIEA 2OFXA 1PDOA 3U7RA 5CFQA 4RA6A 5KWVA 3QEMA 8OHMA 1ID8A 3BMNA 3COYA 2FFJA 3RU7A 1G2OA 4TQGA 1D8AA 5D3KA 1ZAYA 4XRRA 3VVLA 1QYWA 2CJXA 2CLCX 1V16A 3JQ8B 2R7KA 4EJ0A 1Z8DA 3B3AA 5K3FB 3WLNA 1KRXA 4JODA 3VKWA 1QMGA 5A4KA 4CN9A 3C8HA 1YDGA 3QHQA 1XTJA 4B6FA 4AN1A 2JBHA 4NONA 1TLLA 1ZVKA 3HR7A 5KPDA 2APJA 2EXXA 3ENNA 3IHWA 2FPIA 3EOBI 5FTMA 3PVCA 2ZE8A 4ZYTA 4YROA 1J7KA 1QIGA 2JHGA 4IUCS 3AH8A 3UMSA 2SKDA 3CEPB 1IHPA 4UMFA 4NE9A 1USWA 3DSRA 4HMOA 4LJYA 2VK4A 2Q5IA 2Y9MB 3DVLA 5BT8A 2FH5B 5ERXA 4JI5B 1Z5VA 4U5XA 4INAA 5EEGA 3RLIA 1LLQA 5K3EA 3FDZA 4P92A 5DHPA 1LPNA 1KJ8A 4ZAVA 4B3MB 1M0SA 1NY6A 4C0KA 5DNWA 3A0RB 4UPVA 2MINB 5C5EA 2JG3A 1SZJG 1W8IA 3E9DA 3GGSA 3K73O 3WRXC 3CZMA 4JI6B 1OT3A 3UFBA 2BFOA 4BV2A 1V2HE 2ZVJA 2P6RA 1K63A 5A3RA 3T94A 4WZAA 4JYAB 4EKNB 5EZYA 4PAMA 4LSZA 5KSWB 5HDQA 3A9TA 2VQSA 4PG4A 3T3EA 3ADBA 3K9GA 1AHHA 1Y1TA 4I5FA 3EWIA 3MRXA 1XDSA 5F76A 4BBPA 5CIQA 4N5LA 4YRIA 1VQ1A 3L8FA 2H2DA 2UZ3A 1A8UA 1CUHA 5IVDA 4KKVA 4AURA 3SLKA 4EB3A 3OKCA 3LZ6A 4OJNA 3K6JA 1LBSA 4Z4FA 3W2GA 4I5IA 4LTMA 3W5SA 4E1VA 2GXSA 4YV2A 1H8HA 1GOTA 3G7UA 1S8AA 1XZHA 2ZRKA 2IOHA 2OCPA 3KXPA 2CLKB 4MI9A 5DXJA 1L1QA 3PA8A 2VPYA 4GM4A 2Q5OA 4HN2A 5A4JA 5GJWC 3GGDA 4UUMA 1C4WA 1IY1A 1MJHA 1TJPB 2CVZA 3F98A 1B8PA 1YJCA 3TKAA 5DHSA 3VSAA 4G36A 5EVJA 3E7XA 2VRWA 2VXYA 1E1RD 2JGKA 5I48A 2C5BA 1HG0A 3UJDA 2RC6A 2YXDA 3V2HA 3IT1A 1QS0B 3BIOA 4P2GA 3SN6A 2C7PA 3WRVA 4E2FA 1K88A 16PKA 2ZXEA 4TMYA 2GAIA 2WICA 2EC5A 3H8JA 4JBNA 5J40A 1UC4B 3Q4GA 1FYWA 2VSOA 4P80A 3DJYA 2PWAA 3BHIA 4L3VA 4RJLA 1J49A 1U6KA 5AKJA 4WXRA 4V3BA 3C3YA 3ORFA 1XNGA 3EXG2 3DFKA 4JITA 2DHDA 4TWZA 4YTEA 4LMBA 5BN1A 2Q5LA 4RK5A 2P79A 4ZEOA 3IP3A 2Z9DA 3FHJA 1U28C 2PRSA 3MT8A 4KIFA 4WUTA 4CV1A 2BFBB 4OHRA 3RVRA 4B6JA 4X62B 5FF9A 3K4HA 2P2YA 3DXFA 2CHEA 2I76A 1QG0A 4JR0A 3QKIA 4BFXA 5TDHA 2XQIA 1QIMA 2QVYX 2DBQA 1U1GA 3UK0A 3HUFA 2XD4A 5J1TB 2WYHA 4B31A 2IU3A 3SIPA 2R6R1 4YAFA 1WKCA 2ZIXB 3Q3HA 4LNUB 5BVGB 1WETA 5FO0A 4C4YA 4RTQA 2ZYSA 1O97D 2WWHA 3HKCA 3KQYA 2IBMA 2VBIA 3OFVA 3QKUA 1NPDA 1K0FA 4R8MA 2ZJYA 4EKGA 5J3JA 3QFSA 4TUYB 4WCFB 3WQBA 4BP1A 1V8ZA 3RV4A 4D4JA 4MP6A 1SPBS 4IH1A 5H0IA 2MMGA 3P9PA 3D3NA 2BI7A 1VIMA 1FBNA 2Z08A 3HCFA 3P7MA 4JP2A 4PLVA 9ATCA 1P74A 5AK0A 1JAZA 3AHFA 2E5FA 3PE3A 1E1QA 2IEDA 4N3BA 3HNPA 4OFZA 3WJ2A 4NULA 1GGNA 1KK3A 4AMBA 2NQ8A 1UKYA 3AKZA 4IQFA 4HXGA 4JV5B 1E8DA 3H4VA 4MS4A 2WIAA 2HN9A 3U4QA 1ZA1A 3QFHA 4R1UA 4MIKA 3MUNA 4QL3A 4IDNA 4J4HA 2E89A 3NEPX 2Q45A 2YXBA 2IELA 1ODKA 4J1SA 1FZQA 2YL2A 3HWSA 5DBFA 4ZVQA 4BV8A 1KY3A 3EFHA 4P33A 5ETJA 4C7JA 3I6QA 4KRGA 1ZS9A 4TVKA 1T15A 3V8VA 4BMXA 2F48A 3L7KA 3WFZA 1NRJB 2XI4A 2IOFK 1MX3A 4PCLA 4MLDA 3TZBA 4H1TA 4BBAA 3P32A 3OC6A 5HSGA 1GZ6A 3QHPA 5DHUA 5A06A 3HKBA 4BPBA 3WLTA 4BGUA 2FVXA 4XI9A 2OUIA 2B0JA 4FEAA 5DBOA 5E2AA 2C98A 4D41A 3EWSA 2OFFA 4YK7A 1R4MA 5JDIC 4HG2A 4WXMA 3UGJA 2YYAA 4A5OA 3JQGB 1NM5C 3H2JA 1NOIA 4YMVA 2FFAA 4R6XA 3SQLA 1Z22A 1JDPA 1SCDA 4G26A 4N76A 3A7DA 1DAHA 2RAFA 2FKAA 1KJ9A 2C2ZA 4MMZB 4CNBA 2IYNA 2VT6A 1GV0A 4XQ0A 1KO7A 4DQUA 3IAUA 3KQMA 4FHDA 4DPLA 2BKVA 5IMBA 3FOEC 5JNUA 5A02A 3NRBA 5KJCA 4YJ3B 1NN1A 3I58A 1DZIA 1MT3A 2GEFA 3DL0A 5J2TA 1BCSB 2PO7A 3CKYA 3FMOB 4QBGB 5LUAA 3RJMA 3ZJTA 1KOGA 5BMVA 1KMIY 2C61A 3WGKA 4PC7A 1TUEA 4YPVA 2LR0A 1UXIA 4D3FA 4U7JA 4DW8A 4WH0A 3FPGA 4LDPA 1Y6FA 4I36A 3G2MA 3OURA 1WLSA 1PEKE 3ZIDA 1L4FA 2VZ8A 3VO8A 1BWQA 1IATA 4B33A 1ZUD1 4Z8YA 3V8MA 1JIVA 2W6JD 2JJ1D 2VEDA 4A10A 4B3HA 3GFVA 4WK4B 3Q2IA 2FFBA 3LL7A 4DBLE 1XD8A 2H7VA 3DVQX 3RRMA 3AR4A 5IVKA 1DRWA 3H84A 4LCBA 5EP3A 4PYOA 3IMGA 4IXMA 2GDZA 2IU4A 4BVAA 2XKKA 3OUUA 4ED9A 5FBVB 2IU6A 4M0EA 4JVLA 1ZL0A 4NEHB 1N25A 4X7RA 2DY1A 4F4JA 3OF5A 1BG6A 1VKNA 1YA4A 5CTAA 1R0CA 1RZ3A 2HW8A 3YASA 1JEYB 2ZYHA 2XCOA 4MQLA 2V45A 3VR6A 4B76A 4O25A 5B2EA 2YDXA 5CXUA 1U65A 3EIUA 3L7IA 1SOUA 3GLSA 4LK2A 3CZRA 3ZHQA 1LTQA 4BXOA 3UMJA 2PS9A 3MRVA 3DLHA 3R9XA 3KJFA 1GPKA 2Q99A 2J7PD 1XFDA 5D3MB 3TDKA 1CY1A 4YT4A 4UHEA 3BTSA 3IR7A 4XYBA 1ESEA 4KIWA 3A2NA 5HCUA 4EB8A 4KX3A 2EX1A 5SYMA 2HV9A 3DNPA 3VC3A 2D1QA 4DOMA 1NBOA 2QX4A 3AL2A 4DIUA 1B7GO 2GBGA 3QOFA 1XTTA 5CM8B 4XX0A 1IN7A 4R3WA 5IC4A 2IV3A 5KNBD 1SBCA 3G2HA 3VV3A 2EGGA 4WHMA 1JPJA 3JQRA 3EGXA 4X65B 3ZBTA 3T5CA 4JJGA 4XWAA 3GEPA 4LRSB 3EMBA 1KAEA 2JBAA 4CT4B 2F3QA 3IVRA 4DR5B 3W5DA 1F6DA 4Q4DA 2B34A 2DVMA 1HX7A 1GQFA 3Q8LA 2Y1CA 1GLNA 4PNPA 3BWDD 2XMGA 2X0IA 1FXUA 2D0DA 1BNCA 2HGZA 4C07A 3PKIA 4MIOA 4ZZ2A 4UNRA 3M8KA 4Z9BA 3VJMA 1TJ3A 4YREA 4JLDA 4HRVA 4NARA 1XE3A 1EDBA 2BFNA 3F7TA 5I9BA 1LI5A 4GI2A 5JZOA 1RQ7A 1P7PA 1R5OA 3BXZA 4C2AA 3PJEA 4ZZ0A 4XIFA 3GFSA 3UMCA 2JFBA 1JH9A 3H9UA 4K9MA 1MRZA 3IEVA 3ITDA 5KVAA 1JYFA 3U7GA 3FOWA 3SYLA 5F35A 3WNCA 1NXOA 1X7GA 1Y42X 4WN9A 2CYAA 3DO6A 4UCQA 5JC8A 4DLAA 4J90A 4WKPA 3U4AA 3ZU2A 1IM5A 1E9EA 5L6MB 1QYDA 1CZLA 2WSYB 2WDPA 3IUJA 4GAEA 3SS8A 2FF7A 2ZI3A 3X1XA 1OBVA 2VG8A 5FFFA 1ONPA 4X6YA 1U3WA 5DN6A 2HJSA 2WB2A 2F9FA 1XTRA 2OOSA 3Q5GA 5FBLB 4AJJA 3PFFA 3EXFB 1VMIA 2BZ0A 3ZVNA 3A1TA 4D9BA 3O0DA 4RD4A 1WUYA 3PFKA 3GD7A 2AH5A 3W9UA 4E51A 5DGDA 1ZKDA 2ZWIA 4OCZA 4DUZB 4RDCA 3WGMA 2KE5A 1M1YE 4J16C 2WIGA 1YT5A 5ILOA 3DQQA 2HRZA 1AURA 3KB6A 4FHEA 4Y0AA 1UXKA 4L6AA 1NZFA 1YASA 3F8SA 1YAJA 5KCMA 1EUDA 3A6GA 4IYRA 4X1YA 1PX2A 4BY9E 3VHRA 4TKZA 3AVXA 2VYVD 2IK8A 3LGSA 1UOPA 4K86A 1BHSA 3OQBA 1X80A 2RCYA 2H2AA 2WWTA 2C7VA 2QQGA 5EKUA 3SYRA 3W78A 3AUAA 4Y2VA 5GZ6A 2VAMA 4MAMA 4QATA 1UFRA 4K2AA 1SCUA 4MHOA 4RIFA 2NYVA 3FPLA 4KH1A 3V8BA 3OX4A 4JJ7A 1GTL1 1R0ZA 4D96A 2CMGA 3QVLA 4OH1A 4NMWA 2YS7A 3FF4A 1DARA 2I7CA 4HB4A 1JEDA 4CDGA 1S2IA 1NSTA 4KNWA 1IEXA 5GONA 4HTFB 4UATA 1BW9B 1ZK4A 2OORA 4NVRA 3TWOA 3ZCVA 5L3SB 1NXPA 3KHSA 4EKDA 5DASA 3M6VA 2H1RA 2C9DA 1WSWA 3O47A 2P9HA 4QZVA 4ENSA 3KR0A 1CYEA 2OHXA 3NKVA 2AMJA 5D01A 2QZJA 4F4CA 1Y7LA 3HWWA 1MXHA 2ORIA 3CH5A 3BBPA 3BGWA 4UEWA 3QPAA 3SLRA 3OOJA 3ZHVA 4F4HA 4P3OA 4ZGBA 5JVDB 4UFOA 3ZWBA 3A32A 2I1WA 2WYUA 3B6ZA 2QI9F 4OHWA 1SCJA 5FOVA 3AI7A 4RAQA 3OPNA 5K9ZA 1WUIS 3QPBA 1WTAA 3K5PA 3VMFA 3MILA 4RIHA 4MQBA 4O63O 3R7BA 4EG5A 3BZUA 4N5MA 3GLIA 1Z26A 2ODTX 3V34A 3V97A 4WD3A 1R16A 1VSVA 4XOIA 4I4CA 1IQRA 2PTGA 2QV0A 1RMTA 4JLSA 5TXGA 3O84A 1MC1A 5KTPA 3RS3A 4E07A 4FJ0A 1CS4C 1KBQA 1MORA 2HDHA 4J03A 5CLIA 1XPJA 5REQA 1P2TA 5JSKA 5DBGA 4R1QA 2FCRA 3RF6A 4ZCTA 5BYAA 1TYZA 3GZNA 4KDFA 3CLSC 2QJRA 4EY4A 3HBJA 4F06A 1LJUA 3SDSA 3NHLA 4Z0TA 4D6PA 1CQPA 3UGQA 3WISA 4HAZA 4YBZA 2O2SA 3LA6A 4KK4A 1PJBA 3PYLA 3DZ8A 3NT2A 2ZYDA 3M6LA 4K28A 5EGNA 1S3FA 2AA3A 1C0IA 2QTAA 3R5KA 2IYQA 4IDPA 5KEIA 1WW3A 5DXAA 4RY9A 4H3SA 2C5GA 4U2FA 4H0CA 1RP7A 3MT9A 4RWEA 4D3DA 1D5WA 3OQIA 4JYPA 1X2EA 2NLOA 5CX1A 4AJOA 4D46A 3K70B 2VCYA 1CIVA 3JAWB 4KHZA 5KVVA 2I34A 3ECCA 4EA9A 1I9CA 1LF5A 1NVMB 2XUAA 3K9LA 5KYYB 5AIBA 2SCUB 1JQBA 3I8XA 4PRLA 1P4GA 4OLAA 1BD4A 3KUUA 3KZOA 1PFVA 2W2VA 4Z1OA 2BWJA 4UHFA 1AX9A 4OXNA 3CF4G 5K2MA 1DAEA 1T6BY 1Z73A 1PYDA 1XJCA 3UBTA 1Q0LA 4Y18A 2R6GA 3LPDA 1CPYA 4GP7A 4RAOA 4UDOA 4S1VA 4CM6A 2Q5HA 1LFDB 3E8MA 4JELA 3DE4X 2BGRA 3QM1A 1U04A 2OXFA 2Q3DA 2XOKD 3ESXA 2GNPA 3QFTA 4OGFA 5CB8A 3G2IA 5IDYA 1KDPA 1CERA 3O8OA 4QPNA 4ZANA 2ILVA 1UH5A 2GN8A 1QCZA 2VWHA 3BF8A 3NHPA 3IUQA 3OF3A 1Y37A 5DGXA 3VR3A 5KWSA 1DOAA 2W00A 3JALA 4YJGA 4NE7A 3RHTA 2AXEA 4QXQA 3CSUA 3L0DA 4MDFA 1XYGA 3OCUA 2RKOA 4ROSA 1CX9B 1NX9A 1VOTA 2FHSA 2FFRA 2HY7A 1F0YA 2I6GA 2VDPB 4KPFC 3ZCRA 2PH1A 3RM3A 3MUOA 3OZDA 2CZGA 2VXOA 2ZUTA 3T9BA 2D5BA 4EYQA 4C4PA 2C9BA 2DHCA 2H06A 1YI1A 1RI2A 3MXOA 1YBHA 2GJ4A 3FCEA 3Q1KA 4MS3A 2BMVA 3U4MA 1ORVA 1G4AE 4OVKA 5BQFA 4M0KA 1L5NA 4TZTA 3P2EA 1SQ6A 2ATCA 3HJHA 1JG4A 3JQAD 4Y0NA 3V1KA 3ZI4A 3JX9A 2AFIA 1PZGA 4UVGA 5M2QA 2GO7A 2C2HA 4XJTA 4UPDA 3H9JA 4XLLA 4B3XA 3F3SA 4UBIA 1OROA 2OFWA 4RBNA 2CNNA 1ECPA 1ONBA 1SCNE 3TSOA 2AJCA 5I8WA 2HT1A 5A3VA 1J7JA 3OPXA 3PX7A 3KVVA 4LS3A 1RRKA 1XL0A 3ECAA 3JZDA 1NJSA 3IUYA 4MWGA 5HM6A 3DT9A 4WASA 5B7QA 3UHPA 5GVSA 1GWNA 1Z38A 1A2BA 2B7LA 2XQFA 3AI1A 1JVNA 5COQA 4BASA 1BXRA 1NN3A 2O0JA 1NRWA 1PZNA 3A58B 3H0EA 4B9AA 2Q62A 1YBVA 2IH4A 4F3TA 4JJEA 3NHAA 1JSCA 4RZSA 2PMCA 2YJ5A 1D6SA 3JQPA 2GJSA 4H4CA 4WGGA 4MVYA 3EEBA 1DZ3A 4IAOA 4P54A 4Y0VA 1YH3A 2R8EA 5D1NA 3KALA 4M9ZA 3W1VA 4AQDA 4B75A 4X8OA 4J43A 4O2BB 4HLNA 1RQLA 3BSFA 3ESQA 3KM0A 3QVSA 4WCVA 5F78A 1D6JA 3TBFA 1FRFS 1SBZA 4PBRA 5A71A 3AOEC 4EH1A 4IDGA 1ESCA 3Q9LA 2FJ0A 4K3UA 2JLUA 4HHEA 4G5FA 1PT9A 3GAMA 1ZW1A 4RF2A 4DLXA 2WPDA 3NATA 3BYZA 1UMCA 1XDDA 1PRYA 4BB5A 2HHHB 1N9GB 2PS0A 3CRMA 1VE3A 1ZK0A 2QRJA 3DM5A 2C82A 3KIPA 4JVNA 3RRBA 2VF5X 1LC3A 4P1ZA 4JLPA 1HQKA 4YJ2B 5AO9A 1F20A 3OPMA 2B8EA 1A71A 4RH0A 3RTBA 3RRXA 1GNSA 2IEYA 3IQHX 4MXDA 2CNLA 2PFSA 1KEWA 2EW8A 1CYDA 4QXAA 1MOQA 3ZWQA 4YAUA 3VJKA 1NZJA 4P34A 1J20A 4GOJA 3QXXA 4BMOB 4BVJA 3FTEA 1NUAA 2F43A 2WVAA 2FMTA 1XRJA 2P9TA 2AEMA 3HCNA 2B4RO 4Q1DA 5IYZA 3LOUA 2OC9A 3A6ZA 3E8XA 5CA1B 3NVMB 1XRSB 5EZSA 2CV2A 1BDHA 3IXLA 3QYFA 1UBEA 2WSSA 4YHBA 3L7LA 3B7GA 2WE8A 4Y2YA 5KJ6A 4L3OA 5BSUA 4PO9A 1PJSA 2XDYA 4KPYA 3CF4A 1M1YA 2IV7A 5AW7A 1N1GA 5L7YA 5KQRA 4DQDA 4RYDA 3DMDA 3P52A 1O5TA 2WZDA 3IDQA 4IGAA 2WJIA 4PLYA 4RLHA 1XA3A 1VXRA 1PQPA 1PVOA 4J0IA 4ENVA 1NMXA 1IBRA 4AZ3B 3EPKA 4LE1A 2C9OA 1PU2A 4K3VA 4AUMA 3E0QA 4Q93A 4FB5A 3Q5EA 2QRHA 4X1KA 4G09A 1IWPB 2IP2A 3B2NA 1B23P 1IL0A 3T5GA 1DTSA 1MG5A 1GA6A 3CZAA 2Q4OA 4GVLA 1DAPA 2VP0A 3BIXA 2A0WA 4K46A 6NULA 2BJWA 2H85A 3FLAA 1BAPA 2PA3A 4I1PA 1ADGA 5L7TA 3N7UA 1R0KA 1GUFA 3HU1A 3KZCA 4ZJUA 3IIJA 2ZZMA 2F00A 4HJXA 4KRYA 1XKLA 1COWD 5DLPA 2G0NA 3UEOA 2AC7A 3PDHA 3EYWA 2JDID 1WM1A 2W6ID 2Z09A 3COSA 4YO7A 5I9TA 1SXQA 3G2LA 2W2KA 2ZRCA 1E6EA 3WGLA 2O3TA 1MOZA 3H19A 1JIJA 3BMOB 2VR1A 3PQ6A 1H0RA 1KF0A 3B9PA 3ZJ4A 5DOVA 1QRRA 5E7JA 3VISA 3KOXA 1DVRA 1KMHA 4X90A 2QD1A 2Z8ZA 4GMKA 4AX8A 3FHTA 3M6FA 2C57A 2GEUA 1SK9A 1XLWA 2NUPB 4GUAA 2L82A 3Q7RA 4KU4A 4QSHA 5FT9A 3SC2A 1FFEA 2JIBA 1ODSA 2VP9A 2ZIVB 4JJ4A 3BAZA 3USCS 1SVMA 1Y1SA 4BC1A 3ZWCA 3E4DA 3G5LA 4PE5B 1DCKA 4R83A 3IUPA 3V2UA 1GLVA 4P3KA 3KR9A 1K8QA 3EDRA 1IJKA 3OZWA 1JG6A 4WINA 3IHKA 3D4BA 4ZCLA 3W5UA 5E1DA 4CL8A 4EHDA 5EHGA 5F98A 3C1OA 1CF4A 3MWEB 4FNAA 1MGPA 2QRNA 1JVSA 3C41J 4HDKB 4OSEA 4R8VA 3Q85A 1NASA 2CYCA 2BLNA 4Q9LA 4FYIA 1MABB 1FB5A 2ONKA 1J2YA 3AETA 4HGNA 2DWCA 5JO9A 4MA5A 4BJ6A 1IMJA 1LY1A 1P0IA 4TLAA 2PWBA 4Z3KA 3ND8A 3ZHTA 2L17A 4BNJA 1EA5A 1RM4A 4AY3A 4F9TA 1RIIA 3T3HA 4KBGA 2CLEB 5TGTA 5BR1A 3HXMA 4ZAYA 5ALQA 1Z4OA 1ZRSA 3V1UA 5JH7A 5FPTA 1T4DA 4EHLA 1A88A 1ZH2A 5BPHA 1KS2A 2CXNA 4FMCF 2QROA 1E2BA 3DEHA 4IHKA 1QK5A 2WWFA 4C6TA 4E2ZA 4GKVA 4J75A 1O3YA 2BGTA 1W44A 1ZNZA 3IOMA 3WR5A 2FMKA 1N92A 1HEIA 4XDZA 1YE5A 2CLSA 3SYNA 1QP7A 5EMMA 3KUCA 4EPWA 1H4QA 4WNAB 1OIXA 4NJEB 3A4LA 3R4CA 4G56A 3W7AA 1RVDA 4QTUB 4X9XA 3L4EA 4D82A 4MDHA 5H9VA 3L6UA 4QDTA 3BZWA 3M9LA 4EDFA 1ISMA 4JDPA 4KQKA 5KQSA 1OLXA 3GZTB 4NIMA 3AEZA 4BVKA 2JLBA 3PITA 1YB4A 4XCQA 3IX7A 2QGNA 5I8PA 1L5HA 5SYNA 3I2FA 4D99A 1P7YA 3C7TA 1T1SA 2BP7B 2NZXA 2X3UA 1OIWA 1QSGA 1B6TA 1JQDA 4JQCA 4QU0A 3X0DA 2ZANA 1AMOA 3FR8A 4NCXA 4KHPB 3T3GA 5FRDA 1Y3HA 4F60A 1AVTA 2YW2A 1FXSA 3BB3A 5BYBA 4KNYA 4BLPA 1X7XB 2WLTA 1MA0A 3H6GA 3PUIA 4DDWA 1KI6B 3ML1A 2J0QA 4YV0A 3MTAA 2QPTA 2NADA 4KUHA 3I8OA 5TQ2A 3QVXA 1CQIA 1CV2A 3E3NA 5LYJF 2YHAA 4ETWA 2FSUA 4TVSA 2WF5A 3M82A 1OD6A 1OFGA 2IHKA 1Y33E 1P6UA 5JPCA 4DSNA 3B3JA 2OVBA 4I9FA 5E3IA 3GFGA 4XUCA 2KI5A 2R4QA 1R0YA 1TIKA 2BE9A 2GBIA 4OY3A 4R1SA 3BCUA 2NP7A 5HNKA 1WSDA 2GQ0A 3IIMA 3O8LA 1JE0A 4GS5A 2ZI5A 3ISTA 3N1UA 2IP4A 2ZAMA 1QHIA 3A6DA 2BFFB 3NT4A 4R69A 2HCBA 4EM6A 1MDBA 3UMYA 1QHHA 1Z4MA 1F2UB 4OKNA 4H08A 1K9SA 2D13A 3LLVA 2IEBA 3M6XA 4N7BA 4NMMA 5C8DA 2HK6A 2W6CX 1VIYA 4D43A 5F64A 5EE5B 1QWSA 2ORED 4KR9A 4TTTS 1DO2A 2H2HA 3KLBA 1EUZA 1OXXK 1Z56C 1Y9DA 3NRJA 1U99A 2QNRA 3P2IA 4D4HA 4EA7A 1EXNA 3FF1A 4TKLA 1JB9A 3ONFA 3W5CA 1OWOA 3T7DA 3V4LA 1RQXA 4YT8A 3V4RA 2VT7A 2CEKA 1JMYA 2NQ2C 2R5FA 4D8WA 2V7EA 1NUSA 5AVYA 4ITUA 4YN3A 5H80A 4C05A 1BDJA 2BTQB 2I55A 1XRLA 1DT5A 1E3WA 3LHKA 1W0KD 3NBKA 1E2FA 2O7VA 5B3KA 1L4NA 3E2IA 4IUDS 1FNCA 3PC8C 4N18A 4JBWA 1UR5A 3G0HA 3WQRA 1GTG1 2EHDA 1OU0A 1JZQA 3BKWA 4NPAA 2BIFA 3IE1A 1IM8A 2DPHA 3AERA 2AD5A 3ETHA 3I01A 3IURA 4U0JA 1X9GA 3K16A 4D0GA 4Y98A 2XB9A 2FQYA 4JOBA 5E2IA 2GMWA 3FN4A 5PNTA 4RELA 4RY0A 2FR1A 3PI7A 2QVBA 3B89A 5FNVA 1ABEA 1IZ9A 1WMBA 1YD7A 1YZFA 4HUJA 2QTCA 2W2LD 3AF0A 4I1OA 4QYWA 1HOXA 4YCSA 1ONNA 3BRQA 2AFHA 1E3MA 2YFYA 1H22A 2J6BA 4GDFA 4LTDA 3DOFA 3D2CA 3DL4A 4GGPA 4K6KA 4Q3BA 5LC1A 4KUEA 4RKQA 5DMXA 4N41A 3EPPA 3IAM1 4Y2XA 3OM1A 5DCYA 2OE2A 4J0JA 5H4HA 2PQ2A 1TO2E 2B99A 4RLQA 3QW2A 1FNMA 3L02A 1VGRA 3MPOA 3QMWA 4FMBB 4D8YA 2QTVB 1U0RA 3R7NA 4RTSA 3BGIA 1UADA 1QCDA 4QNRA 3T9CA 2Z5LA 1MJNA 2PRKA 1E2UA 5SYAA 2EQAA 3TCKA 2NAFA 1D6MA 1H2RS 3QXSA 4QQRA 2EIHA 3FHLA 3TW0A 1ZG3A 2IKQA 1S7CA 3I05A 3WBBA 5LQAA 1M8GA 1SUAA 4RS4A 4JSYA 5CXSA 3I1IA 2RGRA 2ACVA 5LXTF 4TTVA 3JAMA 4LK3A 4LVCA 5A7GA 2ZB7A 3K1JA 3RFFA 3TMKA 1F0PA 5AW1A 2ZI7A 3BK7A 4RFSA 3ZY5A 4A03A 3NNSA 3QMPA 3TIXB 4H0NA 3WP0A 4EVQA 4CM4B 1N2XA 1PL6A 4JUBA 4DR7B 3SGLA 2VPPA 2VSQA 2QB5A 4R9RA 1ZJYA 1YJQA 2I7VA 2IA5A 4TTQA 2JAXA 4B2YA 3DUFA 4FLFA 2O8CB 4KZKA 2EHJA 2QZ4A 3PP8A 4R40A 1W36B 4PZAA 3NG1A 2Q6KA 2D1SA 5EQDA 1YMVA 1SUIA 3SKXA 1XZLA 3CNNA 3ADDA 4C43A 3GBSA 3L1VA 4A4DA 1CZUA 2YWHA 3NPAA 3LT0A 1XF1A 1P44A 4ZEVA 5B3JC 1U5BB 1VGQA 3FYDA 3QU5A 3T7SA 3TLEA 2QSYA 1EFAA 2YH2A 1T9HA 2GILA 3MK31 5IK2A 4KK3A 1ETUA 4QFMA 4EKIA 3C4JA 1Z83A 3EASA 1UBHS 3E70C 4FTWA 5EKTA 5K3BA 4EYOA 4F5DA 4UPEA 1M2OA 1OH7A 3P2OA 4F45A 3M6WA 4TMXA 4BLUA 1KYWA 1KDTA 5CAEA 2A30A 2IHZA 2E0IA 3LGXA 4LMAA 5BRNA 4FHFA 2QVZX 5A04A 2PKXA 3FPBA 2MHCA 5EIEA 5AXAA 5F7XA 1CVLA 1NG9A 1QPBA 1CEEA 4BPRA 2WM3A 2CFCA 5KAPA 5IJXA 2ZWMA 4CLOA 3PGVA 2AZMA 4CWAA 2YYZA 4H31A 5LM3A 3ZDXB 1A8IA 1R8SA 2II6A 5TLSA 3KR1A 4B4VA 4TS4A 1E9RA 1FLAA 1LCIA 1QC5B 1U3GA 3USES 1OH8A 1C0PA 4EGAA 1HDZA 1I5RA 5GPBA 2J9XB 5FEUA 3S7TA 3QOXA 4ZO8A 1QO7A 2V7QA 5FUXA 3VPHA 2O3JA 1ZJ6A 2VJAA 2B69A 3JYHA 4GI5A 2P35A 2PKQP 5HFNA 3SKVA 3T9EA 1YZNA 2IHVA 3CCBA 4RX1A 4CXMA 2IQ5A 3NM5A 2F1JA 4GG1A 1M0EA 4PO1A 2V6FA 1L5MA 4TM8A 3TLZA 4IX1A 4ZWNA 4Z86A 3W5IA 2C04A 3HGQA 1F7VA 4LYHA 1SU8A 1S2DA 3B60A 4EPRA 3GT7A 2WUFA 4UU7A 4FKBA 2RAUA 4C0XA 1IOWA 3IAS1 3RSOA 1BN6A 4K05A 4PRYA 5FWYB 4QOHA 1L7PA 2ESRA 4XGKA 4N7MA 4EI7A 3HE3A 3DW1X 4EGCB 5A5EA 2GZHA 4CG0A 3H1BA 4EYGA 1H2YA 3KP1A 1I7QB 2PPLA 1OR8A 4GSKA 1GYQA 4TX1A 3VOTA 1K3TA 4BKPA 5JS7A 1CVIA 1LRLA 3HUTA 4BV9A 4QDUA 1QIJA 1GM5A 221PA 1OI7A 2PZFA 5FWXB 1XGKA 2H63A 2ZI9A 1JECA 1UCFA 4R98A 4WNIA 5AVTA 1ZIPA 5I3CA 1O9HA 1A77A 1EP2B 1MO6A 2WRZA 3E48A 2Q7OE 1QX3A 3B36A 4OMUA 4C03A 3J80A 5I6DA 3QJ5A 3EOZA 4O1HA 3S0JA 1BHJA 4GKJB 4P84A 3F6RA 3OTHA 5G0WA 2A1TR 2GK6A 5TE9A 3BXFA 5JFOA 3LTEA 3HCPA 4X60A 5I7FA 1KRWA 1Q2XA 3RC3A 4AG3A 5CA0B 1FA9A 1SQ0A 1GQSA 4G5HA 4J07A 5E38A 4XRGA 4I19A 3F1LA 2ID9A 4P58A 2OOKA 3U26A 1XK6A 2YV5A 4OBWA 2HCFA 5EWMB 2FGKA 1C3VA 4G1MB 3TXXA 3ROQA 1JKJB 3MBKA 3EHDA 2QF7A 3LUHA 1VPEA 2G77B 4J7AA 2CWWA 1TM4E 1UBMS 1TVEA 2F1RA 2YZ2A 1Q7RA 3IPAA 4KR2A 5KVSA 1C3EA 4WVFA 1DAMA 3NHUA 5FBQB 3FW1A 3I2IA 5EJ2A 3UCEA 1WL8A 4WBXC 1FW6A 1CXZA 4MX8A 4DHEA 3ENQA 4OI0A 5JR3A 2EKPA 4YHHB 2V1XA 3VYTB 2FAXA 4BRZA 1C8LA 1CRWG 3WNDA 2J6HA 2VBGA 4ZQGA 9MHTA 3WLKX 2V0CA 3ZY6A 1EDZA 3FYTA 3WLMA 3G5AA 3JRXA 5BXYA 3REFA 1FLDA 2VYFA 5H83A 4XWOA 2QP9X 3IOBA 1CR2A 2X0RA 5SY9A 2FSGA 2Z83A 4BN5A 3HJUA 4FOOA 1X1CA 2NM0A 1P9RA 2XJ9A 3MRTA 4UAUA 3L0YA 3GXBA 4X20B 2VRCD 3G8DA 2RDMA 4PIVA 4O4JB 2XIQA 3R40A 2O20A 4JJIA 3WZLA 5IW8A 1A9RA 3ZW7A 4ENTA 1SBNE 1JFSA 1NJ5A 1HRKA 3VTFA 4PS0A 2FJUA 1KI8A 5DTIA 3L7CA 4QRIA 4JOCA 2IDMA 2YMQA 2V7XA 5DP1A 3QELA 5AUNB 1P5FA 5PGMA 4S24A 3ILYA 3ND9A 5F3WB 3WAGA 1H4SA 1PR3A 1FNSA 3JVIA 4UNPA 3R7WB 4HEA6 4EKYA 5K20A 4MMYB 3HCWA 1XEWX 3LA8A 5SZIA 1J2EA 3S7ZA 3P9XA 5M29A 3I53A 2O52A 1HTTA 1W52X 2PYIA 1QGUA 1P4AA 1DUIA 2BMFA 2ZBQA 1FX0B 4I6JA 3QXGA 1ZI8A 3K9FC 1JBKA 2XMZA 1XQ9A 1ZVMA 1E99A 1K7EB 1NPTO 3CT4A 3EXEA 4WZBB 1YRAA 3T1QA 5EJAA 1ZBQA 1TCCA 3W2IA 3CX7A 1K89A 3BH6A 3GDOA 4I50F 4DCGA 2JFNA 5D5PA 1B74A 3FYUC 3I04M 3IUSA 1XVVA 1NWHA 1JR4A 1UP7A 3OM0A 4FINA 3U0BA