3T1VA

Mgla bound to gdp in p2(1) tetrameric arrangement
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
192
structure length
192
Chain Sequence
b'STINFANREINFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIGEVKGFKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein mglA
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 52
structure length 192
sequence length 192
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t1vA00
5GVSA 2Z4RA 2Z5FA 5EUQB 1Z47A 4NCHA 3R9XA 3QBVA 3V4FA 3KQUA 2DFKB 5DLQC 2O8EB 4PC3A 1O3YA 3TNFA 4NDZA 2FSHA 3FOZA 3RYTC 4HZUB 1YZQA 8OHMA 4QGAA 3H84A 2EYQA 2FZ4A 4O2RA 1CR0A 1EXMA 3C16C 4UNRA 4N0DA 5JECA 2ZRHA 3B6EA 3RLFA 3VR2A 4DLYA 2BM0A 4KCGA 3AF3A 4NP6A 2XTZA 4UNSA 4DDTA 1HV8A 1QHIA 4Q02A 4ARZB 3IHLA 5KSPA 3KDSE 5HZKA 3PUXA 1AZTA 2RAPA 2HYIC 2IYLD 2A9KA 4RD2A 4JVMA 4LJ6A 3X2SA 5LDDC 1G7TA 1E2LA 3SI7A 4BFVA 2O5VA 3TR5A 2PLFA 2HEIA 3NKVA 4ON9A 2V7QD 1E32A 2D7CA 5EZ6B 2IS2A 3A1UA 1EFTA 3GFOA 1M1YE 3SS8A 3AVUA 4ZCLA 2W00A 2GEUA 1E0KA 1IN7A 1DO0A 3T5DA 5KSYA 1DS6A 1UDWA 2NO7A 4OHYA 1FTSA 1G64A 4KODA 4URYR 4OK3A 1Q0UA 2DFLA 4TMZA 3RS5A 1YR6A 3C7KA 4QGGA 1UBGA 3SBEA 3O8CA 4LJ4A 4OJKA 5FH9A 4CEJB 4B35A 2FOLA 4A1FA 4AYXA 3BGWA 3O8DA 3FWYA 4BFWA 2HT1A 2WWGA 4NONA 4A8JB 3C14C 4IDQA 4GSYA 3B1XA 2JEOA 4MRSA 1OFTA 2RGEA 4UNQA 3HDTA 3KTAB 3QVUA 3SYLA 2C98A 4V0NA 1XCMA 2NQ2C 4DBLC 1XPOA 4BUJA 5JJIA 4EPYA 5FOTA 4UXJA 5FOWA 1NSTA 3AUYA 5TB5A 3TE6A 1XTQA 2ZJ5A 1AKEA 4LC0A 2IYYA 3OF5A 5F3WB 4D0NA 1KZGB 4JLJA 3UMRA 5KPJA 4DLRA 1GL9B 3AKEA 3P4XA 4EIWA 1WMSA 3MWYW 3QPVA 2O8FB 4KLZA 4ZCIA 4JBWA 3P26A 5JWOA 1IM2A 1D5CA 3QE0A 2GETA 1SXJA 3IIJA 4B74A 3SFZA 4PQYA 4JLMA 1G41A 1GUAA 3EZFA 3BFVA 4IVQA 3I1FA 4QFMA 4YMSA 5FPHA 2WWXA 1KI6A 1P2TA 1MV5A 3QXSA 4Q7LA 1GP2A 3AP3A 4ASUD 5KNDA 2RB4A 4FN5A 3AVPA 4BEJA 3U3JA 4E22A 5DISB 2RHDA 3UWOA 1U90A 4Q4AB 1Z0IA 2O8CB 4O3MA 2BC9A 1U0HC 2P2LA 4IRUB 2ORIA 2IXGA 2QN6A 1LVGA 3A58B 4C0SA 1TEXA 4TLCA 4OQFA 3W9YA 2J0QA 2C77A 4BLRA 1R0XA 1UEJA 2P6UA 4EUNA 3PEVA 1MKYA 2FSIA 2D7DA 1ZM7A 3OIVA 1G20E 2ZRNA 2RGDA 3UKDA 2CBZA 3CNLA 1Q44A 1XJQA 3REGA 3T34A 5DGXA 2OLKA 1Q22A 3CRMA 1DAEA 4J0QA 2A30A 4GP6A 3BAFA 1AM4D 1P9RA 4L5BA 4TLEA 3W5IA 4ASUA 5CLQA 4G5QA 2NOAA 1HUQA 3CNNA 2YYZA 1Z6XA 2ZUCA 4NYJR 3MUFA 3DL0A 4HAZA 1T0JB 2IA5A 3ZIAA 1Q3TA 2VHQA 4A0RA 4RFSB 2J0UB 3NBZC 4TLBA 821PA 4WZAE 5J4KA 4TSFD 2P6RA 1Z06A 4DDUA 2P5SA 4IEIA 3U4QA 1KI1A 4HAWA 2NGRA 5FOUA 4FW9A 4JS0A 4Y0VA 3EXAA 1XTIA 1OIXA 2FA9A 3LBHA 2WWIA 2V6JA 3KQNA 5JLJA 4C0KA 3GLIB 1D2EA 2G6BA 2CHVA 4HYYA 1UDXA 2ORWA 5GVRA 3GJXC 4AD8A 2IYRA 2FGKA 1DARA 3ASZA 2RGGA 2VBCA 2ZIAA 1M34E 4OI0A 4LYHA 2V6IA 1EX7A 4IDNA 2F7SA 4V0KA 3MD0A 4XH9B 3MGCA 1G8YA 3U3MA 1ELOA 1G6HA 3WBJA 5L8VA 1MO3A 3AP1A 3SE0A 3QSYA 2EW1A 5JS7A 3RRZA 2EU8A 4TSFA 4QJ4A 4ZV4A 3GPLA 4D82A 1HH4A 5CB8A 1E2MA 5J4VA 3IDQA 1W4BA 4M1KA 2WJJA 2Q3MA 1PUJA 1AS0A 2R6AA 1XBTA 3E1SA 1W4CA 4JSYA 1X86B 5L3VA 5C4MA 3AVVA 2BMEA 2CJWA 4MYHA 2JIZD 4KYIB 1KJZA 4X8HA 3K70D 3PQCA 2XXAA 4NHOA 1U0LA 5K8IA 1T3SA 1I2MA 2IUTA 2VHCA 5KSOA 2Q0HA 2OUKA 3AVXA 4EPVA 3SHWA 2C04A 2VP4A 4CEIA 4DCNA 1G5TA 2YC4C 3FYHA 5G3YA 3L0OA 3RC8A 1Q1ZA 1LW7A 1KAGA 1XEXA 4QBHA 1NIPA 1HTWA 3FMOB 1YZTA 1S9DA 3R8FA 4MRPA 4RVCA 5KOYA 1S9HA 4TMKA 3GLHE 4JKYA 1QHYA 2BMJA 2CL6X 2QAGC 4GMXA 1E2NA 4PQFA 2P0EA 2FJUA 3A1TA 1IY0A 1Z28A 2JIZA 3BH0A 3HP1A 4R7ZA 2XOKD 1TUEA 2J7PD 2VA8A 4PR0A 2CK3D 2ZR7A 3B60A 1XEWY 2R2AA 1L4YA 2F1JA 3CF2A 4M4SA 1T5IA 1GL7A 1TEVA 1S8FA 4ZO4A 4KHZA 2AD1A 2IYUA 2BKUA 2ZQ5A 2OBMA 3VKGA 2OG2A 1A82A 5G53C 2ASEA 2ERYA 3E70C 3U2QA 3D31A 2OXCA 2KE5A 4I1SA 1I4LD 2R8RA 1TU4A 1DEKA 1AKYA 2XITA 2FWRA 4RCZA 1GAJA 4BFSA 2GAAA 2FX3A 1OV4A 4GFDA 2OCPA 3ZLJA 4OI2A 5DN6A 4ILEA 3VR6A 1HEIA 3TLXA 4YDSA 1II9A 3TQCA 1Z8FA 1ESNA 2F1RA 2XOKA 4FI3C 4OYHA 1G4UR 2Z4SA 2CK3A 3K9NA 5M04A 1HYQA 2W58A 5IK2D 3CPEA 2W83A 3RWMB 4AYWA 1NG1A 2OBLA 1AJEA 4HEJA 3AM1A 4RFVA 1P75A 1ZD8A 2VSOA 5FBLB 3C4JA 3SQXA 3CF6R 1P9WA 2F9MA 1V5WA 2WAXA 1W5SA 3SZRA 1E1QD 4R98A 4DUGD 4KBGA 3B13B 4QL3A 4YXWA 1DOAA 2QQ0A 4TZ6A 3VQTA 1NMZA 2CCKA 2NIPA 2IXFA 2IUSA 4JLNA 3U7EB 1XJ0A 4FIDA 2D4HA 4EJSC 4PHGA 3A4LA 4RSGA 4H1UA 3AUXA 5TMPA 1N2CE 1PVOA 2ZSFA 3GLHA 2H18A 5IK2A 1GWNA 3VX3A 4GP7A 4BE7B 1VYUA 2H92A 3G5UA 3TSZA 1DTSA 4DCVA 4QKQA 2VP0A 5H1YA 1OXUA 3KXIA 3L8ZA 4BFYA 5AUQA 3LAWA 2I4IA 2QT1A 3QXHA 1E1QA 1NSFA 1QHHA 2DR3A 4DUGA 4W5JA 1E99A 2P6NA 3EZ2A 3ZS8A 3NDBB 2RGAA 3MG9A 1W7AA 3WNBA 2ZANA 5JWHA 4NKRA 4NYMQ 1JPNA 1YZUA 1D2MA 4PAQA 1KSJA 5BN3A 4QNRA 4HB2A 3Q9LA 1XF9A 5TY0A 3CRVA 4EQ6A 3AKCA 1K8RA 2JLYA 2FZLA 3DM9B 1YRBA 4I81A 4TQAA 2KI5A 4H9GA 4TL8A 5H68A 1SVIA 1Z29A 4NCIA 1AIPA 4F91B 1KK3A 3VR4A 1XRJA 1OB5A 2ATVA 1DAHA 2ZPTX 1PLJA 4ITRC 4KFRA 3GP8A 3KXKA 2GXAA 2QMHA 1GNPA 2NMVA 2ZS7A 2G1JA 2Z6VA 3AGQA 1E96A 1E6CA 4WW0A 5A0FA 1R8SA 2ATXA 4QHYA 1ONBA 2CEAA 4RD0A 1KSFX 3CX6A 2ZSAA 2GILA 3LY5A 2J45A 1E2DA 2CHGA 1EWQA 1WQ1R 3A8TA 2AR7A 1BH2A 2ZYVX 2VRWA 1R7RA 1WF3A 4TMWA 3CKLA 5HCIA 3C5CA 4H1VA 2N1BA 1GTVA 2C2HA 2HUPA 3EARA 2XX3A 1IY2A 1N5IA 2QBYA 2PZGA 1U2RA 2Z0MA 1YR8A 1QHSA 5IF9A 4P0TA 4XIGS 2ZR0A 3MFYA 5DHAA 4JLBA 3IQXA 2CMKA 3VHXA 4LI0A 2VHUA 2QP3A 2FSGA 3E2IA 3KKPA 3BFXA 3SBDA 4OI4A 2V1XA 5JMTA 4CYMA 1H8ED 3BORA 4A9AA 3GCGA 4NZYA 1TF2A 2Z83A 3KKQA 3OESA 4YONB 1G5PA 3H1TA 3ONWA 3QG5A 4Z54A 3IBYA 2VP9A 1GRRA 4LYJA 1Z0FA 3BJIC 3QOFA 4IVPA 2IYXA 1G17A 4DLXA 2W0MA 1XJCA 1NN5A 1F2UB 1SULA 1E2FA 4CGZA 1JNYA 4JYBA 4A82A 4CIDA 2R6GA 4MKFA 1J8MF 1DE0A 1SVMA 3CPJB 3H4MA 1LF0A 4ERNA 2ANBA 5CIWA 5G41A 3R9WA 2CLDX 4HUTA 1GIAA 2OSBA 5EP4A 2J0VA 2QAGA 3HPRA 1H8EA 3BIFA 5JS8A 3WRXC 1CULC 3L0IB 1W49A 3T1OA 5KDDA 3U5ZB 3OAAD 1E9FA 1CKEA 2QE7D 3CX7A 3QKRB 4JMPA 1KMQA 2QZ4A 2R44A 3B1VA 3Q8XB 3QXCA 5EJEA 1A1VA 3L43A 1F6BA 2CHQA 1VG0B 5FOXA 4UXHA 5FOSA 3Q5DA 1II8B 2ZR9A 3UG6A 5JCPA 2VSFA 1KK1A 2R6CA 5EXXA 2B7CA 1G3MA 1Z0AA 1IY1A 4RZ3A 2WJHA 3AF0A 3FVQA 1QZXA 1R4AA 1NLYA 3IEVA 1YE8A 1Q20A 3MJHA 3CR8A 1WXQA 2BKEA 2QAJA 2BCGY 1YR9A 3OAAA 3AF2A 3BERA 3GEHA 3LH5A 2QE7A 2VF8A 3W8NA 4BZPA 5F98A 4FINA 1WP9A 2PMKA 1E2QA 3TW4A 2ZRJA 4MRNA 1QBKC 1Z0KA 5BYKA 3K0AB 4A6PA 4LJAA 4RKFA 4RD3A 3KQLA 1IN5A 2CCGA 2ZAOA 3DEFA 5DE3A 4BZXA 3BE4A 1WB9A 1GKUB 2AL7A 2ZRBA 4AI6A 5JZVA 4NYIQ 1GILA 3ADCA 1Z07A 5DI9A 1TU3A 1F48A 4JVNA 5DNYB 4PZZA 1G3IA 1I4TD 4Z1MA 5JEEA 3AKDA 3NHBA 4JT4A 2JDID 2W6ID 3PR1A 2WMOB 1N6HA 3FFBA 4IVRA 4DT1A 1W36B 5FUYA 3BD9A 2BEJA 3QPWA 2BDTA 4EKDA 1PZNA 3B85A 2W2VA 1P6XA 2CLSA 4F38A 5L3SB 3GLGB 2PMDA 3V00A 2YVUA 2XSZA 1N0VC 3GEIA 3L0PA 1ZD1A 3EZ6A 3UWKA 1LF5A 3T1QA 5KNBA 3TR0A 1P9NA 1F60A 4URVR 4IXNA 1CBUA 5FI0B 4PO9A 1D9ZA 2IBMA 2IYZA 1NJFA 4P32A 3NG1A 1E94E 4JJZA 4XWKA 2VSXA 3EC2A 4AKEA 1M8PA 2ZJBA 2QY9A 2ODBA 4LV5B 1QVRA 2FE4A 2QL6A 1NG9A 1XXHE 2W6IA 1A7JA 1W4RA 1A2BA 5FR1A 1VCIA 5L3QB 5TXGA 1N5LA 1JR3E 2VYFA 4PTLA 1P60A 3NC0C 2WSMA 3I5XA 1R6BX 2FPMA 1FX0B 4II7A 4JLOA 3A6PC 2OEPA 4BRUA 3I61A 2BBSA 5DHFA 3TRFA 1TF7A 2DWQA 3H86A 1ZJ6A 4MA4A 4ESVA 1W46A 1YHNA 3GLFB 2FV8A 1KI8A 3L8YA 3F5FA 1FP7A 3LBIA 4DLWA 2XZLA 2A3RA 1X3SA 1Z08A 2FH5B 2YZ2A 5B30A 2RGXA 1D6JA 4A15A 1G3QA 1TPZA 4C2UA 1ZM4A 2JA1A 4MGYR 3VR1A 1NY6A 4UNNA 2ZAMA 2Q9AA 1VCNA 1Z0JA 3ADBA 3CB4A 4Q7MB 4OK5A 3SYNA 1KAOA 2E1RA 4L16A 1D8TA 2J46A 3CW2A 5IHPA 2EFCB 3C41J 3ZD6A 3DM5A 4NE2A 1JB1A 3PITA 4EFMA 4R9UC 3NIBA 2OCBA 5FI1B 2F6RA 4P4SA 3FHOA 2FEMA 3JZMA 4XSGA 3RS7A 2QA5A 4ZI3A 3ASYA 3R7WA 1HT1E 1JR3D 4M1MA 5DO9A 4DIEA 1H8HA 1YJ5A 1Z6AA 3JVUA 3KJHA 4D6PA 4GNKA 4XWOA 2BVNA 2G88A 2H17A 4IHQA 2WJYA 4NCJA 1GKIA 4C7OA 3RC3A 3CH4B 4MH0R 1UADA 4BLOA 4DWJA 5JJKA 4Q66C 3Q5EA 1U99A 3A4NA 2Q3FA 3VAAA 1FTNA 2NZJA 1KI9A 1Z6GA 5KUTA 5FOVA 5AK0A 1DBSA 1NVVQ 1ZM3A 4M8NE 4EPWA 4KFTA 1ZP6A 4LJ7A 5F9FA 3HU3A 4CEHA 1G291 2EFDB 3D7MA 3FHCB 1XXHA 2D62A 1JR3A 4NYMR 4ZCMA 3TW8B 4URWR 3ICEA 2QU8A 4PHFA 1ZM9A 2PZEA 2ZETA 2ZJOA 5B64A 3N2IA 2DFTA 4TN1A 2IHBA 3UMSA 2OAQ1 1X1RA 1Y63A 2OXRA 2HCJB 4Q00A 4RD4A 5J4HA 1XD2A 1TMKA 2E87A 1NL3A 1G9XA 1NVUQ 2VEDA 5SZHB 1XMIA 4C9BA 1KTVA 3MSXA 4K46A 1AGRA 2O0HA 4R2HA 1DAMA 2QPOA 3U7FB 3THYA 1GKYA 4U7DA 1B23P 3G82C 3W34A 3QENA 5BXQC 3BXZA 5FR2A 3WXMA 3FKSD 1CLUA 3HU2A 2ZUDA 2XZOA 1S4QA 1U8AA 2ZI7A 4Q1EA 1ZNZA 4JLAA 1VDZA 3K0FA 3ND8A 5AR1A 1IXRC 1G5RA 4JL5A 3QEJA 2IWRA 3K70C 1E79D 2NO1A 2N46A 2J41A 4RCYA 1G21E 3CRQA 3RAPR 4D81A 3LRPA 1E2EA 3WBKA 4KXFB 4ZIRA 2GXUA 1Z63A 1N6IA 1IAQA 2VO1A 4B71A 3TK1A 2ZI5A 3PG5A 4V02A 2X2EA 5AJXA 1ZD9A 1UF9A 1KDPA 3CZQA 5BW8A 2HXSA 1KIMA 5GADl 5TDHA 1ZUIA 4HDQB 3HYTA 3I8XA 4PAMA 3U60B 4PSAA 2PX3A 3FKSA 1P2UA 3HJNA 1SXJB 4MUAA 3LD9A 5D3MB 4JJKA 2JJ1D 2EFEB 2GCOA 2LWIA 4AWXA 2O8EA 1MRSA 1P2VA 4NU0A 2GZDA 1FFHA 5FPTA 4Q03A 3UANA 2ZRPA 4I1VA 3ZVRA 1E79A 1KI6B 3NWJA 3UPUA 1QHGA 2V7QA 3KUCA 5BWMA 1I2DA 1RFLA 5EE0A 3KL4A 2GNOA 1F3OA 4PPFA 2WV9A 5FFMA 4EAQA 3GMTA 4IJMA 4LJ8A 4NTZA 5CJPA 4M9XA 2D06A 4MRVA 4Q4HA 2GDJA 2XAUA 2ZSBA 4HAVA 4PXAA 1JR6A 1Q3HA 1DG3A 2BM1A 4Q9JA 5DIFA 5AWFC 4ARZA 1LY1A 4D80A 3KXLA 3LW8A 1N6OA 2G77B 2OFXA 5LBIA 2DWOA 1R0WA 4KJZA 3NEJA 3EIQA 2ZI3A 4DB4A 1U0JA 4L4UA 2F3RA 3HR8A 2DPXA 1OHHD 4OHZA 1IBRA 1FL9A 2QPTA 3SU8A 1RRCA 4TTRA 1IONA 4XTCS 3IIMA 5CM9C 4LYFA 4LSGA 1X6VA 1G7CA 1SZPA 4U5XA 5EE1A 1CJTC 3ZVLA 3AVWA 1N6RA 4F4IA 1W44A 4DRZA 2FMXA 2GJ8A 3TIFA 2DHRA 3RRNA 1R8QA 4RD6A 1XNJA 4F93B 5CYPA 2C96A 4CEJA 3U4QB 4BFXA 1CEEA 4C0HA 1SHZA 5LPNA 1XMSA 2J3EA 4KFSA 4UNPA 2BJVA 1OXSC 2QTHA 4PC2A 2MSDB 1OHHA 4C3ZA 3FHTA 1AS3A 1NMXA 1TADA 2VLIA 2WM9B 3Q72A 2IC5A 5JSZB 5KPDA 4FMCF 1KI2A 1EESA 4HAYA 4Q4JB 4BLTA 4LWZA 4O2LA 4TWZA 2BBWA 2OE2A 2O0KA 5DI3B 1W5TA 3D8BA 3EA5A 4RZUA 1D9XA 1US8A 4PHHA 1S0UA 2HDNB 1ZU5A 2W2TA 1LFDB 1U8YA 1CS4C 1SGWA 1CIPA 2IS4A 1XEFA 1BYIA 1ZYUA 4D4KA 4YQFA 3I72A 3GLIE 3T15A 1W2GA 2QRZA 4G1UC 4ZPXA 1RJ9A 4PX9A 3WYFA 1YZKA 4QBGB 4GT1A 4YMUA 2CL7X 1CF4A 4TYPA 5GJCA 4IFBA 3FGNA 5K8LA 1XCGB 4NYIR 1KYIA 2IYVA 4BZQA 3NEYA 2CJWB 2AHOA 3IO5A 3SN6A 4R71A 3ZVNA 2QM8A 3B8HA 1SVSA 3OFND 4TYNA 3PEUA 1UKYA 4BFUA 4HB4A 4DLVA 5SZIA 3JVVA 3ZQ6A 2GF0A 3QKSA 4B3XA 4CEIB 1CR2A 3TUJC 1KDRA 3NBYC 5KYKA 4P4TA 4DCSA 1KO8A 1TAGA 1MABB 5HE9A 3NC1C 4Q1BA 1AK2A 2IEYA 2C03A 2GK7A 4W5HA 2QP9X 4GPTA 4X8LA 3RS0A 2QTVB 1C9KA 3CZPA 1OYYA 1NN1A 3F3YA 3MMPA 4LJ5A 3S1AA 5E3HA 2GXSA 5FPKA 1U9IC 2QI9C 4G5GA 2JLVA 1AA9A 1VCMA 1O87A 3TBKA 4DEYA 2N42A 2XTMA 3HU1A 2X1VA 2ZI6A 3QQ5A 5FUXA 2OCAA 3GJ6A 3LX5A 3OFNA 3NVAA 3QJYA 2VPPA 5DH9A 2ZXUA 3LVRE 4IEEA 5C18A 2YWFA 3FE2A 2IYQA 1YVDA 3OIUA 3T06B 4D4MA 1PJRA 3CLVA 4URZR 5BYJA 4E09A 3N2EA 1WDTA 1R5OA 4LHVA 4PHTA 4RFSA 2QTFA 1JJVA 4FMCB 2WWWA 1JEEA 2GRJA 4DKXA 3PIRA 1IN4A 1G4AE 2GBLC 2PEZA 2WOJA 1GM5A 1E2GA 4TMXA 1A5TA 4LBVA 2JAQA 1RPZA 2KBEA 1IN6A 2DB3A 1CRPA 4B3GA 2G9NA 3RSOA 3JZAA 3VNVA 1RKBA 4LOAA 3GLIA 3B2EA 2WKQA 3IPYA 4IKEA 3ZD7A 1G8HA 4OJQA 4GOKA 4MGZR 1NNEA 2RH5A 2QGNA 3LNCA 3U44A 3N5CA 2FDCA 5JJLA 3X1ZA 1VECA 4PPNA 1T8UA 1OIWA 1L4UA 4KI0A 1NVWQ 2VIIA 2EVWX 1BS1A 1J90A 5FTKA 4MGKR 2XNSA 3OE7D 1ZUHA 1JQLB 3GD7A 1MO6A 3TSWA 1KO5A 2B6HA 1RC8A 3K9HA 2FN4A 2HLDD 3V9PA 4DLZA 4GOXA 2J0SA 2BHRA 3PUZA 1VYVA 2YHSA 3L2OB 4F4CA 2BOVA 2X77A 4W9MC 4A92A 3LVQE 2ZVPX 2ZE5A 3BB3A 3P1JA 3TQFA 4GI7A 1Q1BA 4TTQA 2J7PA 1YZLA 3RANA 4I99A 3PCRB 1GITA 4WXPA 1NVVR 1W0JD 3BOSA 3K9LA 4LDJA 1AQYA 4FWTA 4TYWA 4OI1A 3OE7A 1YR7A 1WA5A 2FFBA 4M22A 2PBRA 2G0NA 4DEXA 3VTKA 1CR4A 1OKKD 4M9SA 4V0LA 2VTKA 1CP2A 5P21A 4D0LB 5FTJA 2GESA 3UK6A 1IJFA 3OHMA 1IXSB 1I4DD 1XZQA 2E9SA 2IUUA 4HLQB 3W8RA 4AK9A 1QHXA 4C4PA 1OT3A 5FL3A 5CK4A 3T35A 4HLUA 3GJ4A 3AEZA 1OFIA 4LRWA 4TLAA 3W5JA 4EQ6B 4ZDKA 5F9HA 3PEYA 2ZRKA 5EP2A 1JXMA 1XTRA 1W0JA 4HAXA 5C2JB 4G5SA 1E9DA 3MAAC 1T6NA 2BJWA 2ZITA 1JQJC 2IF2A 2ZROA 1JEDA 2ZJ2A 3KKMA 1C1YA 1M6NA 1OKKA 2MSEB 3ZZTA 3D3QA 5HZHA 1U98A 4QXAA 1KMHB 1SKYB 3SJAA 1VG9B 4LV8B 2F43A 1P3JA 1FZQA 2H16A 3DVLA 3W3ZB 1NY5A 4DLTA 2GEVA 3X1WA 4FCVA 4LYAA 1DAKA 1G7SA 2XB4A 3N70A 4TYQA 1KKMA 1HY3A 1S3GA 3THXB 4AG6A 2HT6A 5JRJA 3ZZ0A 1Z2CA 4QOSA 4OQMA 1UEIA 2B92A 1NBME 2WWFA 3TVDA 3R9IA 2QBYB 4ZDJA 3LWNA 2OHFA 2AN9A 3W6PA 1MO5A 2O52A 3H0KA 4V03A 1N5KA 2X2FA 1WRBA 3C8UA 1FW6A 1G18A 1MOZA 3AV0B 2HCBA 1F2TB 1YZNA 4A0GA 3ADDA 1C4OA 2O0JA 2ZJ8A 4JZKA 4Z8XA 3THWB 1COWD 1M7BA 1KKLA 3E5HA 3W6OA 1CTQA 1CJVC 3GJ0A 2NO6A 2BWJA 2G0TA 2OBNA 3Q85A 1F5NA 3QXXA 4PO8A 4QHTA 2OM2A 1S96A 3FDIA 2C9YA 3GFPA 3AKYA 3I3SR 2RHMA 4ZDWA 1W4AA 3W90A 1ZNWA 3T12A 1K5GA 1XTSA 3K0CC 3VFDA 3EASA 3X1YA 4XD7D 1WBDA 2ZU6A 2JJ2D 4POAA 2AXNA 4YMTA 4MKGA 2JCSA 1M2OB 3FB4A 2QQEA 4QGHA 5JEDA 1OXTA 4TQ9A 1NBMD 2PH1A 1COWA 5G3ZA 1NKSA 5J4LA 2SHKA 2ZE8A 2ONKA 1U9IA 3BBPA 2QAGB 4LX0A 1VG8A 2ZSEA 2QUZA 4N3NA 3RHFA 1OH6A 1ESMA 2NG1A 4KV9A 3DMNA 4DJTA 2CLCX 2QSZA 1XB2A 3FPAA 1T5LA 4NH0A 5LD2B 1CJKC 1NLZA 1JAHA 3CF0A 1ZIPA 3LQQA 3Q7PA 2CNWD 4RJLA 4B2LA 2YV5A 1OE0A 4NBSA 5JFGA 2PCLA 4AKGA 2QG6A 2UZ3A 2HJVA 4RD1A 721PA 4NPHA 3BRWD 2JJ2A 2H57A 4C0JA 3BWDD 4PC1A 3A1SA 2V3CC 3BB4A 1NBMA 4XVQA 3VR3A 1P72A 2RMKA 2GBLA 2R6DA 2VH5R 2D3WA 1OF1A 1QRAA 2REXB 1QDEA 3FMFA 3EG5A 1N6KA 4LZZA 1OH8A 1X8KA 4DSNA 5EUMA 4PSKA 3CR7A 1KNXA 4P33A 5KHOC 4MGIR 1JPJA 1ZIOA 1T3LA 3I73A 2C5LA 4LBWA 4B6FA 1W2HA 1W0KD 4OHWA 2A7QA 1PUIA 1N6PA 1T9HA 1HQCA 1KGDA 2CNWA 1ZNXA 3K1JA 2EQBA 2O8DB 3WP0A 1NI3A 4ESHA 1TUIA 2YOFA 3QI2A 3CNOA 2ZJZA 4CW7A 1G8PA 4KU4A 2Q21A 2OFWA 2QT0A 3HPQA 4LV6A 3UG7A 1N25A 2ODWA 4D2IA 5HPYB 1L2TA 2D2EA 2AKYA 2GCPA 3A1WA 3W6NA 2HYDA 3QG1A 1KO7A 4X8MA 3DOEA 5BQ5A 1II0A 2VQSA 1DO2A 1VCOA 2Q6TA 4B47A 3LV8A 4IDHA 2I1QA 3NHAA 4M9QA 1KDTA 4KVAA 2BEKA 2YWHA 4DT1B 1E0AA 4EJSB 1HE1C 1R0ZA 1XX6A 3TKLA 1TQ4A 1E1RD 2ERXA 1H65A 1EX6A 3DO6A 3O47A 4LJ9A 1A4RA 2IS6A 1WE2A 2AFIE 1UBFA 1W0KA 4PZLA 5GJVC 3B1YA 4TYYA 4W7SA 4A6XA 4BPBA 1N3BA 4WVFA 2J87A 1HA3A 2NTYC 2XJ4A 4TQUS 2GJAA 4UXIA 4Q7KA 5J40A 1F2UA 3C5HA 4WIAA 1DG1G 2JLSA 3EPKA 1M74A 4MITA 1UBCA 3TAHA 2R6FA 5IRCD 4F7WA 2J1LA 1YZGA 1KJWA 3GLGE 3MWKA 3QKTA 4BECA 4AIIA 4PPQA 2R65A 2Y8EA 3NDPA 4GL2A 3DHWC 3FTQA 2CDNA 1SVOA 1HT2E 3F8TA 3KFXA 2QSYA 3OZXA 2HF9A 3TSOA 2YNMA 3I32A 5CYOA 3AF4A 2PL3A 2NPIA 3QKRA 3WYAA 4B3FX 3FFAA 3HR7A 4JBXA 4Q19A 121PA 2V1UA 1OW3B 2YINC 1II8A 2ZRFA 4I4LA 5TV2A 4O25A 4DXAA 4PC7A 2BBTA 2GF9A 1FOEB 2LKCA 2ZE6A 4LPKA 3RRYA 1KO1A 3I5YA 1EFRD 1ZCAA 5FTNA 2DY1A 4L15A 1NN0A 2XEXA 4B3BA 3QNUA 3LBNA 4N0EA 5EP1A 1UKEA 1Z6YA 3DKVA 1RIFA 3IGFA 1NLFA 1FPMA 4CT4B 1E0SA 5LB2A 3GLFE 2JLXA 2A5JA 2JDIA 2WJIA 2KB0A 4A8JC 2OILA 3PUWA 4PO1A 3T5GA 4JKIA 1KI7A 4IDPA 4UJ3A 1Q1EA 3WMEA 1JALA 2AK3A 1TF5A 2FPLA 4Q9IA 3K0AA 1E9BA 3IEUA 5E7JA 1U81A 4C0LA 4CZ2A 1EK0A 3GQBA 4U02A 1AZSC 3IUYA 1ZUNB 5BN4A 2P65A 3DPUA 3CM0A 2YJTD 3EIEA 3NTUA 4LHWA 3EPHA 1PV4A 1Z6TA 2D74A 3PENA 3R8CA 1LB1B 3VNUA 5A4JA 1RZ3A 1RRPA 2WZQA 4Q1DA 1G19A 4FCTA 5AJYA 1S1MA 3LDAA 2XB2A 5L3SA 2ZJAA 4MQBA 4EPRA 1OH7A 2WIAA 1IOZA 4V0ME 2IYTA 1DPFA 2I1VB 1XD8A 1XMJA 1T0HB 3QF4A 3L0SA 1P61B 1XWIA 4KFUA 2PT5A 3AB3A 2PLRA 3UIEA 5JWRA 3SEAA 4GRAA 4B3DA 2R9VA 4JL8A 2CE7A 2PEYA 5D3QA 3K0CA 4D25A 1XD9A 5CITA 5C1BA 1XD2B 4TLDA 4WA7A 3VX4A 1TTTA 1Z0DA 1OFHA 2A5DA 5CK5A 5EE9A 4ZKEA 2O8BA 5AUPB 4OKSA 4LBZA 1XCPA 4OHXA 3RSLA 3THYB 2QGZA 3G0HA 1ZNYA 1CXZA 3CWZA 3O8BA 2LCFA 1ANKA 1FP6A 4P31A 1NP6A 1FX0A 5C46F 1XZPA 3L82B 2FFHA 3K09C 5B57C 2IYWA 3M0EA 4N1AA 1G3RA 3GLFA 1J7KA 1VHTA 2Q9BA 2F1IA 3QEOA 3FMPB 3EA0A 5HKKD 2F9LA 3CO5A 4M1OA 4PC6A 2V55B 4K81B 4HUQA 1L7VC 4ZI2A 3WY9A 1DAFA 3U6BA 3ETLA 5JRZA 3LO5A 3J81k 2ZRMA 1KK2A 4ZKDA 4GMDA 1CU1A 4U00A 5HCNA 3BH6A 3TUZC 2GJKA 2NO0A 2DWPA 3VU9A 2XZPA 1U94A 2B7BA 1YQTA 4A4DA 1Z83A 2GCOB 4YMWA 4Q47A 3IO3A 5CB6A 1V43A 2ZRAA 1QVAA 2C8VA 1GRNA 1AGPA 1OPXA 2HV8A 4CT5A 3TAUA 2WJVA 3Q3JB 1OXXK 3ICQB 3B1ZA 5HKKA 2FNAA 2JLUA 5CJ2A 2EWVA 2CE2X 4MYCA 3QUSA 4V0MA 1W47A 3W3AA 4EPXA 2I3BA 3A37A 1J2JA 1SXJE 4Q4HB 2B8WA 2GKSA 4IOLA 1KSHA 1W1WA 4S35A 4QM7A 1G3UA 2ZTSA 3SDZA 1NVXQ 1GDDA 2DFNA 4A0FA 1AQUA 3THOA 5FTMA 2AWOA 3PV0A 4PPGA 1BOFA 4TZ0A 4MKHA 3T61A 3QVVA 3IQWA 2F55A 4LGMA 1G7RA 2ZRCA 4QNMA 5H70A 1ZINA 1GVNB 4GZLA 1OFUX 4B75A 1E69A 1G8FA 5GJWC 3U3KA 3BH7A 1FUKA 1YRAA 4HZUA 1G16A 5EE3A 3VHLB 2QRNA 2C99A 4Q9LA 4AURA 4DCTA 3ND9A 4TTPA 1E2JA 4QBFA 2MMCA 2V8OA 3A1VA 1XEWX 4PZYA 2ZS9A 3PEWA 3NBFA 2GCNA 4KITB 1KK0A 3AH8A 4JLPA 2C95A 2J9RA 1ZMXA 1NN3A 1ZC3A 1CRQA 1L8QA 1SXJD 3RNLA 3T1TA 1MH1A 3EPLA 2ZM5A 2JJ1A 5FPYA 2GVZC 4HLUC 4BASA 4BQSA 3RS2A 4M2LA 1ZVQA 2J5XA 4Q1FA 2H5EA 3SHFA 5KU1A 3VKHA 4FXPA 2GEDA 2IYSA 4Y0AA 2VHTA 2H8KA 2X19A 1UFQA 2W2XA 5JI2E 2IHYA 1US8B 1GFIA 3QKUA 4LY6A 4DHEA 2WAYA 3AVQA 3HYRA 3GJ5A 2YOHA 2GZAA 2GAOA 4HZIA 4LHYA 4GDFA 3SR0A 4B6EA 1KY2A 2IW3A 3TVTA 4ACBA 1Q57A 1ZAKA 4FWIB 5D3MA 1LNZA 2K5UA 4M1YA 1RJ9B 2FFQA 2ZSDA 1HQYE 3KFVA 1SQ5A 1FMLA 1GG2A 4C2TA 2PT7A 3I92A 4F92B 4A8JA 3EW9A 4US2R 3CX8A 5CLLA 3SFVA 3KTAA 4Q1CA 2YWGA 1N0WA 2JLQA 1BO6A 4OBEA 5BN5A 4Q18A 1S2MA 2CVFA 2WIBA 3U7GA 3IKJA 4QRHA 1XPUA 2BCJQ 3K53A 3QKSB 3BK7A 3KB2A 3NH9A 3ZIAD 4NCNA 5CIQA 3U61B 1MR3F 2OCYC 4JL6A 3WNCA 1OIVA 2O8FA 4AKIA 3V4RA 5J4YA 1HURA 1IN8A 3S1AB 4DC9A 4B48A 4M1SA 3REFA 2EFGA 3LX8A 2QNRA 5E95A 3OIYA 1S3SA 2VP2A 3Q7QA 2IX3A 4PFSA 4JLDA 1XP8A 4LBYA 3MCAA 1IHUA 5CM8B 4ACAA 5IT5A 3M4YA 4US1R 5E7IA 4Q7JB 4DSOA 3LW7A 2QORA 4B2IA 2HF8A 1LTQA 1SVKA 3ZDQA 1P73A 2XXAB 1EWRA 4BWYA 4RKEA 1KJYA 4MYTA 2FSFA 3CIOA 1P5ZB 4EDHA 2OAP1 3TH5A 4GZMA 2UZIR 1MT0A 4Q4AA 2O8CA 1E0JA 1RYHA 1T91A 3KX2A 4X8OA 1E9SA 4A2WA 1NIJA 4DB2A 1P2SA 2IF0A 3ZGXA 1KNQA 4RZ2A 2OO7A 1XEXB 4TL6A 1XMVA 2TMKA 2H1LA 1GZSA 1ZU4A 3ZH9B 1OYWA 2VF7A 2KBFA 5AJVB 3DMDA 3SJBA 4AYTA 3CBQA 3PVSA 5IDVA 1R5NA 2ZU0C 1JJ7A 5JSZA 4B33A 2BBOA 3WNDA 1SVWA 3B1WA 3K09A 4FMBB 4Q4JA 4QGFA 2LKDA 3PFIA 5HTKA 2GVDC 3PUYA 5DI3A 3K70B 2G3YA 4M1WA 4XOIA 2ZRGA 3U44B 4EFLA 3KKOA 4XWAA 3GEEA 4WOPA 1SHKA 2AWNA 2OESA 3B7GA 4LJYA 4DVGA 4LPSA 2ZYWX 2OZEA 5FBVB 5L3RA 1VHLA 1BIFA 5UKDA 2W0SA 2GXQA 2J0UA 1ETUA 5JHGB 4RY2A 1JBKA 4B43A 2QM7A 4BLSA 4IW3B 4MUBA 5KDLA 3ECCA 4KVGA 3SJCA 1YU9A 4PAOA 1M7GA 1K5DA 2L0XA 4Q01A 3LFUA 3WHKA 3K8YA 1JXOA 3GJ8A 2WPDD 2XTNA 3ZJYA 2JLWA 4G3XA 4US0R 4L9WA 1UAAA 3UATA 1UKVY 3IPXA 2CVHA 1BMFD 4NL4H 3P4YA 2IXEA 1XTJA 1ZW6A 2ODEA 4KO8A 3VMFA 3KJEA 1E9AA 3ZVMA 2CCJA 3MWLA 1MABA 4JT2A 1Z2AA 3M6AA 3OEED 2G83A 5HE8A 1UJ2A 3AVYA 2GZHA 5EZ5A 4OK6A 4AC9A 5FUVA 3GJ3A 4AG5A 2RCNA 3OEHD 4OQNA 4WZ6A 5DN6D 5F2EA 521PA 1KHTA 1TQ2A 3U3RA 4JVLA 5JBQA 5E4FA 3PJRA 3A36A 3I8SA 5LD2C 5CDFE 3U6KA 4Q48A 2JASA 3GFTA 3A4MA 4OHVA 1MO4A 2WPDA 4HB3A 2GA8A 2UKDA 1E3MA 3X1DA 2RGNC 1BMFA 2RKOA 3FMIA 5KO2A 3GLHB 2Q9CA 3AGPA 1M7HA 2IK8A 3LA6A 1E2KA 3NBXX 1G8GA 4OQXA 3ZQJA 3BC1A 3OEEA 1FQKA 4TMTA 3CONA 5AUOB 2KJQA 4MDEA 2C9OA 5H8WA 3WP1B 4HSEA 1DADA 2GTPA 4Q1AA 2PZFA 4YXWD 1QHHB 1ZM2A 2PJRA 2WKRA 3OEHA 4HI0E 1T4GA 2F43B 2IS1A 1KI3A 4YDHB 2HLDA 1VMAA 2PX0A 3SJZA 1QHNA 3RS3A 4IOMA 4LCBA 4UJ5A 3CH5A 4YLGA 2GWHA 1LV7A 2KSQA 3B82A 4B76A 2FG5A 5EP3A 4Z51A 1Z5ZA 2ZRDA 4WBSA 1Z22A 1SKYE 2QENA 3AVOA 1XDBA 3EZ7A 4HATA 4FD2A 2WTUA 5KDOA 1Q1QA 1EFHA 3X1XA 3AP2A 4URXR 3U7HB 1J99A 3KQHA 2GJ9A 1E9CA 3I4LA 3DZDA 3PXGA 3WRYC 1XFAA 2WSSD 5JI3E 2FFAA 4LHZA 4UQOA 4WXRA 5FL7D 2QROA 2WHXA 2WMNB 5FBQB 4ABYA 4C30A 4NMMA 3HWSA 2ZVQX 2A5GA 3I62A 2HJGA 1IQPA 4DDVA 5GJBA 2W6JD 4BGDA 3K9GA 1E2PA 4LK2A 4QJ5A 5FBRB 3LXXA 4L8GA 2EFHB 4UKDA 1WBBA 2ECKA 3ZYCA 5JCZA 2YC2C 4PSVA 1E2HA 4HAUA 1KO4A 3DOFA 4MYUA 4TT3D 2GK6A 5CDFA 3SOPA 4A0HA 4C0BA 1RW4A 4HDOB 2MSCB 4V0OA 5AJZA 4WZBE 2GHIA 2ONJA 4DSUA 3SC3A 1X8JA 1RYFA 4KBFA 2QP4A 3U3OA 2WSSA 421PA 2RGBA 2WJGA 5FL7A 4XTRA 1OLOA 4G01B 2EWWA 1IJEA 2J7KA 1ZBDA 2YOGA 4MKIA 2AD5A 2JGNA 1W36C 2W6JA 4OL0A 1P7CA 4LUCA 4KSCA 3VKWA 4G0NA 1VG1A 5FPSA 2AFHE 4W5WA 2FF7A 4IFEA 1P62B 3DZ8A 1DAIA 3EC1A 4C0AC 2DYKA 2ODNA 4TT3A 4JVSB 4JLVA 4M53A 3CRRA 5TVKA 5FTLA 1PLKA 4LHXA 4GBMA 2R62A 1KOFA 4R2IA 2P67A 1KMHA 2XJ9A 3TJZA 4JIMA 4BFTA 4AY2A 3P27A 4C0QC 1Q12A 2D2FA 1S1CA 2VHJA 4O0MA 1W48A 1KI4A 1EFCA 1GNQA 3THXA 2WWHA 3UMFA 5EXSA 2AK2A 4A36A 3P32A 1VIYA 2AKAB 2ZYTX 2WKPA 4XVRA 1R10A 1Z3IX 2DCUA 4BRWA 4TL9A 4IOKA 1TNDA 1P4SA 3WHLA 3WMGA 3SYKA 4DDWA 2WVJA 3CWQA 2NO9A 3AVTA 4HDCA 2BMDA 1E9RA 1UM8A 2A2ZA 2J59A 3KZ1E 1N5JA 1NKTA 3OIWA 3CUEF 4Q9HA 2AXPA 4XD7A 3R20A 4QG7A 3RS4A 4D0GA 1F2TA 4CDGA 3C15C 3KB1A 4G5RA 3THWA 1ZRHA 5SZKB 1FQJA 2F1HA 1E4VA 1FNMA 2QEQA 3DKPA 2PJZA 4IOJA 4PQRA 1D2NA 1X1SA 2NZ8A 2ZRLA 3F0TA 4LC1A 5KNCA 2P3SA 4GOJA 2BMFA 4OQLA 1N6LA 2OV2A 5TARA 2GJSA 4BFZA 1EG7A 221PA 2A5FA 1T8TA 4KLNA 4DIDA 1YKSA 5SZJA 4CF7A 5EXTA 5B58C 4B73A 4KAXA 3IIKA 4P4UA 1T3HA 2ZREA 4RZXA 4JYCA 2JATA 2Z43A 3K0EA 4EPTA 4Z8YA 2QPAA 2OFOA 4DLSA 3IHWA 3MJRA 1RRGA 2FEOA 3IBGA 1KDOA 2IWHA 3RABA 3ZZUA 2IT1A 3DDCA 4I1OA 4KSBA 5HR5A 5DSZA 2C78A 1MRNA 2Q3HA 4QJ3A 3KUDA 4TMVA 4XJXA 2V4ZA 4DZZA 2ZUBA 4MDFA 1E98A 621PA 1AN0A 5J5CA 5C4GB 1GSIA 5EE5B 3IILA 4CRWB 3QXJA 4HLDA 2IL1A 2WBLC 1Y3AA 3BB1A 1OH5A 2QMUA 2RGNA 1WCV1 3LQRA 4QHSA 4D4LA 4E03A 1J8YF 1NJGA 1PLLA 4XSHA 1J70A 1U8ZA 4QC2A 4E5UA 1B0UA 4FCWA 3TMKA 2A78A 1VKJA 4B2PA 4M9ZA 3ZS9A 1UPTA 1ODFA 2V9PA 1VIAA 2X8AA 1RVDA 1G6OA 4FMDF 4JLKA 3O8RA 2WICA 3EZ9A 1XTKA 4Z1MD 4ZDIA 4M21A 1KY3A 3QF7A 3P20A 3RRMA 1JI0A 3FKQA 4D4JA 2KWIA 1RRFA 1AS2A 5E7MA 3T1VA 2CL0X 4NYJQ 4QBIA 3WYGA 1VPLA 2ZRIA 2YKGA 1SVLA 1E1RA 1FNNA 1X8LA 3ADKA 3CRW1 1UBEA 4BLQA 1QF9A 2XSZD 2O8DA 1ZC4A 4Q4LA 3EX7C 2QMEA 2QMOA 1Q21A 3TUIC 4B44A 1DAGA 1QG4A 5EXPA 1OSNA 1TQ6A 1GOTA 2ZS8A 3LLMA 4E07A 1UKZA 1CJUC 4JBYA 4HB0A 1VTKA 3LLUA 5G40A 5AJWA 1IXZA 5FBWB 4YMVA 4I1UA 1OXVA 2ZJYA 2VL7A 5K8TA 3SQWA 1RE0A 2ZEJA 1SXJC 3EAQA 2NPFA 5AUNB 1NMYA 3SNHA 2P5TB 2V54A 3RWOA 4EJSA 3CPHA 1R5BA 3EWAA 2FPKA 4IXMA 1W36D 2REBA 3KJGA 2JJ8A 2JLZA 1XU4A 1GNRA 4L9SA 1LS6A 2BV3A 5ELXA 4Q5IA 2G1KA 3QF4B 1FUUA 4P4SB 4B3CA 5FUWA 3QBTA 4XVUA 2ZI4A 1BYUA 3QPUA 3RDPA 3R7WB 4BLPA 1E9EA 2F3TA 4G5OA 1GL6A 4M0LA 4AKHA 5LB4A 5DYIA 3EPJA 4KYUA 2ORVA 2YWEA 4NCKA 1CR1A 4QM6A 5J47A 2HXYA 3B78A 1N6NA 1VYTA 1EFRA 2JLRA 4PANA 4C7OB 3QIAA 2WWYA 3NXSA 3H2YA 2O8BB 4K8OA 2H7VA 1DVRA 1CJMA 1ZCBA 3GJ7A 3M1IA 1HE8B 2EYUA 2VP6A 2DBYA 3MLEA 3LXRA 2REOA 4EFNA 3TGPA 3B5JA 4DLUA 3KJIA 3MWJA 5A5GA 1GRQA 1R0YA 3BS4A 5KSZA 1KZ7B 4FMDB 4A2PA 1LS1A 5DYGA 2OT3B 3GLGA 3D6TB 4CVNA 2XNDD 3BFKA 4CEHB 3WMFA 1OB2A 1XXHB 2ZYUX 1H8HD 4IDOA 2WOOA 2RGCA 1KSGA 4DSTA 4D26A 4Q21A 4HUQB 1NF3A 1EGAA 2ANCA 3B9PA 1A2KC 2VP5A 1FMJA 1G1MA 4S2EA 2XGJA 2MMGA 2AX4A 2FGJA 1JAIA 1NRJB 3RVBA 5KTYA 5EQTA 1TX4B 1N0UA 4B32A 3VU9B 4A2QA 1TL7C 3QY0A 5L3QA 3AQ4A 2A5YB 3UXMA 5K8UA 4F4JA 2OLJA 2B21A 3PUVA 2FU5C 1OJLA 3KQKA 1BKDR 3KKNA 3K0FB 2XNDA 2ZE7A 3AF1A 4M1TA 4Q9KA 4TL7A 3EIHA 3K0SA 1JECA 1R2QA 1K6MA 3NH6A 4URUR 4DCUA 2C9CA 1DELA 2IEZA 4YC7A 4BEBA 4JSTA 2CXXA 4ZIRB 2PCJA 6Q21A 2B8TA 1E4YA 3MRSA 5JHHB 4WAUA 1QG2A 2BIFA 1XPRA 4MRRA 1E2IA 1EFUA 5ANRB 3VR5A 4B34A 5B2ZA 3B9QA 1TQDA 4HLCA 2ZI9A 3EWSA 4P3YA 1SKQA 2UVQA
chains in the Genus database with same CATH superfamily
5GVSA 3E61A 2EG9A 2Z4RA 4HNTA 4DY6A 4NCHA 1M2WA 1VB3A 1VPVA 3EXHA 1M75A 1TOAA 3GQVA 3PWZA 1E4OA 4KUEA 3JQEA 1O3YA 4W99A 5DLQC 1K98A 1XDGA 3JQ8B 3L8MA 3TZEA 5EJAA 3DD5A 8OHMA 4HKTA 2WPNA 3H84A 3O9MA 4YP1A 4BMXA 1TI7A 1Z5OA 4TROA 4NULA 3QVSA 1XYGA 3EGDA 3W78A 3UMCA 1JHMA 4OGGA 2FMTA 2Z56A 5B1DA 2XGJA 1K8QA 2OV8A 4M36A 5K7SA 1NNSA 3EXIB 4YP6A 5LYYA 2OGSA 1WB6A 2R5NA 3BK1A 5CNJA 1FXSA 1T35A 3R6DA 3LKBA 3WLPA 2R47A 3D6HA 5G0VA 1BE1A 4ARZB 4I7EA 2INGX 5KINB 4Q0MA 4FQ8A 4DWOA 1W581 1WAMA 2QW0X 4NU8X 3HUUA 3T3GA 3P0IA 1KAMA 2HYIC 4NARA 5LDDC 2FCAA 1QFXA 3VR0A 1SD5A 2ZOSA 3R6TA 3AF5A 3UF0A 1JNXX 3DXZA 1P5FA 3G68A 3GR6A 3DL7A 4IUCS 5IC6A 4CG3A 1ECCA 2D5IA 3OBBA 4ID9A 5JC1A 2YV2A 5IDQA 1UBOS 2VG8A 3AVUA 3LY7A 1M1YE 4KNVA 3SS8A 3COVA 2W00A 4YK7A 4BRZA 1ZH6A 3R3JA 1UZLA 5TEWA 3T5DA 1NW9B 2PU5A 2JFGA 3EDYA 1T2UA 2NO7A 3I6IA 2OO5C 1GGJA 3KUXA 4G8JA 2BFWA 4FM9A 4KODA 5LQMA 1ZIXA 1Q50A 1XZNA 3C7KA 3U81A 3CIFA 4C6TA 2BKAA 1FFYA 4YJ3F 1VRWA 2TMYA 3A1EA 4OJKA 4B6JA 5JASA 3A05A 4KPYA 3KP1A 1YTUA 4B35A 3WA6A 3QLVA 3EEBA 4F2HA 2I0FA 3A4YA 3PUKA 4A1FA 2PN1A 1R4MB 3O8DA 4ZD6A 3V42A 4JXXA 4LXGA 1P1IA 3HEMA 3UPDA 2Y05A 1UK9A 3QLTA 4LMBA 4MRSA 3BHIA 3H2SA 3KTAB 4EYGA 2NQ2C 4DBLC 1QQBA 2XB9A 5EKUA 5KNDD 1NSTA 1EBFA 1YBAA 3AUYA 4PN3A 1QKIA 5C8ZA 1RI5A 3AFGA 3FUVA 2GPSA 1XTQA 4EFDA 1JEYB 4QVIA 1WHSB 2ZJ5A 4BQFA 4FHDA 3OF5A 3Q2OA 2MTBA 2R97A 3U0VA 5ES4B 1F1JA 1JSZA 2FAXA 2JS7A 2H1OA 1GL9B 4EBBA 3CTPA 3EXFA 3NQ41 2VH1A 5E6SB 2PSHA 3ZV6A 5JWOA 1IM2A 4LAFA 4QUEA 1POWA 4HNQA 1TO1E 1SXJA 1SXIA 3IIJA 4P81A 5KTOA 4B74A 4HWSA 1G41A 1QO0D 1GUAA 3EZFA 4N18A 1WS6A 4REQB 1X7GA 3KOWA 3AEXA 3U0BA 1FBNA 4XYMA 4YJGA 2P0AA 1W5FA 3HUEA 3O2JA 3QXSA 4Q7LA 4EEXA 5EJ5A 1GP2A 3STHA 1G6Q1 3AP3A 3VVCA 1K4MA 3GW8A 4FN5A 4S04A 1J2UA 3AVPA 5CJPA 1IRXA 1E1CB 1HEUA 1Z0IA 4Q4AB 2BC9A 3HUTA 2ORIA 4IWYA 3PPIA 1LVGA 2R00C 3A58B 3A2LA 1TEXA 4TLCA 1IBCA 2OVBA 4YCBA 3RIHA 2J0QA 3AO0B 4G0UA 1Z8HA 1MKYA 1ZA1A 4ZAZA 2TS1A 2WTMA 1ZM7A 2I22A 3OIVA 3D1LA 5JYDA 5HQTA 2DGDA 3EY9A 1LH0A 3N8KA 2CBZA 4N7JA 1COZA 4E5NA 5KVAA 3REGA 4O8ZA 4ROTA 4Y3UA 4YIHA 2OLKA 1Q22A 1VBMA 5KKAA 1F2VA 2Q1TA 4J0QA 2D5CA 4MOWA 4WVLA 3IALA 3W5IA 3H5VA 4RXTA 3IVMA 3WSVA 2XE8A 1UZMA 2ETXA 2R8OA 3DMHA 3PIIA 2YYZA 4HR7A 5G0TA 2ZUCA 2HPVA 3SVTA 3ZY3A 1FPQA 1MXFA 3DL0A 4XUGB 5FA5A 2BSAA 2IA5A 1AMOA 4A0RA 1PHPA 3D6VA 3JQ7A 1MNQA 3H9CA 1YJQA 4RFSB 3VYTB 2CF5A 2DBZA 2P5SA 1C30A 1KI1A 3RYFB 2YS7A 1VPWA 1YQQA 1YBMA 5AKGA 3IEKA 13PKA 2B1IA 4BGEA 3DULA 4KTTE 4EO4A 1BN6A 1E3TA 5F64A 3IT3A 5IVHA 4M1QA 4E1AA 2GBFA 4MI6A 2C8KA 3P2YA 2ZWPA 3IQGX 1M8JA 1LX7A 1F12A 2OFFA 4HYTA 5I48A 4DQKA 4QYWA 5TT1A 1I7DA 4IHJA 1RFGE 2BGTA 3UICA 5A2QA 2H08A 1GPYA 1A5AB 4UD2A 2WYHA 3H1EA 1ZO8A 1XV5A 5HP4A 3B89A 3BA1A 5ADHA 1HDRA 2QS9A 5KYVA 4Z9AA 4XH9B 1TKBA 3U3MA 1ELOA 1G6HA 2NUTB 3RKSA 4KN8A 2EW1A 2WG0A 4I19A 3WWEA 2EU8A 2ECPA 1X0XA 3KVYA 3BXOA 3EQ8A 3NWEA 3EN0A 2YASA 1ORIA 4WNAA 1BMDA 5J4VA 3L0BA 1W4BA 1PT9A 3FZNA 1J8QA 4HNRA 2Q3MA 3O83A 1PUJA 1AS0A 3TDMA 1B2LA 4HH1A 1OZ0A 4JSYA 2HF7A 2F3UA 4H77A 5C4MA 1I5OA 3GD5A 3DFUA 3DZHA 3RWBA 2JIZD 4KYIB 5ALGA 4N39A 4UZFA 3RYIB 1CC1S 1I2MA 1QQAA 1K27A 5EOVA 2OUKA 2H1HA 2YIVX 4OY3A 3K0HA 3UH1A 2DTXA 3FCXA 5AHWA 1HEYA 1EWTA 1RPAA 4QX6A 1A71A 2D1TA 1G5TA 4E32A 2GD2A 4L2IB 1L4BA 3OPYI 5C80A 4L27A 2VF5X 1JIVA 4HRAA 2RI0A 1KAGA 2XUDA 4QGSA 1YZTA 3MILA 3N75A 2IIQA 4OB8A 2GCIA 3R8FA 3QVGA 4FYMA 3FPEA 4MRPA 3L5OA 5CLJA 1S9HA 1RKQA 3OURA 3R3XA 4IIUA 4LVUA 1JDPA 3T3OA 2BMJA 3SZGA 3Q6MA 4JC0A 1JE1A 1E2NA 2M32A 4GMXA 1M1ZA 4H1TA 2AW5A 2P0EA 1SHLA 4RK7A 1DCFA 4CM1A 3HP1A 4LXXA 1U3DA 2PMEA 2XODA 1I33A 1LTKA 2XOKD 3FDXA 1TUEA 2H8GA 1WCXA 3GT0A 3IRUA 3LJKA 4MUMA 4R81A 4XRRA 3FGPA 4CM3A 2CWDA 5M2QA 2BFFA 1ESZA 5EIBC 3KDPA 4JCCA 3G5AA 5AKHA 4QXMA 4KHZA 2IYUA 2E4XA 2ZQ5A 1W8DA 2A14A 1A82A 3RRXA 3NBMA 3U2QA 3E70C 4OAPA 4RS3A 2GEFA 2WB2A 2VUTA 5JJ5A 1J42A 1DEKA 1TU4A 1JQDA 1Y3BE 3OY2A 4HGPA 4BFSA 5BSHA 4WXHA 2JCBA 4KE9A 2GAAA 2RI6A 4ZV7A 1N36B 4GFDA 2N47A 2OCPA 4JP8A 5DN6A 5JCXA 4UHJA 4EI2A 4JOSA 4X92A 4XI9A 2XMCA 1SU6A 4E88A 2BEUB 2NZUG 4LECA 4X6YA 4UOQA 5BNZA 1KR2A 4LNUA 4OYHA 2CUKA 4ME6A 5F4ZA 2CK3A 2ID4A 5M04A 2GB4A 5T64A 1R6UA 3CPEA 2GI4A 3IT2A 4AYWA 2OV6A 1NUPA 3RCBA 1H9BA 4C7JA 3O8LA 5AFSA 4RF4A 4HTFB 4RFVA 4U9IS 5ARCA 3D0OA 4L74A 2F9MA 3DV9A 1V5WA 1SBTA 1P5HA 1W5SA 2FMHA 4I4IA 4XASA 4YRDA 1R6VA 4Z0HO 1E1QD 3GRUA 4R98A 4DUGD 5B2FA 4IQ8A 4QFCA 1KRXA 3CB2A 3BXPA 5L4NA 3KNZA 1OXBB 2BMAA 2QQ0A 3KPVA 3SCZA 4JA0A 5CX1B 3PR2B 1WETA 2OG1A 4RK1A 2OCGA 1NMZA 4U6NA 2ZIXA 1N3LA 1Y33E 4A6DA 4EEZA 1XJ0A 1R4NB 3I9JA 3KU1A 4EJSC 5IJ9A 2R8BA 4RH1A 1NF8A 4X64B 4CDRA 1FY2A 2CHFA 3A4LA 4HMQA 1AHNA 3TTTA 4IIGA 1B0AA 3PQ3A 4H1UA 5CCXA 3WLQA 4AMBA 2V5VA 5TMPA 2BTEA 5BWBA 1PVOA 1EB8A 3PQDA 1EEHA 1PQ4A 2NAFA 2ZWOA 3E3AA 5IK2A 3U4HA 3SC6A 3ZY2A 2XMDA 1RCUA 4DR5B 1Z25A 4QQFA 4BE7B 2GK3A 1YACA 3G5UA 3UAZA 1ENOA 3KTDA 3CN9A 1FS4A 4QASA 3FNGA 4YRKA 2P8JA 2QT1A 5ICFA 3THRA 1DCKA 2PUWA 2ZSUA 3OJLA 4BTLA 3CNEA 4IDFA 1XPOA 1TEHA 2RGAA 2Q5HA 3WMWA 5DHPA 2BEWA 1GLNA 1CYEA 2A1TR 3D4IA 4Z4HA 3S5UA 4NG5A 2YDYA 1FP4A 1YZUA 1D2MA 1P2BA 3NWOA 4JKOA 5SY4A 4CM8A 4F06A 3M70A 2NTNA 3RC7A 3Q9LA 3WBBA 5CFQA 1ZRSA 2C0QA 3DQQA 1MMFB 5TY0A 3GH3A 1NV8A 2WAMA 3HRIA 1KQNA 3AKCA 4YQYA 2JLYA 1P0QA 1KQOA 2FZLA 2PSDA 3DM9B 3H5LA 3TYXA 1IBSA 3Q41A 2O3JA 2PKQO 4TTJA 4B09A 3USCS 4BY9E 4QDXA 3BQ9A 1RRVA 1U1DA 2ET6A 2KI5A 4J0EA 4TQAA 4AUMA 4H9GA 4TL8A 5H68A 5K1ZA 1NLMA 1NE2A 1YCDA 2BF4A 2CYCA 2D1RA 3HL0A 4NCIA 4RPIA 4RV4A 4TVSA 2AZXA 5HGXA 1XL0A 4R9SA 2DQZA 5ALKA 1OLUA 1E62A 2FXVA 3E4CA 3IYLW 1DAHA 4JELA 2ZPTX 5T57A 3HKCA 4IFTA 1TUBB 1GSOA 1LV8A 2C29D 4KFRA 3TQSA 1GNPA 1W5BA 1CUJA 2ZS7A 4IDEA 2Z6VA 4REMA 1BVYF 1E1MA 1ENPA 1JG2A 1WVIA 2LCQA 3RTEA 3UPTA 3PDIA 1DKOA 3EYWA 3HJTA 5KTSA 2PXXA 1ONBA 2H54A 4RD0A 2CLEB 4WNYA 4H4CA 1UWVA 2ZSAA 3H8VA 2XCIA 5SY9A 4GGPA 2YRXA 2V6GA 2H5LA 3PP8A 1WQ1R 3OCJA 3ZNQA 1ZN8A 1GPBA 4MQLA 4QPPA 4N65A 2ZYVX 1YBVA 4E5SA 1QM5A 3DV0A 5KOHB 4K2HA 1YGPA 3B6JA 4BMNA 3CKLA 5CTJA 3C5CA 5EYPA 4P38A 2ZUUA 1DC7A 1PJQA 1YZVA 4WPGA 5K3BA 3G3EA 1T36A 3ABZA 1U2RA 1EZ1A 2OYCA 4LMPA 5KSWB 3GXBA 1NX6A 1USIA 1J21A 1TJ3A 3IQXA 4JLBA 2AG6A 4C4YA 3SIRA 1LGYA 4H60A 3I0MA 3P9IA 4O59O 1Q5PA 1J23A 4RYDA 1ACJA 1SUDA 2XYQA 3FTPA 4WZBA 3ANYB 3SBDA 1PFVA 5DXAA 3BL5A 1KZHA 4QPCA 3TLAA 1KRHA 1NFFA 2FG7C 2RBKA 4DRXB 1U02A 5AI9A 4ZYWA 4A9AA 3BEOA 3L7DA 4GKKB 1J5EB 1G5PA 4Z54A 2E4VA 3NIFB 1HRKA 3CG0A 3PX2A 1Q11A 1TGYA 2VP9A 5KZMB 2LBPA 1HQKA 3A1DA 3I9MA 1UT5A 5ECWA 1T8RA 4KJXA 2PWZA 1XZCA 2JEYA 3CW9A 4IVPA 3O1HB 2CJFA 1FRNA 1OU0A 1I9GA 5JO0A 4AZ0B 1XELA 1ECJA 3OOYA 3QLEA 1PRYA 1SULA 2OQ2A 3VH4A 3KJQA 4YUWA 3CT4A 4LDRA 3EOZA 4JYBA 1OGYA 3R7NA 4C7BA 3EXEB 2QTLA 1RM4A 3R5SA 5AVOA 1WF6A 1FXWA 1U8UA 3DEKA 4DTCA 5I51A 3CPJB 1W87A 5CIWA 5ALIA 4CIBA 1QOPB 3M6LA 1GIAA 1WCWA 2MT9A 3DWIA 2J0VA 3QOYA 1S4MA 1Z36A 4NEQA 3HPRA 5EL0A 1H8EA 4YRIA 5BR4A 4FFBB 4FFLA 4XM1A 1CULC 3L0IB 3C1OA 3T1NA 3AUTA 5I3ZA 3U5ZB 2IPMA 4CQLB 4PLWA 4F2GA 1YSCA 3HBNA 4MS1A 1SN7A 3CX7A 4JMPA 3H3XA 3HN2A 2BGKA 4MNTA 3UMBA 2PK3A 3L43A 2R7NA 2WD7A 3K1AB 5B6IA 1ULSA 2YN2A 2SCUB 4WA8A 5LMNB 3LA8A 4M0KA 1C7IA 3J80A 4LF6B 1FJ2A 3KVNA 3LUFA 1AD2A 4AJ9A 4EB6B 3CVWA 1G3MA 3R9KA 4UBOA 4XJTA 3IUSA 1Q0QA 1FTWA 1OROA 3OLWA 2OB1A 3IEVA 1YE8A 3FZEA 1Q20A 3MJHA 3PXDA 4J1TC 3CKMA 1WXQA 5AO9A 2BKEA 5A6SA 3JAWB 1CS0B 4L9RA 3KSZO 2QAJA 1G0NA 1YR9A 3OAAA 3OJXA 3AF2A 3LH5A 2P9BA 4CF7A 2HJSA 1OLXA 4FYVA 3BMQB 2QE7A 1YOVB 1GPMA 2YUTA 5D7NA 1CRLA 2QRQA 3ONEA 4BZPA 5F98A 1L8XA 2I7VA 3AL2A 3DE7X 3NTVA 4Q4DA 1E2QA 1VHWA 2C4VA 3V3KA 3M1LA 4MRNA 4FUQA 3QA9A 1U6JA 3W8EA 5BYKA 2HN9A 3K0AB 2O2XA 1NBWB 1PWZA 1YZFA 3GEPA 4FOOA 4H0NA 1SOMA 4EUKA 4BZXA 4H4EA 3IP9A 5DE3A 3SC2B 4XWWA 2WZCA 3GZJA 1WB9A 5JZ9A 5SY6A 3DZIA 5FQNA 5JZVA 1IAVA 1GILA 1Z07A 5DI9A 4LF4B 3KZXA 2OMKA 4TM8A 4EG3A 3P8ZA 1TU3A 3CCCA 4RADA 4COOA 1G3IA 3ZU5A 4EHBA 3NP9A 3AKDA 2JDID 4PVCA 3PR1A 3I6MA 1S7GA 4CMKA 3BSWA 3DZFA 2LDBA 4P3OA 1ICIA 1IY9A 4BO3A 5B36A 3N58A 3ND5A 3ZV4A 2XT0A 1K2VN 3B85A 3DCJA 3R0QA 1P6XA 2CLSA 5KIAA 1QH8A 2FW7A 5L3SB 1KMNA 2E7ZA 3L7YA 2YVUA 3P9CA 3JQDA 3V00A 1CRZA 1GFZA 3GEIA 4QDJA 3R4CA 4MVJA 1N1MA 1BHO1 9MHTA 1LF5A 3KWLA 1PR1A 3RE1A 1P9NA 1F60A 5T6MA 2BFBA 4G41A 4URVR 3B51X 5FI0B 4ZU6X 5K05A 1D9ZA 5IAJA 2YIDA 1C4KA 3D2CA 2IYZA 1NJFA 3AESA 4FN4A 3NG1A 4EF4A 2Y0BA 2AG1A 1E94E 4JJZA 3U3XA 4DV7B 1JLKA 4K3UA 4BE9A 2IEAA 2QY9A 4OPMA 1PF7E 2ODBA 4IEFB 4BRWA 4CUZA 2K6GA 2I91A 5AH0A 1M33A 4XCVA 1K7SN 1I0ZA 3DNMA 2FE4A 2QL6A 4LZLA 3QIVA 4FNOA 4NBNA 5JQWA 1W4RA 3U13A 2FMIA 1P4GA 3GZNA 3UT0A 1VCIA 1D6SA 2BGJA 3NO4A 5IYZB 5L3QB 2AX3A 1P60A 1RMQA 2XVAA 2V4UA 2WSMA 3AZPA 3BIJA 1PZFA 3D0QA 4WESA 5I9BA 5ILQA 4DPKA 2ZFUA 4GZ5A 3AG5A 4YAKA 4F1JA 2Q5JA 2X42A 2IZ6A 2OQVA 3MXOA 3MRXA 1BXKA 1TF7A 1X39A 2DWQA 1CV2A 1IB6A 1ZJ6A 3HVJA 4KXQA 4MA4A 4V0SA 3ZEAA 4CF4A 1YHNA 2C58A 2QLTA 4ESVA 2FV8A 1KI8A 2BI4A 3R3HA 1U8TA 1ADBA 3LBIA 3NHZA 4IX1A 4K2AA 3RBVA 3PE3A 4BNHA 2PZJA 1UC4B 5FYDA 2RGXA 3UWMA 4A15A 2VUHB 2J33A 2Q5CA 2RC6A 2YV4A 3NDRA 1M5TA 1NE7A 2FP4B 4KE7A 2JA1A 4X94A 1SBHA 1VHJA 5BMVB 4HQKA 4IGKA 1BDJA 3D8UA 4TVOA 4Q7MB 4FX2A 1Q17A 3Q0TA 4U2DA 5BV1A 1PNVA 2PPLA 1D0SA 4MPTA 3WRVA 5IAGA 3SPXA 2VTVA 3R7FA 2Y68A 1NXQA 4Q05A 1RZRD 3R9XB 1MHPA 3H1PA 3QUQA 3KB8A 1YQWA 4JUAA 2QQ5A 4NE2A 5DGTA 1GZHB 5HILA 3VI3B 3NIBA 4EFMA 5IT0A 2M9MA 1U1FA 3LGXA 4I46A 4ZQBA 4P4SA 2REQA 1H2BA 1Y1LA 3FHOA 4RXMA 5HIKA 4CIYA 4XSGA 1WXDA 3ASYA 1BDBA 1N7HA 1U0RA 4RZHA 4DIEA 3DUWA 1ZI9A 4Y2SA 2V6MA 3OUZA 1H8HA 1FSFA 2Q9UA 1C3OA 1Z6AA 3KJHA 3TW0A 3H2HA 2BVNA 1GKIA 3MTJA 4LF8B 4ZAYA 1RYYA 2FPPA 2VDJA 3V7YA 4MH0R 3AJDA 4BLOA 4DWJA 2I6GA 4L3WA 3Q5EA 4GG1A 4I6GA 4UM7A 2WWRA 2W2KA 3H9EO 4WHMA 16PKA 3A4NA 2XRZA 5LQNA 1NSYA 1DQYA 1FTNA 1ZZEA 4YJKA 1KI9A 1ZJYA 4CKXA 2MHCA 2R6JA 3AB7A 1NVVQ 2MINB 1ZM3A 4KFTA 3RGGA 4P22A 1L0BA 5F9FA 3AOEC 1HFKA 4CEHA 1QX3A 5LA6A 3UJ7A 1P8JA 3TNLA 4CTJA 2D62A 3GV0A 2R7KA 4ZZ1A 3MTQA 4WBNA 1J20A 2C94A 1JR3A 4EHLA 1YR1A 2Q6VA 4LGVA 1PUXA 1K7CA 4JYAB 4ND4A 4V1CB 3TW8B 2D0DA 5IEBA 3UGKA 2QU8A 3CGWA 3F5DA 3SIWA 5BN1A 1PEDA 3COYA 2PPVA 5JY6A 3UMSA 4U7JA 4QA9A 4W9NA 1Y63A 3SN6A 2HCJB 4QULA 4RD4A 4EGAA 1XD2A 2E87A 2VKTA 5J4HA 1NL3A 4AO6A 4CMHA 1NVUQ 1U63A 4MV5A 1L9KA 1SG0A 2PQMA 1HYBA 2FWPA 4J2TA 3T7RA 4FT4A 3MSXA 1KEEA 5GTDA 3THYA 3PDWA 4KQXA 3GUVA 3I0ZA 1UMCB 4LOLA 1B23P 3QENA 3BXZA 1X1EA 2EQ5A 4OB6A 2ZUDA 4HDAA 2XZOA 3EEYA 1UUFA 2ZI7A 4O2AB 4Q39A 4K6KA 2HHHB 3HXPA 3QVLA 4L4SA 1IXRC 4JL5A 3QEJA 1OYVA 3K70C 3RVPA 2X5XA 3GNLA 4ALLA 1G21E 1TA0A 2ZIFA 3LSTA 3ZGNA 1SU7A 3IUEA 4PWZA 3LRPA 1E2EA 4Y9SA 4D81A 4PNEA 3PWTA 3LUKA 4NQZA 5EIFA 1QC5B 1N6IA 3QWIA 2EP8A 3DDUA 1JIXA 3GXOA 3UYLA 2ZI5A 2HMWA 3Q0EA 1CIVA 5AJXA 5H9WA 3FDFA 1UF9A 4ZCTA 4Q3CA 3EVDA 4KN5A 2HXSA 1KIMA 4P7GA 5GADl 1M2VB 1I0LA 4F21A 3I8XA 3SG0A 4PSAA 3GI1A 3G0GA 1U3CA 1JQAA 2QN7A 4ZVTA 2QHXA 5TC4A 4Y2UA 3D7NA 4MUAA 3HJNA 3DYBA 4UUOA 4BVKA 4AWXA 4C76A 2O8EA 2JGEA 4MYRA 5AJTA 2Z4TA 4KDCA 3BXEA 1L1EA 2ZYHA 3UW3A 1IZ8A 1KERA 2GZDA 4FOPA 3ZVRA 3ON5A 1MAAA 1E7SA 2WQZA 1KI6B 4MEBA 5K3OA 3NR2A 1DIRA 1DC6A 3MZ0A 1XYYA 3KUCA 5BWMA 4MVJH 2H1RA 4AJJA 3DBVO 1Y89A 1NYRA 4PHCA 1R27A 1F3OA 3M4ZA 4PPFA 5GY7A 4NXMB 4M8IA 1VFNA 1KFEB 3KSBC 1N2IA 4LDPA 3A4TA 3AHGA 4LZNA 4MPPA 2ZAYA 2FQQA 3TI7A 5DIFA 4ARZA 1LY1A 3IDFA 1U0GA 2W6QA 3LW8A 3HM2A 4AZ3A 5EHZA 5KWEA 5LBIA 3L6CA 2BZ1A 4OLAA 3NEJA 1WPQA 2ZI3A 3FWPA 3W9SA 2PRJA 4YY3B 4L8LA 2F3RA 5LBTA 4EG8A 4CLOA 5JSQA 4CKWB 1P4AA 4N82A 3RK4A 2QPTA 2WYVA 2BGWA 1CZLA 5CM9C 4NV1A 1PGPA 3OCZA 3STYA 1N2OA 4FDMA 4Y2VA 3HXOA 1MB4A 4GPAA 5FQOA 1OXKB 4IP0A 1TQHA 1CJTC 1K2WA 1HNZB 1XRRA 2GPJA 3PFHA 3ESQA 1U3UA 2WI8A 3AVWA 1W44A 4KRXA 3UKOA 2PYIA 3GJQA 1BFUA 2YXPX 2BP7B 3BREA 1QAOA 3TIFA 3WGJA 4A5SA 4D0RA 1KJNA 4W5OA 3QXGA 4IPTA 2CDCA 1S3FA 2IXAA 4MA0A 3WADA 5C7LO 3U4QB 1M10A 2J3MA 1Q1AA 3BG5A 3HV0A 5LFAA 3ZD9A 1A9XB 1XMSA 5HQ3A 3TCXB 3KD2A 2ADOA 1S2GA 3NU1A 1QO0A 4A16A 3JQAD 2GPWA 1AS3A 1LLCA 3GB9A 2C2MA 2CW5A 4YWJA 3W7AA 3Q72A 3SOZA 1Z5NA 2XUPA 3D43A 5H81A 5KB3A 5KPDA 5LMUB 2Q5FA 2GHRA 4G6ZA 3O73A 1ZSYA 2VS1A 4IG4A 4CCYB 8ATCA 2OE2A 3TZKA 5AW8A 1W5TA 4F0JA 1WHSA 1N5DA 4HXFB 4WKGA 1EUCB 1D9XA 5I4BA 1VJRA 1S0UA 1O6BA 1P1FA 4F96A 3DE1X 1VA4A 1ZU5A 3WJ2A 3JCZA 3QV2A 1LFDB 4NZZA 3FIUA 1CS4C 4X85A 1XEFA 3JWPA 1LSJA 1FP1D 1QK5A 1QZ3A 4TRMA 3WZLA 1ZYUA 1SCIA 4UQPA 1IEWA 2FJPA 4PLYA 2XBLA 2D2XA 2QRZA 3GLIE 1I4EB 1LUAA 5JYEA 1T34A 4ZPXA 4YMUA 3WYFA 1YZKA 1KZ9A 2BDEA 4REQA 3AEUB 4B31A 1UC5B 5GJCA 3HJBA 1PJ4A 3FGNA 1YZHA 4IFBA 4EHJA 1XCGB 3RSGA 4NYIR 3WYEA 2IYVA 2QJWA 3BXHA 2CJWB 3E9MA 3QYAA 2I6UA 4I5EA 4R71A 3ZVNA 3RO7A 3OVMA 5TGTA 5IVPA 1V8ZA 3OFND 1T8WA 2IZ5A 5DTRA 1UKYA 1EZZA 3VOSA 1DZIA 2I2WA 5AW0A 1E1CA 3BWYA 1DP4A 4QLBA 3QUCA 4TN5A 3ZDZB 1ZHHA 4ER5A 1GT6A 1UFRA 2KX7A 4DCSA 1I4WA 1RS0A 4TQGA 1KO8A 3JQRA 1TAGA 3JD0A 2G8NA 4NK4A 2X40A 5HE9A 4EUHA 1Z4LA 2C03A 2RFLA 5EESA 4E4RA 2XDQB 3WLRA 5CB4B 4JQZA 3DBIA 4Z7OB 1M66A 2QTVB 3CZPA 2NWQA 1TCAA 1Y4AE 3F3YA 4LJ5A 3S1AA 4HNUA 3VTAA 2ES4A 4G0VA 3HG7A 1SK9A 5TRTA 1AA9A 2COEA 4YMHA 1ZVKA 2BE7A 2VDKB 4F8EA 5LZ9A 3TBKA 2ACWA 2D8AA 3PPVA 4L08A 1T0BA 4IIEA 1T9GS 4IM7A 3GFVA 4BIMA 4YRSA 3QJYA 1XL1A 3NVAA 1A5ZA 1DRVA 2VPPA 1FX1A 3NAGA 3VDRA 5KREA 4MGEA 3LPLA 4O2BF 1Q16A 1PK7A 3CLUC 1NI4A 2IYQA 1WMAA 1XDSA 3FE2A 4X9XA 5AIAA 5E9QA 3T06B 4CLRB 3M4XA 1PJRA 5BYJA 2P78A 3KPUA 4UHHA 4UUAA 2CLHB 4J0DA 3KETA 3ZIUA 5KWIA 1R5OA 4LHVA 4RFSA 1MEJA 3TRJA 3WLLA 3GHYA 1UXOA 3N6VA 4YUVA 3OUUA 4ENWA 2BGIA 3DLCA 2O2GA 4C7MA 5JMTA 1JEEA 3HSSA 3OQVA 3UZUA 4PRYA 1JA1A 3PIRA 4MLZA 1EK5A 2CNOA 2JANA 2WOJA 1FVOA 1KQ3A 1E2GA 1KJ9A 4N5MA 1MEOA 3NM5A 1IY8A 3N8DA 3HN7A 1GZ4A 3VNVA 4N01A 4JB8A 3L6DA 2EC5A 2JB9A 1P6UA 3PK0A 4MJ3A 4BV8A 4XA8A 3O93A 1RMTA 3HO6A 1NYQA 3JWEA 4MGZR 5JAZA 2AUNA 3LNCA 3F6RA 3QE4A 5JJLA 3X1ZA 1T8UA 1OIWA 1JMYA 1L4UA 2AFRA 4DAEA 4QUBA 3CNQS 2EVWX 2CSXA 4KWTA 1BS1A 1J90A 2WYIA 5J63A 5K0LA 3ZHXA 3OE7D 3CC8A 4W63A 1RAAA 3I2GA 4IL5A 3TZLA 1IHDA 2ZAGA 4NI5A 4RPCA 3VZPA 2IELA 1F4PA 3EDOA 3IQEA 1ZVVA 2O5EA 3I5AA 4CL8A 1JLMA 2B6HA 3K9HA 2FN4A 2HLDD 3V9PA 1SWWA 1CUAA 1M34A 5EG5A 2JIDA 4G07A 4GECA 3WGHA 4H6VA 3QWBA 2NP6A 3TTWA 3PT9A 5KMGB 5LQCA 1JG6A 2W4MA 3WLSA 4XYGA 3I52A 4TOIA 5SYMA 1H2ZA 2CL5A 2X77A 3KZOA 3DH0A 4IY1A 4M54A 3NALA 3BB3A 4XGIA 5ALTA 1JPVA 3RYIA 4BO8A 3UBTA 3RU7A 5DHSA 1Q1BA 3B1KA 2FN7A 2BONA 3FSEA 2BI7A 2XKAA 3LC2O 4I99A 3PCRB 1GITA 1V9SA 2Y76A 1W73A 4O4IB 3C3BA 3ZXYA 1AVTA 2OL4A 1PQWA 2JHGA 4WFKA 4FWTA 2ZTLA 2GFIA 4GSLA 1YR7A 5F52A 2UU9B 1WA5A 4HFNA 2FFBA 4QEZA 5J2UB 2W98A 2WHPA 4G5HA 5I5EA 1OKKD 1IEVA 4PYNA 3HKBB 3EY4A 4HMOA 4ZHQA 1F0YA 5P21A 4HT3B 3T3DA 5E9WA 3LGAA 4EHDA 1IATA 2E9SA 5EWJB 3N59A 3RYHB 4JJAA 2IUUA 1UP6A 4HLQB 4AK9A 1GN9A 1ORVA 1QHXA 1OT3A 3OKCA 3Q98A 3WYBA 5K3EA 2D54A 4EUFA 3IDAA 3GJ4A 1U31A 4Z4CA 3KTOA 1OFIA 2YNMC 4AO8A 4PBRA 1X38A 3FM9A 1DX6A 5AI0A 4E3ZA 4EQ6B 3E7WA 4MP8A 5EP2A 2ZB8A 2QKYA 5T3YA 1JXMA 4YJ2B 3S55A 1FZTA 4UATA 2LVBA 3KQOA 4G5SA 1QHEA 4YRZA 1TC2A 3KBOA 4KO2S 3MAAC 1EXNA 1L7NA 3OE1A 3QU9A 4ZARA 4CMEA 5C4IA 5JTTA 4EY6A 1RMYA 2BJWA 2ZITA 2Q2VA 3JU3A 1QE0A 1UT6A 1Y9DA 3KUUA 1YRHA 4I3FA 3ZZTA 4ZMSA 4B8WA 4ZYZA 5HZHA 1WB5A 4B4VA 3SJAA 1IPHA 4E14A 2FR0A 1MIOB 5C34B 3VVMA 2XXJA 4DM3A 1V25A 2PBLA 1E6WA 1EBBA 1ZQ9A 3ZCVA 3FFXA 3QRWA 5COQA 3PJEA 5IFLA 1W94A 3BE6A 2BEUA 4KI7A 1DAKA 4MW9A 2VNAA 2WD9A 2HJWA 4I9FA 4HDRA 2AMJA 4MYDA 5EJ7A 1QLWA 2OGZA 2Z6UA 1S3GA 3B1FA 2FZ5A 3SHTA 3AEKA 3ESAA 1NURA 3VHQA 4PICA 2B2XA 4WLNA 3TFOA 2WIKA 1Z2CA 4LY9A 3BSSA 4OQMA 3PLNA 1EFVB 3D4LA 1CZRA 3CMMA 4PZUA 1HLPA 3CLTD 3TVDA 3R9IA 1EEXB 1YO6A 1C7QA 3LWNA 2AN9A 1RKVA 3BGIA 4K9NA 4EYKA 4PTZA 2FZVA 3WK6A 5HWSA 3V6MA 1AQ6A 1WRBA 2YMPA 2EZ9A 4ARUA 3OLYA 4KX3A 4ZC1A 1PJSA 1UM9B 5IVDA 1L5GB 3WSTA 2VQFB 1MOZA 2HCBA 4F3NA 1C7ZA 1YZNA 4A0GA 2O0JA 1IJBA 3TLCA 1KKLA 2FEPA 3GRYA 4D56A 2P9YA 2X9GA 4B80A 1U2TA 1TJ4A 1CJVC 1U3FA 3GJ0A 2BWJA 3EMDA 1RCFA 2GCGA 3GJTA 3Q85A 4PO8A 4YRJA 2PZAA 5A4DA 3GFPA 1LWNA 3IJRA 1TJYA 1ZXBA 3A06A 1K63A 3CY6A 4YJHB 1WBJB 2RHMA 4ZDWA 3C7DB 1ZNWA 3T12A 1WMDA 1DEOA 2JGAA 5A03A 5LMCA 2O5RA 4GX5A 3UOWA 4Z3DA 3I2FA 2BZSA 3HABA 1ZCZA 1GTRA 3QX3A 3EASA 3G9QA 2CNBA 4DBVO 5JD3A 4JOBA 1P33A 1N2CA 4XD7D 1VMIA 2AXNA 4G4SO 4JJ7A 4POAA 1JDZA 4LDZA 2P91A 2DQKA 3AHFA 3JSXA 2HXGA 3FB4A 4JYPA 5D87A 2OXIA 3GAMA 5JXGA 4TQ9A 3NETA 1NBMD 4WRRA 3VR3D 1EVYA 3WWPA 4BEVA 3NLLA 2SHKA 2OHOA 2J3QA 3F97A 2ONKA 3CLRD 4WUTA 4KBYA 4IH4A 4KL8S 1O4WA 5KNCD 2DX7A 2WSIA 2JAPA 4DV6B 1YS1X 4YRCA 5HDBB 3RHFA 1DSSG 2NG1A 3BCHA 4KV9A 3T1HB 2ZYDA 4LVCA 3FPAA 4NH0A 4DJTA 4LMAA 4B8ZA 1R74A 3IOEA 2XKKA 4DNPA 2IKQA 4QBTA 5HKAA 3CF0A 1ZIPA 3A6KA 1MVLA 2SNIE 4B2LA 3HJGA 1OE0A 3RVSA 5DT2A 5IUNC 5J5VA 1CQPA 1KFJB 1CDDA 1UPCA 1YB4A 2XVYA 3NB0A 1O95C 1J56A 1P1BA 3WIVA 2Y0PA 4PC1A 3ISTA 1UQRA 2EERA 3FCEA 1JEOA 1T9GR 2X0NA 5EIAA 5JAOA 2XOXA 4XVQA 1QFSA 2HMVA 5A7FA 2R6DA 2VH5R 5JZMA 3AXTA 2D8MA 2SBTA 1N6KA 4DJJA 2C2ZA 4X41A 1OH8A 2CNKA 2XH8A 4PSKA 5EUMA 2HTFA 1JWAB 1L4LA 4YMGA 2XLBA 1T3LA 4E2XA 4ZANA 3R8XA 5KOHA 4KPEC 5D1HA 4B6FA 3SSAA 3RSZA 4ZQHA 4KW7A 3SYTA 1JAYA 1HQCA 1AU9A 1KGDA 2CNWA 4MVJM 3E7PA 5K03A 5C7IO 3ER9A 1NI3A 3B9RA 4ESHA 2YOFA 4GI5A 5LOVB 2QXYA 4QOHA 4CW7A 1G8PA 4KU4A 2UDPA 3HPQA 4J76A 3UG7A 4LV6A 1QX4A 4PPYA 4QTXA 4AIRA 4MEAA 1FTYA 2AKYA 2D2EA 2GCPA 3A1WA 1SM4A 1B8UA 3W6NA 3ZY6A 4JV5B 3DOEA 4O1MA 5BQ5A 4ZK2A 5BSVA 1Y3DE 2GPNA 4ZVUA 3IIIA 4HDNA 2O2SA 1F2DA 3N1UA 3VISA 3O8QB 4B47A 1U8CB 5I45A 1XMXA 1T15A 2Q6OA 2XIQA 3R3YA 4LF7B 3W8DA 1IYZA 1E5DA 5FAKA 2IDJA 4L9AA 2D3TA 2ACVA 3E9EA 4G1VA 4WLEA 1QGOA 1BW9B 1XX6A 2NAPA 2PJUA 4UVEA 4EJSB 4OX9Y 3O47A 1NUSA 3HJCA 2JKZA 2W2PA 3C1TA 1X0VA 2AFIE 5FEMA 4LYGA 2Q6IA 4M98A 3IEMA 3KHSA 4W7SA 1N3BA