3T1VA

Mgla bound to gdp in p2(1) tetrameric arrangement
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
192
structure length
192
Chain Sequence
STINFANREINFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIGEVKGFKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein mglA
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 52
structure length 192
sequence length 192
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t1vA00
1EXMA 2X19A 3MRSA 4CGZA 1Q22A 1W47A 4AG5A 4MUBA 5KHOC 4NCKA 1Q1BA 2R6GA 3FB4A 4Q4HA 4WIAA 3M4YA 1Z0FA 4POAA 2JLVA 2JJ2A 2R44A 3NXSA 4G5SA 1IN5A 3IO3A 2C5LA 2W58A 3CNLA 3UXMA 1VCOA 5AUQA 4C0JA 1DE0A 2IK8A 4DJTA 1VMAA 1GDDA 3GD7A 4FWIB 4NCHA 5L8VA 2Z6VA 2RH5A 1YZKA 5KPDA 4WVFA 2ZI4A 5CIWA 5HCIA 2NQ2C 2XNSA 1G9XA 1NVVR 3T1TA 5CDFA 3VR4A 1NN1A 1A2KC 3T12A 4JZKA 2HLDD 2AD1A 1SKQA 4UNNA 1SULA 1Q57A 4Q7JB 1IJEA 2YC2C 3CX6A 1MRSA 2ZVPX 1X3SA 2DWPA 1MABA 1UFQA 2HCJB 4RZUA 1VYUA 5L3SA 1HUQA 1N6LA 3B2EA 2J1LA 2AD5A 2OCYC 1WQ1R 3TVDA 4B3BA 1U0HC 2O8CB 4QHTA 5TARA 1G18A 2BJWA 1RZ3A 2QI9C 3CUEF 3EASA 3O8CA 4Q1AA 4E5UA 2BMEA 4TLCA 4CRWB 4Q03A 3FTQA 3GEIA 4BFYA 1KJWA 2ODNA 2AKYA 1W0JA 3KFXA 3QXSA 5AK0A 1Y63A 2QG6A 1SQ5A 3C5CA 5J4LA 1OFHA 3F5FA 1G3QA 3CRRA 5GJBA 2A5YB 2ONKA 2I3BA 3GFTA 3IPYA 3C7KA 1XB2A 3UWOA 3QKTA 1ZMXA 5SZHB 4P3YA 4JS0A 4Q9JA 1W4AA 4RD4A 1IJFA 3EC2A 4DUGA 1G8GA 2BJVA 4DBLC 1IM2A 4ZV4A 2FF7A 2C77A 2GBLC 1GAJA 2JLWA 5E7MA 1E94E 4Q4HB 4ASUD 1IAQA 4DCTA 1FMLA 3VMFA 3VR2A 2QRZA 3IIKA 4EJSC 1M2OB 5B2ZA 4S2EA 2HXSA 4NPHA 2ZU6A 2IYSA 4HLCA 4Q9HA 4AC9A 2ZEJA 3EWAA 1G7CA 2RAPA 4D81A 3RSLA 4XWKA 1LF0A 2ZITA 3SHFA 5DHFA 3K9LA 4LUCA 4PQFA 1SXJE 3X2SA 2QQEA 2FJUA 1T0HB 1VG8A 3DOEA 4EJSA 5C1BA 4CEIB 4BFUA 1C4OA 1NSTA 2ZRIA 1G8YA 2ZJOA 3Q8XB 1ESNA 4IDHA 2O8BA 1Z2CA 1MABB 3G5UA 4OQXA 3EG5A 4H1VA 5K8UA 4P32A 1Z0AA 4TLAA 1ZD9A 5L3SB 3SBEA 4MKGA 4BFXA 3GLFE 1CR1A 2IYWA 5CYPA 4GI7A 2OBLA 2ZTSA 3SN6A 4YDHB 5KSPA 4D25A 4BFSA 2GCOB 1ETUA 2GEUA 2HXYA 5FPHA 4LJYA 1P62B 4KSBA 4JLPA 1OFTA 4DB4A 5AJWA 3UMFA 4P4UA 2KJQA 1NLFA 4E09A 1H8ED 5BN3A 221PA 1PUJA 5E7IA 4LGMA 2VHUA 2ZUBA 3WMGA 1S3SA 1WP9A 1PLKA 1OHHD 1ESMA 1FFHA 2MMGA 1S1CA 1J2JA 2QTHA 3ASZA 4B34A 3KDSE 4BLSA 4EPRA 4RKFA 3U6BA 1YR8A 2QRNA 5C46F 3L0OA 2CVHA 2V6IA 2D7DA 4P33A 2QT1A 1DADA 2FPKA 5KNCA 4A0RA 4WA7A 2VSOA 1E1RD 1E9DA 3T35A 3CRMA 1P61B 1Z07A 2CLDX 3RVBA 2A9KA 2F55A 2WIBA 3QY0A 4B35A 2JGNA 1G3MA 1SHZA 3DO6A 1WA5A 4OKSA 2BBOA 3QG5A 2JLXA 2J0UA 2ZR7A 2AL7A 3R7WA 1OH7A 1Z0IA 3BS4A 4NHOA 4B48A 1E98A 1NIJA 1R0YA 1ZUHA 3KXKA 2GZDA 1E9AA 5CJPA 3RWMB 4JVLA 1I2DA 2CXXA 1EFHA 4EJSB 2FOLA 5JFGA 3FDIA 1LF5A 3EPJA 2NTYC 4MGZR 4C0AC 1COWA 2XSZD 2IEYA 2AFHE 3QEJA 4AK9A 3A4MA 1XCMA 2O8BB 2P0EA 1KO7A 2NPIA 2R6AA 2BMFA 1TQ2A 4Q1BA 2WMNB 4IEIA 2VHTA 3VR5A 1U9IC 2G77B 4P4SA 3IEVA 1DAGA 3HU2A 4RFSB 4Q48A 5FPYA 4URXR 3V9PA 4B6FA 3WP1B 2IWHA 2D4HA 1KI7A 4D0NA 1W5SA 3EZFA 2FSGA 2W0SA 1KY2A 4IDOA 5D3MA 1W0KD 3VU9A 4ZI3A 3EIEA 4PAMA 2DHRA 4CEJA 2QSZA 2VP6A 4DDWA 4JLDA 4LYHA 4OBEA 3ZJYA 4WZAE 1B0UA 4CT4B 4PO8A 2GHIA 3EIHA 1Z83A 3T1OA 3PV0A 2OCBA 2ORIA 3SFVA 2V4ZA 4R9UC 1MO4A 1FUUA 1XDBA 1OYWA 3IPXA 4NP6A 1W2GA 5HZHA 1D2EA 2G1KA 1N5LA 4MYTA 1Q21A 4X8MA 3KXIA 1GG2A 1QVAA 2QP3A 5GJVC 5J4KA 1N6NA 1RC8A 1U99A 4KYUA 4YXWA 4A0HA 2WPDD 2KI5A 2REOA 4A4DA 4ESHA 3ADBA 4MA4A 4FWTA 1EFTA 1N6OA 5FTLA 1AIPA 3OE7A 5IHPA 5C4MA 3W5IA 3AF2A 2FWRA 1U2RA 4KVGA 3VKHA 4TT3A 1Z29A 1E0SA 1OXUA 5L3QB 1E2DA 3ZH9B 1KI6A 3IGFA 2FV8A 3U44A 1NBMA 2VRWA 2ZSDA 3HP1A 1NNEA 1ZCBA 2Z83A 2J0SA 2VYFA 3R7WB 5KYKA 2ZI5A 4J0QA 4B3XA 1BYIA 2L0XA 2OCPA 3K70D 4JVMA 5CK5A 1OYYA 4LHYA 3FKQA 3EARA 2H5EA 4DLTA 3TGPA 3CM0A 3CRW1 1R6BX 1E69A 3DOFA 4OYHA 3BB3A 1FNMA 1KY3A 1BYUA 3H84A 3SJCA 2OBNA 2UKDA 5JMTA 1F3OA 2DPXA 3HPRA 4LHZA 4RCYA 4OI4A 4P4SB 2GEDA 4FW9A 5FOUA 1NL3A 1X8LA 2B21A 4V0OA 3W5JA 2CEAA 5DI3A 5EE1A 4IDQA 3VU9B 2C9YA 2WSSA 5KPJA 4O2LA 3ZDQA 3X1XA 2A7QA 1G291 4CEJB 3SYLA 4II7A 2NG1A 1ONBA 1YZNA 3CRQA 3D8BA 2IYTA 2JJ8A 3BIFA 3IHLA 2BM0A 1AQUA 2C04A 1OW3B 1XXHB 1AQYA 1PJRA 2DCUA 4PC6A 4O3MA 1U81A 5LB2A 2X8AA 4RD2A 3I8SA 4EKDA 1N3BA 1G4AE 2WWHA 5EE3A 1XTIA 1MH1A 3WNCA 1A5TA 3Q5DA 3E5HA 4M21A 2ZJ2A 4UQOA 4UXIA 1XJQA 5FTNA 1E2PA 2IYXA 3KZ1E 5FTKA 3LO5A 2BCGY 4PSKA 2ZPTX 2GAAA 1FZQA 2XJ9A 4TQ9A 2P6NA 2RGDA 3TR5A 2W83A 1QVRA 1II9A 3BC1A 4FXPA 1WB9A 2FDCA 1W1WA 3P27A 3U7EB 2BOVA 2ECKA 3JVVA 5DISB 1XEWY 1I4DD 1RIFA 1KI6B 1MT0A 2IL1A 3BJIC 3ZVMA 5J4VA 4F91B 1UDXA 4HZUA 4GZMA 3A36A 4XD7D 2ZYTX 1JQJC 1OH6A 3RWOA 1GZSA 3C16C 2HYIC 1Q20A 2ZYUX 1XD2A 2J59A 4KI0A 1SKYE 2QN6A 4F4CA 3SR0A 3U7FB 4FMDF 1JI0A 4C2TA 4TMXA 3QQ5A 1US8A 2WJGA 3K09C 4ABYA 1P6XA 1JJVA 2NO7A 4XVRA 2JLSA 1EFRD 3NC0C 2NGRA 2YOFA 3C14C 3F8TA 1F6BA 3GLGA 3CF0A 3BRWD 4CF7A 1N5IA 1U98A 2YVUA 3AKYA 1PUIA 4FINA 5DI3B 4CZ2A 4N1AA 4RJLA 1BOFA 2IA5A 1IY2A 1S4QA 4MGIR 2CK3A 3SFZA 2R2AA 4GSYA 3NBXX 1KSJA 1KDPA 3MFYA 1VKJA 3R8CA 3TW4A 2QROA 1P9WA 2GAOA 4EAQA 3IUYA 3ADCA 4LJ8A 3TUZC 1UF9A 2IYZA 2OILA 3GJ7A 5FBWB 1CXZA 4EDHA 4E03A 3D3QA 2W00A 2ZRBA 3F3YA 3U3KA 4KU4A 2XTNA 3KKNA 2NO1A 4P0TA 1R4AA 2EWWA 4IOJA 3UG6A 4A6PA 4B3CA 4Q19A 2ZJYA 2W0MA 4PQYA 1ELOA 3FOZA 4DZZA 2D2EA 3PEUA 1PVOA 2XNDA 1R8SA 5JSZB 2O0JA 4RZ2A 1ZC4A 4M1TA 5DNYB 2AXPA 4GBMA 3TAUA 5KUTA 4EUNA 4BLPA 1T8UA 3SQXA 4R98A 5LBIA 5IRCD 3TLXA 5FPSA 1TU3A 1T6NA 2ZAMA 3NDBB 3NBZC 2ZAOA 4A2PA 1IQPA 3U3MA 5JRZA 4K8OA 5H70A 1OB2A 2ZE7A 1ZM2A 3OIVA 4L4UA 4QGGA 4RD0A 1UEJA 1XD2B 2YKGA 4LK2A 2MSDB 4Q7MB 2WKQA 4XH9B 1NN3A 2QNRA 2FN4A 3QF4A 4ZIRA 1MOZA 2D06A 1P2VA 1XMVA 3A1WA 4PPNA 4Q4JA 3WNBA 1CRQA 1IONA 4KSCA 4NONA 3FVQA 4RZXA 3REFA 2FFHA 2QTFA 1US8B 4QHYA 4TSFD 3OZXA 3QPWA 4C9BA 3ZD6A 5E4FA 1D9ZA 4GP7A 3KJEA 1NN5A 1YR6A 1SVSA 1J8MF 3OEHA 3GLGB 4D6PA 1R8QA 2FX3A 1VIAA 2VHQA 4KLNA 1M7BA 3I73A 3WHLA 1K5GA 2ZIAA 4L9WA 2VA8A 4M9ZA 4OQNA 1S2MA 1JR3D 1SVIA 4A0GA 1WMSA 1TQDA 4Z54A 4TLEA 2JIZA 3OF5A 5B30A 3V00A 5DIFA 4PAOA 2ANBA 4BZPA 1YJ5A 4PANA 2ORVA 2OAP1 1TQ4A 5CLLA 3N2IA 5EXXA 3PXGA 1G20E 3K0SA 1Z6TA 4S35A 1CS4C 2YNMA 3P4YA 2CL6X 3RRZA 4M1SA 5F2EA 4BEJA 3DKPA 1U8YA 3A1VA 2DWOA 1S8FA 4KFUA 2FSIA 2P5TB 4TMTA 4IXMA 3EPLA 1XTSA 1P2SA 2XTMA 1Q1EA 1QG4A 2ZXUA 4TL8A 3C41J 1DELA 1E0KA 1N6HA 1OLOA 3KXLA 4OHWA 4DLRA 3LRPA 4OJQA 2ZE6A 2FGKA 5EE5B 1WRBA 1VHTA 4LV6A 2XZOA 3TUIC 4B2PA 2O8FA 3H86A 2N42A 1PLJA 2VO1A 3IQWA 3W3ZB 3H2YA 4F92B 5EJEA 1HT2E 2HF8A 2ZROA 5BXQC 3SNHA 3QF4B 2CLCX 3I92A 3CIOA 3AVYA 5FTJA 1KMHA 4ZIRB 4LHWA 4Q4JB 2ATXA 2G88A 4TMKA 3AKEA 3UK6A 2HYDA 2A3RA 3A4LA 3QSYA 2GXSA 3T34A 5K8LA 4MRVA 3I1FA 1KZGB 3K0CC 3U4QA 4F4JA 1C1YA 1GKYA 1KI8A 2RGAA 2DB3A 2CHVA 2XITA 2JDID 1IN4A 2WZQA 4DC9A 4HAUA 4PTLA 2H57A 1GVNB 2GA8A 2JCSA 2OAQ1 2ZI3A 1MO5A 2YWHA 1CEEA 1BO6A 1ZU5A 2GCNA 2OLJA 2JJ1A 1F60A 4K81B 3BH0A 4TLBA 5DE3A 2QMEA 1GL6A 1E32A 1TF2A 2FPMA 1ZD8A 4NYIQ 5HE8A 4GFDA 4PSVA 3A6PC 2R6FA 1SGWA 4C0HA 2KSQA 5AUNB 4TYYA 4GOXA 1W44A 5FPTA 4EPVA 4HSEA 5HZKA 3U7HB 1OFIA 1W4BA 1EG7A 2FE4A 2EYQA 3OIWA 4MRPA 1EX6A 4XWAA 2UZ3A 2XOKD 5KNBA 5JWRA 4NTZA 1K8RA 3MJHA 4BGDA 3W3AA 2BHRA 4HAZA 1T3LA 4HLQB 3MG9A 4JLJA 3KB1A 4JT4A 5DYIA 5EXSA 2P65A 1X8JA 3SJAA 1S96A 5G40A 4XJXA 5JECA 3THYA 2GJ8A 1CF4A 3FGNA 3ND8A 3ONWA 4FIDA 3UIEA 4M0LA 4ZCIA 1XRJA 2ONJA 2FFBA 3HR8A 1M74A 3QNUA 1N2CE 2O8FB 1IY0A 3CWZA 3R9XA 1XXHE 2X77A 2JLUA 4M1KA 5IK2D 4AKIA 2V54A 1E9FA 4E07A 5KSOA 2BMJA 5BWMA 3I72A 2VP4A 1KMHB 1KSHA 1XF9A 2G0NA 2ZRFA 4BZXA 4IXNA 2ZSAA 3B1WA 3VHLB 1DARA 2QAGC 5FR1A 1GIAA 3TSWA 3LFUA 3KQUA 1UBCA 4PO9A 3W6PA 2ZRAA 3U4QB 2QY9A 1LY1A 4A15A 1G41A 4DLUA 3PUZA 4LBVA 2NOAA 4QBHA 2OEPA 4WZBE 3V4FA 5FI1B 2EVWX 1IY1A 2GVZC 2VP2A 4HB3A 5J4YA 4IVQA 721PA 1A2BA 1G1MA 2BM1A 3G82C 4FMDB 5A0FA 1GNRA 3UANA 4RFVA 4MYHA 3TW8B 4ZKDA 4C3ZA 1PZNA 2F1IA 3L2OB 4MKHA 4BECA 4DCVA 2G9NA 5GJCA 4QBGB 1Z6XA 2WJYA 3NDPA 4TTPA 1L4YA 3RANA 3CH5A 1BMFD 4ZKEA 1G8HA 4R7ZA 1N6PA 2EU8A 1OE0A 4MGYR 1NI3A 5BW8A 2IHYA 3D7MA 4RD6A 4JLOA 3MCAA 4KYIB 2RHDA 1T0JB 1FOEB 4CEHB 3GPLA 3TJZA 2CVFA 4DLYA 3P32A 4JVSB 3CKLA 1G3UA 4R2HA 4F93B 4QGAA 5H8WA 2Z4RA 2W6JA 3VHXA 4ZCMA 1DAEA 3AVXA 2GJKA 4XVQA 1AKEA 1GKIA 4MH0R 3THYB 3KKMA 2GDJA 4TTRA 3X1ZA 4DSOA 2AK2A 2WBLC 3CRVA 2OM2A 3PIRA 1Z2AA 3A8TA 1RW4A 2CHGA 4TL7A 3CX8A 2GEVA 2EFEB 3B5JA 3IQXA 2V3CC 2J0VA 1GFIA 2BEJA 3WBJA 4OHZA 4HAYA 1I4LD 2CMKA 2C2HA 5FBQB 5GVSA 1NF3A 2GRJA 4PPGA 4G5RA 3B7GA 3E70C 1RRPA 4XOIA 1F48A 2F7SA 5EE9A 1CJUC 4V0NA 5FL7D 2PL3A 2EW1A 2QENA 2YOGA 3HPQA 1Z63A 4H1UA 3RDPA 4AYXA 3SQWA 3B1VA 1N25A 4TL9A 2O8EB 2J7KA 1SZPA 2J46A 1JALA 1NN0A 1G3IA 3P26A 1ZUNB 4XVUA 4CEIA 1X86B 2WJIA 1XMSA 2IXEA 3LVQE 4IFEA 4ZO4A 4D4MA 3EAQA 1IBRA 4NH0A 5JEDA 3LY5A 3B82A 4B75A 2WWXA 3J81k 1A1VA 3KFVA 3TH5A 3E1SA 2Q9AA 3RNLA 1P9RA 1VTKA 2YC4C 2QPAA 3PFIA 3BE4A 1U8AA 2JA1A 2O0KA 1KSFX 5G3ZA 2GCOA 2V9PA 2CJWB 2HLDA 1G8FA 3TNFA 1QDEA 4AD8A 3GLGE 2IS2A 2ANCA 1W0JD 2ZI7A 3KKOA 4NL4H 5KDDA 3OIUA 5C2JB 4FCVA 5J4HA 2PH1A 3C15C 1XBTA 2VSXA 4LOAA 5GJWC 2YWFA 1DAFA 3PCRB 1TUIA 4G5QA 1JPJA 3QVVA 4GP6A 4MQBA 4O25A 4OI1A 4RD1A 1HV8A 2FSFA 3ND9A 1SKYB 5FH9A 4I81A 4NYIR 5AR1A 4YQFA 4LBYA 4I1VA 3PENA 4DUGD 2VBCA 4HEJA 3GFPA 5A5GA 2F3RA 1GP2A 4NMMA 4Q4LA 2RGNC 2J41A 1NIPA 1A82A 2GVDC 2QBYA 4W7SA 2F9MA 3PEYA 3LXRA 3RS4A 5EUMA 4FI3C 3UMRA 2I1QA 2V1XA 1AM4D 1ZP6A 3HDTA 4IFBA 1F2TA 1ZIPA 2V7QD 3NEYA 1XTKA 3RHFA 4HB0A 2D2FA 4YC7A 1OXXK 2GBLA 3EPKA 2C78A 2CL0X 2KBEA 3ZVLA 1FQJA 2GKSA 1P2UA 3BFVA 1D5CA 4JYBA 4M1WA 2V55B 4Q00A 3W34A 1ZVQA 4A9AA 3B8HA 3KQNA 4TYQA 1G8PA 2J7PD 2OESA 3FYHA 3IEUA 2PLRA 2VHJA 3KL4A 2WAXA 2B8TA 4YMVA 2IEZA 5KSZA 3X1DA 3RS7A 4JLBA 3VQTA 4RFSA 3U6KA 1RPZA 4I1UA 1XCGB 2BBSA 4PC7A 1G7RA 3LX5A 3U61B 4N3NA 4AKGA 1R5BA 3U2QA 2GXUA 3AVUA 4QNMA 3FPAA 1AGPA 1KI1A 2PZGA 3EXAA 1JXOA 5DO9A 4DRZA 2NZ8A 3QPUA 3AV0B 3BFKA 3BH7A 3LA6A 1XP8A 1E96A 2IBMA 2VP5A 4Z1MA 1HE8B 1XWIA 1G16A 4DIEA 2C03A 4Q9LA 2XZPA 2ZM5A 4LBWA 2ZRLA 3FFBA 2ZYVX 3ADKA 4BWYA 4DVGA 4QBIA 2PX0A 1L7VC 2E9SA 3U60B 2REBA 4DSUA 5AWFC 3T1QA 5IT5A 3GJ3A 1JJ7A 1HQCA 2GETA 2G83A 1OFUX 1ZBDA 1LFDB 2IT1A 3THXB 3THWA 2QBYB 1H8EA 1ZYUA 5DI9A 4M1OA 121PA 2J45A 4KFSA 4D80A 2YWGA 5L3QA 1OHHA 4GOJA 1F2TB 4LHXA 2ZE5A 4Q1FA 2IUSA 5BQ5A 5CM8B 1X6VA 3LW7A 4LBZA 8OHMA 2NO6A 1RKBA 2KWIA 3K0EA 5CYOA 3H1TA 5L3RA 3SC3A 1ZU4A 5K8TA 1N0UA 2BCJQ 3W8NA 1KK0A 2ZI6A 3BB4A 1XD9A 3UATA 4RSGA 3LBNA 2XB2A 3MWJA 1E1RA 4LPSA 3OAAD 4BLRA 4DXAA 1UADA 1COWD 3U7GA 4PQRA 3SI7A 2IS6A 1YR7A 4PC1A 2VEDA 4K46A 2ZYWX 3CF2A 1GL7A 5KSYA 1S1MA 1A4RA 4JSTA 2IYUA 5JI2E 3NBFA 4LYFA 1IXZA 4LJ7A 2WOJA 1TX4B 2QAJA 4TQUS 2QEQA 3BFXA 1Z8FA 3WNDA 4IHQA 4Y0AA 4JKYA 2OT3B 1QRAA 2IYYA 5F9HA 4NYJQ 4PZZA 1E99A 4UNPA 5JHHB 4UKDA 4BLQA 3FE2A 5HKKD 1U9IA 1AN0A 3I61A 1NKTA 2FZLA 1L4UA 3EW9A 1U90A 3MMPA 2ZU0C 4BRUA 2FH5B 1XXHA 1KAOA 2CL7X 1TU4A 5FOTA 3EX7C 4M8NE 2GESA 1PV4A 3QENA 1UBGA 4ZPXA 3VNVA 3RS3A 1D9XA 1EFCA 2RMKA 4LDJA 1VPLA 1L8QA 1W0KA 2QMUA 3Q7QA 4QC2A 2WJHA 1AA9A 1CJTC 1M6NA 2BVNA 3THWB 5EZ5A 4ACAA 1ODFA 2QGNA 2DYKA 4WBSA 4BFTA 3TUJC 2I1VB 4IOLA 2ZJBA 2C98A 2A5DA 4LPKA 3CNNA 2N46A 3HWSA 4HDQB 4HLDA 4GNKA 3EIQA 3Q3JB 3IDQA 1Y3AA 4PZLA 2QZ4A 3QXJA 4LWZA 2ZETA 1TUEA 3CB4A 3PITA 4TYNA 4UXJA 1J70A 3TKLA 2EFGA 2GF9A 2WPDA 3R9IA 4Q5IA 4LC0A 3K70C 4D26A 2JLRA 4ZDWA 1T5IA 1KIMA 1TL7C 2WWIA 1VYTA 3O8RA 2OFOA 1R0XA 1GKUB 1QHNA 1RYFA 1HEIA 3NC1C 5M04A 1WBDA 1JEDA 3EZ6A 4QOSA 3BORA 2Z43A 3PUXA 2XGJA 4A1FA 2E87A 4L16A 3VFDA 2CE2X 1L2TA 2FU5C 4IJMA 1M8PA 1TEXA 4B6EA 4HAXA 3NKVA 1W7AA 4BEBA 3W6OA 5B57C 1QHIA 2R8RA 1CR4A 3HJNA 4X8LA 1JBKA 1R7RA 1NLYA 4IOMA 4ESVA 1Q44A 2GF0A 1S3GA 3C8UA 4XIGS 1EWQA 2FGJA 1N6RA 1XX6A 1ZM4A 3KJGA 1P7CA 1W46A 1X8KA 1ZJ6A 3PUYA 4OI0A 2PLFA 5JSZA 4V0LA 1VHLA 2D3WA 1ZNYA 2H92A 2JAQA 2GJSA 3SYKA 1J99A 1JAHA 1QF9A 4Q02A 3JVUA 3L82B 3Q7PA 4FCTA 3P1JA 4LV8B 621PA 3GLIE 2ZREA 4LJ9A 4QJ4A 3Q5EA 3BOSA 4AWXA 3KKPA 1GOTA 5FUWA 1OJLA 3QVUA 3QIAA 2OLKA 1E0JA 2ZSEA 4OK3A 1E2KA 1H8HD 3HU1A 5LB4A 4BASA 2ORWA 1IOZA 1MKYA 3MLEA 3LLUA 4OJKA 2OSBA 4TMZA 4MYCA 4JKIA 3K1JA 3CX7A 1II0A 4PXAA 3CZQA 3C5HA 4OK5A 4Q66C 3RRMA 3PUWA 3WBKA 4BE7B 2ERYA 2IS1A 1CTQA 1UKYA 2F6RA 2OBMA 4XD7A 2VP0A 6Q21A 4IOKA 3IO5A 3K70B 2A2ZA 2IW3A 1XU4A 3K09A 4QHSA 5HPYB 1XPOA 1UAAA 4ZDJA 4TL6A 3IBGA 1EX7A 2RGBA 4G5OA 3GJ6A 3K53A 2JLQA 2G6BA 2F1RA 4BQSA 2Z0MA 1EFRA 1U8ZA 4QFMA 3V4RA 2ZS7A 2ZR9A 1RRFA 2ZUDA 4BFZA 4KITB 5JS8A 4D2IA 3NEJA 1XCPA 4AG6A 2CLSA 3RS5A 2C9CA 3QE0A 2C8VA 1E4VA 2RGGA 3TIFA 3ZZTA 5JRJA 1SVWA 5JBQA 1IN6A 5KOYA 3MWKA 4NYJR 4Z8YA 1E0AA 1VIYA 4NBSA 4FMBB 4XSHA 1TPZA 2XNDD 3KTAA 3LQQA 2QORA 2LKDA 1LS6A 1SXJD 2VF7A 4RZ3A 3QPVA 2CE7A 1GRNA 1G4UR 3AVQA 1KI4A 3BD9A 4TMVA 4EPYA 4A0FA 5FOWA 5JS7A 3TK1A 2P2LA 3QXXA 1KTVA 5FPKA 5SZJA 3RAPR 2BV3A 3EC1A 4L9SA 3UPUA 1CR0A 4JJZA 1O3YA 2C99A 2FNAA 2PT7A 1GRRA 3DVLA 2B6HA 1NVWQ 1EGAA 2FG5A 4YMTA 1GITA 4C0BA 3GJXC 2Q3MA 2DR3A 4OI2A 3RABA 3IBYA 2PCLA 2QP4A 3OEHD 3IIMA 3LH5A 4F38A 1S9DA 1AS2A 3LWNA 3PG5A 3ZIAD 2IWRA 3LQRA 3X1WA 4DLWA 1R10A 4O0MA 2JLZA 1W2HA 3N70A 1E2GA 1Z0JA 4ZDIA 1TTTA 4JLMA 4PPFA 5AUPB 3SE0A 2VQSA 3SJZA 2JIZD 4TSFA 5L3VA 4G3XA 1OKKA 4NZYA 4N0DA 4JL8A 3CPHA 3AF1A 5GVRA 5FOVA 4LCBA 3EA0A 4IDNA 2IXFA 5FOSA 4HLUC 2Q9BA 1XMJA 1O87A 3QXCA 1R5NA 1T9HA 3R8FA 4ERNA 1NMXA 1U94A 1DAHA 2OO7A 2MSEB 3A4NA 3D6TB 4BLTA 2CNWD 3SOPA 4URVR 2XZLA 2XJ4A 2BBWA 3KTAB 4V02A 3ZLJA 4HI0E 1YQTA 1EWRA 4CYMA 2RGCA 1CIPA 4HLUA 3VR6A 3BBPA 2HEIA 2QM7A 1Z5ZA 1Z06A 3GLHB 3LBHA 4DSTA 2XXAA 3WYFA 1DAIA 4C0LA 1S0UA 4LJ4A 4BRWA 3SBDA 3KQHA 2XTZA 2V1UA 4V0KA 3OFNA 3ZD7A 2ZS9A 521PA 2ZRDA 4JLAA 4WZ6A 4D4JA 3ZQ6A 1N0WA 2IYLD 5G41A 1MO6A 2QPTA 3D31A 1AZTA 1FX0B 3AP3A 2IF2A 1CJMA 1E9CA 5JHGB 1E2FA 1Q3TA 4LYAA 2NO0A 1AKYA 1DO2A 3DMNA 1AZSC 1FP7A 4OK6A 3ZVNA 2XAUA 3PEWA 2YZ2A 1VG1A 2FFQA 1E79A 2P6UA 2UVQA 2CCGA 5JJIA 3AKCA 2BIFA 5DN6D 1QZXA 1ZNXA 3WRYC 1WBBA 5E3HA 2LCFA 3DHWC 2B7BA 5LDDC 3GEHA 4A82A 1NRJB 2ZSBA 1UBFA 2O8DA 4FD2A 3AF4A 3OESA 1DEKA 1E1QD 3EZ7A 3KB2A 5GADl 2J3EA 3K0CA 3T1VA 3WHKA 1QHHA 1ZW6A 3DM9B 5IF9A 5J5CA 4PHGA 2Q3HA 1W36D 3TAHA 2O52A 5DHAA 3REGA 1XPRA 1JR6A 2YJTD 1G64A 2VSFA 1GUAA 3WY9A 5FTMA 2W6ID 4HUQB 3A1UA 3OEEA 1NG1A 2QMHA 5G3YA 1JB1A 1M7HA 3CR8A 2EFCB 3B60A 5BN5A 4LJ5A 4KFRA 3NH9A 4KHZA 4CEHA 2PCJA 1WE2A 3B85A 1XNJA 4MRRA 3WRXC 3VKGA 3QBVA 3SEAA 4DB2A 1KO5A 4URWR 2CCJA 3BERA 4PHFA 1MRNA 1XTQA 3L0PA 3QKRA 2V6JA 2XXAB 4FMCB 5TY0A 1NG9A 3RYTC 4V0ME 1YU9A 1KJYA 1OH8A 1LTQA 2F1JA 2BKEA 2O5VA 2GILA 1ZAKA 5AJXA 3QEOA 1E2NA 3ZQJA 4I1OA 1TAGA 2CDNA 1DG1G 1KNQA 4URUR 1G5PA 1TADA 2FFAA 2VP9A 4M9XA 4W5WA 4MUAA 3MWYW 5P21A 5EUQB 4PC3A 1ZM9A 5KO2A 2VLIA 2EQBA 4C7OA 5B64A 4FN5A 4LJAA 4PFSA 1P2TA 3R20A 2ZANA 4URYR 4QJ3A 4B32A 4IRUB 1K5DA 5SZKB 3UG7A 3RLFA 1KO1A 2PJRA 2Q6TA 4RVCA 4TYWA 4ITRC 2O8EA 1HT1E 5IK2A 4ZI2A 2QAGA 2ZRKA 4B44A 3K9GA 2ZRCA 2O8DB 4IEEA 1E2EA 1NMYA 5DSZA 3RS0A 5EE0A 1QHHB 2BMDA 4LY6A 1AS0A 5H1YA 3LDAA 3FKSA 3CWQA 4EPWA 1G3RA 4EFLA 1G7TA 4TQAA 2ASEA 2WM9B 4EPTA 2IC5A 3TQFA 2OE2A 2WKPA 5F3WB 3I5YA 2EWVA 5D3QA 1G6OA 4YDSA 4L8GA 2CJWA 1KSGA 1KAGA 1WXQA 1T91A 4JIMA 3GQBA 3VX3A 4B3FX 5HCNA 3A1TA 4TN1A 5LD2C 1M1YE 4X8OA 4GL2A 1NP6A 2AHOA 4NKRA 3GLIA 4DWJA 1DAKA 1KO4A 1ZM3A 1KOFA 3DPUA 4JMPA 2W6JD 1XEWX 4B73A 1F2UA 1RJ9A 4QBFA 2ZQ5A 3QKRB 4MGKR 2IUUA 1BMFA 1YZGA 4M1MA 1X1RA 2ERXA 2QE7A 4KO8A 4DLVA 1DS6A 4CDGA 1VCMA 2WWYA 4L5BA 5J47A 4MRNA 2FEOA 4QXAA 4F4IA 2H16A 3VX4A 1Q3HA 5G53C 4PAQA 4XTCS 2VL7A 1LV7A 2WIAA 1OIVA 2QT0A 3M0EA 1FP6A 4ILEA 4LYJA 2JJ2D 4C7OB 2A78A 1P73A 2DWQA 2W2VA 2IS4A 1OIXA 2VH5R 3FMFA 1KHTA 4D0LB 4URZR 4YONB 2FSHA 4D4KA 2BC9A 1YRBA 2R6CA 3E2IA 4B74A 5JLJA 1DPFA 3AVVA 1CLUA 4R2IA 1G6HA 2QAGB 1P75A 3LAWA 2TMKA 5JJKA 3B1YA 1NSFA 3SJBA 2F1HA 1KDRA 4EIWA 3QI2A 5FL7A 2OV2A 3JZMA 1NVXQ 4JLVA 1N6IA 2GXAA 4OQMA 4CIDA 3DZDA 4JSYA 3RRYA 2FPLA 4PR0A 4NE2A 1G5TA 1W48A 5EZ6B 5EXTA 1E4YA 4KLZA 5B58C 4M9QA 1XEFA 4KCGA 2GTPA 3DMDA 4WOPA 2NZJA 2G3YA 3BB1A 3TRFA 1KKMA 3GLIB 2ZE8A 2HJGA 2ODBA 4HUTA 2PMDA 1FNNA 1F2UB 5UKDA 1RJ9B 1C9KA 4JL6A 1T4GA 1KDOA 1Z0KA 3U5ZB 2AFIE 4P4TA 5LD2B 1ZCAA 1ZUIA 3FMPB 2PBRA 1XEXA 4QNRA 2QSYA 1XPUA 1Z6AA 1I2MA 5BYKA 1D2NA 4UNRA 2ZRHA 4WXRA 1TEVA 3GJ8A 3THXA 1FQKA 2C96A 3P4XA 4HDCA 5FFMA 5EP1A 4W9MC 5FBVB 1XTRA 1S9HA 1T3SA 4G01B 3MAAC 3NVAA 5CIQA 5CJ2A 5JEEA 5FOXA 3A37A 1DO0A 2RGNA 3DDCA 2RCNA 3CNOA 5AJZA 1II8A 4A2QA 3KQKA 4TZ6A 3I3SR 5FR2A 1LS1A 3QJYA 5EP4A 3GLHE 2WSMA 3AP2A 5CITA 2XX3A 3M6AA 3ICQB 2YV5A 1E2JA 1E3MA 4ASUA 5AUOB 2XB4A 5FUVA 3RRNA 4GMDA 2IYQA 2OZEA 1J7KA 4CT5A 3Q85A 4DLXA 1SVOA 1YZQA 4XWOA 2V7QA 1VG0B 4BZQA 2P5SA 2PZEA 2AK3A 1BS1A 2XEXA 1WF3A 2AXNA 3KJHA 2JATA 1OSNA 1UKZA 1D2MA 3HU3A 1KNXA 3PQCA 4IDPA 5BN4A 3AVWA 2J7PA 3B6EA 5SZIA 2AKAB 4Z1MD 1N6KA 1HH4A 2X2FA 1CJKC 3K0AA 4V03A 1XMIA 2PT5A 2HUPA 3TR0A 2J9RA 4HZIA 2ZSFA 1TNDA 1OV4A 3GJ5A 3K0FA 4Q47A 5DH9A 3UKDA 4AURA 1YE8A 1T5LA 2B7CA 3B9QA 3L43A 2OG2A 3EZ9A 4I99A 3EZ2A 5C4GB 3NBYC 1HYQA 5JI3E 2RB4A 1N5JA 4TYPA 2WICA 3ZVRA 3NTUA 2D62A 1XEXB 2YWEA 5EQTA 4JT2A 1W4RA 4M9SA 4Q7KA 3BGWA 3LX8A 2X1VA 3CW2A 4M22A 2IXGA 3W90A 3PJRA 3EPHA 2PJZA 1R2QA 2C9OA 2ODEA 1OXVA 5DYGA 2K5UA 2G1JA 2NIPA 1CU1A 4GT1A 2PZFA 3AF3A 5JCPA 4DHEA 3O8BA 1UKVY 3QKSA 4W5HA 4RCZA 1JR3E 3SZRA 1RVDA 5AJVB 2QPOA 1AGRA 2BBTA 2WMOB 4D0GA 1ZD1A 3SS8A 3ZS9A 3T61A 4C30A 4KVAA 4OL0A 1II8B 4PHHA 1Z08A 2JEOA 1P5ZB 1V43A 1YR9A 2A5JA 2IUTA 3I5XA 2ZRPA 3QXHA 2HT1A 1R0ZA 1UBEA 1E2QA 4BLOA 1MV5A 1JQLB 1T8TA 3M1IA 2HJVA 3MGCA 2DFKB 3KUCA 4P31A 5CB8A 1JPNA 3B9PA 1BIFA 1KZ7B 2CCKA 3LVRE 3QG1A 3FWYA 1E9SA 2WV9A 2P67A 3CLVA 4YMSA 4DT1A 4B3GA 3RC8A 4DDVA 2GK6A 2RGXA 1QHYA 1SVMA 4ZDKA 1WCV1 1HY3A 1YRAA 1Z22A 4HDOB 2ZRGA 1J90A 2JASA 3GEEA 2ZR0A 3T5DA 4HB4A 1NVUQ 5TMPA 2OFXA 2IYVA 2H1LA 1OPXA 1KI3A 4DKXA 5TB5A 1TF5A 2IHBA 2VTKA 2QP9X 3L8YA 4EFMA 3OAAA 2XSZA 3AVTA 5JWHA 2SHKA 3WXMA 2HV8A 4V0MA 1U0LA 3CONA 2GJ9A 3K0AB 5BYJA 3A58B 4ZCLA 4B2IA 1R5OA 1GNPA 3CPJB 3K0FB 4LX0A 5DLQC 3VAAA 2DY1A 5TV2A 4Q1DA 1JECA 3GJ0A 4U7DA 4QL3A 2ZRNA 4LRWA 1LB1B 2OHFA 2WAYA 1F5NA 1QBKC 2QM8A 4JBXA 1E9RA 1BH2A 1ZC3A 4KBFA 4Q1EA 3HR7A 2D7CA 3W6NA 2ZJZA 2ZRMA 2B92A 4Q9KA 3SHWA 4G5GA 3ZYCA 3KKQA 4YXWD 2Q21A 3EWSA 1JAIA 4DCSA 4US2R 5HKKA 4AYWA 4BUJA 1SHKA 1XZQA 3OE7D 3OIYA 4IVPA 3ADDA 3GJ4A 3HYRA 4TT3D 4LZZA 5E7JA 4QM7A 3KUDA 4AY2A 1E9EA 2R9VA 3QKSB 1WDTA 3QOFA 5JJLA 1NBMD 2B8WA 4Z8XA 1KK3A 3DKVA 3QF7A 4MDFA 5H68A 1DAMA 1V5WA 2Q0HA 1XFAA 4G1UC 4PZYA 4C2UA 2YHSA 2CBZA 4CW7A 3AB3A 4QGFA 5JZVA 1N5KA 2MSCB 3CF6R 2EFDB 4D4LA 4KBGA 3AUYA 4O2RA 4QRHA 1TMKA 1LW7A 4OQLA 3RSOA 1KI2A 2D74A 3IKJA 2R65A 4OHXA 1XJ0A 3ECCA 4DSNA 2NMVA 1KDTA 5IDVA 4PHTA 3L8ZA 4ARZA 1E2HA 1IHUA 4DT1B 2PEYA 3JZAA 4U00A 4US1R 3WYGA 1ZM7A 3UMSA 2JLYA 1Q12A 4X8HA 1FTSA 2J0UB 2IYRA 3MJRA 2VF8A 4PSAA 2AR7A 3Q9LA 1ZNWA 1Z3IX 2R6DA 2ATVA 2WSSD 1E2LA 1RRGA 2DFTA 4QGHA 2YYZA 1EESA 4OHVA 1OT3A 2O0HA 4GPTA 2F9LA 1GRQA 4FMCF 3FFAA 4WXPA 4NU0A 2AWOA 4A2WA 5KDLA 4NYMQ 4WW0A 2H7VA 4DCNA 2C95A 2J87A 1UEIA 3AH8A 4M2LA 1EK0A 3F0TA 4LC1A 5D3MB 4MITA 2I4IA 3H0KA 4C4PA 4BPBA 3WP0A 2EFHB 4PC2A 4GZLA 1YZTA 5CB6A 2FA9A 3K8YA 1NMZA 2OCAA 3NHAA 1W5TA 2HF9A 5CLQA 1KJZA 4IVRA 4BFWA 5CM9C 2GZAA 1CBUA 1YHNA 2A5GA 4IKEA 3FHTA 4B33A 3NWJA 5FUYA 1D8TA 1RYHA 3VKWA 1Z47A 2GXQA 2UZIR 1J8YF 1LVGA 3SYNA 1P3JA 2ZJ8A 1A7JA 2RGEA 2HDNB 3U3RA 2WTUA 3CBQA 2ZJ5A 4MKIA 4BFVA 2V8OA 3AKDA 3AP1A 4KODA 4A92A 3PR1A 3FHCB 1E2MA 2PEZA 3IILA 4ARZB 2WKRA 3KQLA 4DDUA 3U44B 3ZZUA 1FMJA 3PEVA 3GFOA 3IIJA 2WJJA 2ZJAA 3B78A 2BKUA 5FBLB 1RRCA 3EA5A 1XZPA 2GK7A 1H8HA 4EQ6A 2YINC 1FL9A 2WHXA 3PUVA 4B47A 4W5JA 2CK3D 3K9NA 4MRSA 4B43A 1VCNA 3OHMA 4RD3A 1CULC 4TWZA 4EFNA 2A5FA 2H8KA 4B2LA 1G21E 3W9YA 2HCBA 4PX9A 4RKEA 4B71A 2WWWA 4NCNA 1T3HA 3TE6A 1N0VC 3DEFA 2GJAA 3ICEA 1KYIA 2IX3A 2PX3A 5K8IA 2DFNA 1SVKA 4TTQA 2WWGA 3KX2A 1GNQA 1U0JA 1CJVC 5KDOA 3HYTA 1P72A 1X1SA 3QBTA 3AEZA 4EPXA 3B1XA 5CDFE 1NY5A 1FW6A 1K6MA 1Z6GA 4LJ6A 1HTWA 1R0WA 1OXTA 2MMCA 1OXSC 3MWLA 5HE9A 1NJFA 3LLMA 3GLHA 4HAWA 821PA 1TQ6A 3T15A 1QG2A 2FMXA 5JCZA 1IXRC 1HA3A 1ZNZA 4JLKA 2RKOA 1SXJC 1YVDA 2W2XA 1FUKA 4C0KA 1CR2A 1W49A 1HE1C 2KE5A 1VYVA 4QM6A 4OQFA 4Q4AA 1FX0A 4LHVA 3VR1A 2REXB 4G0NA 4ON9A 1YZLA 4R71A 2J0QA 4Q21A 5F98A 1GTVA 1E6CA 1SXJA 1G19A 1M7GA 3P20A 1Z6YA 3AF0A 4GMXA 4L15A 4QG7A 4FCWA 4A6XA 4I1SA 3ZS8A 4NCJA 1I4TD 2ZI9A 4HZUB 3S1AA 1E9BA 3I32A 1UKEA 4EQ6B 1VCIA 4C0QC 3WYAA 2NO9A 1VECA 3GLFA 2G0TA 1Z28A 4XSGA 1MR3F 3TSOA 2Q9CA 3GP8A 1ANKA 1GM5A 1KKLA 3ZGXA 3R9WA 1P4SA 4M53A 2WJVA 4B76A 1H65A 1OKKD 4YLGA 3TQCA 4HUQA 4TZ0A 1EFUA 1YKSA 3BXZA 2GNOA 4WAUA 1KO8A 3NG1A 3DZ8A 3ZIAA 5FL3A 1NKSA 3AGPA 1RFLA 1OB5A 1CRPA 2CHQA 1IN7A 3I4LA 1TF7A 4Q01A 4HAVA 5ANRB 1JR3A 3BK7A 3LV8A 3SDZA 4DDTA 4YMUA 4DLSA 2BDTA 1GILA 2OFWA 4F7WA 3FMIA 4E22A 3W8RA 4KV9A 1IN8A 1DG3A 2ODWA 3I62A 2QTVB 4HB2A 4JYCA 3T06B 4N0EA 3L0SA 5ELXA 4U5XA 2QU8A 2BWJA 1QHSA 1UM8A 1VG9B 4GOKA 2GZHA 4NYMR 3CZPA 3LXXA 3OFND 3THOA 1AS3A 3A1SA 5HTKA 3N2EA 3NH6A 1DOAA 2CNWA 4Q4AB 2DBYA 1DBSA 1JEEA 4NDZA 5J40A 1G17A 2KB0A 1OF1A 2F43A 1JXMA 4LV5B 4JVNA 4KFTA 5TVKA 5C18A 1ZIOA 3FMOB 1SXJB 1D6JA 3LNCA 3ZZ0A 4PO1A 4UJ5A 3LD9A 4ACBA 1E79D 3WMEA 4LSGA 1NVVQ 3VNUA 4HYYA 3QKUA 2E1RA 4CVNA 3AVOA 4DEYA 4DLZA 1KK1A 3S1AB 1NJGA 3QUSA 4YMWA 1QHXA 2QUZA 3K9HA 1ZRHA 1W4CA 1DTSA 2QMOA 1MO3A 1BKDR 2Y8EA 3GLFB 3SU8A 2KBFA 4US0R 2JJ1D 3CO5A 3AQ4A 3U3OA 4A8JC 2VPPA 3KJIA 4B3DA 4MYUA 1AK2A 4KXFB 2FZ4A 3B1ZA 1UPTA 4Q7LA 2ZRJA 2LKCA 3OEED 5DN6A 5KU1A 1W36C 1FPMA 1UDWA 2JDIA 3NHBA 1CP2A 1B23P 2DFLA 4JBYA 5KTYA 3H4MA 5DGXA 4A8JA 1AJEA 1JNYA 4U02A 1CKEA 4RY2A 1E1QA 1SVLA 3G0HA 2BEKA 4OHYA 3MUFA 2H17A 1ZINA 4JJKA 4DCUA 3DL0A 2GCPA 2OXCA 1HURA 2VIIA 4TLDA 5JWOA 4HATA 2ZS8A 2W6IA 2Z4SA 4QKQA 3Q72A 4Y0VA 1XD8A 2RHMA 1GSIA 4Q18A 3GMTA 3RC3A 2QGZA 1M34E 4MKFA 3AGQA 2XOKA 3BH6A 4LI0A 4M4SA 4Q9IA 3IHWA 2AX4A 4UNQA 4UNSA 1Q1ZA 1Q1QA 1UJ2A 4AI6A 3LW8A 4GRAA 2X2EA 2F43B 1OIWA 4DEXA 2GWHA 3O8DA 3TVTA 2ZUCA 5EP3A 2WOOA 1PLLA 2QL6A 4I4LA 5LPNA 2W2TA 3C4JA 2A30A 2H18A 3RS2A 2WVJA 3X1YA 2FEMA 3WMFA 3VTKA 4KAXA 4UXHA 4JL5A 1E2IA 1Q0UA 2Z5FA 5CK4A 1RE0A 1NY6A 5A4JA 3T5GA 5AJYA 5FUXA 2AWNA 3PVSA 4H9GA 5FI0B 2QQ0A 2QA5A 3VR3A 5EP2A 1HQYE 5TXGA 4QJ5A 3GCGA 2OUKA 3FKSD 2F3TA 3B13B 3DM5A 2IF0A 1VDZA 1Z0DA 1G5RA 4TMWA 2NPFA 1XTJA 1GWNA 3CPEA 2P3SA 3LBIA 5HR5A 5KNDA 4Q1CA 2LWIA 1GL9B 3N5CA 4JLNA 3CH4B 4A8JB 1NBME 2VHCA 4IW3B 3AM1A 1KI9A 2OXRA 3FHOA 3O47A 4JBWA 2R62A 4Z51A 4AKEA 2AN9A 5FBRB 4GDFA 2YOHA 2Q3FA 421PA 1W36B 4PPQA 1P60A 3TMKA 1P9NA 4AYTA 4AKHA 2J5XA 5TDHA 1KMQA 2WWFA 1FTNA 2ZVQX 3NIBA 2O8CA 1YZUA 1G7SA 1LNZA 4KJZA 5F9FA 3MSXA 3TSZA 2QE7D 2HT6A 1NLZA 1XJCA 4AIIA 4UJ3A 4NCIA 5E95A 4DIDA 3ASYA 2EYUA 4XTRA 1OH5A 3U3JA 4MDEA 2P6RA 3BAFA 4D82A 3ETLA 5EXPA 3CR7A 3I8XA 1DVRA 3AVPA 3TBKA 3L0IB 3AUXA 2PMKA 3UWKA 4A36A 4M1YA 3BWDD 1IXSB 2N1BA 1KGDA 1KK2A 1QHGA 3MD0A 4C0SA
chains in the Genus database with same CATH superfamily
1DIRA 4IGFA 3COJA 3OIDA 1BDBA 4MEBA 2X19A 3MRSA 2CXPA 3USCS 2HA6A 5IVKA 2FP4B 3RUEA 1EXVA 1I1HA 4NZ9A 4UVEA 4TKZA 3RQIA 1T9KA 2W42A 1BROA 2HWYA 1Q1BA 3FB4A 4Q4HA 5HQTA 4J94A 1GZHB 2QRPA 3F46A 4G0ZA 3G0CA 4RZIA 2R44A 1LDEA 2VN8A 1IN5A 1W87A 3IO3A 1M2OA 2W58A 3NXSA 1VCOA 2ZTHA 4AZ0B 1K88A 1L5MA 5ILGA 4F9EA 1VMAA 3MQ2A 4I08A 2PUEA 4HD8A 3D1VA 1YZKA 1R9GA 4YJHB 3W7VA 4IF6A 3CVUA 4RMJA 3EDQA 1PT7A 2NQ2C 3RHSA 3HL0A 3E4DA 4ZOQI 3T1TA 4ZO8A 4LF8B 3SJUA 1GG8A 3KNZA 1A2KC 1RRKA 4JA0A 2OM6A 1TJNA 3WZMA 5EL0A 3LXUX 4BJ5A 4EI8A 4X7PA 3D3WB 3DTTA 4KQJA 2PKRA 3PSHA 3JQAA 6ADHA 3ICWA 4NEQA 1Z36A 2H9AA 1UC8A 4O59O 1GPAA 1NW9B 4RZUA 4MHTA 1VYUA 1Q15A 2YASA 1HUQA 5L3SA 5E3IA 3G8AA 3RAEC 1E58A 4U63A 5IP5A 2PZAA 5ESDA 1L4NA 4YREA 5G1OA 5C4IA 5HFNA 3TVDA 1CUHA 2JH9A 4ND4A 1G18A 2QVLA 2B20A 2ZWVA 3IDOA 3F7OA 4FZRA 5LMCA 3GEIA 3SQDA 2ODNA 2AKYA 1W0JA 3KFXA 4MI3A 4BJ1A 5AK0A 2QG6A 1WZUA 4ENVA 2B98A 2QRGA 3BKXA 3DUFB 3WICA 1G3QA 4JWTA 3ZWMA 2Y1XA 4QUKA 1A0OA 2VJLA 4JI6B 1XB2A 4U6QA 4DL9A 4QJBA 2ADMA 2ZP1A 3PGLA 4DZRA 4BNZA 2TMGA 3IUEA 2C3UA 2RDMA 3W1EA 2I1WA 4JS0A 3HI6A 4ER3A 1WB5A 4FUQA 1KMMA 1WKBA 5FAXA 1A5AB 5DW3A 3MJFA 5FD8A 3ROQA 1ZOLA 4V0SA 1IM2A 3UNXA 1ECCA 3B48A 3EF0A 2R3SA 3G9TA 3W06A 4RWEA 2GBLC 3KVYA 4XSVA 2JLWA 3H18A 4OB8A 2YFHA 1XNHA 1MNAA 1WXEA 3IIKA 5HF9A 4N7BA 2HXSA 3VUFA 4I6GA 3EJWA 4N5MA 2W7TA 4Y1EA 1WG8A 5JPIA 2RAPA 2BD0A 2CXUA 1HE3A 3OM1A 1XK6A 4NC9A 3RSLA 1HRKA 3NT4A 5DHFA 1BVUA 4LUCA 5ER9A 4PQFA 1SXJE 3X2SA 1A88A 3AEQB 3HXQA 5IC6A 2HL6A 2GBPA 1N5MA 3GVHA 1OR8A 1T0HB 3V4OA 4EUKA 3KT0A 5LOVA 1NSTA 4QICA 3CZ9A 4WN9B 4DSZA 1WBJB 1Y81A 1QQ7A 1BQEA 1X2EA 2AH5A 2QYTA 1EZ1A 4JLSA 3ET4A 3D7SA 1CG6A 1ESNA 5BQPA 3KR0A 4TKUB 1Z2CA 3T4EA 2CHEA 4F06A 2GUGA 1PQPA 3KEMA 4H1VA 5K8UA 2YRXA 1Z0AA 3QNMA 4TLAA 4DY6A 1ZD9A 2XVXA 3KBBA 1B8PA 3V32A 2QLFA 1T5OA 4MKGA 2EEZA 1RBMA 4Y2PA 1AUXA 3GUZA 3BTSA 3CZ4A 4GI7A 3DSRA 4UM7A 3U7IA 1GD1O 2BI8A 4GGOA 5KSPA 3SY8A 2H63A 3RC7A 4ZAZA 4MVJF 1ETUA 2B83A 4LJYA 3LMKA 4OQDA 2QYOA 4C21A 1JHPA 4KSBA 3NM4A 2CMGA 4JLPA 2UVDA 1PVVA 1CT9A 2PRSA 3LRXA 4LNUA 3VYSB 2PNJA 4E09A 1H8ED 2X42A 221PA 2IU4A 4PZDA 5E7IA 5FORA 2HO4A 2FZWA 2XH8A 3I6ZA 2ZUBA 2BGLA 2UYGA 4QREA 4QYXA 2MMGA 1NU8A 1S1CA 2QTHA 1HOTA 3ASZA 4HXFB 4QOFA 1PHPA 1DRJA 4QFCA 4QYMA 4RKFA 3U6BA 3DCNA 2XCIA 1DI0A 4U2GA 4JP2A 2F67A 3ZEAA 5KX5B 2IKSA 1T3ZA 2EBHX 1XRNA 2FPKA 2WFAA 3E61A 2IYFA 1Y6RA 3RSQA 1AY0A 1VGQA 5DHQA 1QH1B 1D1SA 3R0XA 1IULA 1C7ZA 3AEXA 3II6X 4QXQA 2CLDX 3E8XA 4K9LA 3S3TA 2A9KA 3NNNA 4F72A 1SCNE 3WIEA 3QY0A 5KHAA 2JZOA 2Q29A 4HDAA 5C8YB 4PBTA 4RWZA 4ARVA 3ZVKA 3RFCA 4OKSA 4LXUA 2BBOA 2JLXA 1RWOA 2C1XA 2EV9A 3LDFA 1FRVA 1R0YA 2BTQA 2GZDA 1E9AA 3KXKA 2P0YA 5CJPA 4JVLA 5IAKA 4EYKA 4IH1A 2MWMA 1U3GA 1E66A 2VDNB 3L93A 3V8PA 1RXYA 4BNJA 3AI3A 1E2UA 4C0AC 1COWA 2XSZD 1GTJ1 3GT0A 5DHUA 1KH2A 1JG1A 1G20B 3A4MA 1KO7A 1XLVA 1T2FA 1JLRA 4I8DA 3DDWA 2WMNB 3IXQA 1A8QA 4IEIA 1C4WA 2VPTA 3TGLA 2VHTA 3MGKA 4LF9B 2I3GA 1OVMA 3ZHUA 4QFDA 4RTRA 4RFSB 2AN5A 2G25A 4UPVA 1K27A 2P9JA 1QFYA 3E9EA 4B6FA 1H05A 1WWKA 4YRFA 1KI7A 3KZVA 5SYMA 4BQPA 4PV7A 4MJ7A 5LMUB 3FVTA 1JDZA 2B1JA 3PR3A 4FDVA 4PG4A 4RELA 3WRVA 4ALMA 3ZCTA 3AL0C 2R68A 1BJRE 1NBEA 2XUQA 2ZAIA 3IA7A 3OZUA 1K8QA 4PAMA 2QD5A 3KDPA 4KGXA 1UFRA 4KMRA 1I6LA 4JLDA 4J4HA 4LYHA 3MJTA 2ISSD 4F4HA 3I2YX 5B37A 5DK4A 4PYOA 1QHFA 1VHQA 2BRUC 1UDBA 1ISHA 1L7NA 4OHOA 4UMDA 5HQ3B 3HVRA 4N5IX 2ZWIA 3OFKA 4J4BA 4D99A 3PV0A 4S24A 1SCAA 2OGUA 2ORIA 3SFVA 1EAYA 2V4ZA 3BQNB 2RC5A 4ALKA 2VAPA 4NP6A 1XDBA 4XCVA 4D0SA 1XMXA 5HZHA 3UB2A 1JHRA 1P2GA 5JNTA 5C8DA 1NT2A 3I5UA 2PVPA 2QY6A 3KEOA 3V33A 2QP3A 1O5TA 3HB0A 4KYUA 2BRUA 2KI5A 1TMGE 1ORVA 2REOA 3V48A 4MA4A 2X0DA 5FTLA 1AIPA 1QOQB 4P5DA 1N7JA 2HHJA 4S04A 3FZNA 2VNKA 3VKHA 1LKZA 5FRDA 1KEVA 2YYSA 4TT3A 4E0BA 2GZ1A 1OXUA 1E2DA 3EN0A 3TDMA 5A4AA 3ZH9B 4HNVA 3U56A 2ZSDA 3HP1A 3HXOA 1NNEA 1DSSG 2G4VA 1ZCBA 2Z83A 4U39A 3UJ6A 3I5MA 4DOMA 1TJ3A 4HAIA 3F6YA 3RBAA 1HTBA 1ZMRA 4XGNA 1GPMA 3R7WB 4UTPA 3VR4H 2JAOA 2FCRA 4G4IA 4HVLA 3OE4A 4JVMA 4OJYA 3C8HA 2X4GA 3MT0A 4KQ6A 1YDMA 3EARA 1GFSA 5EJ2A 2NQTA 3UKOA 5DCYA 1DEAA 3EZXA 4MWTA 3CRW1 2DBQA 1E69A 3NP9A 3DOFA 1YBHA 1XMPA 3BB3A 3ETEA 3GA5A 4ZWNA 3VU0A 2UKDA 4BP1A 4N49A 4C87A 5JMTA 1CQIA 2DPXA 2QXTA 4XLZA 3D2AA 2QQGA 3DDUA 3OT4A 5LYYA 2JVJA 5CGQB 1AV7A 1QO0A 3CX3A 3ABQB 1WDLA 1PR5A 1TZJA 1QCDA 1CQPA 1UAGA 1YB7A 2BFFA 2XE8A 1GPKA 3NO4A 5DI3A 5EE1A 1R4ZA 1JJBA 1S3FA 3UQZA 2FEAA 2EZUA 4L6AA 4Q3BA 3CLSC 5HIJA 1G291 1ZISA 2ES4A 1MDBA 2FWNA 1ONBA 3I2HA 1YZNA 3NAMA 4CM9D 5TQJA 4HTAA 4PFQA 2FMHA 2WHPA 3I2KA 1N2CB 2OWEA 3IHLA 4OBWA 1ZL0A 4PONA 5AVVA 4GLBA 3K5WA 4O3MA 3NIGB 2BP7B 3E3LA 5GWXA 1EGVB 5LB2A 3O8QB 1QO7A 2X8AA 1CUSA 2IW1A 1USIA 1FVHA 3LCVB 2WWHA 2ZYHA 3VBEA 1XTIA 3BK1A 1L5VA 3E5HA 4UXIA 4CM1A 3TQHA 2BEUB 1SQGA 4YBRA 3GUCA 3QU5A 1QGZA 3BK2A 3EDYA 1OLSB 4DMMA 4E2YA 3PA6A 3SZUA 3AWDA 3LBYA 4Z3OA 1S6YA 3RRXA 3UV3A 3G7SA 2WJ4A 1FZQA 2BLLA 2F59A 1W1UA 2WAOA 4TQ9A 1YB2A 1DMSA 4Y2JA 3TR5A 3UCFA 1II9A 4F9FA 2FDCA 5C52B 1X8XA 3LL4A 3K32A 2VJCA 3U7EB 5DISB 3MK31 2HWWA 3JVVA 5L6MB 1I4DD 4R8SA 1RWBA 1KI6B 1ILWA 3PEEA 5F5LA 2O7RA 5J4VA 2FCAA 1I9GA 4HZUA 4Z0HO 2VJQA 4GZMA 1OH6A 9GPBA 3RWOA 3HUUA 3C16C 2HYIC 1Q20A 4H7IA 3MB8A 3INGA 2QN6A 4DXDA 4F4CA 4EO4A 3SR0A 4ZMRA 3IDAA 1RE1A 1WIWA 2NYUA 3OURA 1N75A 2JCBA 2P2DA 2WJGA 2JI8A 3QQ5A 4LVOA 4Z0PA 2OZLB 5SY4A 5IG2A 1JJVA 2CKMA 1T2CA 4JD5A 1ZR2A 3EBOA 3FW1A 2JLSA 1R88A 4AW9A 3AONB 3NC0C 5JH7B 1YRWA 3VZDA 3BIJA 2YOFA 3UC5A 1UMCA 1E7QA 3DB2A 1F6BA 2J5BA 2YY5A 1R9JA 3BKWA 2YIVX 4DRYA 1N5IA 2PUDA 4EKYA 4CMHA 4FINA 1L4KA 2BKXA 1WP4A 1OLUB 2BFOA 2J32A 1BOFA 2X4IA 1A04A 1IY2A 1Q74A 1S4QA 3HFGA 3JQQA 3O03A 4MGIR 4PINA 1OGJA 4B5LA 1CD5A 1SC6A 4FLMA 4BMNA 1QDLB 2VDMB 1P9WA 5ALMA 3B9RA 2PA3A 4LJ8A 1AKWA 3B3GA 3FYTA 3GJ7A 1DL5A 2ZVJA 4RQAA 4KP7A 5FBWB 2IZOA 2HA7A 5JCOC 1FDOA 4G85A 5LYJA 5BWLA 5IABA 3BD6A 4KU4A 3SHOA 3KKNA 2NO1A 3RREA 3KEGA 2IEBA 5L7WA 1XC7A 1PQWA 3E8MA 4KMMA 2ZLBA 4UVDA 4WDQA 1J22A 2D0DA 4N76A 2JFUA 4CF4A 3OOYA 4GE0A 2YXEA 4H7HA 3PEUA 4X0EA 5JCOA 1C50A 2XNDA 4Q12A 1JDSA 1XPUA 4K6HA 2PPVA 1ZC4A 1NTRA 3WYCA 3V1KA 4L2IA 4IV5A 5KUTA 4E70A 4EUNA 4L28A 4RS4A 4KR9A 4KR2A 5H82A 5LBIA 4YRIA 2I9PA 3I1JA 3V97A 4EY8A 4BU0A 3R24A 4MKXA 4TTSA 2H4FA 1E1LA 1XTBA 3NBZC 2ZAOA 5FT9A 3WR5A 4A2PA 4BVFA 3K9BA 4F2GA 3O94A 3E3OA 4OMFG 1Y1PA 4K8OA 4H08A 2FP3A 4TRRA 4BATA 4CM5A 5G0UA 3CSSA 2GD1O 3MJVA 3OIVA 1QYWA 2O7VA 3DE2X 3QBJA 1UEJA 3C24A 4RD0A 2P1ZA 2VHZA 1VP3A 2YKGA 3KXDA 1GG5A 2FN4A 1ABEA 2HCRA 1F9AA 3HWWA 3ZK8A 4EJMA 1RXWA 1YTUA 1XMVA 1J56A 1KEWA 4PPNA 4X3PA 1CRQA 1IONA 4RZXA 2M98A 2PA0A 4NONA 4QDUA 4D1YA 3ZD6A 1US8B 1UH5A 5FWDA 3TMAA 4A26A 1MEEA 1PGOA 2EATA 4CIVA 1JEOA 2RHWA 1ML3A 1YR6A 3MTIA 2XWBF 3KVOA 4TV9F 3F4LA 2PUGA 1M66A 2N0SA 2J8ZA 3VZCA 1SCUA 1L3IA 1QE3A 1M7BA 4LY3A 5ALSA 1K5GA 1QIJA 1Y5MA 2AG6A 4BB9A 2WHRA 2VA8A 3O90A 1RTTA 2AC7A 5ARCA 1LWNA 2PRJA 3G7UA 2YY7A 1M2JA 4TLEA 2JIZA 1UMDB 4G9BA 2YV4A 1EJ2A 5B30A 1C8BA 2ANBA 2FW1A 3ORQA 3EGCA 4L0MA 4PANA 1CYDA 1VA4A 1Z34A 1ZD2P 2IGTA 3W7AA 2ORVA 4EA6A 2XWSA 4JDPA 4B8YA 4HWRA 4MVCA 1YZFA 2G5PA 5HGJA 2YJZA 4I7EA 4Z99A 1TCBA 2X13A 3EEFA 1YKFA 4F84A 3K0SA 1NQOA 1XZHA 1CS4C 1AKUA 1ECGA 1LSSA 1W6RA 1A9OA 2ZVDA 3FRIA 3NHPA 4HCJA 4RAOA 1YDEA 2AF3C 5H0IA 3ZKWA 4ZEMA 1EEXB 1P0CA 1U8YA 1EP2B 3K2QA 2CGEA 1S7GA 3KZCA 2Y92A 3V2IA 4BNWA 3EXIA 4N8EA 3FBGA 1QE5A 1G98A 4RHUA 5M5BA 2PMBA 5FI3A 2YUTA 3ZDDA 1DKNA 3VKUA 1NJ6A 1L7AA 2IY8A 1A5BB 2Q50A 3C1TA 4TL8A 4WKBA 4HH0A 5IDQA 1DELA 1KXZA 3VA7A 3KXLA 4OHWA 2XNKA 1ENOA 1TRHA 1RPAA 3ND6A 1NF2A 4GKJB 1WRBA 1JLLA 2H2DA 4N8SA 4GC9A 4KNYA 1ZJ4A 4B2PA 2N42A 3IQWA 2C3PA 3W3ZB 1GR0A 2P8SA 5EJEA 5MFPA 2CMFA 3NUGA 2IEAA 3UVEA 3SNHA 4O1IA 2A9QA 2CLCX 5JBIA 4AROA 3CIOA 3FWHA 3IX7A 4G8DA 1U8UA 4R40A 4Z7NB 4Q4JB 3AVYA 2AIRA 2HPZA 3WC4A 3AKEA 5LQNA 2W11A 3S4YA 3SQMA 3QSYA 3QUTA 1T2UA 4MRVA 1H4SA 3C4QA 4EX6A 2O2EA 3H0CA 1NOJA 5JS1A 4P8RA 2FRDC 3HCPA 1YHYA 4WK2B 2FWJA 1SIUA 4G07A 2CHVA 1QGOA 4UM9D 4XXHA 4BVLA 2V5UA 4YAEA 1KTIA 4YRPA 1HBJA 2WP8J 5ICCA 5JFOA 5COAA 3O93A 2GA8A 4WZAA 5IKMA 4RDXA 3SXJA 1POXA 3PHBE 2ZI3A 2PWZA 2GCNA 2VJMA 2B78A 4ENQA 2P1DA 3PP8A 1G63A 2VDLB 3B2QA 3RUHA 2F00A 4C05A 3L8HA 3D8NA 1GL6A 2HK7A 1FQOA 4WXHA 2VDWB 3ZWWA 1L4GA 4CCYA 1YSCA 4XUCA 4F6LA 5IWAB 3ZX5A 2ASVA 3FR7A 4RU1A 2XLBA 4XA8A 5DLEA 3J80A 5HZKA 3ZE9A 1FNCA 1GARA 2AOTA 3BL5A 1ZLYA 2FE4A 4UE2A 1EX6A 1XL1A 2B69A 4YT8A 2DRIA 4UHKA 3VYUB 4IAOA 3WL3A 5JWRA 5KNBA 4RMIA 4WKNA 3MJHA 2ACEA 4BGDA 3W3AA 5KMGA 2BHRA 4G1EB 1T3LA 3HP7A 3MG9A 1IZ9A 3TQQA 4JLJA 3ZTYA 5DYIA 3VHQA 2P65A 1X8JA 3OQNA 2YJNA 2YJ4A 5DCWA 1PRYA 4XJXA 5G40A 2GJ8A 4K7JA 2CDRA 3WADA 3FGNA 3QFTA 4EUFA 1FZTA 1Y8AA 3ZU3A 5IXJA 2RAFA 4OB7A 3GAMA 1O97D 2FFBA 4MUMA 5DV9A 4LWPA 3OOJA 3EVDA 3I01A 2EJUA 3Q11A 1XXHE 1EFPA 4DLNA 1PWZA 4V1CA 4DM7A 2ROQA 3TIXB 1P29A 2Q99A 2ZZKA 3VAZA 2FR0A 3I72A 3G3EA 1KMHB 3DKIA 4TZKA 3RIHA 3R5FA 2AEMA 2QRMA 1X7ZB 1HXHA 3GCXA 3B1WA 5TRTA 4BZXA 5B36A 1VSTA 1GIAA 2H1CA 4Y1FA 5DKFA 5J3JA 4BMVA 3NIFB 1OI2A 1R3DA 4ZTZB 2XUFA 3ICOA 3STHA 1NAIA 5K8JB 4GP9A 4A15A 2GZMA 4LBVA 5DNVA 4WASA 4C07A 1EA5A 4G4JA 1ORTA 1UBSB 1BVYF 2EVWX 1IY1A 3IBTA 1KOJA 5EFZA 1ZUNA 5FI1B 4Y1GA 2R8YA 4R51A 5LZ5A 3STWA 5AW7A 1PJ4A 4HB3A 4L7VA 5J4YA 4EHLA 3FWZA 1G1MA 2KHZA 2BMAA 4FMDB 4MYRA 4RFVA 1KR5A 3L2OB 3PGVA 1RLUA 3ASVA 3D6VA 1B14A 2J6CA 4X66B 2J5QA 3O9VA 4GECA 3ZCPA 1XZJA 3NDPA 3W8DA 4RXUA 3KSDO 2OO5C 4A6EA 3ITNA 2OOKA 3CH5A 6PFKA 1QKJA 1Z7WA 4ZKEA 1G8HA 2EZ8A 4HJRA 3IRVA 5IXYA 2ZUEA 1MX3A 3FWPA 1P0QA 4ZEXA 3ML1A 5BPFA 1NI3A 5K8CA 3B7PA 3D7MA 3UPTA 3F4KA 3LQ4A 3M9XA 3MCAA 3NU1A 3F9CA 2B99A 2RHDA 1W9HA 3KYDB 4KYIB 3BCHA 1FOEB 4CEHB 1JIJA 3WWOA 1FB5A 2FN7A 2H4YA 4ZVLA 4JVSB 3CKLA 1G3UA 2OO5A 4QGAA 2G06A 2R96A 4ZQBA 1WUJS 3JSAA 3VHXA 3B6MA 3LGAA 3RUDA 2YMMA 3IMCA 4HEA6 4R3UC 3THYB 1KAQA 1CJSA 2RFLA 2GDJA 4DQVA 3TRHA 1U6IA 1CFZA 1EB8A 3W9SA 3KU4A 3SPXA 3FXAA 3UB3A 4BVGA 3LY8A 4DSOA 3PX7A 2WBLC 3E05A 4M76B 1C3VA 3PIRA 1JLSA 3WNVA 1JLHA 2JHAA 5HKBA 1G8KA 1KWGA 4RDHA 5ADWA 4QLOA 4WUTA 1PTJA 2VNJA 3WBJA 2O2IA 2CMKA 4OP1A 2ALJA 1CNEA 1DNPA 1NF3A 4PPGA 3ZGYA 4CKCA 3C48A 3LFTA 2MSKA 4JEMA 4RVHA 3E70C 1V8PA 4UM5A 1RRPA 4YCAA 5T5QA 3MRXA 1F48A 3KD3A 5FLKA 3MXTA 2XCLA 1ZFNA 1CJUC 2ZDHA 4Q3EA 4V0NA 1JKFA 2PL3A 5FL7D 2ONZA 3ETHA 4TLLB 5LXTF 2C0CA 4MMXB 1TKRA 1AGYA 1MX5A 5BQOA 1MGOA 3F5SA 4H1UA 4CM3A 4KPEC 1MIOA 3M1AA 4J4TA 2Z3ZA 4OV6B 4ND5A 2F8LA 1R4NB 3IUPA 5BSHA 1RYNA 2WUDA 3RT7A 1GKKA 3F6RA 3CW8X 2CWWA 1LX6A 3IB3A 4P5PA 2VKTA 1X86B 2WJIA 1XMSA 3LVQE 4ZV9A 4ZO4A 4D4MA 3JQAD 2WJ6A 3GGCA 4Y0NA 3W6ZA 4Z4QA 1N78A 4NH0A 3CEAA 3DONA 3IVGA 4KIUA 1AQLA 2FK8A 4I1YA 1FFYA 3DBLA 2J67A 5CXUA 3E1SA 1ZVMA 3JQRA 2QX9A 3AEUA 2YC4C 3THRA 2OYRA 4HS4A 4NBRA 2ID4A 4PR3A 2HRZA 5KYWB 3ESBA 3QM1A 4JXJA 1N2IA 2O0KA 2Z04A 3KHKA 4EHAA 5HBGA 4ZYLA 4XRRA 1Q95A 1G8FA 3EVEA 4O29A 3UJDA 1QDEA 4AD8A 3GLGE 2Z3WA 2Z08A 1GN8A 5AM0A 1W0JD 2X9LA 1YO6A 4NL4H 1H2HA 5KDDA 5TLSA 3DBIA 1IG0A 1Q83A 2ID7A 4FCVA 4KXNA 3L7MA 2PGOA 2GFHA 4YJ2B 5C2JB 1XBTA 4OUDA 2D2IA 5CT9A 1EJ0A 3AB7A 1JHOA 3PCRB 4O25A 1EVQA 4UCXA 1JPJA 1WVGA 3D9QX 4GP6A 4WFJA 3O82A 2XGMA 1AMNA 2CLKB 2CVZA 3DXFA 1VE6A 2FWIA 5CBKA 4O2AB 4F8YA 3IAAA 4UBNA 1ZK4A 3A0UA 3OQPA 2WD7B 3PENA 4HEJA 2WQZA 3GFPA 4ND2A 4GYJA 2F3RA 2WHEA 1N9KA 1CZHA 4L07A 4DMGA 4K1XA 2ZTMA 2GVDC 4RTKA 4P2BA 3R9KA 2WF6A 1FNBA 2QBYA 3B1KA 4PE5B 3W1WA 1O77A 3LPDA 4FI3C 1AMUA 4N48A 2DT5A 4O4HB 4JIGA 4MO2A 1YONA 1ADBA 3HDTA 3UAWA 3OCYA 4E2WA 3TL3A 2V7QD 2P5UA 4I9FA 3UT0A 3QVXA 4MKZA 1XTKA 4DM3A 1I2ZA 4HB0A 4TOIA 5HUJA 1A95A 3VH4A 2I80A 2CL0X 1RLMA 4ZODA 4BO8A 4A5OA 4BUZA 2DUMA 1D5CA 1VI6A 3MBOA 2MIIA 4XIJA 3B8HA 3C3CA 3WGJA 1XT6A 2JAWA 5BYAA 2ZTUA 3STTA 2J7PD 3OF2A 3PPVA 2OESA 3K73O 2QXYA 3LUGA 1VPWA 3IEUA 2PLRA 5AP9A 3UM9A 1ACMA 2C0PA 1P7YA 3MPOA 1SXGA 1ZOIA 2B9VA 2IEZA 3PLNA 3LC7O 4MW9A 5L53A 1W8DA 4HYQA 3U6KA 1RPZA 4F86A 4YMHA 3IMFA 1G7RA 1C7EA 2JCXA 2REQA 2HXGA 1J42A 1RBZA 2OAEA 3FM9A 1SC9A 3IUSA 3LTEA 4QNMA 1ZNQO 4CMEC 1LDMA 3FPAA 3AVUA 3QLUA 3IAEA 4DRZA 1O9BA 3QPUA 4R2LA 3BH7A 2GMWA 4YRMA 1XP8A 4KXUA 1NATA 1W73A 2VDQB 1LPAB 2VP5A 3FD8A 3HXLA 5D5PA 3GVXA 3EMDA 4N12A 1G16A 2X41A 1VKRA 2RHCA 1Y6FA 2XZPA 3PHIA 4JB2A 1ARZA 1FYVA 1G2IA 2ZM5A 2I7TA 4BN5A 3NX4A 1CDZA 1NRXA 1T6ZA 3E5RA 1J33A 3OO1A 1XWFA 3P0IA 2RJ3A 1JU4A 1PQYA 2ATIA 3CLTD 1GTG1 4BWYA 2WSYB 3B5IA 3ICPA 4QBIA 5BR8B 2WF9A 1EE1A 5AWFC 3T1QA 4PGFA 4HEQA 1JJ7A 2VJDA 1HQCA 1E5XA 4IHJA 1TA9A 5DBGA 1YCHA 2G83A 4TMFA 5JG7A 1ZBDA 1ZWKA 3DJFA 1LFDB 3ESYA 4EHKA 4IV8A 4AWBA 3THXB 1C1HA 1X9IA 4LI3X 2C2ZA 1MC1A 4IG9A 2ZQYA 4R2KA 4D46A 4LF6B 4M1OA 1YC5A 1C9DB 1E8NA 3KXPA 2YWGA 1ISMA 3LHKA 3PDUA 3U4IA 4YR7A 3AX6A 2IUSA 3RC9A 5CM8B 2FPXA 4X60A 4DZTA 4UDOA 5KU7A 1RLTA 3PQ7A 3N2ZB 1QM5A 1RQPA 1U2PA 3H1TA 1ZU4A 2XNHA 4MW6A 2BCJQ 2XUDA 4QU5A 1P33A 5ALDA 1KK0A 2ZI6A 3W8NA 1XD9A 1NULA 2HK6A 5FADA 1HZJA 3UATA 1TLLA 3MWJA 4LDZA 4FK8A 4E1BA 1E1RA 4NFHA 5JJBA 3OAAD 2AZMA 3D6HA 4YHBA 4DXAA 1YJ8A 1NVTA 1COWD 3LLCA 2P9CA 4PQRA 1WDWB 1OOEA 4WEOA 1SBQA 4TPKA 4ZARA 2IHKA 2ZPAA 5KSYA 2ODQA 1X7YB 1A4RA 4XPIA 1G1AA 2JFGA 3ROZA 1S5PA 1V8FA 2HNKA 2IYUA 2NZ2A 4BO7A 4CF3A 3DR5A 4LYFA 5JI2E 5CTJA 2QEQA 1CS0A 3BXFA 1AVTA 3EEIA 2E1PA 5E6SA 3V7WA 4ATNA 1QIHA 5ADVA 4LN1A 4Y0AA 5JALA 2IYYA 2Y1DA 2AN4A 2AW5A 4NYJQ 1EWKA 5C7LO 5KI6A 4UNPA 1JA0A 3ANMA 4UKDA 1ZONA 5E4JA 3ZBPA 1X19A 2VT6A 4RVNA 5B4UA 2OK8A 1VJTA 4BJ6A 5HKKD 1U9IA 1AN0A 2VWQA 3SC6A 3RU2A 4C43A 1PSDA 1QE0A 1GPUA 4ZA2A 5FNVB 5AVQA 1I7QB 1I24A 3MMPA 2ZU0C 3A32A 1U7PA 1FFDA 5HDBB 3UGTA 5KOJB 3F5QA 1EDEA 1GL3A 4M6WA 3TLAA 3I0ZA 2CVQA 2HLPA 4M8IA 2PZLA 5EMMA 3QENA 4V38A 3WDSA 2VHWA 3ZNPA 6REQA 3VNVA 4GMFA 3WLRA 1U1GA 1NDQA 4LDJA 1UBJS 1L8QA 2BR5A 5AKGA 3EVBA 3UWSA 1NVMB 1I7NA 2YN0A 1I5RA 1C7IA 1P0MA 1J2YA 2WG0A 3THWB 4ACAA 4FGJA 2QGNA 2DYKA 1G8AA 4WBSA 3WIUA 4TT8A 1KQPA 3TUJC 3BHJA 4O0LA 3TRIA 2ISQA 2A5DA 1UPUA 2FB9A 3FN4A 4LPKA 2N46A 1GAEO 3VH1A 3HWSA 4U2KA 1DUVG 4UAVA 2YFYA 1GTL1 3FUTA 3EIQA 3W9UA 1HFJA 2G08A 3Q3JB 1V45E 3S5JA 4GSKA 2WKWA 3QXJA 4AUNA 4OUKX 1JS1X 2NXJA 2ZETA 4OPMA 2D8AA 3PDIB 3CH7A 5C5IA 3R7FA 1A9SA 2Q07A 3DKRA 4RF3A 3G8CA 1MH9A 1FA9A 2GBFA 2OP1A 2WPDA 3QHQA 3R9IA 5H16A 4LK3A 3TIVA 5A3JA 1PEYA 3B6ZA 1I2AA 2WJ3A 1ACLA 4LC0A 4S1OA 2VDKB 1ORRA 3AZPA 1T5IA 1KIMA 1DCTA 1TL7C 3JARB 3DA8A 3NKLA 3MT8A 1WX1A 1TECE 1GKUB 4RF4A 4F5YA 1Z82A 1QHNA 4LECA 3HCEA 1AK9A 1RXSA 1XF1A 5LU8A 1I51A 1JEDA 2YW2A 2D5CA 3MHTA 3O84A 4OFBA 1KYWA 3SICE 3NTLA 4QOSA 5K0NA 3ZY2A 1JDNA 3PUXA 4YGYA 3S2GA 1ORIA 4KVFA 2E87A 3IVMA 4V0RA 1WPRA 4EI9A 4L16A 5FX2A 4ZO7A 1BXGB 1ILEA 1RHRA 1Y8RB 4B6EA 5KAMA 3UMJA 3NKVA 3GMIA 3D6UA 4BEBA 4YPVA 5U4QA 4LISA 1U0TA 3BXOA 1DBWA 1JIIA 4EBBA 3WLOA 3NWPA 4X8LA 1EX9A 2PXHA 3SAJA 2ZBGA 1NLYA 2C2KA 1BDMA 1V4VA 3M81A 1E4EB 3ABOB 3C8UA 3GT3A 5IYZF 2FGJA 3CKMA 4OXYA 1P9OA 2Q3LA 5EOVA 2IQIA 4ZVRA 2PFGA 1CUUA 4YP6A 3RVMA 3ZE7A 5U1PA 1MPXA 3RFFA 5KHLB 1WSWA 4Z4GA 3TLCA 4GRDA 3SYKA 4CIBA 4JYZA 3CLKA 2G1UA 3V5NA 4GH5A 4J0GA 2JFYA 1QV9A 1SELA 4LV8B 4XIFA 4XQGA 621PA 3R09A 1J06A 2R4UA 4DNOA 1MGPA 3OQ6A 2A0UA 2D5AA 4XCXA 2I4TA 4LJ9A 3KFLA 4QJ4A 1M6YA 3BOSA 1I94B 3AT1A 1LDNA 5FUWA 1OJLA 1SD5A 1EE9A 3CGWA 4EDFA 1OJ7A 3C7DB 3U13A 2OLKA 1E0JA 4C3UA 1H8HD 2C07A 4KE8A 1UOQA 5IPFA 1IOZA 2V3VA 5I5GA 4D3SA 2OSBA 3G0DA 4G0OA 3N1UA 1QC5A 2V6FA 1NXOA 4JKIA 1V96A 1XNGA 2FPWA 3K1JA 2VA9A 1RWWA 3CX7A 1NLUA 4U6NA 3CZQA 4D9KA 2XWQA 2LDXA 2UUPA 5K01A 4R8RA 3WBKA 2UXCB 3I58A 1M5TA 4BE7B 3PT9A 1YMQA 1CTQA 4DW8A 2F6RA 3P9ZA 2VP3A 4V3CA 1S02A 4EG1A 3EC7A 1H4TA 1ZMTA 4K05A 4IOKA 4E1VA 3IO5A 3A3KA 3LKVA 4ZHSA 2A2ZA 3N2GA 4L4XA 4LTMA 4FYPA 4XGKA 1UAAA 3VH2A 2Q2NA 1PZEA 2NU8A 1FFGA 1UMBA 3IEXA 2BGMA 1T15A 3S70A 1E9VA 3GJ6A 3NR2A 3U1VA 3ZI0A 1NWCA 2WMYA 4BJHB 4DR3B 3A1EA 3WQBA 1L3CA 4BQSA 2WABA 4NJOA 3LK6A 3K1AB 4QT4A 3AUKA 1EFRA 3NC4A 3SG0A 3M9WA 1CY1A 5BQXA 3NTOA 2ZS7A 1XZIA 1UBHS 4ZRMA 3TD6A 4BFZA 4JB3A 3BRWA 1UXHA 4BB5A 1O9GA 3FMGA 1O94C 1A9XB 2C8VA 3QE0A 4RHYA 3ZUGA 5FAKA 1GV1A 2ID8A 3EQZA 3KR1A 1X74A 4FLFA 4BVKA 3N0VA 5EZYB 4C03A 1MMFB 3T38A 5JQGA 2BH2A 2X1MA 5FLYA 4F5EA 1Y7IA 3U1TA 4Y2HA 5B3JA 1IPEA 4NBSA 3FB1A 3F6SA 2XNDD 4XSHA 3KTAA 2Q4BA 2ZKIA 4ZANA 3U09A 3TTXA 1Y7LA 3A28A 2XADA 2NACA 1O94A 3OMWA 1NBHA 4GLFA 4HR7A 4G5FA 1NJ5A 4HWTA 4NK4A 4GICA 3QPVA 1N8SA 2E4ZA 4CM4B 2CE7A 1H5QA 2A14A 3O9MA 4LMRA 1RAHA 5EJ8A 3L02A 3K94A 5CPFA 1BA2A 1A1SA 1KI4A 2BFEB 3UAGA 4DDVA 4LQCA 2R6R1 1T4CB 4QYIB 4YRAA 4UCQA 4W8OA 4CMKA 1KFBB 4GSLA 2FWPA 3O8NA 5F73A 5JS7A 2P2LA 3QXXA 5FPKA 5LKAA 1GU0A 5SZJA 3IS3A 3EC1A 3RAPR 1CR0A 2DBRA 3DV9A 4FFNA 5AHKA 1HR0B 1Z37A 3SD7A 2IPXA 3ESQA 4DDHA 1MTZA 2B6HA 4KN5A 4ZRNA 3QPAA 1TZ2A 1EGAA 1MT3A 3G8BA 1K5PA 3VBCA 2IZ7A 1ESZA 4C0BA 2Q3MA 2GAFA 3I2JA 5ALWA 4LXGA 3WO1A 2HU5A 2I4OA 4B2YA 2HU7A 5NLLA 2EP5A 3LWNA 1DQNA 2ZZMA 4KFCA 3LQRA 3AHHA 5HX7A 1R10A 3D6MA 4ZCRA 1UWKA 2Q1TA 3DNMA 1W2HA 1E7WA 4FFMA 4XQEA 2JLZA 3GAAA 3WGGA 1E2GA 4ZT2A 3EXHC 4XUDA 2NTVA 4PPFA 2VQSA 3M33A 2JIZD 1YI1A 3I6BA 4TSFA 5BSMA 3SJZA 3HB4X 2X15A 3I37X 3VM6A 4JL8A 4MS3B 2O4CA 5DGHA 3AF1A 1V8DA 4F6CA 1YVPA 1R18A 4B9EA 5FOVA 3EA0A 7ABPA 3SMQA 1FSGA 3FF4A 4F1JA 1L7RA 1NM5C 2SKEA 4QOIA 2Q9BA 1XMJA 2QLLA 1VKOA 1R5NA 4F8EA 3IKMB 3R8FA 1U94A 3TLGB 1PYGA 3CZMA 4RZHA 1T26A 2E3JA 3SOPA 1DBRA 2C5AA 4X93A 1SIWA 2G72A 1UPFA 3MJ4A 3MWDB 4WCVA 5KQGA 3OD5A 1ZPDA 5KS2A 2HY7A 5BMVB 4ZVPA 2POQX 2RGCA 1CIPA 3VR6A 1SA0B 4NULA 2BONA 1HL3A 1K86A 3L1KA 4DSTA 3N53A 1JDBB 4MYDA 4BKQA 4C0LA 2NVWA 4L5AA 4MULA 3IT0A 3QELA 2V7GA 4KK4A 1RMQA 3RF7A 4ESEA 2WQ6A 4I4TB 2ZRDA 4PG5A 3ME5A 3QA9A 4G2NA 4E4RA 1ULTA 5F3RA 3A26A 4KYTA 4AS3A 4TS4A 3L8EA 4JENA 3AP3A 2IF2A 1EWYA 1SC1A 5DGCA 3W2FA 1E2FA 4WN3A 2NO0A 3DMNA 3M1YA 1AZSC 2JI9A 2YZ2A