3T1VA

Mgla bound to gdp in p2(1) tetrameric arrangement
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
192
structure length
192
Chain Sequence
STINFANREINFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIGEVKGFKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gliding protein mglA
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 52
structure length 192
sequence length 192
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t1vA00
3FGNA 3DKPA 5KDDA 2PJZA 2BVNA 4L16A 1Z0KA 2GILA 1P2TA 1JQLB 4ZO4A 3X2SA 4LBVA 3CX8A 4HAXA 4D4MA 3ZLJA 3ZS8A 1G5RA 2CLDX 2H18A 1F48A 3QKSA 4KFUA 1LW7A 2C99A 3OIVA 5J4KA 1NG9A 3CRVA 4PO8A 4G5RA 4EAQA 2VP5A 1HY3A 3ZYCA 1LY1A 4TQAA 5SZHB 3TH5A 3U44A 5HCNA 3FE2A 5IF9A 2B8WA 3VX3A 2W00A 1GFIA 3B1VA 2X2EA 4LJ6A 1S8FA 4OHVA 4QBHA 5AWFC 5J40A 1E0JA 2WWWA 1QZXA 1KI1A 4A6XA 1COWA 5TB5A 1IY1A 4HYYA 1D9XA 3T1QA 5JS7A 5E7MA 2CXXA 4XVUA 3B78A 1N6RA 4EPVA 2VLIA 3L0PA 3WYAA 4EFNA 2YWFA 1IN8A 3B5JA 4FCVA 2OILA 2N46A 3NWJA 1TEVA 1LTQA 4D82A 1NBMD 3SOPA 2G0NA 5C4GB 4L15A 3B6EA 2GEDA 4PSVA 2VH5R 4A2PA 1EFUA 1PLLA 1J2JA 4OL0A 3ZQJA 2ZRMA 1TL7C 1X8LA 3K0EA 4QM6A 3CBQA 5KPJA 2V6JA 3QY0A 1CULC 2A3RA 1NN0A 2F43B 4I1OA 2A2ZA 1IN4A 4UQOA 4N1AA 2ZU6A 3WP1B 4QHYA 3K0CA 3C41J 1KI6B 1MKYA 4BLRA 4B6EA 2JLZA 1WBDA 1YU9A 4RZ3A 4TLCA 4TSFA 2YHSA 1E2GA 3HR8A 4DLRA 4DLSA 1OXTA 2OG2A 2A5JA 5AK0A 3X1DA 1KSJA 4BRUA 2AWNA 4EJSB 2OXRA 3AV0B 2C2HA 1OV4A 4JVSB 1XX6A 4KVAA 2J0SA 3RHFA 3LW7A 4LPKA 2ZREA 2EU8A 4PANA 2KBEA 4PAMA 2VHQA 5DI9A 5FPTA 5JWHA 1DAMA 1JECA 3LXRA 1XEWX 5AUNB 5KNCA 1IJEA 1DBSA 3GLFB 4TMWA 1WBBA 1AGRA 3B13B 3QBVA 4HUQA 1HYQA 3RVBA 2ZJOA 3W5JA 1G4AE 1RW4A 3BH0A 5HE8A 1XXHE 4DDUA 1XD9A 1KKMA 3I32A 2ZM5A 3IKJA 4MH0R 5HR5A 2PH1A 4Q7LA 2CHVA 1QVRA 2D06A 4FMCF 2REOA 1II0A 4RD0A 2EFGA 2VHCA 3KXKA 4Q21A 1G1MA 2HF8A 2P6UA 5DE3A 4DJTA 1EX7A 2DFKB 1G7CA 1P61B 1D2NA 4RVCA 1FL9A 821PA 1IXZA 2O8DB 5IDVA 4KFRA 1CR4A 2MSCB 4BFZA 3KJGA 3LRPA 1G8HA 4DCTA 2F1JA 5JBQA 2FFAA 1R8SA 5EE9A 3JZAA 4HZIA 3K8YA 4V0OA 1VYVA 1S3GA 5FOTA 2QMUA 2ZSFA 3GEHA 3AVVA 3IPXA 4OI2A 2ZI4A 4WXPA 4AKGA 1ZM2A 3KUDA 4NTZA 3WHKA 3ZIAA 3PIRA 1KI8A 1W48A 4IDPA 4V0ME 3RC8A 4G5OA 4PZYA 2KJQA 1L4YA 3W6OA 1E98A 2ASEA 2F1HA 3MUFA 4FCTA 1CR0A 4RD1A 1W36C 2FU5C 2QAGB 2WHXA 2ZI6A 3CNNA 4YLGA 3W90A 3ASYA 1TF5A 3FFBA 4GSYA 3A4LA 2G83A 3THXA 1UJ2A 2QQ0A 4R2IA 2J0UB 4AKHA 1GILA 2GXSA 2W83A 3F8TA 1TQ6A 2A30A 4XOIA 2D7CA 4TLEA 3QIAA 4KSCA 1JJ7A 1KZGB 1E32A 2BMEA 4Z8YA 2BJVA 3VMFA 4DCNA 3O8RA 4IOMA 4PHHA 1SGWA 3U6BA 3A36A 3B82A 2WWIA 1W4CA 3CNLA 3KXLA 3CF2A 5FL7D 3UPUA 1BMFD 1E9RA 4B43A 3AKEA 1GWNA 5LBIA 4DUGA 1XBTA 1XF9A 1WRBA 4D4LA 1FP6A 4L9WA 3T34A 1KI3A 2GJ9A 2PT5A 2OLJA 2JLRA 1G6OA 4RFSB 3D8BA 4TWZA 1BO6A 5EP4A 1UDXA 1P6XA 4WVFA 4D26A 5LDDC 3SQWA 4IOLA 3UMFA 5AJYA 1KI7A 4NH0A 4BE7B 1A2BA 2ZRKA 1KMQA 2VSXA 1ZM3A 2ZYTX 1DARA 4D2IA 5FOXA 3DEFA 2B6HA 2R6GA 2NOAA 1MRNA 1H65A 3EXAA 4LV8B 4UXIA 5L8VA 4C30A 3LLUA 1NLYA 3OESA 3LNCA 4IFEA 4KODA 4TTQA 3PXGA 1KY3A 2GF0A 2P5SA 4FMDF 3GCGA 1X86B 2MSEB 5GJWC 4UNRA 4ZV4A 1RRCA 1SKYB 3EA5A 2P6NA 1CR1A 4P33A 1E2NA 4B3BA 2R65A 1E9CA 3ADDA 1E2QA 3EWSA 2GVZC 2OFWA 1D5CA 1DOAA 4OYHA 5L3QB 3GLGA 4CIDA 2JASA 2YOGA 3DMDA 4XSGA 5EQTA 4HDQB 2HDNB 1U0LA 3QPVA 5FPSA 1OFHA 2HUPA 3EZ2A 4KLZA 5B2ZA 3RS5A 3LBIA 2QGNA 3QOFA 4IFBA 3VR2A 4NL4H 1FUUA 3TKLA 1E79A 1KI4A 2BKEA 2I4IA 2WIBA 4Q4JA 5EUMA 3SS8A 1OXVA 2AX4A 4OI0A 1G291 1AS2A 1NF3A 3CW2A 1UAAA 4TMVA 1JXOA 2GHIA 5J4VA 3WNDA 3U3OA 4LJ4A 2A9KA 3HYTA 1NIPA 2D3WA 3KKNA 2P65A 1RIFA 2ATXA 4RFVA 4UNPA 4BGDA 4MUBA 4FD2A 4II7A 1T4GA 4LBZA 5FBWB 1BS1A 3QXCA 2REBA 1H8EA 3BH7A 1PUIA 2CE2X 2UVQA 4H1VA 2HJVA 3LVQE 3AVXA 2ZVPX 5FBLB 1CJTC 3TR0A 3NXSA 2W58A 4G5SA 2IXEA 4TTRA 5F9HA 4MYUA 1T0HB 4M53A 1OH7A 1DE0A 1IQPA 1MRSA 3RAPR 1X3SA 5JJIA 1RZ3A 2ZAOA 4IVRA 2VP6A 2OUKA 1RYHA 1SKQA 2QPTA 5EJEA 3NG1A 4FXPA 2G1JA 1GRQA 5CM9C 3UMSA 1YZGA 2WWFA 4AI6A 1NVVR 4LV6A 1XCPA 2DWPA 3NDBB 5EE3A 5KSPA 4CZ2A 4HEJA 2IC5A 3GLHE 3KZ1E 1NI3A 1RRPA 2ODEA 4KU4A 3OAAD 3UG7A 5LD2C 2QQEA 1U0HC 2Q3FA 1ZMXA 3EWAA 1LVGA 3UIEA 3C14C 2CK3D 3HU3A 2GCOB 5BWMA 1P3JA 2IYSA 3GPLA 2IYZA 2VHJA 1G8GA 1GKUB 3AVOA 2C98A 2BHRA 2FSGA 1F6BA 1C4OA 2G77B 1XB2A 1FUKA 2HXYA 3CRQA 4M9SA 3H4MA 1IM2A 3B1WA 4WOPA 3A1UA 4KLNA 2IS6A 3T1TA 1J8MF 3QPUA 5FH9A 2GBLA 3GLIB 3BOSA 3PUZA 1PV4A 1Q1QA 2QPAA 3U6KA 1KI9A 4P31A 2EWVA 1JR3E 1E1RD 1NG1A 1W49A 3RWMB 2F43A 1KOFA 2RKOA 5K8IA 1NJGA 4ABYA 3UG6A 2ZE6A 2CCJA 2ZI3A 4G1UC 5B58C 1U98A 1VIAA 1KI6A 1IBRA 5JS8A 2B92A 2ZRNA 4AYWA 2AR7A 3MCAA 3LX8A 1X8JA 1QHHB 1ZC3A 4CT5A 5KTYA 1VYTA 2IF0A 1GIAA 1ZJ6A 2QG6A 1AN0A 2DB3A 4M0LA 3CPJB 4EJSA 4JLPA 2B7BA 1KJYA 3MD0A 5CK5A 1W0JD 3AF4A 3IIJA 2JEOA 3LBNA 4NDZA 2WWYA 3CH5A 3KJEA 4B32A 1KAGA 2WM9B 1ZCAA 4K46A 5EZ5A 3T35A 2LKCA 2IWRA 2OO7A 2ZR7A 4HAWA 1KDOA 1SXJD 3KDSE 4MYTA 4DDWA 1GZSA 2FG5A 4EIWA 4LCBA 1Q22A 1FX0B 2EWWA 3L43A 3L8YA 3ZZ0A 5F3WB 4AURA 3CZPA 1NVWQ 3GLFA 1R0YA 1G64A 3EZ7A 4JL5A 2JJ1D 2ZJBA 4KAXA 4GI7A 1Z83A 2C8VA 1CTQA 3L0OA 4RCZA 1OHHA 2IHYA 2AFIE 2OBLA 4Z51A 1BH2A 3NEJA 3EASA 1T5LA 4QHTA 2QROA 5SZJA 1A2KC 1NSTA 1VG1A 4GP6A 3I4LA 3VR1A 3O47A 4HB2A 4PC7A 1F5NA 1R0XA 1KO1A 1JR6A 2EW1A 4MUAA 2YINC 1Z29A 4X8MA 3B1XA 1CRQA 4W5WA 4MDFA 4DRZA 3KKOA 4JLBA 2JJ8A 2C5LA 4YQFA 1YR8A 4BUJA 3D7MA 2EYUA 1G7TA 1VG9B 2O8DA 1EX6A 1JBKA 3R9WA 4PSAA 5EP3A 1OF1A 3H84A 3I8SA 2GXQA 4PZZA 2XSZA 1GL9B 4UNQA 3EPLA 4JLOA 4CF7A 1AJEA 4Y0VA 2H7VA 2XGJA 3TR5A 1HE1C 3AF0A 4GBMA 3TIFA 3THYB 5BN4A 2ONJA 1G16A 1P9RA 1AQUA 1FTNA 4NCJA 5CJ2A 3WP0A 1KNQA 1UM8A 1ESNA 1KO7A 2A78A 3W6PA 2FPKA 3ICQB 4QGGA 2ZR0A 1QG2A 4M8NE 5TY0A 2QAGA 1T3SA 4A0RA 4LSGA 4C0QC 2JJ2A 4LX0A 1L7VC 3M0EA 4FCWA 2ZSDA 1S9DA 5L3RA 3N5CA 2JLQA 3Q5EA 5FPKA 1XD2A 5C18A 2DY1A 2J0UA 1MV5A 5FR2A 3GP8A 2Z6VA 1SVMA 1SVSA 4ZCIA 1RRGA 5JEDA 1JEDA 2RHDA 1E9EA 4HB0A 2W6IA 1JPNA 3EC2A 3HDTA 3WNBA 1DAKA 1E6CA 1Q0UA 3KKPA 4BRWA 2ODNA 2PCLA 3OF5A 3SC3A 1GSIA 1K5DA 1NVXQ 2HYIC 3I92A 1G3IA 3CRW1 4DB4A 4KYUA 3E70C 4TN1A 1ETUA 4EPXA 4M9ZA 4RKFA 3LW8A 4B2PA 4A15A 1A7JA 1HTWA 1XTQA 2JIZD 2Q3MA 3MWJA 4MRRA 4RFSA 4OBEA 4UKDA 2ZQ5A 4XJXA 2LKDA 2ZSBA 4O2RA 2QAJA 4QKQA 5JHHB 2F3RA 5DGXA 5P21A 4D25A 2WOJA 5FI0B 3U7EB 4A2WA 3N2EA 2GF9A 1VDZA 2H17A 4OK3A 1E99A 4NYIQ 5JSZB 2ZPTX 1OKKA 1P4SA 3BS4A 4LHYA 4OK6A 2Q9CA 3DKVA 1IN5A 1R4AA 2QM8A 2WPDD 4BZQA 1KDTA 3RRZA 3FVQA 4X8LA 1G41A 3CF6R 3TNFA 3ZH9B 1OXUA 1E9BA 2ERXA 4BQSA 5IK2D 2WJIA 2YC2C 2BBWA 3GEEA 3VU9B 3L2OB 5EZ6B 5L3QA 2D62A 3P20A 1VCMA 3UATA 4OHWA 2ZSEA 4WZ6A 4PAOA 2WJHA 4Q4AB 4JKYA 4LGMA 4US0R 4X8HA 1OFTA 1R0ZA 2R9VA 1TX4B 2AKYA 5UKDA 4DC9A 4D4JA 1OB5A 2FF7A 1OLOA 4KO8A 4DEXA 3B1ZA 3RRNA 2IXFA 4XH9B 3FB4A 1ZD8A 2NO7A 2VP9A 4GMXA 1G9XA 2ZI9A 3W5IA 2FE4A 2WAXA 1U81A 3LQQA 4CW7A 1G5PA 2QBYB 1T3HA 3A1SA 2QMEA 2V6IA 2BBOA 2V9PA 4M21A 4IEEA 5EP2A 2F7SA 4N0EA 1KMHB 8OHMA 1NSFA 4JBWA 2VEDA 3NKVA 1T9HA 1M1YE 3WYGA 1XEWY 5TARA 1GTVA 1N6HA 3IILA 1F2UB 2GK7A 4QHSA 1XFAA 4PO9A 1D2MA 3QXJA 1WQ1R 3RS3A 4EPRA 3DM9B 2QP3A 1ZAKA 2ECKA 4BPBA 4LJYA 2AD5A 4U02A 3W34A 1SVWA 3SJBA 2ODWA 4ZI3A 2QMOA 4PQFA 1K5GA 2QENA 3K53A 2WICA 2QE7A 3GLGE 1ZBDA 1E2KA 4NBSA 4TT3A 5FOSA 1T5IA 2JLSA 5FTKA 3CF0A 3BB3A 3QXSA 4ERNA 3MGCA 5FOUA 4ASUD 1OW3B 2Z43A 4CEIB 3W9YA 5A0FA 3ADBA 1U90A 1AKEA 1CU1A 1E2EA 5JFGA 5J4LA 3PVSA 1TF2A 1WB9A 2GTPA 3R7WB 3QEOA 1JEEA 4NU0A 1QG4A 2GAOA 3G82C 1E9DA 1KJZA 1P62B 1YZUA 1GDDA 4TTPA 3THWB 1NP6A 1SVKA 3LD9A 1KDRA 2IYWA 2Y8EA 3FHTA 4JJZA 4ACBA 3QF7A 5BQ5A 2J3EA 3KQUA 4A8JC 4NHOA 1MT0A 4G3XA 3EARA 1E2DA 5CJPA 4EUNA 4POAA 5B57C 5BN3A 3OEHD 3UKDA 5CB8A 5FUYA 3REFA 4EJSC 3B7GA 4W7SA 5DN6D 1SVLA 3Q5DA 4FW9A 2FGJA 2V1UA 3C5HA 2FH5B 1X8KA 1GKIA 1AQYA 2ZITA 4HUTA 1DAEA 4RZUA 4Q01A 1JR3A 3GLIA 2F6RA 1KNXA 3CWZA 1G3UA 3DDCA 4GOJA 4H9GA 1W2GA 2VF7A 3FPAA 4OKSA 2C95A 4B44A 4B3GA 2IUTA 3RC3A 3W8NA 3BB1A 2AL7A 3AEZA 5AJVB 3GMTA 4V0LA 2FOLA 3KL4A 3AGPA 4ZDIA 2O8EB 1QHHA 1DAIA 1E2IA 5H8WA 4GMDA 3NBFA 2VP4A 4RKEA 1DG1G 1KY2A 2IYTA 2BJWA 4MKIA 3TSOA 2CDNA 4UXJA 4C0JA 3I61A 4HB3A 2J7PD 4TYNA 2IT1A 2DHRA 4PPGA 2WSSD 1TADA 4XD7A 3Q85A 1W4AA 4KFTA 1ELOA 5KYKA 4C0KA 3UANA 4D0LB 1ZM7A 2XOKD 1KO5A 4CRWB 3TW4A 1VPLA 2ZUDA 4P32A 3J81k 4DLWA 4U00A 1AM4D 1FX0A 1EGAA 1VIYA 2HT6A 3BBPA 1E0SA 4S35A 2NO0A 4GT1A 1F60A 4BLOA 3RS0A 3RWOA 1KJWA 2WOOA 3ADCA 3AKDA 2HLDD 2FA9A 1DG3A 1ESMA 4BZPA 3LH5A 1HT1E 2FSFA 2VL7A 3IIKA 1WP9A 4N0DA 2PX3A 1YRAA 2Q0HA 2P3SA 4CEHA 2G3YA 2J59A 2B21A 4OHZA 3P27A 5CLQA 5J47A 5KO2A 3ECCA 4A8JB 4JSTA 5FFMA 3DOEA 2V4ZA 4LJ9A 3A6PC 3AVYA 2QAGC 2RHMA 3A1VA 1AA9A 5SZKB 1Z6TA 1S2MA 2QPOA 2XJ4A 3RSLA 2G0TA 2H1LA 1N6LA 1R5BA 2VSOA 4C0HA 2ZRPA 4RD4A 1X1SA 1D2EA 1TMKA 3MWKA 3NTUA 4F93B 1YVDA 5LB2A 1CRPA 1DAGA 2LCFA 3THYA 1D8TA 2PEZA 2GEUA 1EFRD 1UKYA 4HB4A 1ZNWA 2J0VA 2ZE8A 2HEIA 2GJAA 4RJLA 2GETA 4XVQA 1XU4A 4L5BA 2ZAMA 3AVTA 4KXFB 2V8OA 2ZSAA 2FGKA 1AZTA 4F7WA 1T91A 2OE2A 2PEYA 3CRMA 2B8TA 3GLFE 3RS2A 2KB0A 5JHGB 4QJ4A 3PUYA 2NO1A 1ZM4A 2RGNC 3K9NA 4TL7A 4I81A 2D4HA 2OAQ1 2IW3A 1XTKA 621PA 2QORA 3LFUA 2JLYA 1XTRA 5CYOA 1N6OA 4B71A 1M34E 2QTFA 3FKSD 4LHZA 2J41A 3PEUA 4NONA 2MMCA 1N0VC 1OFIA 1Q1BA 4TQ9A 4QXAA 1YZQA 1MABA 1P5ZB 4KBGA 2IS4A 4A92A 2PLFA 4GNKA 1KK2A 4JZKA 1IOZA 4Q9HA 2W0MA 2FMXA 5FR1A 2OCYC 4Z54A 1UBEA 4Q00A 1YJ5A 2NMVA 4HLDA 5LPNA 2WBLC 3KJIA 1IN6A 1JQJC 1Z6AA 3UK6A 4B3FX 2RGDA 3EPHA 3RRYA 2ZI5A 5FUXA 3MWLA 3IEVA 1EESA 1NL3A 3EZ6A 1IY2A 4Q4LA 4RZXA 4GRAA 4EFMA 2W6JD 3JVVA 2WZQA 3TUJC 4YXWD 4BFXA 5EE1A 1QHYA 3TSWA 2PMKA 1P75A 2P0EA 1FFHA 2NIPA 5DIFA 2PZEA 1E0KA 3I3SR 4Q18A 1OYYA 1ZU4A 4WW0A 1GNRA 5EXSA 2J9RA 3OFND 4S2EA 3W8RA 2OCBA 2BDTA 4NP6A 5E7JA 5HKKD 1G17A 2BWJA 1JXMA 4ZKEA 4B48A 5JRZA 1IHUA 3VU9A 5FL3A 4MQBA 2IYRA 5KDLA 2AFHE 4W5JA 1OJLA 2UZIR 2XNDA 4URXR 1SZPA 2O0HA 3AVPA 2ORIA 1XMSA 4IDHA 4Q4AA 3VR3A 1U8ZA 3LX5A 4DDVA 2YKGA 2O8CB 4ON9A 3OIYA 1P7CA 3T1VA 4Q1DA 1AS0A 1LNZA 1R7RA 3FMPB 1NVVQ 3EIHA 5KHOC 2OFXA 1QVAA 3OE7D 4C0BA 4O3MA 4MGYR 3EPJA 4P3YA 2OEPA 2DCUA 3U7HB 4ZCLA 3SHFA 2QBYA 1Z6YA 1R2QA 3PUWA 3M4YA 3W3AA 4NYMQ 2NTYC 3GJ6A 1R6BX 3QXXA 4MITA 5KSOA 2ZYUX 4YMUA 1XTSA 1KMHA 4DSUA 3IQXA 5GVSA 2Z4RA 4CVNA 2IK8A 5IRCD 2R6CA 4TLDA 4IDNA 4LBWA 1Z06A 1MO4A 2REXB 5AUOB 3A4NA 2HV8A 4OQLA 2QP9X 5E95A 3R20A 2KE5A 1SVIA 4TYQA 5HPYB 1SVOA 1KDPA 1Q1ZA 4QNRA 3SYKA 3AVUA 1V5WA 1T3LA 2W2XA 1YZNA 2QA5A 4LBYA 1M7GA 3PCRB 1W36D 5TVKA 2J5XA 3KJHA 1SKYE 3MWYW 2IEZA 3EZ9A 3TQFA 4LPSA 1U8AA 3BIFA 1ZUNB 2GVDC 2IYUA 3CZQA 4RY2A 1IAQA 1Q57A 3T5GA 1YE8A 5AJZA 3U7FB 4AG5A 2PL3A 4URYR 5FPHA 2YWHA 4TZ6A 4LY6A 3VAAA 2V7QA 3T61A 2X8AA 1Z0DA 2CEAA 3H2YA 5JJKA 3L0SA 3P26A 1H8HD 4CEIA 6Q21A 2R6DA 2QZ4A 1U2RA 4D0NA 3V00A 3NHBA 4BFUA 3R7WA 2J87A 1G3MA 4LRWA 2E1RA 3U2QA 1E94E 2DFLA 4Q9IA 4DCSA 5H70A 5IHPA 3THWA 1O3YA 4ZDJA 3C8UA 1ZIPA 1IJFA 4Q1AA 3X1YA 2C77A 4B47A 3GJ5A 2GEVA 1J99A 5D3MB 1DADA 2P2LA 5K8UA 3B9QA 1OT3A 3EW9A 4PAQA 3V4RA 3C15C 3KX2A 3IDQA 4WZBE 1YR6A 5JRJA 3K9HA 4EPWA 4G5GA 4GPTA 2NGRA 2YNMA 5E4FA 3V4FA 1W0KA 1OIVA 4EFLA 5GJCA 4LDJA 5KPDA 1KTVA 4N3NA 1WF3A 2JDID 2RGBA 3CO5A 5DI3A 3RLFA 4LI0A 3AF2A 2IXGA 1M7HA 2VIIA 3U4QB 4UXHA 1NJFA 3X1ZA 3OEEA 4Q4HB 4BFVA 1II8B 5B30A 4I99A 1G19A 3SHWA 1E9SA 2GZHA 1VYUA 3K1JA 1M8PA 4M9QA 4QGFA 1QHXA 1TEXA 4AD8A 1NMYA 1XDBA 4HSEA 1VKJA 2JATA 3K0AB 2O8EA 1OXXK 1OSNA 2XXAB 1Z0FA 4O0MA 4I1UA 4JL6A 2AN9A 4D81A 3EG5A 2CHQA 4LYAA 3LA6A 4A1FA 4F38A 1T8TA 4URZR 4AYXA 4MA4A 1E69A 2CMKA 2CNWD 1XTIA 1FNNA 3PITA 1IXSB 3CONA 2IS2A 1E2HA 2OESA 3QSYA 2C04A 2RCNA 5DISB 4TL9A 3MJHA 2GNOA 2ZRCA 1XJ0A 2GJ8A 2ZEJA 3Q8XB 4HLUA 4Z1MA 5G3ZA 3TSZA 1N5JA 5BYKA 4BEJA 1BOFA 1HQYE 4JMPA 4M1YA 4U5XA 3QKUA 2RGCA 2GDJA 2CL6X 3VKWA 2GXUA 2NO9A 2BOVA 5G53C 2OZEA 3GLIE 1NNEA 1AZSC 2R6FA 1GAJA 2DFNA 2HF9A 5KNBA 1ZNYA 1COWD 1HUQA 3M1IA 4URWR 2IUUA 3VR6A 5J4YA 3B85A 1XZQA 3DHWC 3L0IB 4A8JA 5KU1A 3AUXA 1CJKC 4M1WA 3H1TA 2BMJA 3LXXA 4EPTA 1CXZA 1A5TA 2YC4C 4LJ8A 2J45A 3KQHA 3L82B 2C9CA 1EK0A 2RGXA 4FI3C 3ADKA 2F55A 5HTKA 2O0JA 1C9KA 4O25A 3VHXA 1IY0A 4A0GA 1Z08A 2Q21A 4QGHA 2FFHA 4A9AA 2VA8A 5IT5A 5JZVA 4WIAA 4LK2A 3ZD7A 1NBMA 3KQNA 2F9LA 2XZLA 4URVR 2KSQA 3HWSA 3KB1A 4LC0A 3U44B 3GFTA 4GL2A 2GKSA 5JLJA 1PLJA 3CKLA 4TSFD 3BRWD 3ND8A 4L9SA 3UWKA 2V54A 2OBNA 3WRXC 1OPXA 4YONB 1SHZA 2VF8A 3B60A 4Q9LA 2CVFA 3FFAA 4Q48A 4B74A 1EFHA 4DLTA 1TPZA 4P4UA 3DOFA 3E1SA 3SDZA 1TU3A 5DYGA 2ZRAA 5CM8B 4TYPA 4LJAA 2QU8A 4UNSA 2GWHA 4A82A 3CWQA 4PZLA 3RS4A 2YYZA 5EE5B 1IXRC 1Z07A 1Q12A 2EQBA 1QHGA 3SZRA 4AYTA 3N2IA 1OFUX 5FUVA 4ESVA 2FJUA 4MGZR 2CCKA 4YMVA 5M04A 4JLJA 5E7IA 1SXJB 5JMTA 2WJYA 4PPNA 1M74A 2ZU0C 1TTTA 1GL7A 1J7KA 2UKDA 1M6NA 3R9XA 1G3QA 3CPHA 4A0HA 4Q5IA 4DLXA 2D74A 4RCYA 5GJBA 1G8PA 2P67A 3BH6A 4AC9A 4DWJA 1Z28A 4MYHA 3TRFA 5AJXA 1RVDA 3TBKA 1L2TA 2C9YA 2EFEB 4HAVA 3U5ZB 1S1CA 2VHUA 4IW3B 2ZROA 4RD6A 2YZ2A 2QSYA 3T5DA 3IEUA 1KSHA 1ZC4A 2FEMA 3Q72A 5FBQB 2VTKA 4DSOA 2QMHA 2ZUCA 4GZMA 3IO5A 4KV9A 1E2LA 3SYNA 1KIMA 4BZXA 3RRMA 3C7KA 5KDOA 1W5SA 4D4KA 4PXAA 2R62A 1M7BA 3SR0A 1R5NA 5H1YA 4TLAA 3GJXC 4R7ZA 2VO1A 3DPUA 3G5UA 2JGNA 2FPMA 3LBHA 4JBYA 4HZUB 1Z2AA 4RSGA 1OH5A 3ZIAD 2WKRA 3K70D 3M6AA 2O8CA 3ICEA 2G1KA 4Q7MB 1Y63A 1N2CE 1VCIA 4UJ5A 2RGEA 1QBKC 5DO9A 3I1FA 1JAIA 1JB1A 4KFSA 4PPFA 1E2FA 4BLQA 4Q47A 1AK2A 2RGNA 4Q9JA 3KXIA 5L3SB 3ASZA 4BASA 3NH6A 1VCNA 2RB4A 3FHCB 4NYJR 3Q7QA 2WKQA 1B0UA 2OCAA 3CUEF 4P0TA 5C1BA 3U3KA 4DT1B 1CKEA 4DVGA 1SULA 3HPQA 1KK3A 1X6VA 4MGKR 1NVUQ 2BMDA 2J7KA 1ZD1A 2AXNA 3I73A 4C0LA 2ZJ8A 3ZD6A 2HJGA 1HURA 4H1UA 4LJ7A 2E9SA 1XPUA 4DIDA 1G3RA 4V03A 3PJRA 1ZRHA 3CB4A 3ZQ6A 4F4IA 2IYXA 3Q9LA 2CLCX 5C4MA 3CM0A 1WDTA 1GKYA 2QN6A 4OI1A 1C1YA 1VG0B 3PQCA 4LYJA 5KSYA 4IRUB 4BECA 4EQ6B 5FL7A 2EFCB 2KWIA 3IIMA 1NY5A 1BMFA 3MJRA 3K70B 1CEEA 3T12A 3AP2A 5DLQC 2IYQA 4OJKA 4BFTA 3PUXA 3THXB 2QY9A 3KKMA 4YMWA 2FV8A 2BKUA 2OHFA 2J46A 3I5XA 1ZUIA 5FBRB 3A1WA 4EDHA 1GRRA 1TNDA 1I4LD 2R8RA 4QM7A 5FI1B 1RJ9B 2OBMA 3AF3A 3GQBA 2A5DA 3QEJA 1ZNZA 1KGDA 2JCSA 3TAHA 3FHOA 4YMSA 4PHGA 3ZS9A 1BYIA 1XMIA 3MFYA 4CT4B 4DLYA 4XWAA 1YHNA 4P4TA 1EXMA 1KK1A 1Q3HA 3CR8A 1Z22A 3F3YA 5D3MA 2FWRA 2P5TB 4D6PA 2QUZA 1UBFA 2PLRA 1MH1A 2BIFA 3TE6A 3VNVA 2ZRLA 4GFDA 4IOKA 4B6FA 3HP1A 4C2UA 5TXGA 2PCJA 3QJYA 2AK3A 2Z83A 3QPWA 4MYCA 3EA0A 1LFDB 1OXSC 3SJZA 5KNDA 4QJ3A 2AD1A 5JWOA 5G40A 1E79D 4DIEA 4Q7KA 4GOXA 5BXQC 4QBFA 2VQSA 4AG6A 4DSNA 2DFTA 3LO5A 1MO3A 3MSXA 2NZJA 4TMKA 1XTJA 3TUIC 3U4QA 1N25A 4M1MA 3I5YA 2WJVA 5G41A 2X77A 1II8A 3BB4A 4CEJB 4QBGB 3KFVA 5CIWA 4HLUC 1DAHA 3NC1C 3H0KA 4RZ2A 3NIBA 4ZKDA 3BWDD 1XMVA 3FKQA 5EXXA 4C3ZA 5AUPB 2A5FA 1H8ED 3GJ8A 1EG7A 2XXAA 2WV9A 3EIEA 1XPOA 1LS6A 3L8ZA 4F4JA 1E0AA 1Q44A 1N6PA 2V55B 3KQLA 3AGQA 5CDFE 4W5HA 1JAHA 2ANBA 1II9A 1TQ2A 5CYPA 2QRNA 2ZYWX 3HPRA 1E9FA 1N5KA 2F3TA 4JVMA 3U3RA 4KHZA 5E3HA 3W6NA 1YR9A 1HA3A 1DO2A 3PV0A 4Q7JB 1VHTA 4CYMA 4FIDA 3N70A 4B3XA 4C0AC 3VX4A 4C7OB 1D6JA 2QL6A 2GCOA 1G21E 2OT3B 2AKAB 4DHEA 4LHVA 1IONA 4R9UC 4V0NA 1UEIA 4BLSA 4PC3A 5CLLA 3CRRA 1W1WA 3NVAA 1ZD9A 2O8FB 4QNMA 5DNYB 3ONWA 1N3BA 2ZR9A 4HATA 3QNUA 4M1KA 3Q3JB 4GOKA 2ZRFA 3SFVA 1DO0A 2AHOA 2BMFA 1S9HA 1O87A 2QSZA 2ZRGA 5LB4A 4MKFA 4NYIR 421PA 4HAZA 3A8TA 4AKEA 4TL8A 4WBSA 5HZKA 3EAQA 2ORVA 3IBGA 1FMLA 1DVRA 3QG1A 5JECA 1E96A 1RYFA 4DEYA 4F91B 3CX6A 4DSTA 1Z63A 3NBZC 4LJ5A 3TLXA 4B73A 3AKYA 3RS7A 3OAAA 4MKGA 4QC2A 2ZETA 2O0KA 2O5VA 4C9BA 2FFBA 1LF0A 1GP2A 1GRNA 4HAYA 5ELXA 1UBGA 2CK3A 4XVRA 2FPLA 1ZVQA 3NH9A 4DKXA 1OIXA 5KUTA 2WVJA 2O8BB 1G5TA 1X1RA 2XZOA 1OIWA 2FEOA 3F0TA 1NMXA 4B3CA 3BFXA 3QF4B 2H16A 2QEQA 2R44A 1QHNA 2ZJAA 5GVRA 1ZYUA 2J1LA 3QKRB 4FMBB 1N6KA 2JLUA 1S3SA 2C78A 1E1RA 3QI2A 1N5IA 3W3ZB 3SU8A 3DMNA 3D31A 3WYFA 5JCPA 3CLVA 4ESHA 2CL7X 4JJKA 1EFTA 3C5CA 2ZJ2A 3LVRE 3A58B 4GP7A 1ONBA 1Z6XA 2FX3A 5AJWA 4B75A 2J0QA 4LHWA 2IL1A 3GFPA 3UWOA 1A4RA 5F98A 4LWZA 2XB2A 1KYIA 4OJQA 3LWNA 1KO4A 3GJ0A 2NPFA 1UF9A 2XEXA 3BORA 4KYIB 1S96A 1W0JA 2DPXA 3ZVRA 2CL0X 2FN4A 4PC6A 3PR1A 4QG7A 2HXSA 3AH8A 3ZVNA 2ZYVX 2E87A 2PX0A 3EIQA 3QXHA 4IDOA 2WTUA 3O8BA 5FTLA 3WNCA 2GZAA 1OHHD 1SXJA 3PENA 4LUCA 1RFLA 4PC2A 4B2LA 3VKGA 4D0GA 2G88A 3SBDA 2ZJ5A 3RANA 4NPHA 2H57A 2VHTA 4MDEA 2JJ1A 1NBME 2NPIA 2Q9BA 4US1R 1Z47A 4WXRA 2PJRA 1CJMA 3QUSA 4XWOA 1JPJA 1FNMA 2ZE7A 5HCIA 3TQCA 4PPQA 5FOWA 1ODFA 1MO6A 5FBVB 3FTQA 2AK2A 3VKHA 2ZI7A 3NBXX 3WMEA 5CB6A 2X2FA 4US2R 2XX3A 4FWIB 1G6HA 1XD8A 2XSZD 4JLAA 3X1XA 2IF2A 3BE4A 1GG2A 2VRWA 1EWRA 4A36A 4BFSA 1A1VA 5DHFA 1GUAA 1R10A 1F2TB 5HE9A 4A4DA 3CNOA 3EZFA 1MO5A 1XXHB 3IPYA 2FSHA 1RPZA 1G4UR 2V3CC 4HZUA 3S1AB 1E1QD 5A5GA 2WKPA 2YWGA 4LYHA 3TVDA 1G7SA 1W44A 2KI5A 1YR7A 3GEIA 4P4SB 1G20E 2ATVA 2DYKA 2JJ2D 3VFDA 3QENA 4EPYA 1CJVC 2GAAA 2PMDA 2QI9C 2DWQA 5L3SA 4U7DA 3FOZA 4BFYA 2ONKA 4I1SA 4LYFA 3SJAA 4TMXA 4JYBA 5JSZA 4M1OA 4DT1A 2W6ID 5K8LA 3VR4A 4OHYA 1CS4C 4PR0A 4NCKA 2IYYA 1KK0A 5CK4A 4A6PA 4Y0AA 1E2PA 4DZZA 3I62A 1XZPA 5FTNA 1FPMA 2QT0A 2DR3A 4BEBA 3LAWA 1LF5A 2ZVQX 3BJIC 3OIUA 1G8YA 4QJ5A 5DHAA 2IS1A 4KCGA 2OM2A 1CBUA 3BC1A 3TMKA 2RMKA 4QFMA 4EQ6A 1KSFX 2YOFA 3E2IA 1UKVY 1YRBA 3SI7A 3FMIA 5FTJA 1TAGA 3DVLA 3UXMA 4Q1CA 1R0WA 1HEIA 1OKKD 3UMRA 2ZRDA 2K5UA 1I2DA 2JIZA 1XD2B 4FN5A 4KJZA 2X19A 521PA 2CBZA 4Q19A 3SE0A 4IVQA 3KTAB 1KO8A 5JJLA 1RJ9A 1XJCA 2YWEA 5FTMA 2VYFA 3LLMA 4JVNA 5JI3E 3SQXA 2BCJQ 1K6MA 2LWIA 4PX9A 3B1YA 3BGWA 4C0SA 2WPDA 1ZIOA 1BYUA 5SZIA 2FNAA 2ZJZA 2ZS7A 1U9IA 3D6TB 4FINA 2L0XA 2OCPA 1F2UA 2JLXA 4V0KA 2D2FA 3WMFA 3CIOA 3HYRA 5IK2A 4E09A 3PEWA 5DSZA 3KUCA 2G6BA 1DS6A 1XRJA 4EKDA 1UEJA 4ITRC 4JT2A 1A82A 3QVVA 3VHLB 2I1QA 2ZRJA 3LV8A 4NCHA 1T0JB 4J0QA 1GVNB 3WY9A 2RGGA 1W5TA 4JLDA 2IHBA 3A1TA 3ZVLA 4G0NA 1WCV1 1WA5A 1Q20A 4MRNA 1UADA 2A5YB 3BERA 5K8TA 2D7DA 1BIFA 2R2AA 3D3QA 3U3JA 1SQ5A 4CEJA 3A37A 4JLNA 4KVGA 1LS1A 1I2MA 2BM0A 4URUR 2Z0MA 3QKTA 1VHLA 1RRFA 2AWOA 1VMAA 2OXCA 3MLEA 4O2LA 2RGAA 2OFOA 4Z8XA 2H92A 5CDFA 1U99A 4NZYA 2QM7A 4L4UA 4AY2A 2EFDB 4PHTA 4UNNA 2CJWB 3R8CA 1KHTA 3PUVA 4OQFA 1FQKA 2BM1A 4PC1A 1J70A 1DPFA 3TW8B 4B34A 4C4PA 1PJRA 2EFHB 5D3QA 1P2UA 3GJ4A 4KBFA 3WHLA 2QE7D 4E07A 1P60A 3U3MA 4DDTA 4TT3D 3X1WA 4M2LA 1HE8B 2WIAA 2X1VA 3CH4B 1W36B 4C7OA 4JLVA 4PHFA 3EC1A 4YDHB 4BWYA 4GZLA 4JL8A 4AIIA 3MG9A 3NBYC 5C46F 4B3DA 2QRZA 2G9NA 1VCOA 3QQ5A 4XTCS 4DCVA 4PTLA 3OZXA 3T15A 2O8FA 1E2JA 1FZQA 1FTSA 2ANCA 1XP8A 3NDPA 4YDSA 2ORWA 1XEXB 4NKRA 3VQTA 4AWXA 4WAUA 1Z3IX 3WBKA 4ASUA 4IVPA 1VTKA 1SHKA 5L3VA 4DB2A 4BFWA 4ARZB 3I8XA 2CLSA 2GCPA 1ZINA 1RE0A 1Z0JA 2XTNA 4M22A 2C9OA 3SBEA 1WMSA 1W46A 2GJKA 1NLZA 3B8HA 4PQYA 3ZZUA 4ZPXA 4JYCA 3DO6A 4HAUA 1G18A 2HCJB 1M2OB 2C96A 2ZE5A 3BD9A 2GXAA 3QBTA 2WWHA 1JALA 4TMTA 3AQ4A 1XWIA 2FFQA 3SFZA 3CPEA 1PLKA 4E5UA 1YZKA 2JLWA 2JLVA 2Z5FA 4OHXA 3OEHA 3RDPA 3IO3A 1JR3D 2YJTD 1OB2A 4PQRA 4Q02A 5DN6A 2F1RA 2VP2A 1YQTA 2O8BA 3VTKA 4E22A 4F4CA 3P4XA 4XSHA 1US8B 3KB2A 3ZJYA 1PVOA 3QF4A 1QDEA 2WMNB 3AF1A 3Q7PA 5C2JB 2ZTSA 1S0UA 3QKRA 3GLHB 4FMCB 5EE0A 5EP1A 5EXPA 4AKIA 4NCNA 4LZZA 3REGA 3V9PA 2EYQA 3WXMA 3IBYA 1NN1A 4JBXA 1SXJC 5DH9A 4A0FA 4D80A 3K0CC 2QP4A 1NN3A 1Z8FA 2BBSA 4NYMR 4DBLC 1MOZA 1KI2A 3GD7A 5TV2A 2PZFA 1D9ZA 3HU2A 3SYLA 1U0JA 3VR5A 1P9WA 5CIQA 1I4DD 2VSFA 3QVUA 1E4VA 3PEYA 3MAAC 1NN5A 4XD7D 2XTZA 4ZIRB 1CF4A 2VPPA 1W4RA 4JT4A 5EUQB 4YC7A 1K8RA 2O52A 121PA 1TUEA 2JAQA 1OYWA 3OHMA 3SJCA 3IQWA 1HQCA 2J7PA 1AS3A 1S4QA 2NO6A 3P4YA 1UFQA 2Q9AA 4CGZA 3K0FB 2WSSA 4OI4A 1P73A 2ZRBA 4PSKA 2YV5A 4R71A 4IKEA 1S1MA 3THOA 1N5LA 4BLPA 2NG1A 2XOKA 3K09A 5HZHA 3QKSB 4B35A 1QF9A 3U61B 2IBMA 4DXAA 3A4MA 3ZZTA 1Q1EA 4BLTA 4NYJQ 3CR7A 1ZNXA 1N6IA 1Z5ZA 2GK6A 2ZIAA 3IHLA 3FYHA 2GJSA 1ZU5A 3GFOA 4HLQB 2F9MA 3B2EA 5JCZA 4KSBA 2FZ4A 2HLDA 1QHSA 1FW6A 1QRAA 2NQ2C 2UZ3A 1T8UA 2FDCA 1UKEA 3BFKA 5J4HA 3R8FA 2N1BA 4HDCA 2FSIA 5BYJA 2A7QA 3QE0A 1OH6A 3PFIA 1W7AA 4FWTA 2WSMA 2TMKA 1EFCA 3RYTC 1J90A 1PUJA 2EVWX 2C03A 2XZPA 3BXZA 4QBIA 1DELA 3C4JA 1P2SA 4IJMA 3ZDQA 1WXQA 2ZS9A 4PO1A 2GCNA 2QGZA 1FQJA 3LQRA 4GDFA 1HH4A 3BFVA 1F2TA 2GRJA 1DEKA 2XTMA 2YVUA 1XXHA 2XITA 3CX7A 3S1AA 1NIJA 1KSGA 4WZAE 3SN6A 1GOTA 3ZGXA 3PG5A 1XPRA 2BEJA 3TAUA 1N0WA 1W2HA 1NLFA 4CEHB 1HT2E 1Z0AA 2ZS8A 4P4SA 4JKIA 1UPTA 4V02A 3TUZC 3TJZA 4XIGS 1EFRA 4F92B 4JS0A 5AR1A 3K70C 1UBCA 5LD2B 1SXJE 2WMOB 4Q66C 1T6NA 2IA5A 1W47A 2ZXUA 1KAOA 4FMDB 4M4SA 4DLVA 1ZP6A 4RD3A 4W9MC 3FDIA 4ILEA 5A4JA 4WA7A 1XJQA 2HT1A 2Q3HA 3BK7A 2IWHA 4TZ0A 5H68A 1AIPA 1YKSA 2V1XA 3RSOA 4LHXA 1IN7A 4B2IA 1GL6A 1YZTA 2QTHA 3AP3A 3ND9A 1ZW6A 4Q1FA 4Q9KA 3DM5A 2ZJYA 1E9AA 3FKSA 5B64A 3KKQA 5BW8A 2ODBA 2H8KA 2CE7A 4I4LA 1W4BA 2XJ9A 4V0MA 2OSBA 2QT1A 1G8FA 4G01B 1P2VA 1E1QA 1U9IC 5AUQA 5JI2E 3E5HA 4A2QA 2IX3A 3P32A 2Q6TA 4XWKA 1TF7A 3NHAA 4HUQB 4ZI2A 1TU4A 1Z0IA 4HI0E 1F3OA 2IEYA 2AXPA 4QRHA 1Q21A 1NKTA 4Q1EA 5J5CA 2VBCA 4IXMA 1NKSA 2OV2A 4DLZA 2VP0A 721PA 1NRJB 1J8YF 4OQNA 2WJJA 3K9LA 1U8YA 2PT7A 3KTAA 3AKCA 1WE2A 4B76A 2A5GA 5KSZA 3WRYC 2W6JA 1GM5A 4YXWA 1XEFA 1HV8A 1MABB 1E4YA 3AP1A 4MRPA 1AKYA 1MR3F 3DL0A 4UJ3A 2D2EA 2P6RA 5KOYA 5G3YA 3T06B 2BC9A 3SNHA 4C2TA 3ETLA 3OFNA 2GA8A 4LC1A 2XNDD 4Q1BA 3F5FA 1L4UA 3OIWA 5HKKA 4G5QA 2CHGA 2IYLD 3AB3A 4DLUA 4DUGD 2BCGY 2XAUA 2ZUBA 1E2MA 1KKLA 3IGFA 3JVUA 3HJNA 1Q3TA 1Y3AA 4L8GA 4XTRA 1ZUHA 4ZDKA 5BN5A 1R5OA 4MRVA 3H86A 4IXNA 4M1TA 1CIPA 1CP2A 2Z4SA 3LY5A 2JA1A 4HLCA 1U94A 1N6NA 1DTSA 1XCMA 2KBFA 3KFXA 2WAYA 4KI0A 1KZ7B 3EX7C 2CVHA 1GNPA 3T1OA 3TK1A 3OE7A 2FZLA 3C16C 1R8QA 1Z6GA 3ZVMA 3TGPA 2F1IA 2HYDA 3DZ8A 2DBYA 2IYVA 4JLKA 2ZANA 4B33A 4JSYA 4X8OA 4QGAA 3PEVA 2W0SA 4K81B 4MKHA 4LV5B 4TYWA 1YZLA 2ERYA 2W2VA 3RNLA 2WWXA 1CLUA 5TMPA 1LB1B 1ZCBA 2CJWA 1QHIA 4R98A 5FPYA 5FOVA 3GJ3A 4OQXA 2I1VB 5EXTA 3U7GA 3K0SA 4TYYA 3B9PA 4NCIA 1UDWA 3AUYA 4DCUA 1FMJA 2MMGA 4TMZA 5CITA 1E3MA 3I72A 221PA 1TQ4A 2V7QD 4QOSA 2IUSA 3SEAA 4LOAA 4IOJA 5ANRB 1JNYA 4M1SA 5GADl 1LV7A 1DAFA 5F2EA 1NY6A 1XNJA 5F9FA 3NC0C 1CJUC 3FMOB 3LDAA 4Q03A 4ACAA 2BBTA 1GNQA 4I1VA 3TVTA 1VG8A 1XEXA 3O8DA 1TUIA 3G0HA 1OE0A 2N42A 3O8CA 5JWRA 1H8HA 2SHKA 4Q4HA 4TL6A 2PZGA 1CR2A 4ARZA 2ZRHA 1JI0A 3WBJA 3VNUA 2GESA 4NMMA 2BV3A 2B7CA 5FUWA 4ZCMA 2RAPA 4HDOB 3AM1A 2OLKA 3AVWA 3JZMA 1RKBA 1B23P 4IDQA 1P9NA 3K0AA 1PZNA 1L8QA 3R9IA 3WMGA 1GITA 3GLGB 1G7RA 1VECA 2DWOA 1W0KD 4K8OA 4IEIA 3U60B 2BEKA 4KITB 3IUYA 3IHWA 2CCGA 3DZDA 4AK9A 5TDHA 4JIMA 3QG5A 2PBRA 4R2HA 1Z2CA 5DYIA 1I4TD 3OEED 3EPKA 1P72A 2QTVB 3P1JA 1FOEB 4IHQA 3HR7A 2JDIA 1ANKA 2QNRA 4PFSA 4OQMA 3KQKA 3NEYA 1US8A 2GBLC 2ZRIA 2R6AA 4Q4JB 4ZDWA 1BKDR 2I3BA 1XCGB 5JEEA 2W2TA 3GLHA 1V43A 3K09C 4MRSA 2OAP1 1ZM9A 1XMJA 2GZDA 1OH8A 4CDGA 1NMZA 1JJVA 4RD2A 1N0UA 2WWGA 4MGIR 3AVQA 2WJGA 4NE2A 4YMTA 5GJVC 2HCBA 4E03A 3BAFA 2MSDB 3GJ7A 3K9GA 4JVLA 4TQUS 4OK5A 3FWYA 1FP7A 1AGPA 2H5EA 4ZIRA 1RC8A 3RABA 1UKZA 1TQDA 3HU1A 4QL3A 2NZ8A 3MRSA 1EWQA 2XNSA 3MMPA 2XB4A 2YOHA 4Z1MD 3FMFA 2CNWA 5DI3B 4M9XA 2RH5A 4TLBA 4JLMA 3K0FA
chains in the Genus database with same CATH superfamily
3RUFA 1Q7TA 2HGSA 4IKOA 5TF4A 5KDDA 4L16A 4PS0A 1PFWA 4ZO4A 1P2TA 3X2SA 3ZLJA 3CX8A 4HAXA 4LI3X 2YY5A 3ZK7A 1UANA 2CLDX 3QKSA 1I2CA 3LGXA 3RTAA 4JGGA 1HZJA 3WIBA 1KIAA 3M1AA 2NV6A 4P5PA 2VVTA 2XGSA 4BBJA 1Q77A 2ZSIA 4GL4A 4EAQA 4EW2A 1RDFA 2OV3A 3JTMA 1W5FA 4UAJA 3TH5A 1PR1A 4MUNA 3FMGA 4JR2A 5HCUA 4YA6A 3FE2A 5HMLA 5IF9A 1SURA 4ETNA 3FCUB 1GFIA 2EP8A 1KIFA 4IQ8A 4LJ6A 4MI6A 5GONF 1F8XA 3QYFA 5ESRA 4A26A 3LO8A 1UMCB 4NBLA 1XQWA 3B52X 4DCJA 4PONA 3THRA 2OPHA 2Y0PA 5JS7A 1JDBC 2JK1A 3W4JA 2IQIA 4HDKA 1FYFA 3LF1A 4A10A 4FYVA 1N6RA 2PBLA 4EPVA 5CEJA 2IZ5A 4EFNA 1FS4A 4IMJB 2YWFA 3KR0A 3KQYA 4RYDA 3AXSA 1E1MA 4EYQA 2GKGA 3D2AA 3NWJA 3UH1A 1TEVA 1LK7A 3C7AA 3ICCA 2BH2A 3SOPA 3LGSA 3U1TA 5JZ9A 2G0NA 1LPPA 4OUDB 4L5CA 5H4HA 5A6SB 4PSVA 1H2FA 3M6LA 1M2NA 3NR2A 1T8PA 1HT0A 1JLHA 4MW6A 2N47A 3CBQA 4TLLB 3VRHA 4V1CA 5KPJA 1UJ6A 2BHLA 3RW9A 3CVWA 2PN1A 4TRMA 2ZK7A 3L92A 2PX6A 3BWMA 2FUG1 2XMZA 1H23A 4OB8A 2Q4TA 3UF0A 1SO8A 2R47A 4QHYA 1NMQA 3C41J 1KFBB 1DXOA 1WXWA 3ZR4B 4R01A 3JRNA 1KDZA 4BGEA 1FUEA 5J2TA 4RANA 2PX5A 2YHSA 3E2MA 3W78A 4Z2AA 1NQ5A 1N4DA 4HNUA 1NONA 3AR5A 1EAYA 2B1IA 5D7BA 2OG2A 2H5LA 1PV1A 3HB5X 2HF2A 4GE0A 1UMDB 2GX6A 3TCKA 3WJ1A 3E2PA 3MB8A 3IT1A 1LBSA 4JVSB 5E6RB 4Y2UA 2G0AA 1NSYA 3RM3A 4MAMA 3LW7A 4FE7A 4NY1A 3OKCA 4Y9UA 4TRRA 2OHGA 2IU3A 2P1DA 2EU8A 5LQKA 4PAMA 2XMDA 2DETA 1M2HA 5WRFA 1NVMB 4MQMA 1DAMA 3S1LA 2BZGA 2X0EA 3TFQA 3ZUGA 3JQ9C 3R3HA 2PFKA 5JRDS 3D6UA 1ZEMA 2LW7A 4NBTA 2Y67A 5LZ2A 3I1YA 3IT3A 5AUNB 1YB2A 2VKTA 1IJEA 4LFBB 1WBBA 1H4TA 4GXQA 1OBVA 2DLDA 2GN8A 1RS0A 4HUQA 2VZEA 3AETB 2G76A 3C74A 4R16A 1OILA 3SICE 4FYHA 1QSGA 1RW4A 4KQ1A 5HE8A 1YQ9A 5JYDA 1Z0SA 1XD9A 4FEEA 5A3JA 4FKMA 2NP7A 3KYIB 4Q93A 4JI2B 4KK4A 4IZ6A 2PH1A 3IOBA 5ECWA 2CHVA 3SZ3A 1MF7A 5K4HA 2REOA 5AI8A 4ENVA 1FSPA 3GV0A 3KXKA 4C06A 2VWHA 4V02A 3RIYA 3H9CA 1G1MA 3MTQA 4JGIA 4TUYA 1B6GA 3OQBA 2B82A 1KFCB 1NUTA 1IG3A 4DJTA 2YYAA 5AXAA 2OP1A 1EX7A 1YA6A 1UXIA 4GPIB 1G7CA 1P61B 4IMPA 2OZLA 4YV7A 1ENZA 1FL9A 2TMDA 2AYXA 1UJ4A 5IDVA 4KFRA 1IVSA 4M36A 1PX2A 3LRPA 3D43A 1VKOA 4BLWA 1MAVA 3OCYA 2FFAA 4YLEA 5EE9A 3KOOA 4Y2YA 2Y1DA 1UWKA 7REQA 1FYDA 4EG1A 2C8LA 4P7FA 4W6ZA 2QRJA 5KQSA 4IR7A 1J0XO 3G8CA 2QUHA 1OGJA 4PNEA 2D6FA 3I9V6 3AVVA 1IHXA 2ZI4A 2NUTB 1N5RA 3KUDA 4BWGA 1M67A 1KI8A 1W48A 4V0ME 3R6DA 4QECA 2DU8A 4IMRA 2QZ9A 3M3DA 3PX3A 1FMCA 1UWCA 3OCUA 3BSWA 3EN0A 2AXEA 4MPPA 2F1HA 3TZHA 1IVNA 4MVJG 4RD1A 1W36C 3GARA 4YLGA 3QE4A 2OFFA 2CJFA 2VT7A 4LXHA 2V5AA 3ISTA 2DKOA 3MT7A 2PFGA 3OCJA 4JYZA 4GQBA 2CFSA 4R2IA 2DPYA 4Y1RB 3E9DA 3L7LA 2FEPA 3QHQA 3ZOZA 3F8TA 4XOIA 1TQ6A 2VXOA 1NF9A 2VZLA 4TLEA 2RK6A 4BQRA 2I4RA 5JZSA 1KBOA 4WBNF 2AFHB 3P8ZA 1SOAA 2BHSA 2L82A 4M46A 4Q16A 2GH1A 3W8DA 4IOMA 1I30A 2DWUA 2HBRA 3A36A 5HKAA 3KYCB 2WWIA 2ZXFA 2GBIA 3JPYA 1WUYA 2CUZA 5EIEA 4P3NA 5FL7D 4IJQA 1EK2A 2IZ7A 3GXBA 3NANA 1GWNA 5I9IA 3EVCA 4RJTA 3GEBA 1FRQA 1RM5A 2PDAA 1WRBA 4KQFA 4OGGA 1W93A 1EWYA 1FP6A 1QIGA 3IQFA 9GPBA 2ILVA 3EISA 1V2HE 4CF4A 2OLJA 2W2QA 1K8YB 4RFSB 5DBIA 5EP4A 2AHRA 4WVFA 2II6A 3BBLA 1ZL0A 3NM6B 4WA8A 2VUTA 2BL4A 1DJLA 4XGQA 4EUHA 1M1YA 2WU3A 3G79A 1YTUA 4ZV7A 1N2IA 1LD3A 4OG2A 4R8VA 5FOXA 1LC0A 3SMVA 2C9ZA 1H65A 1B8VA 1DKRA 1M66A 3EXAA 3L9XA 3UMGA 5HSGA 2P6OA 1BX1A 2PUEA 5F3RA 1MAWA 4U3JB 4HFMA 3IB6A 1V7QA 3VTFA 5IJZA 2QT9A 8ATCA 1EEHA 4NBWA 1RLMA 1REQA 2HAEA 3KVOA 4LISA 1S3IA 5GONB 3LKVA 3CF4G 2DPMA 3GCGA 4KWIA 3OT5A 5GJWC 4ZV4A 4DKJA 1N8TA 1T34A 1BDIA 1C1DB 1KP3A 4BKMA 3VPSA 4BJ6A 1E9CA 4G5YA 4CIBA 1AXGA 4I1RA 3EWSA 2OFWA 1KP9A 3UMJA 3HDQA 3V80A 2MYPA 4CIDA 3D81A 1BA3A 4XSGA 4PX2A 3O0DA 2HDNB 2QRLA 4KQKA 4MS4A 1A9YA 5FPSA 1IUNA 2HUPA 1RAAA 1QYIA 4MAAA 1OLUB 2Q5LA 5IAOA 3HM9A 4LDNA 5KAMA 5JNTA 2Q4EA 5ILGA 3PNKA 1NVBA 2HPVA 4HFRA 1RMYA 2ZB7A 3QOFA 5CA1F 2K2WA 2Q6KA 4X97A 2JH3A 3QWAA 5CT6A 3ROZA 2JFXA 3TKLA 1E79A 3S7ZA 4UCFA 2BKEA 3QFSA 4OQQA 4G4GA 4WNYA 2WM2A 4BVAA 1JIIA 1OXVA 5TMDA 1AA6A 1G5QA 4OI0A 1G291 3OZDA 3AEYA 1AS2A 1NF3A 3CW2A 1PT7A 4O4IB 3CLSC 1JXOA 2P3LA 5BPFA 1BE0A 3WNDA 1C41A 5IJ0B 4MPRA 2H51A 3U3OA 2YVQA 2WZDA 2BGWA 3QWBA 4LJ4A 2A9KA 2AEFA 4E21A 1Z7YA 2CHFA 2D3WA 3I05A 2P65A 1JFSA 5FLEX 1JR2A 4KP7A 4B3RB 1DJQA 4RFVA 1QVZA 2CB0A 2EG9A 4YPFA 1QG6A 2B5VA 5DP1A 1T4GA 3QMPA 5KU7A 4A2WA 1BS1A 1RXEA 4FK8A 1MB2A 1NFQA 2OV1A 3DBHB 4FOSA 5IPFA 4I1YA 9LDTA 2JGDA 1L7RA 1P7PA 2UVQA 4PLPA 1MA0A 1RHJA 1N3LA 1W6RA 1AKWA 2O06A 3BL6A 3LVQE 4GLBA 4H18A 1W59A 5ARBA 2AZXA 2MTBA 2HJ9A 4MB0A 2J5QA 4JI3B 3D1LA 3HHPA 5TEVA 1L5ZA 3TR0A 3NXSA 3OZUA 4G5SA 5F9HA 4M8SA 4MYUA 1T0HB 2OGUA 3BGVA 3PUKA 4K05A 2I2DA 1QH8A 1QQ5A 1DUSA 3HCFA 4LVCA 4U6NA 4ZCQA 2A0FA 2AGVA 4OLJA 1OAOC 1XF1A 3CN9A 4IMIB 1QZ3A 5CGZA 4EO4A 1XK7A 5GZ3A 4LOJA 2BKVA 3SY8A 4FXPA 4K9MA 4CG1A 2ZWIA 2VKQA 4FXOA 4D3DA 1ISFA 4D3SA 1HDYA 4CKZA 3O73A 5H3LA 1JQ5A 3UMSA 1JAXA 1YZGA 1MENA 4A91A 4AI6A 3N8GA 4A2QA 4RWEA 1XCPA 3F9CA 2DWPA 4YB8A 1J39A 2PQ6A 3ROFA 4CZ2A 3ADOA 1OLXB 1XHLA 4WSOA 3GLHE 3KZ1E 2ODEA 1W9HA 4KU4A 2CNLA 4R31A 5I7UA 4H7PA 3NTOA 3SIRA 3T3MB 5LMNB 3DTNA 5LD2C 2BGKA 3EWAA 3MMZA 1Z5UA 3MRTA 1UXOA 3B3GA 2UV8A 2GCOB 4IV0A 1JHRA 4RJIA 2IYSA 3VH4A 4DZTA 1LQUA 4M99A 1GKUB 2BHRA 3LPCA 5D86A 3ZU2A 4RHXA 5MN5A 1XB2A 1FUKA 2RBEA 4YJHB 3O26A 4N8DA 3H4MA 5ES3A 5EMJA 1IM2A 2NSLA 4MNTA 4JI0B 4KLNA 4BVLA 2IS6A 3T1TA 1KYXA 1J8MF 3BOSA 3VAYA 1DOHA 1VSBA 1I8TA 2GYUA 5EZQA 3U6KA 3ABZA 4X61A 3GRAA 4X3PA 4Z4HA 1ZRSA 2JIOA 1SHUX 1X94A 2F43A 3GRYA 5CVCA 3PICA 3HXMA 3BQMB 4IWXA 4FZ3A 5DW0A 1KI6A 1IBRA 5BMVF 5INTA 2HCFA 3GZTB 5LKAA 2JK0A 2NU7B 5LP6A 3EZNA 3LX8A 4NJEA 4GI3A 3FCCA 4KIWA 4RF5A 1P18A 1JRLA 2B5WA 1VYTA 2YJ6A 2BR3A 2PX2A 1GIAA 1MUUA 1XTUA 2V6MA 4BTEA 4N3BA 2DB3A 1E9VA 3OU7A 3TLJA 3V8PA 4ICIA 3G49A 3AHEA 4UD6A 5J3JA 2B7BA 3WHPA 1GQSA 1SCDA 1KJYA 1W1UA 1P4GA 3AF4A 1QOPB 3NHSA 2WM9B 4N01A 3T35A 1KFKB 4A5SA 1KE1A 3FTCA 4RSHA 3DD5A 4HADA 2SBTA 1KDOA 3O3CA 3KDSE 4GOND 4JUBA 1EHCA 4GXRA 3F2IA 1GZSA 1YD7A 2FG5A 3BJZA 4WOCA 4EIWA 4S1TA 4CKBA 1EU1A 1E6MA 2OWEA 1E3TA 3ZZ0A 5BV8A 4JL5A 1XKTA 3AW9A 1XQXA 2XT6A 1LDMA 1ZY2A 1FZTA 3EMVA 3L0OA 4B09A 1OHHA 3D4IA 1NYTA 3KAJA 2IHYA 2AFIE 2HMAA 2JJYA 2GNAA 1BH2A 1UC4B 1EPUA 1UFRA 3MGBA 1C50A 4JDUA 4M7PA 1EBBA 2J9FB 1A2KC 3VR1A 3AY6A 3VU8A 4IF4A 4JUIA 1M34A 1JG4A 1J2YA 2HWUA 1F5NA 1TVEA 1KO1A 3GDHA 2CZGA 4PGMA 4ZGBA 3RJ9A 4MUAA 2DKNA 1WTCA 4U0KA 1K92A 1KQPA 2XVAA 3HJTA 3HP4A 1QG0A 1CQXA 1D2CA 1CRQA 1JFFA 4H7EA 4W5WA 3BSYA 3IP3A 3V4SA 3KZOA 3KKOA 4DRZA 3WDSA 4PYQA 1NF2A 1XDWA 2C5LA 4N39A 1U3GA 1EVIA 3W2IA 3WYNA 1YR8A 3K6SB 3BCRA 2FPIB 2EYUA 3ESDA 4XQ0A 2H59A 1VPWA 3AZQA 1EX6A 5LZ4A 1JBKA 3LUCA 2AX3A 4FFVA 5FEMA 1R00A 2IY8A 5COAA 2GXQA 4OPMA 1NX6A 3N28A 1ICIA 4LKOA 2YRWA 4JLOA 2VHYA 3LUKA 3WK4A 4W1PA 1TOAA 2WT4A 3W5HA 4GBMA 5F5XA 4JUFA 4P34A 3IDAA 1CX9B 1VJ5A 1H9AA 4RH1A 2BUCA 1C9DB 5CA1B 3IAUA 3IR6A 3H87A 2VQEB 1Z4KA 4JJ4A 4AUKA 4DLPA 4EH1A 4BN0A 3DTVB 4LXXA 1AKUA 1C8KA 1DQZA 4ASUA 1SHTX 3T7TA 4DR7B 4WJLA 2HIGA 4M8NE 4P81A 2R8XA 2QAGA 5COBA 3A6KA 5FLXA 2JJ2A 2QQFA 1CVRA 3M0EA 4JI4B 3ZHRA 4ADSG 2WYVA 2Y92A 3AO0B 3ZV3A 1JYSA 1MV5A 2JCYA 5JH7A 2Q3JA 3WAGA 4AULA 4JELA 3T95A 1ISGA 4GVLA 1JKFA 2I8CA 2DT8A 3KZKA 2XPCA 4M88A 4YDRA 2I34A 1RRMA 2B0CA 2BHNA 3EC2A 4P4LA 3GUYA 2E2WA 4O4HF 1JN0A 1DAKA 1E6CA 2E4ZA 3EODA 3ZBTA 4M60A 3FDFA 3WMXA 1NXPA 2YWJA 2ODNA 3NHFA 4QUHA 1K5DA 2ISCA 1NVXQ 2AC2A 4DLAA 1G3IA 1I10A 3CRW1 2FP4A 3LRXA 1QQAA 4BVBA 4DB4A 4JJIA 3EBPA 5HIIA 3E70C 3P9IA 3CC8A 3AK4A 5CH3A 2LUOA 3NBKA 4AUEA 3HN2A 3UPDA 2CNKA 5K8CA 2CNNA 1CUXA 4JP2A 1XTQA 4B2PA 4CCSA 4Q0MA 2Y93A 2FUNB 2NZVG 3MWJA 1RAGA 3EXHC 3M34A 4OBEA 4XJXA 2ZSBA 3WGZA 3TX2A 2PJUA 1SZDA 2F3RA 5DGXA 4D25A 3QKIA 3W8FA 1YB5A 1VDZA 1SCIA 3MF4A 5AJHA 5JSZB 4LHYA 1OKKA 4KJXA 2NQTA 4KNYA 3D7KA 2RAFA 4CR6A 1O96A 3B2NA 3DHEA 1ZPDA 3EG9B 2ATEA 2PZ8A 5IVDA 2HK6A 3U26A 1IN5A 1G5IA 4BE4A 5H4GA 1CFZA 1KBQA 4DMRA 5K3SA 5D5HA 5U9CA 4BZQA 2QRVB 2AG0A 5I5GA 3RRZA 2MWMA 5IVPA 2J5RA 3G59A 4FHGA 5KREA 2HA5A 3IMCA 3ZJVA 3L7NA 3CF6R 1XN1A 1NRXA 4U9UA 4OH7A 1P1RA 2P5UA 2C88A 3TQTA 4DLNA 1E9BA 2JEZA 2Q45A 4BQSA 4PINA 1I7PA 1X92A 2LXNA 3GEEA 2BM9A 1ZGAA 3EA4A 1EP3B 2V7VA 1L5FA 3M6MD 4HLNA 5KX5A 2GI4A 1ZUD1 2JCGA 2MJLA 3GP3A 5D01A 2D62A 3KO8A 3VNSA 1O77A 1KGSA 3C3PA 4FHZA 4U7TB 3GAAA 4PAOA 5FBZA 4DBZA 2QVLA 2WJHA 1LJUA 3DYBA 4KXWA 5FULA 3IOCA 5KOJB 1R0ZA 5FNZA 1MW8X 3ZZNA 4DC9A 10MHA 2R48A 4CL8A 2OY0A 4KIUA 2I2BA 2JJQA 1NXTA 3R09A 1CVLA 2IXFA 4PPYA 3FB4A 1MP0A 4JD5A 2IV7A 2FG6C 4WCFB 2NO7A 2VP9A 4OBWA 4GMXA 5EHNA 1K8XB 1MEOA 2HCTA 2ZI9A 3LQQA 3W5IA 1G5PA 1ACMA 2VUUA 3A1SA 2QMEA 3BE8A 2V9PA 5B3KA 1ZONA 3N5KA 1ESEA 1BWRA 2O2EA 5SY9A 5IAAA 3CVUA 1T2AA 1PR5A 1A98A 1H1LA 3Q0TA 1OBHA 3DZHA 1W581 1QRUA 1MAHA 3WL6A 3TO5A 1WZEA 3SC4A 5ALGA 3II6X 1F2UB 2ZVJA 3IVAA 1YJXA 1TLTA 2FMKA 1A27A 3I9V1 4L0QA 5F52A 4C14A 2GO7A 2H0QA 3FCSB 3QXJA 4WPGA 1M5TA 2ECKA 2IIBA 3RIGA 5K0ZA 1NZDA 1EVYA 2JGKA 2ZJFA 1AF7A 1NDUA 3IURA 4LJYA 4KQ6A 4RORA 2NACA 2VFAA 2Y4NA 3ZHOA 2F64A 1QTQA 2QM3A 4E2FA 5HGXA 3SJBA 1S3FA 2I33A 1BW9B 4M0EA 1SKAA 5TMEA 4ZI3A 5TJ9A 2GLTA 2ECPA 3K53A 2QENA 1NJ6A 2CNBA 3CSUA 2NO5A 1ZBDA 2UYQA 5THQA 1TC2A 4TT3A 2UAGA 1K98A 3PQ5A 1D0VA 2H29A 2JLSA 4G89A 4MI1A 5FTKA 3T52A 1B8UA 1YSCA 1HDIA 2WFAA 4ERNA 2WZCA 2Z43A 1RI4A 3W9YA 3TLAA 1Y5RA 3MTDA 4OREX 2IZ6A 3K0BA 5AVZA 3PLRA 1YI1A 1OI3A 4UMEA 3W04A 3R1IA 1CUDA 2PKXA 1WB9A 4G2NA 1XJ5A 3P2EA 4OCZA 3MWFA 2QLTA 2Z6QA 4B40A 2YBDA 5K6AC 1P62B 1ULBA 3GUVA 1YQQA 3OJCA 2QV0A 2QZPA 1SVKA 3KJFA 1VZ2A 1QGED 2EW2A 3GFSA 3LD9A 3P9KA 3ZXIA 4JB3A 4CLXA 3SHTA 2DMRA 4A23A 4BTVA 2YQZA 5A2GA 4H7JA 4JJ6A 2B99A 2G4VA 4A8JC 1KZHA 1MT0A 3KLMX 1L5QA 2VYQA 4MHOA 2GCIA 2Z2KA 5BN3A 4MV4A 4UDOA 1FXUA 3OEHD 3GRZA 3URKA 3EXFA 5CB8A 2I65A 2FWJA 3SX2A 1C7FA 5BY2A 4W7SA 2OKGA 1KZYC 2WFMA 1X7ZA 3F4LA 5M3BA 3C5HA 3W05A 3WL4A 3RUDA 3ZUPA 3RQSA 2GNPA 5HS4A 4X41A 4RZUA 5FFFA 4DCMA 1UIRA 1PJ4A 4EA8A 2CLHB 1HL7A 1RADA 3DDCA 3MA0A 1Q16A 4RJ2A 2Q8PA 1FW8A 4R1PA 3TCNA 2C95A 4A16A 4MAFA 2HPZA 1PU2A 3V6MA 3QITA 3GCXA 4J0GA 5KI6A 3VYUB 4JLSA 3SBOA 3AJ9A 1SXHA 4U2GA 4V0LA 4CTNA 2DUUA 1RAHA 1MDBA 1ITZA 2HHAA 2O8EB 1QHHA 1DAIA 1UM9B 1G59A 1WZNA 2FEAA 4GMDA 3NBFA 4CV2A 2N75A 3OX2A 4KR0A 2WUFA 2RKBA 1V9SA 1Y8RA 3LYAA 2MINB 4RKEA 3RUAA 2IYTA 4MKIA 3PEFA 1PFVA 3TSOA 3I61A 1TAHA 2PGOA 2A0WA 3F9IA 5KYNA 1R27A 1DWPA 1I3NA 1NAHA 2IT1A 1T8YA 1QRDA 2VYVA 1IULA 3CHYA 3IP9A 4TXJA 1Z5GA 2ZDGA 4X20B 1FDSA 4XD7A 1W4AA 3RARA 1ELOA 4X7MA 2YS6A 4P7GA 4TTTS 2YJZA 5FWXB 1DXHA 4Z0NA 3C6ZA 3TPFA 1M2VA 3DW1X 4C5BA 3LCVB 1XRLA 2CXQA 2WIGA 4QIHA 4CRWB 2DUJA 1DU4A 4P93A 4UU7A 1BE1A 1WUJS 1Y4DE 3SK0A 4JQSA 2O7NA 4OIMA 3TOCA 4BCCA 1AM4D 1TAUA 3HVKA 5CXSA 3U7QA 1YE3A 3EXG1 2DULA 2HHJA 2HT6A 2IHTA 3DEZA 4AN4A 1NOKA 2LVBA 2Q5JA 4S35A 2FZGA 3GMDA 4MGHA 1F60A 2AFIA 4BLOA 5ALWA 2J9XB 1BEZA 1E6LA 4HN9A 5AKJA 3PRKE 2C3YA 3AKDA 1ESMA 4DV2B 4QATA 1JVBA 2FUCA 2V59A 3IIKA 4FKBA 4XOUA 4BNFA 5C7OO 4E70A 4FLEA 3KJNA 2EHJA 3DR5A 3EGEA 5KVCA 4CEHA 1A4XA 4F72A 4EL5A 8GPBA 5IFKA 2C8KA 5IBRA 5J47A 5DTEA 3EW7A 1TMOA 2VJAA 1M0TA 1VP3A 3LPDA 3LP5A 2ZIEA 3C6BA 3R6TA 3NATA 3SLKA 1HRDA 4HDRB 4RENA 4JEUA 4NZMA 1D4FA 3VUFA 1QUFA 1S2MA 4PYRA 1IE3A 1MD9A 1KMNA 1WMAA 5BN1A 1I3CA 3KSRA 1JFTA 4K6MA 1C1XB 3KBOA 4N5HX 1N6LA 2HIAA 4N9QA 3IA2A 1I3OA 3ZWWA 5EJ7A 3ANMA 4PZAA 4S1NA 4LZAA 4RD4A 1GZ5A 1TMKA 1POWA 2C5AA 1X1CA 5KYUA 3H2SA 1MZPA 3VDNB 5LB2A 1TCUA 2XWBF 3JQ7B 2LCFA 5JSQA 4ER0A 1D8TA 4CTKA 4RESA 3THYA 3ETHA 1BFUA 4Y18A 4YHBA 2HEIA 4MIOA 4RJLA 2GETA 4XVQA 3HKCA 3T7EA 5BQOA 4L5BA 4UE3S 4ZVKA 3WFZA 3AVTA 2ZSAA 3K1YA 1PJ8A 1AURA 2ISQA 4X62B 1AZTA 4YJ2B 5DVZA 4DV4B 2R3SA 2C97A 4L6AA 3GLFE 3TB4A 2KB0A 3HA7A 1U8CB 4RULA 4LF7B 2NO1A 3QVLA 2RGUA 3R5JA 5ALKA 2ICAA 4E3ZA 2Q1TA 2VN8A 3NW9A 1ZHHA 2B0JA 2H4FA 3TRDA 3STTA 4XPIB 4JWTA 3I53A 3U1VA 2J3DA 1ZGBA 5CB0A 2QNIA 5EMNA 4QM6A 5DLEA 1Y42X 4FZ5A 2OBFA 2J41A 1DV1A 1FFGA 1OFIA 2LPMA 4GQAA 5C37A 2D0DA 3WK9A 2WYUA 1YZQA 1W19A 1T6YA 2ORED 5ALSA 4G5XA 1WAMA 2DT5A 3F6PA 4A92A 4GNKA 2I3AA 3CGWA 3FTDA 1CK4A 4JZKA 1YDWA 3ZK8A 4Q9HA 5LA6B 5FR1A 2A1UB 2BFFA 1Q1AA 5DX0A 1UBEA 4U7WA 3U7JA 1GQFA 1NX9A 2H08A 1CNFA 1NW4A 5LPNA 4EB0A 1EB9A 2A9PA 3PKJA 3TN7A 5B36A 3F1KA 3LY9A 1Z6AA 3UK6A 1DL5A 2DE0X 1ZN7A 2BSXA 1KVTA 1XU7A 4Z4CA 1UMBB 1A9TA 1OZAA 4MMXB 4B3FX 3EPHA 1DRVA 1VRCA 3DJFA 4LRSB 5DWDA 1CY8A 1EE9A 2HMYB 3D5TA 1NL3A 4LDRA 2B30A 4OQPA 4V0RA 5FUXA 1PNTA 4GQIA 4I66A 2FLVA 3NV9A 4RZXA 3VZQA 2PUWA 3L4KA 2W6JD 5EQFA 2I99A 2WZQA 3JX9A 4KWHA 1U1IA 3BTVA 1U3CA 4UVDA 3T1VA 2HU2A 4BFXA 4NXNB 2EZUA 4QT4A 1P75A 2P0EA 2P9JA 1I7DA 3DBRB 4OXKA 3A25A 7GPBA 2VNIA 3QPDA 4M0FA 1L5KA 4E0BA 1KEVA 3PP8A 1OYYA 1RVV1 2PU7A 1RYZA 3L7IA 4WW0A 3HKEA 3E35A 5E7JA 5HKKD 2MDTA 3OCVA 5ICCA 4B46A 5HDBB 3OO1A 3D0OA 2QTRA 5JTTA 3ZBQA 2VK1A 2WSBA 3USZA 4O8ZA 5T4BA 1P5JA 4JI8B 4R2JA 4BNJA 3UAYA 1B0ZA 1OJLA 1WQ4A 4Z1OA 2ZTMA 4C4XA 4B5KA 3AERB 3AVPA 5JDCC 2ORIA 1XMSA 2EX4A 3VR3A 2QQ5A 1U8ZA 2PUFA 2O8CB 3SPXA 1N3IA 4B8WA 1LVHA 1P7CA 2GT1A 1M6EX 3SKXA 1R7RA 3HI6A 2VTEA 5JCJA 2XCUA 2OFXA 4BYGA 1CZOA 3UN1A 4JV5B 1Y82A 2VHXA 3D4LA 3P45A 4RH0A 4ZI7B 1H05A 4ZCLA 2IIPA 3U7HB 4NG5A 3ITKA 3EMKA 2QBYA 4YRPA 3H0CA 1DJPA 3UHPA 2JCVA 1JEJA 4NYMQ 1KPIA 2A35A 3V3KA 1EVQA 4HVLA 1Q0ZA 1RD4A 3WGNA 4YRKA 4K9PA 4ZEOA 4AZ3B 4P3KA 4MEJA 2Z4RA 4L95C 1Y6QA 1FTGA 4D92A 1O97C 4TLMB 4IDNA 2IODA 4QJBA 2IXDA 1KRHA 4D8UA 3IEPA 1PZXA 4BMOB 4DANA 3I01A 5AHRA 1GGNA 2OG1A 2QP9X 3A6DA 5E95A 5KYVA 3NTXA 3STWA 2I7XA 2O1SA 3PXUA 4PO3X 2YS7A 4TYQA 4CQLA 3LMKA 1Q1ZA 4QNRA 5JADA 2FQQA 4LRYA 4CM9A 3ZWAA 1E6UA 1V25A 2I22A 3Q3IA 3U48A 3FG9A 5EIFA 3RTCA 4S1VA 2J5XA 1U2DA 3MWYW 5IAKA 5TE9A 3VSBA 1SC3A 2NXCA 4R4JA 4ALJA 4C3VA 3NT5A 3BIFA 2QTLA 1ZUNB 2WF6A 3RRBA 4EA6A 3CE6A 1IAQA 2F55A 5AJZA 3OLQA 3OT1A 4YAEA 5IEBA 3FOEC 1LW6E 2PL3A 4OMDA 2EL9A 5DNDA 2ID8A 4JASB 3VAAA 3RAJA 4LWPA 2V7QA 4FE3A 2X8AA 8LDHA 1ODSA 1UBSB 2VSNA 2CEAA 3G9UA 4L8YA 3ZWNA 3L0SA 4GWLA 5J2UB 1JG2A 1LPOA 1YNOA 1YZVA 2WDPA 3NT2A 4KW7A 1JVSA 4DJEC 2R6DA 3T38A 5A02A 2QZ4A 4QUAA 4ENQA 1TB4A 4P22A 3AHJA 1CPYA 5IAJA 1TJ3A 3GQBB 2YZGA 2Q0XA 5AI6A 3NHBA 5EIBC 4BFUA 3R7WA 3WA7A 1GV0A 5H0IA 1BN6A 2OAGA 4LTNA 4RTMA 3RYCA 1IB6A 1FRZA 2V3VA 3SVZA 1CRWG 1O3YA 2UUCB 3C8UA 3X1YA 2FW6A 2C77A 2YMLA 3WO0A 4YUXA 5L45A 2J9ZB 3AV3A 3UWPA 3ELUA 2CLKB 3AR3A 3B9QA 2DGDA 1OT3A 4IM7A 5LIPA 3EW9A 1RT9A 2E37A 2CVOA 1XMQB 1U1GA 2AJBA 5DLYA 5HUQA 1RWBA 3OEWA 5H16A 3TDMA 2F1OA 1O08A 3EXG2 1SAYA 3H5TA 1K89A 4HWTA 1AQJA 3GHHA 1DP4A 4KNVA 4XARA 5E4FA 4R1SA 1OIVA 4EFLA 3E82A 3K20A 2R25B 3WL3A 2VF4X 4K9RA 3L02A 3R23A 4NNPA 5D6NA 4E7PA 3T41A 1XZJA 2A0KA 1TRHA 3C39A 3G2PA 3RLFA 4DG5A 1V37A 2F59A 2GD2A 1M7HA 2IXGA 2VIIA 3QY9A 3TQRA 1CEYA 4BNTA 2ZG6A 4RLFA 1GQQA 2FZEA 4UXHA 2G67A 3UUGA 4NFHA 3V8QA 4Q4HB 3X1ZA 3ZEIA 3EVEA 1N8NA 1SBYA 1T5TA 1YONA 2MYNA 5GOTA 4E30A 4R7TA 5BR4A 3SP1A 2FZVA 4BO6A 1FU4A 1ZD2P 5BSVA 5JAPA 2HNBA 1DFIA 3DH0A 1QHXA 1TEXA 4M9QA 1SBTA 2I78A 4ZAGA 3SMQA 4UOEA 5I48A 5CAEB 2FKNA 2JATA 1A8QA 3OLVA 3GRUA 1NPTO 4G4SP 4KK3A 3RREA 4TOIA 2HSEA 4JL6A 3OM0A 1PJ3A 4Y1EA 4KQGA 1D1QA 3EG5A 4FGSA 5GADl 2CHQA 1SQSA 2QJFA 2YICA 3LA6A 4A1FA 2ZTLA 3W7VA 2BGMA 3N0VA 3ZX5A 3TJMA 1LI4A 1V8OA 1FNNA 4YCLA 1IXSB 3CONA 3I1IA 2IS2A 3E22B 5GWXA 4E5SA 2BGLA 1O57A 1NQOA 5TX7A 5KS2A 5FKJA 3GGCA 1QF7A 2E0IA 3C4QA 1JHAA 3FNFA 1T3ZA 1TW3A 1X87A 3IEKA 3HCAA 1I13A 4OFZA 3ENNA 4TL9A 2J0EA 2ZRCA 5IBQA 2ZEJA 3WV5A 2AXQA 4I1PA 5G3ZA 1Q5PA 4J07A 2OXIA 4C7KA 2RHOA 1RR6A 3BXHA 1BOFA 4I5EA 1HQYE 3C3DA 5BYKA 4F2HA 3QKUA 3ROKA 2PKQO 3DUFB 2CL6X 3KPWA 4UM9D 4I8DA 3OQNA 3OBBA 2FRDA 3T9DA 4PCAA 1WD5A 5EPEA 4ITVA 5G53C 4UARA 3GLIE 1HSZA 1Z4JA 3K1AB 1AZSC 2VJMA 2R6FA 1NNEA 2GEFA 4I4TF 1CF2O 2V8BA 3RODA 2FMTA 3JXEA 1VKHA 4RE6A 4E2XA 4AWAA 4I19A 1XZQA 4AB1A 3L0IB 3H13A 5KU1A 3AUXA 5DYTA 3DWIA 1HSOA 3M3HA 4M1WA 3KM0A 2OCXA 4BO4A 3PT5A 4YRIA 5D87A 1CXZA 2XXBA 1FE8A 4OLAA 3WLOA 4H31A 2ZJ4A 4LJ8A 2H2IA 5FO1A 3KQHA 1YOBA 3CLUD 6GPBA 3Q8LA 5FBHA 3CWCA 3DVAB 1QWSA 4FI3C 3ADKA 4D4GA 2E4XA 1DIBA 1ECPA 1STOA 3U7RA 3V2HA 3WC4A 1Z08A 4M76B 1FXSA 1IH8A 5ISMA 4F5EA 3IKLA 4EY6A 5L3ZA 5F4ZA 2CVPA 4JHXA 4BNYA 4AUNA 4D57A 1KY5A 2VPWA 4H15A 5AW5A 1NBMA 1Y6JA 5A04A 1SXIA 1UODA 3NORA 3NP7A 4NBKA 2KSQA 4ND6A 4GL2A 1TZBA 4M7WA 3I5AA 5GV7A 5JLJA 5IS2A 1PLJA 4TSFD 1EVZA 2QD3A 1UBRS 3B3QA 5A5EA 4S0ZA 1U7OA 2V54A 3KZCA 2OBNA 3C97A 1QQ7A 5I7EA 3G7UA 1SHZA 2QX6A 4PCVA 2QF7A 4Y1GA 4YONB 3VC7A 1DAOA 4AJ9A 3FFAA 4Q48A 1FYEA 3PGKA 1FNDA 3G0GA 2EC5A 1XMOB 3SDZA 4GO1A 2VZ0A 5EA2A 3QMMA 5EKXA 2JCXA 4BWVA 4LJAA 1JSRA 1CUFA 1N0IA 2FW8A 4FSXA 1VL0A 3TRIA 4PZLA 1WWKA 2RIPA 5H9WA 5BWLA 4CM6A 1IXRC 2EQBA 1JAYA 1Q12A 4N7MA 3H8WA 4WZAB 3GNTA 1N1GA 1U1FA 3PNVA 5B2FA 2OBXA 2G17A 1YS2X 3N2IA 3WICA 4V1CB 3KE8A 1KAHA 3VTAA 1PKXA 3DYIA 3R3XA 4MGZR 4ZZ0A 1LPBB 1NKVA 1YDGA 2NT4A 4JLJA 3QMVA 1GGHA 2ZP1A 5JMTA 2XUJA 4PPNA 4AXXA 5BQXA 2CBXA 1M74A 2ZU0C 3DEAA 1GL7A 3BE5A 2O7SA 5DM60 4ZICA 5JT1A 3R9XA 3JQBC 5I3CA 2QXUA 3I4CA 3H9GA 5KVQA 1GEGA 4Z7JA 1SUAA 5CVTA 1G8PA 3BH6A 4DWJA 1Z28A 1ULAA 4NOMA 1RZVA 3W7BA 3AUKA 3U5TA 3TBKA 3EZGA 1L2TA 4ZZ1A 1EKXA 4RDIA 3ZC3A 4CF5A 4YCAA 3I9KA 1U0EA 4WCFC 5JAOA 1ZC4A 3Q72A 3ZBUA 1NW9B 1DCTA 2VTKA 4I50F 3VR4D 3ZU6A 3L4JA 2F00A 2QRQA 4OYYA 2DHQA 1A8PA 4YH1A 4DMFA 1GQYA 3AC0A 1CY6A 2X86A 1EFPA 3ABSB 3ACDA 3KV1A 4J8PA 2AI3A 1L1QA 1LWNA 4LXUA 4WUVA 4CNBA 1BCSB 2JD1A 3NHRA 4Q4CA 2VAVA 1GPUA 1R5NA 3PR3A 4XJVA 5FADA 4BQQA 1OC2A 4PW0A 1A9QA 4RFLA 5H1YA 4R7ZA 2VO1A 3DPUA 3G5UA 3NPMA 2ADFA 3LC7O 4JBYA 4F1KA 4DV6B 4ZRNA 1OWNA 3FSEA 4IX1A 5HBRA 3M6AA 1UDCA 3OECA 3HKBA 1VCIA 2P27A 1XP5A 2E3JA 2G7ZA 1JAIA 1JB1A 1XDZA 2VBGA 4GX2A 2AKEA 2JFWA 2I4MA 4IIJA 3TQQA 4BLQA 2D0IA 3A2NA 1KDVA 2IDMA 5EIAA 4TUYB 3VPDA 3NH6A 4UFPA 1VPTA 5C7YA 4NYJR 1MXFA 2DQKA 4QOJA 4KZPA 3KRTA 5EMLA 1LPNA 1UPUA 2O2ZA