3T1VA

Mgla bound to gdp in p2(1) tetrameric arrangement
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
192
structure length
192
Chain Sequence
STINFANREINFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIGEVKGFKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Gliding protein mglA
total genus 52
structure length 192
sequence length 192
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3t1vA00
4KSBA 4MYHA 1MRSA 3DVLA 3W6OA 3UXMA 1KJZA 3KQUA 3DKVA 4G1UC 4TSFA 2GCOB 5CYPA 1GTVA 2VYFA 5FUWA 4HATA 1HV8A 2ZUDA 1VTKA 3M6AA 1G8HA 3G5UA 2QMUA 5AJXA 4JL8A 1Q57A 2I1QA 4I1UA 2J0UA 3R20A 3Q8XB 2BJVA 2JDID 3GEIA 2CNWA 4OL0A 4QXAA 1QHHA 2XTMA 3QBVA 1P6XA 3OF5A 3QBTA 1Q12A 4GMDA 4ZCIA 5HR5A 1NL3A 3CRW1 3MMPA 1E0AA 5CM9C 3NG1A 1XF9A 3PJRA 2NZJA 4Z54A 3QENA 5HKKA 3RS2A 5EE3A 1XU4A 4OKSA 1PV4A 5GJWC 4MUAA 2Q9BA 3NXSA 1ZMXA 1ZM4A 5LBIA 2QEQA 4UXJA 3JVUA 3NDBB 3QF4A 5HZKA 2FFHA 4Q00A 3ZD7A 5J40A 4K46A 3C5HA 4BFXA 3FFAA 2WWYA 3AF2A 1Z6XA 4PSKA 1KI8A 5A5GA 5C4GB 1MABA 4K81B 4GL2A 1M34E 2ZS8A 1QHIA 2ZJ5A 2O8FB 2ZSAA 3V00A 1AKEA 3D8BA 3BFXA 4MGYR 1CS4C 1IBRA 4TMVA 1YR7A 2FDCA 3AVTA 1NP6A 4TLBA 4D2IA 1UEJA 2GF9A 2GXSA 4BWYA 5LD2C 1PVOA 4F4JA 2BMFA 3N70A 2OCPA 4HAWA 2P6RA 3GLIE 2ASEA 1W2HA 3DZ8A 4M21A 1X1SA 2R6AA 4ASUA 1KZGB 3CWQA 3G0HA 5JI2E 4B3FX 721PA 2R6DA 3LH5A 1MR3F 2GEDA 3K09C 3AB3A 2FMXA 1E96A 4QGAA 3CONA 5HKKD 1W5TA 5B64A 3ZQ6A 1VCNA 4S35A 3KX2A 4ABYA 2FV8A 5CIWA 3QQ5A 5DH9A 1VMAA 1N5KA 1QVRA 2XNSA 3WMGA 4DSTA 5KUTA 3UPUA 5FR1A 3EIEA 1U8YA 1UFQA 2QTHA 2ZI6A 2JJ1D 4XTRA 2VHUA 4JZKA 1OSNA 2WBLC 4WXRA 1NG1A 1CR0A 1XTRA 3ZJYA 1OV4A 1ESNA 1YR8A 1M7GA 4U5XA 3VFDA 2NZ8A 4F91B 5JSZA 1NNEA 4JT2A 3T34A 2ZRJA 3MD0A 2W0SA 1X8LA 4C0QC 3EPHA 5JEEA 2H57A 4MITA 2PZGA 4V0ME 2ZSFA 4IXNA 1DAIA 1U98A 4IHQA 4MUBA 1BOFA 4TSFD 4E09A 5SZJA 3K0EA 4GP7A 4BFWA 4KYIB 2WJJA 5J4VA 2ZANA 3EA5A 2WWIA 4H1VA 3GD7A 3MFYA 4B48A 1P73A 4G3XA 2QSYA 4C4PA 3Q7PA 3TQCA 3ICEA 3EARA 4YMSA 2CCGA 5A0FA 3TR5A 1VHLA 1I4DD 3BRWD 2V1UA 2HJGA 1J99A 5LPNA 5J47A 5FOUA 3CUEF 3OHMA 5KNBA 3O8CA 2AWOA 2BWJA 1E32A 2ZTSA 4FXPA 5FBLB 3PEYA 4ON9A 4M1TA 4N0DA 5F3WB 3PUXA 4TLEA 2GDJA 2F3RA 1K8RA 1WF3A 4BZQA 1R5OA 1GDDA 1N3BA 2X77A 4MYCA 4CVNA 2BM1A 3T1QA 1E79D 2QMEA 4DVGA 1YR6A 2XZLA 2CHVA 4MA4A 5EZ5A 3WNBA 2B8TA 4GI7A 1L2TA 3NC1C 5KYKA 1JQJC 3DZDA 3MJHA 2ZRNA 2P2LA 4NYJQ 2D3WA 4C0AC 3NTUA 1WBDA 4A0GA 1SXJE 4MRNA 1F60A 4A6XA 4ZDJA 3BC1A 2QA5A 4XJXA 5EUQB 3BFVA 4R2IA 1PLLA 3QPVA 5HE9A 3K0FB 4JLPA 1ESMA 3PFIA 1OXVA 1YZGA 1TF2A 4NL4H 5J4YA 3PEVA 2IHYA 3A4LA 3NHBA 5B2ZA 4C0HA 4M1SA 2DY1A 4NYJR 3DDCA 2PT7A 2CCKA 5H1YA 3OFND 1Z07A 3AGQA 2ZRFA 4OJKA 4PSAA 5FUVA 4RVCA 2EFCB 3FMOB 2ZJ8A 2NO7A 2JASA 1JXOA 3AVQA 3OE7D 1L4UA 4OQLA 1OF1A 2HLDD 1KMHA 4O0MA 2UKDA 3CH5A 4JJKA 4LV6A 1NVWQ 4UQOA 4WZBE 3SBEA 1KKMA 5IK2A 4BLQA 2WWGA 3K0FA 2YNMA 3CR8A 2ATVA 4M1MA 4TQ9A 1Z6AA 4Q4LA 3CH4B 3C41J 4URVR 1M74A 2A5JA 2NPIA 3EZ6A 1WMSA 4AKEA 1G1MA 1GG2A 4IVQA 4AKIA 2FPMA 2ZAOA 3B1WA 4W9MC 1EGAA 3AF1A 2F1JA 4IDPA 4ZDKA 5KSZA 1XX6A 4IRUB 3VX4A 1XNJA 3K0AB 1XEFA 2WV9A 1VG0B 4B3XA 4TL8A 1TEVA 1YJ5A 2KBEA 3V4RA 2QRZA 1NKSA 3T06B 2C9OA 3RVBA 3CRVA 1J8YF 2OXRA 1KAOA 2EWWA 2GVZC 4D82A 2VBCA 4DT1A 1T5LA 2AHOA 3B2EA 3UMFA 1LF5A 1UJ2A 4CIDA 4LUCA 2ZEJA 2IYSA 2IS4A 2WJIA 2EQBA 3LX8A 4C30A 2VTKA 4TYWA 2FH5B 3U7GA 1E2MA 4QGFA 1Z0IA 3RAPR 5G3ZA 1KO1A 5JBQA 5JSZB 3D31A 1Z29A 2IK8A 3BB4A 4YLGA 3BB3A 2ZR9A 2GZHA 1N6IA 4P32A 3DO6A 2ZIAA 2WVJA 4Q9IA 5KNCA 4DEYA 2NOAA 2E87A 1RFLA 4HAVA 1RZ3A 4B47A 1RYHA 1DAFA 2ZRCA 3EC1A 3QXJA 4C0LA 1AKYA 2FG5A 3IBYA 2J7KA 3PUYA 4C3ZA 2WPDD 1KYIA 4FMDF 4YMVA 2FSIA 3RC3A 1G7SA 4FINA 4RZ3A 3U3RA 2WJYA 3LV8A 4M1YA 3BD9A 4IEEA 3AUYA 1O3YA 3Q5DA 2RGXA 1AN0A 2OLKA 4JS0A 5KSPA 2RGGA 4Q9KA 1E2DA 1FX0B 1IONA 4U02A 3L0OA 4KODA 5TB5A 1XTQA 1M7HA 4NYMQ 3RANA 2ZJ2A 3A1VA 1OYWA 2JAQA 3ADKA 3A6PC 4D0LB 5J4LA 3KUCA 2IYYA 4KFTA 2ODWA 4PFSA 1C9KA 5JJLA 2IUTA 3ND8A 4NCIA 1Q20A 2ZI9A 3ZD6A 3AVUA 1OH8A 4XVRA 1UKZA 1KDOA 2PX3A 1JPJA 3BH6A 2D06A 2DHRA 4FIDA 4HEJA 4O2RA 5FFMA 5JI3E 3FYHA 1KJYA 4B2PA 1E1RA 1R5NA 4GOJA 1DS6A 5G53C 4D81A 4BZXA 2ODEA 3GP8A 1KDTA 4NMMA 3UMSA 4I1SA 5CYOA 2Q3MA 1ZNWA 3A1TA 3WHKA 1N6NA 1N0UA 2HT1A 1WE2A 2ZRHA 2C98A 4JL6A 1GAJA 2ZVQX 4LV8B 5CJPA 5K8TA 3KTAB 4BECA 4GOKA 4I99A 2WIBA 2UZ3A 4MH0R 4WZAE 1HA3A 1MRNA 3W6NA 2DWPA 2FSGA 3QEJA 1GRQA 2ZI7A 3HWSA 4Q9HA 1GVNB 1N0VC 4Y0VA 2JEOA 3VR1A 1ZC4A 1XPUA 4F7WA 1KK0A 3QVVA 1XDBA 4HSEA 4LHWA 4UJ3A 1DAMA 2PMDA 1II8A 3U3OA 1IN6A 2ZYTX 3TVDA 3AV0B 2Q3HA 4LZZA 3U6BA 3GLHA 4BFZA 2B6HA 3IO5A 2CJWB 3CR7A 3DOFA 2YOHA 1T4GA 4RD4A 3KTAA 4I4LA 3LNCA 3TUZC 1OH7A 1XEWY 2WKPA 3P1JA 3IIMA 3J81k 5F9HA 4L15A 1ZAKA 3NBFA 3LFUA 5JS8A 4C0KA 2ZXUA 1XXHA 1E79A 3EAQA 1SXJB 2IEZA 1ZU5A 4MRRA 5CK5A 2CVFA 4CZ2A 1E4VA 1TQDA 3S1AB 3IQWA 3TH5A 3SDZA 5E95A 3GLGB 2DYKA 3TVTA 2ZRDA 3A4MA 1LVGA 3SJZA 2XB4A 2W2VA 4W5HA 1SKYE 5L3SA 1A7JA 4M1KA 3OZXA 3QXSA 4NPHA 121PA 4HB2A 2CLDX 4OQXA 2BMJA 1P62B 3T1VA 4A8JA 4C0JA 2CE2X 3W5JA 4FWIB 1AS3A 4RD2A 1FFHA 2R65A 1ZM9A 3NBZC 4V0OA 1AM4D 3KKOA 3CX6A 3FGNA 1XTIA 2VSXA 2FN4A 4RZ2A 2ZE5A 3TUJC 1N6OA 3AVVA 3IPXA 1SZPA 2N46A 4TTQA 1Q44A 3C8UA 5C2JB 3BXZA 2JLQA 8OHMA 3TIFA 4C9BA 2HYIC 3KKQA 2OFWA 3MWLA 3IHLA 4LWZA 2ONKA 2HDNB 1D2EA 4YC7A 4O25A 2HUPA 5DISB 2ZSEA 4URXR 2BHRA 3DPUA 2WKQA 2MSDB 4RFSB 5TARA 5HZHA 4DLRA 1EFHA 1ZD9A 3L0IB 4NHOA 5M04A 1X8JA 4QGHA 2IS6A 4LJYA 5EE0A 2FA9A 4JL5A 1RRFA 1U8ZA 1NY5A 2OCBA 1R7RA 4QBHA 1E2NA 2GTPA 4QHYA 3CBQA 4TL6A 1W48A 2OG2A 1OIXA 2BIFA 3A4NA 3B7GA 4URWR 3THXA 3K9HA 4HB0A 4WVFA 4WZ6A 1G3UA 2BOVA 5H8WA 5DIFA 3H0KA 4Q4HB 2IX3A 4FW9A 2CCJA 4M0LA 2ZRGA 1IXSB 4E22A 2Y8EA 2IXGA 2VH5R 3LY5A 2ZU6A 3M4YA 5AR1A 2FFBA 1S1CA 2VP5A 1GOTA 1GILA 4XVQA 2FEMA 1FW6A 2OESA 2P5SA 1N6RA 2JDIA 1JEEA 2CHQA 4F93B 2ZSDA 2XZOA 1YZLA 4ESVA 4EQ6B 4DUGA 1LFDB 1S9HA 4V02A 5FTMA 1Z63A 1Z22A 1P75A 3TK1A 5GADl 1Z28A 1ZNYA 2DPXA 4II7A 1NF3A 1GKYA 3CWZA 5K8LA 1EG7A 4OHXA 1KI6A 1IOZA 1LTQA 4Q03A 4IOJA 2V6JA 5DI3B 1ZYUA 2ZQ5A 2NQ2C 4LC0A 3T1TA 1OH6A 3VHLB 4MKIA 3SQXA 3B9PA 2OT3B 4ERNA 3TW8B 4DKXA 1G8YA 4A36A 1KZ7B 4V0MA 5EE5B 2G0TA 1XBTA 4NYIR 4JKYA 3HPQA 3Q7QA 4TZ0A 3IQXA 3LQQA 4B6EA 3HU1A 2GJ8A 2C2HA 2RB4A 1W49A 2Z4SA 2WJVA 1OIVA 4X8OA 2QZ4A 1SGWA 3ECCA 5GJBA 2XJ4A 2H8KA 4U00A 3UANA 3TAHA 4A0RA 4CEJB 3AKEA 3AH8A 3OEHA 3A37A 3FHOA 3AVPA 3C16C 4PC2A 3MJRA 5DHAA 5JRJA 5L8VA 2A5FA 4PTLA 1WA5A 3IDQA 1I4LD 2B7CA 1R4AA 2IYLD 1KI9A 3L0SA 1N6HA 3B9QA 4URYR 1H8HA 4B35A 5JRZA 3EZ9A 1CR2A 1E9AA 3H84A 1R8SA 3C4JA 2V3CC 1VHTA 2IYVA 2H7VA 2MMGA 3IIJA 3QXCA 3LW8A 1Q22A 1R0WA 4DBLC 4JMPA 1EFRD 3LDAA 1OW3B 3CF0A 1E2IA 3P27A 4B76A 2WOJA 3RSOA 1MT0A 4A8JC 4M9ZA 2PT5A 5IT5A 1ZP6A 1VYTA 4LCBA 4PX9A 4HUQB 5DYGA 1NN0A 2KWIA 4NCHA 3SI7A 1E6CA 2IWHA 5JEDA 2E9SA 1IY2A 2YC2C 3I62A 2B7BA 3FMPB 4ITRC 4WIAA 4A2QA 2JCSA 4F4IA 2GF0A 1EFTA 3R7WB 1GNPA 1G21E 2AK2A 3C5CA 4FMCB 4P0TA 3KFVA 3B6EA 1T8TA 3GJXC 1NSFA 2NO9A 4Q7LA 4AD8A 1E9EA 1NN5A 4PO9A 4DLXA 4KXFB 1CJMA 2RHMA 4XVUA 1UKVY 4LBYA 1U9IC 1YRAA 1F2UA 2D7CA 2WAXA 1FL9A 4B32A 4DLWA 2UZIR 1D9XA 4Q5IA 3RS5A 3KXLA 1Y3AA 2IW3A 3EG5A 3BBPA 4LPKA 3U44A 3TRFA 4ZDIA 5CDFE 4A0FA 1E2EA 3O8DA 4AK9A 1XP8A 4AY2A 5E7MA 1AK2A 4OK6A 4TT3D 4A6PA 4LRWA 2XOKD 1AIPA 4KLNA 2AX4A 1IY1A 3CF6R 1S1MA 1W4BA 2O8DA 2DCUA 3LLUA 2CBZA 1XJ0A 3GLHE 1F2UB 4PZYA 4QBGB 3RSLA 1OJLA 3VMFA 2PL3A 2AWNA 2G77B 3BH0A 2V8OA 4AG6A 5E7IA 1G64A 4RD1A 4Q1BA 1ZJ6A 4BQSA 4QHSA 3I72A 4PZLA 2JIZA 1TMKA 2FX3A 3U61B 1GZSA 4H1UA 4P33A 3ZVLA 4QM6A 1Q1QA 1GIAA 3AP1A 3FKSD 4ZCMA 2Q21A 1HE8B 4HZUA 2GKSA 5GVSA 3U4QA 3MCAA 4DCUA 2NG1A 2P0EA 3PEUA 4Q21A 4QBIA 3ZZTA 3VKHA 3O47A 3TW4A 3U3JA 2FGKA 4GP6A 1E0KA 3SZRA 1F6BA 2QENA 3WNDA 3AVXA 1WP9A 4IVRA 2P6NA 4OI2A 3SU8A 1IAQA 2A5DA 4AWXA 1DE0A 5FTLA 4TYNA 1D2MA 5CB6A 1A82A 2OCYC 3WY9A 2VP2A 4ZIRB 1E0SA 2ZE6A 3QXHA 3WBJA 5TMPA 2DR3A 3LBNA 3DL0A 1E3MA 2A5GA 2P65A 2ZYWX 1XEXB 3CPHA 4HAZA 2JLVA 1MO6A 3JZMA 5BXQC 3U4QB 1HUQA 1DG1G 2XSZD 4XWKA 4RD0A 2EFDB 3PUVA 3UK6A 3W3AA 3R9XA 2QPAA 1Q1ZA 3FB4A 3HR7A 2W6JD 3RS0A 4B3GA 3VU9A 2J0QA 1P9NA 3E70C 1NSTA 1WCV1 1COWD 3MG9A 3SFVA 4PO1A 3WMEA 3TBKA 5ELXA 2IWRA 1A2BA 4Q4AA 1FP6A 3P20A 1CJKC 1CJVC 1P9RA 2ZSBA 1WQ1R 2REOA 4HAUA 2WTUA 4KVGA 3CZPA 5K8IA 3QVUA 2N42A 2ZYUX 4M1WA 2OCAA 4LI0A 4NCKA 2OSBA 1XEXA 2IYRA 2WSSA 4PXAA 2OXCA 1RW4A 3HYRA 4R98A 4B34A 3DKPA 4A82A 5EP4A 4HUTA 1NN1A 1ZRHA 3SS8A 1V5WA 2QY9A 2J7PD 4N1AA 4PHHA 4NE2A 3QI2A 3AQ4A 1G6OA 2PJRA 1VCIA 3AF4A 2JLSA 2GXUA 3CNNA 4QNRA 2J46A 4PHFA 1E2FA 3QPUA 4TQUS 5HPYB 2PBRA 2YOFA 1X6VA 3DMDA 4YDSA 2RGAA 3QF7A 1N6KA 2IYXA 3GQBA 1N5JA 1W47A 1SVKA 2JLRA 4FMDB 2XXAB 4TZ6A 2BM0A 1R8QA 4Y0AA 5EZ6B 2XGJA 2WHXA 1ZNXA 2BMEA 5F9FA 1EWRA 5KDLA 2ZRMA 2G0NA 1R0ZA 2IYUA 2V54A 5CLLA 1JR3A 2CVHA 4NCNA 5IDVA 2QGZA 4PC1A 5KSOA 3JZAA 4KBGA 4K8OA 2D2FA 5FOVA 1G3MA 3ZZ0A 4PC7A 3GMTA 5FUXA 4NU0A 2ORIA 1UM8A 4X8LA 3QIAA 3PUZA 1HT1E 2GAAA 3ZIAA 2RGNC 1OPXA 4H9GA 1SXJD 2IXEA 1M7BA 3B1VA 1IJEA 3MRSA 4LJ6A 2XXAA 1HQCA 2IBMA 2CK3A 3GJ0A 3FMFA 2H1LA 4HI0E 3VR5A 1OFHA 1RPZA 2O8DB 2FOLA 1YZQA 2ZI3A 1CKEA 4G5RA 1Q3TA 1GM5A 4IW3B 2YWFA 4G5OA 3ZYCA 3RRNA 4TL7A 2EYQA 4AI6A 1R5BA 3D6TB 1YQTA 3B85A 4OI4A 3BORA 5EJEA 2BBTA 3BFKA 1ZM2A 1PZNA 4A2WA 3O8BA 3GLFE 4CYMA 1KI4A 4M53A 2BV3A 3TNFA 4RZXA 2ZE8A 3CIOA 1E2HA 1XB2A 4L5BA 4IOMA 1HT2E 3TSWA 4G01B 4P31A 2QRNA 2A9KA 4TMZA 3X1XA 1NVXQ 1ZCBA 1O87A 2X8AA 5JECA 4B6FA 4G5SA 1VYUA 1GL7A 2QI9C 2H5EA 4QJ3A 4FMCF 5JHHB 4BE7B 3PVSA 5JWRA 2F6RA 2MMCA 4LV5B 1F48A 4C7OB 1Q21A 2EWVA 2OEPA 3EXAA 1WB9A 3T12A 2FE4A 4KITB 2WKRA 2OFOA 3BERA 3K8YA 3KJGA 3NBYC 2IF2A 1BKDR 4XOIA 1T0JB 1YZKA 4TYPA 1LS1A 2IF0A 2R8RA 4LYAA 1E9RA 3MSXA 1P2UA 5EP2A 4O2LA 4TLAA 1CP2A 5AUNB 4IFEA 5TY0A 2FGJA 2IYWA 1CTQA 4Z1MA 3DM9B 2AD5A 2W83A 4D4KA 3QKSA 3PR1A 4CEHB 1KSJA 3RNLA 4EFLA 3C15C 1MO4A 3CW2A 1TPZA 4A9AA 2VPPA 2ZI4A 4RFVA 4MGKR 3MAAC 2CHGA 3R8CA 4Q47A 3VKWA 2DBYA 1WDTA 4A2PA 3I32A 3F5FA 1XD9A 4IKEA 2GWHA 2HCJB 3CO5A 2QBYA 1ZCAA 4B43A 4PHTA 5FL7D 3EIHA 4XD7D 4CEJA 3RC8A 2JA1A 5JFGA 3KUDA 4PANA 2Z5FA 1TF5A 1SVWA 2IUUA 4DB2A 3A36A 4IVPA 2C03A 4L9WA 1AZTA 1NBME 1H8ED 2WM9B 5BN4A 4IFBA 1C1YA 1II0A 1P60A 2ORVA 2OV2A 5G40A 4D6PA 4QJ4A 4BRWA 1T9HA 3CPEA 3W34A 3E1SA 2I3BA 3LQRA 3HJNA 2JLZA 1Q0UA 1E1QD 5FOTA 2VSFA 2YVUA 4RY2A 2C04A 2C96A 1KJWA 1M6NA 4A92A 4CEIA 1IN8A 1QRAA 2QP3A 5IRCD 1CXZA 3CNOA 2QBYB 2BJWA 5EP1A 4D4JA 1XZPA 2HEIA 2YWEA 3IIKA 4A15A 2OBNA 5H68A 1P7CA 1MOZA 4DT1B 2V1XA 4BLPA 2VSOA 4Q01A 1DEKA 2Z43A 3ZS9A 1IM2A 4BEJA 1TU3A 2VO1A 5FOWA 5EP3A 1KI3A 1H65A 3K53A 5CJ2A 5BYJA 1E4YA 2AXPA 1PLKA 3T5DA 3BK7A 3WXMA 4L4UA 2JLYA 2L0XA 3P4XA 5E4FA 1FUKA 3GJ5A 3Q72A 4JLBA 1CBUA 1CJUC 1N6PA 2PCLA 2ZRBA 3EASA 5F98A 3BIFA 1CU1A 2FF7A 2TMKA 1XMJA 4W5JA 3BGWA 1NN3A 4C2UA 2XNDD 1U99A 3D7MA 2ZETA 3B1XA 4OK5A 4HB3A 1I4TD 2RGNA 3OEED 2ZPTX 3TQFA 1E9BA 2RH5A 4MQBA 5SZHB 2ZVPX 2EW1A 4MKGA 2AFHE 4A8JB 3LO5A 4EPVA 1YU9A 4JBYA 2GXAA 4MDEA 1Z0KA 1SVSA 1JQLB 2G3YA 3RWOA 4TMTA 4N3NA 3KQNA 4JVNA 1E9SA 2G1JA 2W6IA 4LBVA 1HURA 3DEFA 1KO8A 2ANBA 2J7PA 1FP7A 1AS2A 3EZ7A 3OAAA 4TMWA 1CEEA 4RCZA 1YZUA 4JT4A 4LPSA 3CRMA 2DWOA 3BE4A 3L8YA 1Q1EA 4MKFA 4OHWA 1IN5A 1ZINA 1WRBA 2QPOA 2GAOA 2WSSD 1KSGA 3TUIC 1A4RA 1BS1A 4Q9LA 3MWJA 3R9IA 1BYUA 2W2XA 5C4MA 3GLIB 4UNSA 1J90A 2NO0A 2QUZA 3BJIC 1W0KA 1FQJA 3RYTC 3VAAA 3RHFA 1X86B 4YDHB 1W4RA 2JLUA 1SHZA 2F9LA 4F38A 3CRRA 1F5NA 4UNPA 1NRJB 2VP9A 1F2TB 2W6JA 2WMNB 2O8BA 2PMKA 2FZ4A 1YR9A 4M2LA 1XJQA 2DFKB 3VQTA 2J0UB 2XSZA 5FTNA 1ZVQA 4KO8A 4JLKA 4QJ5A 4OK3A 1DARA 3ZS8A 3WBKA 1XTSA 4US2R 4DIEA 1EX7A 3N2IA 4AC9A 4B3CA 2Z4RA 2C9YA 3MLEA 4JLOA 4B3DA 1JR3E 3FPAA 4LHVA 1OXTA 3GFPA 4DSOA 3T61A 4EDHA 4P4SA 4JJZA 5E3HA 3VKGA 4YMWA 3X1YA 3AUXA 4RSGA 1OLOA 2QP4A 4E03A 3W9YA 1G41A 1RJ9A 1CJTC 3REGA 3AP2A 2D62A 5AJZA 1MKYA 2A2ZA 2DFNA 4CGZA 1TTTA 1YHNA 3K0CC 4JBXA 1XPOA 3RS3A 521PA 2DFTA 3G82C 2FZLA 3FOZA 2QE7D 4Q4JB 4XSHA 2ZE7A 2BBOA 2QT1A 4A4DA 4DDTA 4B2LA 1NMYA 2J41A 3RS4A 4QC2A 2BBSA 4Q1FA 2PLRA 4ZKDA 2NMVA 2REXB 2Q9CA 2O8CB 2YC4C 3OIUA 3QG5A 1VIYA 2JLWA 1DAGA 4Q9JA 5HE8A 4D4LA 3AVOA 1P4SA 4GRAA 3BS4A 3X2SA 2GXQA 4Q1EA 3AF3A 2DWQA 2P6UA 5FBWB 5KOYA 3IKJA 3SC3A 1JPNA 4KJZA 2GETA 4JSTA 4PHGA 3KKNA 3I8SA 3TKLA 1UF9A 1UDXA 1Z6TA 5J4HA 1U2RA 3VHXA 5JWHA 1A5TA 3IPYA 4D4MA 3SYNA 2C99A 2BEJA 4GZLA 4OHYA 4LBZA 2PZFA 2O8CA 3KQKA 4Z51A 1DELA 5FTKA 2Q6TA 1BIFA 2ANCA 3Q9LA 1KHTA 3AP3A 4Q7MB 4S2EA 1HQYE 1U9IA 3TAUA 2CE7A 1TQ4A 2H18A 3ICQB 5LB2A 1CLUA 3B60A 3P4YA 1XTJA 3GFOA 3RLFA 2WWFA 3IO3A 4FN5A 4X8HA 3WYAA 3FHTA 4B3BA 3BAFA 4JYBA 3K09A 1FTSA 1RC8A 2P67A 3LWNA 1BMFA 3SOPA 3E5HA 5JWOA 1FNNA 3SEAA 4FI3C 1Z2CA 2EFHB 4EFNA 1HTWA 1MABB 5L3RA 2FEOA 1OHHA 2PLFA 1QF9A 1IN7A 3B78A 3ZGXA 2W00A 4BLOA 1JR6A 4MRPA 2JLXA 5JJIA 1NIJA 2BEKA 6Q21A 2W6ID 3PIRA 3SYLA 3NIBA 3KL4A 1W0JD 4HUQA 4JVSB 4PQRA 1Z2AA 5FR2A 4HLUC 5IF9A 3LXRA 1HH4A 3U5ZB 1KK3A 2BDTA 4NDZA 4EKDA 1QHYA 3KJIA 4IDHA 2BMDA 2I4IA 1W5SA 3IGFA 4HDCA 4JLDA 5SZIA 1IN4A 1SVOA 3Q3JB 4KCGA 3QEOA 1GL6A 3ADDA 2GESA 4IEIA 1OFIA 5GJVC 2HCBA 4D26A 1G5TA 5C1BA 1DTSA 1Z3IX 4BFYA 4EJSA 2ZM5A 1VG1A 2JJ8A 5B30A 3LVQE 1FUUA 4Q48A 4RD3A 3WHLA 3HU3A 5B58C 1QVAA 1GFIA 3RRMA 2IA5A 1Z0DA 1DOAA 4NZYA 3X1ZA 1VECA 4OBEA 1UBEA 1J2JA 2O5VA 3CF2A 3KXIA 3C14C 4XH9B 3VR6A 3K9NA 1QHXA 1NKTA 1E2JA 1XCPA 2OO7A 5DGXA 3OEHD 3IEVA 1IJFA 1E2LA 1Z6GA 2OFXA 1G17A 1P2VA 2F3TA 3O8RA 4TL9A 4I81A 1KO4A 4ZKEA 3ASYA 1U0JA 2ORWA 1XD8A 5GJCA 1JAIA 1FTNA 1FPMA 3SR0A 3UKDA 4DCNA 2ZR0A 5CIQA 1E1QA 1RRPA 3BOSA 1D8TA 3X1DA 4NONA 4C0SA 2YWGA 2AL7A 2GCOA 2XZPA 1RJ9B 2F7SA 4AYTA 4DDWA 1XFAA 1S4QA 2J45A 3BB1A 2VRWA 1G3RA 5HCNA 4P4TA 3W5IA 4YMUA 4MRSA 5FPTA 5AUPB 4WW0A 4PZZA 1GUAA 1JALA 3RABA 3CM0A 1KY2A 1BO6A 5KNDA 2QTVB 4JLJA 1Q1BA 2EVWX 1E94E 2MSCB 2ONJA 3B5JA 5FTJA 3LW7A 4DLYA 3K70D 4PAMA 4ESHA 1OKKD 2GK6A 3SBDA 4CEHA 1ZD8A 2RGBA 3KZ1E 4CRWB 1KI1A 1W0KD 3K70C 1Z0FA 4KFUA 3WMFA 2ZRKA 3QKRA 3FKQA 4B73A 2RCNA 5H70A 2GJAA 3KDSE 3K9LA 3ND9A 1KTVA 1G5RA 3HP1A 4Q19A 2ERXA 1KMQA 4AYWA 2QTFA 1NLFA 4BPBA 2O8FA 2WJGA 3OAAD 1RE0A 1CR1A 4DWJA 1KNQA 3U7HB 4PAQA 3F3YA 2QQ0A 1OE0A 5FI1B 2JJ2A 2XTZA 2ZRAA 3M0EA 5JMTA 221PA 1EFUA 4DEXA 5E7JA 2XTNA 4QM7A 1P5ZB 1NLZA 1G18A 3QKRB 4ZCLA 4HLDA 4CT5A 2ZJOA 5DN6A 1GNRA 3P32A 3OEEA 2PZEA 4WBSA 3T5GA 5JCPA 1W7AA 5A4JA 3FVQA 4DLTA 1G7RA 2V7QA 1JB1A 3QPWA 1IY0A 2J5XA 4V0KA 1GKIA 4ARZA 1UKYA 2REBA 4DHEA 4BFVA 2CLCX 2RMKA 3KKPA 4PC6A 2IYTA 5GVRA 4OHVA 4XD7A 4WA7A 5D3QA 3PQCA 5CB8A 3K0CA 3M1IA 4IDNA 4UNRA 3T1OA 3IUYA 2VF8A 3FMIA 4ZO4A 1ZUHA 4EPRA 2CK3D 1Z5ZA 1G20E 1W36B 421PA 4TWZA 4LJ5A 3SNHA 3KB1A 2R6FA 2G6BA 3W8RA 3VNVA 4URZR 1U81A 4Z1MD 1QDEA 1XTKA 3ZIAD 4M9XA 2IHBA 1XZQA 3QJYA 2AR7A 2QN6A 2ZREA 5FL3A 1P2SA 4AIIA 3THWB 4GPTA 2EFGA 2YJTD 3OIYA 1YKSA 3H1TA 2QL6A 3HPRA 2XITA 4RFSA 1GL9B 4L8GA 4KYUA 4JLMA 3AF0A 1II9A 1DAKA 4P3YA 4R9UC 2WSMA 4CT4B 2OUKA 2WAYA 2KI5A 2V7QD 3TE6A 2GCNA 3JVVA 1XPRA 5AJWA 4PPFA 1Z08A 3I61A 3EX7C 3CRQA 3UATA 1JBKA 1OKKA 4IDOA 5DLQC 3ZZUA 1T3LA 4E07A 5TV2A 1G9XA 2NPFA 4TMXA 4MDFA 5JJKA 3GCGA 2KJQA 4YXWA 2WWHA 4URUR 1VDZA 3ZH9B 1I2DA 4BUJA 4DLZA 2NIPA 1TADA 3IHWA 2YYZA 1U8AA 2ATXA 1TF7A 4IOKA 4POAA 1W46A 5DI9A 1ZNZA 3R8FA 1K5DA 3TMKA 4Q1AA 1D6JA 5F2EA 2VHJA 2F1HA 2GEUA 2D7DA 3LVRE 1B23P 4UXHA 1NVVQ 1XMSA 3GLFB 2F1IA 4LJAA 3AM1A 1DG3A 2GBLC 4ZIRA 1D2NA 3ADBA 3RDPA 3VNUA 4AYXA 2YOGA 1DAEA 3TR0A 5CITA 4Q02A 2R62A 3A1UA 5DI3A 1Z0AA 4OHZA 1W44A 3E2IA 3GLHB 1EK0A 3EPLA 4HLCA 2PEZA 2OAP1 2H92A 4DDVA 4ZI3A 4KSCA 3WRXC 3B13B 1COWA 3GJ3A 1CF4A 4LYFA 4GMXA 2NGRA 3GJ8A 2HF8A 4OJQA 4TTPA 2F1RA 5TXGA 4EJSC 1SXJC 3KKMA 3RWMB 2CL7X 2ZJBA 1D5CA 1VCMA 4N0EA 1R10A 3S1AA 2OZEA 3H4MA 1QBKC 4JSYA 3W90A 1VG9B 1QHHB 2OAQ1 2ZR7A 2R9VA 1AA9A 1KMHB 3NEYA 3SHFA 1DADA 2HXSA 2ZRLA 3LLMA 3THYB 1G8PA 3V9PA 4DCSA 3VTKA 2NTYC 2J87A 1KK1A 5AJYA 2KB0A 2AXNA 2QG6A 1Z6YA 4B71A 3EWAA 1P61B 1YZTA 4FCVA 3X1WA 2O8EB 3V4FA 1U0HC 1ZM7A 4JYCA 1W4AA 1LS6A 2C77A 2CLSA 3QF4B 1G3IA 4LYHA 1R6BX 4YONB 4KVAA 2GHIA 2GEVA 1Z0JA 4MRVA 3REFA 1TAGA 4LJ9A 1N5IA 4LOAA 2JJ2D 4UJ5A 4KU4A 1HE1C 3THYA 2D4HA 1E2PA 1XEWX 4KBFA 3SQWA 3U7FB 1RRCA 2PJZA 2QU8A 3BH7A 1TQ6A 4R71A 3A1WA 3OESA 2PCJA 3AKDA 3ETLA 1LNZA 2NO1A 3WYFA 1G5PA 1G8FA 1S8FA 1SVLA 2AKAB 2OE2A 1GNQA 3AKYA 5D3MA 3L82B 4IOLA 2VIIA 1MV5A 1TNDA 4Q7KA 5TDHA 3VR3A 2H16A 3EW9A 3IEUA 1KY3A 3H2YA 4KI0A 3MWYW 3VR4A 1KNXA 4PQFA 3TGPA 3U3KA 2FWRA 1P2TA 5KPJA 1SVIA 4W5WA 3SJCA 3ZQJA 821PA 4OI0A 1AGRA 3LRPA 2O0KA 2FPLA 4M9QA 1T8UA 2OBMA 1FMLA 2WWXA 4QBFA 4DLSA 3TSZA 5FPYA 1M2OB 3I8XA 3HR8A 5JZVA 1PUIA 3GFTA 5CDFA 4UKDA 2GJKA 4NP6A 1R0XA 4M1OA 4NCJA 3AGPA 3T35A 1M1YE 1PJRA 2AFIE 4NTZA 1W0JA 1DO2A 2WOOA 1F2TA 2O8BB 1S0UA 2PX0A 1NMXA 2O0HA 3QKTA 4TTRA 1E9CA 2W58A 4HLQB 2BVNA 4YQFA 3Q5EA 2B8WA 3RS7A 1G7CA 2CXXA 1T3HA 1XMIA 2BKEA 3LD9A 2HLDA 2C5LA 1S9DA 5FBRB 1DAHA 2R6GA 1VPLA 5EXTA 1C4OA 1LY1A 5AK0A 1G19A 3PG5A 3OIVA 3N2EA 1BMFD 4OI1A 4D80A 4A0HA 3H86A 4FMBB 1SVMA 5G3YA 5LD2B 2B92A 5FUYA 1MO3A 1UBFA 1X8KA 3OFNA 3VR2A 1XRJA 2QMOA 2ZJZA 2ZJAA 4DC9A 4ACBA 3CLVA 2QSZA 1S96A 5JLJA 1E0JA 1Q3HA 1MH1A 4IDQA 2W2TA 4BGDA 1AQUA 4UNQA 1SQ5A 2GZDA 2G83A 5KO2A 3UWKA 4LC1A 1EFRA 2JIZD 2VLIA 1A1VA 5EXSA 2A5YB 3NBXX 1AGPA 1XWIA 2GZAA 4M9SA 4QG7A 3FHCB 4HZUB 3F8TA 4QGGA 4Q4HA 1VKJA 3NC0C 4PPQA 4DJTA 5JS7A 1DBSA 3SHWA 2YWHA 1FMJA 2HV8A 2ZUCA 4AG5A 4Z8XA 4E5UA 3FFBA 5L3VA 5K8UA 2CEAA 1T5IA 4Q18A 2GK7A 4LJ4A 3U2QA 5AUOB 2F9MA 3QKSB 1NJFA 1K6MA 1YZNA 2C9CA 5BW8A 2G1KA 1PUJA 2GRJA 4PSVA 4US0R 4PAOA 5FPHA 5FPSA 2KE5A 1KK2A 1JECA 2OBLA 1BH2A 3PITA 4EQ6A 4JKIA 5J4KA 4L9SA 2J59A 2O52A 4W7SA 3W8NA 4QOSA 2ZS7A 2VA8A 3QNUA 4L16A 1XXHE 2VP0A 2QP9X 4PQYA 1K5GA 2P3SA 3I1FA 4BZPA 1KI6B 4JLVA 1TU4A 1NVUQ 4NKRA 3KFXA 1UBGA 1JNYA 1X1RA 2FFAA 5JCZA 5BWMA 3THOA 4U7DA 4NYIQ 5G41A 1XD2B 4HAXA 5LB4A 4AKHA 2Z6VA 1OHHD 2O8EA 2ZU0C 4DCTA 1S2MA 1P72A 2OM2A 1ZIPA 1W2GA 2CDNA 3I73A 4MYUA 4LX0A 4ZDWA 2IYZA 2CMKA 2OLJA 2JGNA 4MGIR 3KJEA 4Z8YA 3U3MA 2EYUA 2BC9A 2IXFA 1FNMA 3KB2A 1Z06A 4DSUA 3OIWA 2VHCA 4TQAA 4CEIB 1R0YA 1N5LA 1CRPA 4ZV4A 3GLGE 4HLUA 1Z47A 1WBBA 4TT3A 2ODNA 5L3SB 2VEDA 2G9NA 4NBSA 3U7EB 2GBLA 1OT3A 2PEYA 2JJ1A 2IEYA 1OB5A 4KHZA 1E69A 4QRHA 3ZDQA 1WXQA 2KBFA 1KDPA 1GRNA 2J3EA 1AZSC 4GBMA 2QQEA 2VP4A 1HEIA 1OXUA 1T0HB 4QHTA 3F0TA 2Z83A 4G5QA 4XWOA 4CW7A 1S3SA 4TLCA 2DFLA 1F3OA 3I3SR 2Q0HA 4XTCS 4US1R 4TYQA 1H8HD 2IS1A 4ACAA 2BCJQ 4LBWA 2GILA 1TX4B 2CL6X 4CF7A 3B1ZA 4FD2A 4O3MA 1X3SA 3AEZA 1DVRA 1ZC3A 4EUNA 5C18A 4WAUA 4ASUD 3KXKA 4LHXA 1OXSC 4LDJA 1OIWA 3GPLA 4DCVA 1SULA 1Z8FA 3NH6A 5IHPA 4NYMR 2Q9AA 4RZUA 1VCOA 4EFMA 4LHYA 5EUMA 4RKEA 4TN1A 2YINC 4BASA 2GVDC 2RGDA 2ZYVX 3FDIA 3GJ7A 3LBIA 1G4UR 1OFTA 3R7WA 4UXIA 2B21A 4KFRA 1EESA 3PENA 3SJAA 4EPWA 4JBWA 2D74A 2YZ2A 1JEDA 2XJ9A 3THXB 3ADCA 4UNNA 3FWYA 4I1VA 1H8EA 2VQSA 1UADA 3GEEA 2ZITA 1E99A 5FI0B 3B1YA 5HTKA 5UKDA 4HDQB 3EC2A 2F43A 5TVKA 1D9ZA 3EZ2A 3QXXA 1GP2A 5SZKB 1QHSA 3QKUA 5FOXA 3NH9A 5HCIA 1P9WA 1QZXA 3FE2A 2QT0A 4EPXA 1LF0A 2CL0X 2R2AA 2QAGA 1T3SA 3HYTA 3AVWA 2Q3FA 5AUQA 3U44B 1VYVA 1A2KC 3SJBA 1JAHA 4DUGD 5KHOC 4PO8A 5ANRB 3DOEA 3GEHA 1YE8A 3MWKA 4TMKA 3UG7A 1ZUNB 2N1BA 4AKGA 2QAJA 4MGZR 1U0LA 1ODFA 2CNWD 4PPGA 4BLSA 4LJ8A 1DO0A 2GCPA 1HYQA 1W36C 4DSNA 2XX3A 2QPTA 3I4LA 4QNMA 1CULC 4CDGA 3ONWA 2VL7A 4BFUA 4RD6A 1L8QA 3TSOA 2KSQA 2J1LA 2QAGB 3BWDD 4B74A 4C7OA 1N2CE 1NJGA 1E9FA 1UDWA 2C95A 3PUWA 5KTYA 4MYTA 2J0SA 4X8MA 1KI7A 2QM8A 2ERYA 2RGEA 1E2QA 3TJZA 5AJVB 2FFQA 3PXGA 1J8MF 1QG4A 3NWJA 1V43A 4YXWD 1BYIA 1U94A 1KDRA 4GSYA 3SE0A 1XJCA 3K9GA 5CK4A 2ODBA 4R7ZA 3ZVRA 4GFDA 1XD2A 4JLAA 3CX8A 5CLQA 1IXZA 1XMVA 3KJHA 2YKGA 4XWAA 3CZQA 4KV9A 3EZFA 1W36D 1VIAA 2XNDA 2X2FA 5KPDA 2XB2A 4BFSA 1TL7C 3NHAA 5FBQB 3QUSA 4QL3A 3R9WA 2X19A 1EX6A 2E1RA 5B57C 2PH1A 1VG8A 621PA 4B33A 1II8B 2A78A 1UAAA 1LB1B 1E1RD 4GNKA 4A1FA 2LKCA 1G16A 2J0VA 1UEIA 5EE1A 2DB3A 4V03A 3RRYA 5DNYB 4JVMA 4GT1A 4EPYA 4R2HA 3SYKA 2C78A 3C7KA 3VU9B 1ELOA 2SHKA 4PPNA 1DPFA 1NVVR 2LKDA 4OQFA 1G3QA 4Q7JB 3UWOA 2JATA 3QE0A 2C8VA 4LGMA 4LHZA 1SXJA 2IT1A 1S3GA 4C0BA 2WJHA 3QOFA 1G4AE 5DSZA 5BQ5A 5KDOA 3A58B 1W4CA 5J5CA 1ETUA 2ZRIA 3GLGA 1NG9A 4HDOB 3U6KA 1ZD1A 2RKOA 3EA0A 4HZIA 3PEWA 1FOEB 4TLDA 4XSGA 3U60B 1AS0A 4BLTA 1IHUA 3LAWA 4RJLA 4FCTA 1N25A 1RRGA 1NBMA 1PLJA 1ZBDA 2VF7A 2WPDA 1FZQA 5FL7A 1IQPA 1TQ2A 1Y63A 2V9PA 5DN6D 5EQTA 4KAXA 2ZJYA 1GITA 1NLYA 3VX3A 3AKCA 2LCFA 3CB4A 1E2GA 5EE9A 1ZW6A 3HDTA 5P21A 2VHTA 1L4YA 1GRRA 2I1VB 4ILEA 4OQMA 4GOXA 4DIDA 4EJSB 4KFSA 4DZZA 1FX0A 1GWNA 4M4SA 4XIGS 4ARZB 2ZS9A 5BYKA 1YVDA 2F43B 2HXYA 4RKFA 1JJ7A 1R2QA 5FPKA 3W6PA 1KKLA 3DM5A 1TUEA 2QGNA 2FSHA 5CM8B 1JR3D 1G8GA 1RYFA 5FBVB 2V4ZA 4M8NE 3AVYA 3T15A 1CRQA 3ZLJA 3DHWC 4B2IA 2AN9A 3EPKA 3GJ4A 1ZU4A 1RIFA 1N6LA 3HU2A 2ZUBA 5LDDC 3NVAA 2HT6A 2H17A 2BBWA 2X1VA 1TUIA 5FH9A 2QROA 2G88A 2FNAA 1KAGA 1SKYB 3K1JA 4DB4A 2IYQA 2MSEB 2ZRPA 2AKYA 1QG2A 1MO5A 1OXXK 2GA8A 2BCGY 5EXPA 1JI0A 1G6HA 3B8HA 1NY6A 1ANKA 3QG1A 3QSYA 4FCWA 4TYYA 4I1OA 1NMZA 1US8B 2EFEB 3A8TA 3WRYC 4BEBA 5IK2D 2GNOA 3ZVNA 1SHKA 4EPTA 2GJSA 3L43A 3P26A 2HJVA 1G7TA 2QAGC 1KSFX 1J7KA 3I5YA 2X2EA 4F92B 5L3QB 1E98A 2CJWA 1I2MA 3MUFA 4P4SB 3RRZA 4BRUA 4B75A 2XEXA 2QORA 2EU8A 3ASZA 1ZUIA 2OILA 3PCRB 4ZI2A 3L2OB 1XXHB 3L0PA 4D0GA 2RGCA 1E9DA 4JLNA 4LYJA 4Q4AB 3GLFA 1US8A 4M22A 2ZAMA 4Q4JA 1L7VC 4GDFA 1KOFA 1T6NA 4ZPXA 4YMTA 1ZM3A 3EPJA 2A7QA 4DLVA 4LJ7A 3LA6A 4F4CA 2ZI5A 4LY6A 2QM7A 2FJUA 5FOSA 1KO5A 4Q1DA 3N5CA 2IUSA 3FTQA 1FQKA 2R44A 4Q66C 4V0NA 1AJEA 2AK3A 1KIMA 2UVQA 1KI2A 2XOKA 2FSFA 5D3MB 3TLXA 1YRBA 2RHDA 4FWTA 4WXPA 4OQNA 5KDDA 1XCMA 3K0AA 2GJ9A 2V55B 4Q1CA 5DE3A 1EWQA 1EXMA 1UBCA 3CPJB 1NI3A 5KSYA 1NIPA 4P4UA 1B0UA 2J9RA 1GKUB 1ZIOA 2OHFA 2VP6A 4HB4A 3FKSA 3WYGA 1LW7A 3IILA 1JJVA 2ECKA 4HYYA 5BN3A 3NDPA 1Z83A 1P3JA 3NKVA 4WOPA 2O0JA 4EAQA 3Q85A 5KU1A 2FPKA 3ZVMA 1TEXA 5DYIA 4BFTA 1UPTA 2WIAA 3K0SA 1EFCA 2LWIA 3UIEA 3CX7A 1CR4A 2D2EA 3OE7A 3KQHA 3LXXA 4DXAA 4PR0A 1XCGB 1NBMD 3MGCA 4RCYA 2QMHA 3WP0A 1GSIA 4J0QA 1OYYA 2NO6A 2YHSA 3IBGA 2RAPA 4QKQA 4DDUA 1UKEA 3CKLA 4LK2A 2HF9A 4BLRA 5C46F 4V0LA 1SKQA 4G0NA 2F55A 4C2TA 1KSHA 4D0NA 3GLIA 3EWSA 4HAYA 4AURA 1E2KA 3B82A 3THWA 1JXMA 2A3RA 2V6IA 2WMOB 2WWWA 3GJ6A 4D25A 2K5UA 3PV0A 4GZMA 1LV7A 1M8PA 2IC5A 5BN5A 5DHFA 5AWFC 1ONBA 3NEJA 1OH5A 2W0MA 4EIWA 5DO9A 3EIQA 3WP1B 2XAUA 4IXMA 2WICA 4PC3A 1RKBA 2FU5C 2IS2A 4OYHA 2A30A 2QNRA 4NH0A 3KQLA 2R6CA 3QY0A 3K70B 1U90A 4QFMA 2YV5A 1W1WA 3DMNA 3I5XA 2VHQA 4LSGA 1QHGA 3SN6A 1T91A 2Z0MA 4DLUA 4JIMA 3SFZA 1HY3A 1RVDA 3LBHA 2WZQA 2P5TB 3LX5A 3UMRA 2QE7A 3D3QA 3L8ZA 2AD1A 3A1SA 1KO7A 1QHNA 1CIPA 4IJMA 4JVLA 4B44A 1OFUX 4MKHA 3I92A 5EXXA 1OB2A 2ZROA 2BKUA 3W3ZB 1KGDA 1IXRC 1G291 1J70A 4DRZA 3CNLA 4G5GA 3WNCA 2HYDA 4KLZA 3UG6A 5L3QA 1AQYA 5JHGB 2IL1A 1N0WA
chains in the Genus database with same CATH superfamily
1KZ4A 4H35A 3ZWKA 4X66B 3W6OA 1KJZA 2HCTA 4EW6A 2HC9A 3DONA 4HWGA 2NVWA 3C3EA 3B1FA 2ZXEA 3PFWO 4LI3X 1HV8A 5T5QA 2H6EA 4KE8A 1Y42X 4M36A 3ZW7A 3M5DA 3PWKA 2QYTA 4TXHA 3T6KA 2PUBA 3OZ7A 3KPJA 3MJ4A 2O23A 2JHFA 2M6RA 2J0UA 4O4LF 3Q8XB 2ZDQA 4QLOA 3ESBA 1QK5A 3ITKA 4OL0A 2EBHX 4INOA 4WZAB 2XTMA 1P6XA 4B4DA 3AC0A 3OF5A 3QBTA 3IAS6 3DD5A 1XKLA 4KL8S 3MMPA 5E6RB 3NHZA 1ODTC 2OD9A 3NG1A 4INZA 1XF9A 2K87A 5FF9A 5HF8A 3R7NA 3K6RA 3PJRA 3U7QA 2XRYA 2QJWA 4H0FA 4ZT7A 3O2JA 4HDNA 3UYKA 1P91A 4WY8A 3NONA 4O4JB 3VTZA 4ZK6A 4A5OA 2WT4A 5LQKA 3PHIA 3JQ9A 2ZSIA 3NXSA 1PYOA 1E1CB 1VRWA 5LBIA 4UQLA 1UBTS 1J5XA 4KHPB 3NDBB 1IRIA 3G2NA 3PPWA 1G2PA 3QF4A 3K0BA 4LWPA 2O59A 5D00A 4S24A 1KYVA 3C5HA 2I4MA 2PU7A 5H5JA 1KPIA 1IMJA 4IL5A 5EGSA 2ECQA 2WAAA 3HNOA 4JIGA 3SG0A 2XMBA 4ND6A 2I6QA 2ZS8A 5KYUA 2IOQA 3DT9A 3VI4B 5D84A 3VC1A 3RSQA 1AXGA 2CFSA 5F2NA 5IZCA 5AVWA 4DKJA 3HB0A 1KEZA 3D8BA 3T99A 4DXDA 2P9HA 3DEZA 1CS4C 1CZNA 1ZHHA 1T2UA 2Q1XA 1F38A 3EOBI 2MOKA 3R1IA 2FDCA 3AVTA 1ZK3A 4NZOA 3TM5A 1KTIA 2BMFA 2ZIVB 2OCPA 2JFHA 2ZYSA 3OM9A 4RKYA 4KPYA 5CW1A 2XUFA 4ZODA 3DZ8A 2R6AA 4HHEA 1KZGB 5HA5A 5B3KA 1UWKA 1Z5PA 2QLTA 3KDPA 3LH5A 4CLDA 5C52B 3NT4A 3E5RA 2PT6A 3OWHA 1RXSA 3H11B 3IJRA 4FBLA 4QSMA 1WF6A 2ZWOA 4IDGA 1E96A 2G9RA 3F6EX 5KYUB 4GR9A 4Z5XA 1F12A 4KVZA 4AJKA 5HKKD 1KETA 1OI2A 1W5TA 3DV0A 2V4MA 2YV3A 4KDRA 1VCNA 2RHLA 3ZQ6A 5B64A 5JZMA 5ITVA 4S35A 4EGCB 8LDHA 1TZMA 3OY2A 4OX9B 2FV8A 3L1HA 4GSLA 1VPWA 3QQ5A 4CF4A 4R51A 4ARBA 4AP5A 4DNOA 2RI6A 1LLDA 2RHOA 1UFQA 2QTHA 2X58A 2ZI6A 3PF9A 4JC8A 4RQTA 2H2FA 2IUEA 3DE1X 3A7DA 4BV8A 4J90A 1U63A 1NG1A 2GF2A 4V0SA 3VFDA 2L42A 3RIHA 5BSVA 2NZ8A 3F74A 4UBMA 4F91B 5JSZA 1CYEA 4I3FA 4I9UA 2W0SA 5BO5A 3EPHA 5JEEA 2H57A 4MITA 4LF8B 3SMVA 2VAWA 3N86A 2F64A 1J2RA 5ALXA 4RMIA 1OLUA 1Q7CA 4XUCA 3K0EA 1WKVA 5BXQC 3AR5A 2DWCA 1YL6A 5J4VA 1LPNA 2X5JO 3MLBA 3M7IA 1P44A 2XHZA 2PRYA 4CUZA 1P73A 3JQEA 4DQLA 2QSYA 1QRTA 2VJAA 4C6TB 4P98A 3PA6A 1AUXA 1FRQA 4XM1A 2RJOA 1GGEA 1VLZA 4KGXA 4M9UA 4X1IA 2W22A 3TZBA 3J81A 2WSLA 4PRZA 2CUTA 4YMSA 5A0FA 3TR5A 3V1NA 2JD1A 2ZTMA 4N8SA 5TS2A 2HJGA 3IL2A 4MQEB 5CH3A 3ROTA 5HJEA 2WIDA 2PBFA 3OHMA 4OFBA 4PLWA 1GCAA 2B4QA 3VOSA 3WGMA 4F2WA 3LCJA 1YDHA 1AXEA 2JD2A 4N0DA 4WNAA 5EPEA 5G0SA 2NZUG 3ENZA 5C35A 1AB6A 3NX4A 3TZLA 3YASA 5KCZA 4UEJA 4GMFA 3OCJA 2DG2A 3AJEA 3I1JA 3JQ6A 1WF3A 4GEGA 4N8DA 4K8RB 4S0ZA 4BZQA 2QUBA 2C7QA 4XM2A 2E18A 2B8NA 3B2NA 3DMGA 1IEVA 1Z68A 2FPXA 2FCAA 3T1QA 3ZE9A 1JFSA 1XZAA 1N9GB 1YH3A 4GI7A 5T4EA 3GNSA 4U2DA 4C7XA 3OFKA 3EOZA 1NYRA 3DZDA 2GA9A 3KB8A 4KDCA 3C98A 3HMKA 1ESCA 1C5KA 1EVJA 2J85A 3L7LA 3K1AA 4IYJA 4OOEA 4C0AC 3NTUA 5E2IA 1WBDA 2D1FA 3BFPA 3N7TA 4OHBA 1PNRA 1F6WA 1OGJA 3EEBA 4EY4A 1EZZA 4MRNA 1Z2NX 3V9AA 8ADHA 2FSPA 1F1JA 2QA5A 3C6BA 3EEYA 3BFVA 4WNAB 4ZCTA 3T41A 4R2IA 2VJKA 1RPTA 1SCJA 3P8ZA 4PYIA 4AQ7A 5HE9A 2PQMA 3WLAA 2PZLA 2ZTLA 2HU8A 1U80A 2C2OA 2VJYA 4GNRA 4FOTA 1OXVA 3I9V6 3CW8X 1TF2A 4KEAA 2VR1A 2RKBA 2HHCA 3IURA 4M1EA 3H1EA 4RIFA 3H1FA 3QSGA 5EWMA 3VDRA 1D2CA 1F8XA 4JT8A 1MXFA 4R3NA 1MAWA 2CY0A 4KYTA 5KAPA 5JJCA 4NYJR 1EINA 2CCKA 2OCXA 1LK5A 2XWJI 3NTXA 2ZRFA 3W1WA 5KQLA 1LWNA 3QU9A 4BP3A 1MJFA 1JF8A 1T9BA 2I8LA 4MRMB 4C4RA 3W5AA 5CLJA 5K51A 4ENTA 1LNSA 2QTVA 1L4UA 2CZCA 2QW8A 2XCLA 2YJNA 1GTL1 1OF1A 3LX6A 5EIOA 2XKAA 4X90A 2O2YA 4GZ3A 3VH1A 3AFIA 3HN7A 4JJKA 5IK2A 1GY8A 5L9AA 3HXMA 4M1MA 5JO0A 2FHSA 5CVVA 1Y9DA 4FS8A 4EHIA 4Q4LA 4XB6B 3OU6A 3AOGA 3GEMA 1RFGE 1M74A 1QGUA 2OD7A 1NRIA 2BEWA 2RHHA 4YIKA 2ICAA 3W8DA 3INTA 3DPSA 2W6MA 3B6ZA 3UA3A 3Q8MA 2CXRA 4TUYA 3F71A 2VNSA 2F1JA 2HMAA 4ZDKA 2HIMA 4IRUB 1TA0A 1N8TA 3K0AB 2YIMA 3Q3CA 1XEFA 1YNOA 1VG0B 1EA5A 2BAGA 1U2DA 1YQGA 3C6KA 4QASA 2JHPA 3G0IA 4QUEA 5KTKA 5DCLA 1FFGA 2QRZA 1PW7A 3H99A 2C9OA 4N5IX 5FB3A 4DA6A 3V4RA 3RVBA 3CRVA 4RETA 2WF8A 2P7HA 2X8JA 3AHGA 1UZMA 4YRFA 1KAOA 2VA9A 3WB0A 4DT1A 5ALIA 4ESEA 3IAHA 3G8YA 1Z8HA 4FNOA 2P4UA 3SQLA 1YIOA 5BSMA 1U0GA 3ZOZA 2UZ1B 4C07A 5C81A 2NU7A 3QA9A 3EGWA 3U7GA 1WDKA 2CLMB 5I4BA 4KTTE 5ALQA 4BJHB 4MGHA 1K5HA 1R6XA 1Z0IA 3RAPR 5G3ZA 1KO1A 1MAAA 3OE1A 4GYJA 1YQQA 5MN5A 4MVJP 1QWOA 3R76A 3ISVA 2XHEA 3C5WP 1DKQA 5JISA 2CDRA 1MIOA 3A3OA 3ITDA 2ZIAA 5BMOA 3ID6C 1VPEA 2NOAA 3ROXA 4B47A 1RYHA 4LNHA 4DAEA 2EHDA 2F4NA 3A4TA 3EC1A 1URPA 4IQ4A 2ZGVA 1O5OA 1W34A 3G68A 3L4EA 3QXJA 2CLOB 3MWDA 2FW9A 1XMXA 1TK3A 1CC1S 2J7KA 3PUYA 4C3ZA 4TV9F 4GKKB 1YK1A 2FSIA 2ODPA 4D8WA 5GWXA 2NYRA 4RVSA 3QU2A 4RZ3A 3WL6A 5JXHA 1PI3A 1RZVA 3M8KA 2YIVX 3P9NA 2NQ8A 1Z37A 3AIOA 3LCVB 1NQVA 6ABPA 2B1JA 3Q5DA 3G0CA 5GV7A 1AN0A 4QFCA 1KMCA 4U7GA 3H9GA 2QRJA 4U6QA 2P3LA 4EUSA 2PTGA 2PWZA 3PC3A 2RGGA 4MS1A 2GCIA 4IDEA 5ER9A 4ZCSA 3SSMA 3U3ZA 5IANA 1DDOA 1E2DA 1M1YA 1IONA 3AIKA 1E6KA 4HEHA 4IGEA 5FTMA 1UWVA 4D4IA 4DMUB 4NYMQ 5CBPA 1M5TA 2QRQA 2HN9A 1U2ZA 2LNDA 3A1VA 1HLDA 5TRTA 2A92A 2NSHA 2ZM6B 1KS9A 3ADKA 4ZGWA 1XQ9A 2P1RA 1OI3A 2WT9A 3KUCA 5DSXA 3T5AA 3DE5X 3V8VA 1L8AA 1T4CA 1Q20A 1ZMOA 2P30A 1NRWA 2P9CA 3IMFA 4HQ0A 4J1QA 3UV6A 4KWTA 5AKEA 4BB9A 1OA0A 4XVRA 5EVJA 2GN6A 3KSRA 4KNWA 4ZAGA 1YULA 2A8YA 1NW4A 3F9RA 3JYNA 4OLJA 1QX3A 5E1DA 5AM0A 3ZI0A 3CVOA 1KJYA 4GRIA 2I91A 3ESRA 4OLHA 1DS6A 1I7NA 2ZRQA 1N3IA 2ODEA 3LC2O 5G53C 3VOTA 3WLJA 3D6VA 5KMGA 4NMMA 1NJ8A 3HCCA 3G9ZA 2Q2QA 3STTA 1R6AA 3BE6A 3UMSA 5BV1A 2Q3MA 3A1TA 4V2IA 1B8OA 3WHKA 4ALLA 2OY0A 4EB6B 3JWGA 1EUQA 2O0MA 2CV0A 1J2EA 1WE2A 4JL6A 4PSCA 3CEMA 2HT1A 2ZVQX 3I34X 5LXTA 1P4HA 3EXHB 3JAWA 4UE3S 1TAQA 2X4IA 3PDIB 4GOKA 3WOHA 1VL1A 5BN4B 3SGLA 3E9QA 4WZAE 3LIIA 3KZXA 2XVAA 4HN9A 1QSGA 2FSGA 3G85A 1CUAA 4XB2A 1GRQA 3HWSA 4C4ZA 4J0IA 1OYOA 1JFLA 2VPZA 1O57A 2HBZA 3R5JA 1IHOA 2AF4C 5KYGA 1Q7BA 2ON6A 2OFFA 3QYAA 5AM1A 1H5UA 5FLXA 1EHIA 2H4HA 4BKRA 4UJ3A 1JHVA 2PMDA 1DQNA 4N0QA 1NJ1A 5CH5A 3D0RA 2R2GA 3JYOA 3ER8A 3EFOB 4CN8A 4R1QA 3CT4A 4RD4A 1T4GA 2V7WA 3EXHA 3JAWB 1Y3IA 3KTAA 4HDRB 2PA3A 1W88A 1XEWY 3L9WA 4AZ0A 1IHDA 3SFTA 5B5SA 5B7GA 3QWIA 3J81k 1ZAKA 4MUJA 4HSGA 2ES4A 1FSZA 1O7JA 2A4MA 5YASA 3FYSA 1L7BA 2QQFA 1GLGA 4KQ2A 4ARIA 2IEZA 2H07A 3PCXA 3VTAA 5KVQA 4C3UA 2NP7A 4C08A 1E4VA 1CE8A 3WGJA 3H3JA 1TT5A 2I5PO 1ML4A 5E95A 4F2GA 3TVTA 1FS5A 1PWZA 5HIKA 2IVZA 1KR2A 3PHGA 1JG4A 1VKRA 3GNQA 1ISHA 4HEA6 3ZZMA 1JGTA 1NONA 3MN1A 4G4SO 1SKYE 1XYYA 2GASA 2JB9A 2YV1A 3NC4A 3TD9A 5GONA 3OZXA 4HQNA 3O94A 4HB2A 3VU1A 2YNMD 3T1VA 1ZJWA 3I23A 5E0KB 3NUZA 4WKNA 4YQZA 4EYQA 4FX2A 3T9EA 2ADFA 5I9BA 1Y37A 1XI2A 4RD2A 1ZRSA 5JSYA 2RONA 4ZOAA 1VDMA 3TJRA 1H2YA 1AD2A 5ITWA 4M8IA 5HQ3A 5CCEA 1JHRA 3FGNA 5LQJA 1XTIA 3N0XA 3M6LA 3ISTA 2O5CA 5DGDA 4RZ2A 1NKVA 3KT0A 3TUJC 5CUQA 2XQGA 1NAHA 8GPBA 1ZI6A 4BNVA 4KX3A 1NOIA 1Q44A 5C2JB 3AO0B 4CI0B 2COUA 3TW6A 2FLKA 1FQWA 1WPRA 1MIHA 2OFWA 4IF4A 2FZVA 3IHLA 3NV7A 4HJXA 4Y0NA 1UT6A 2X0NA 3DSRA 1D2EA 2QY6A 4CMEA 1JHYA 1G6Q1 3HO8A 3P52A 3CBGA 4M98A 4Y6QA 1P18A 4URXR 1J33A 3DPUA 4Q4DA 3CJTA 4S1PA 1U7OA 4RFSB 2R00A 1OTXA 4PYRA 4ZJUA 5HZHA 3MTJA 3C3DA 4MHTA 2ZQZA 3BHJA 4Y9TA 1I6KA 1U8ZA 5AFSA 1JAYA 1E2NA 2GTPA 2XTAA 2P35A 4QDKA 2HK6A 3JYLA 4OO3A 1QONA 1NFRA 2H0AA 3IEKA 1M0SA 1W48A 4K28A 5IBPA 3VV3A 5FLKA 4I5IA 4DBVO 1WB9A 2W6CX 4K9MA 4L1KA 1KOLA 1XG5A 1G3UA 4BKMA 1LH0A 3ROEA 2WABA 3TXXA 1M83A 1APBA 3KAJA 1E7MA 4E22A 4WDQA 1QR6A 3C1OA 4N82A 1PWXA 3SHTA 2VH5R 3L7IA 2NVBA 3LY5A 2LD4A 3SDSA 1PFYA 4ZQHA 2HSJA 1S1CA 3H04A 1GOTA 1IK6A 4QT4A 1EJBA 2WD7A 3EXIB 3OQ1A 5IKMA 4NEQA 1JEEA 3I2KA 4MWTA 4ESVA 1KC3A 2A9VA 3F3MA 4EQ6B 3RRBA 1Z63A 1P75A 1S8AA 1ZA1A 2O2JA 2ZYDA 3NYWA 1HM5A 4N9QA 3RYCB 1RXVA 3HH8A 5GADl 1TOAA 2J4DA 5ULLA 1FLDA 3WLKX 4II7A 4HGRA 4MQ5A 4EO4A 3LT5A 1BRTA 4OHXA 3WTBA 1K86A 1U1IA 1LTQA 1W35A 1XTZA 2PAAA 1DAOA 2W71A 3UAXA 4E51A 2A9JA 5KINB 4LC0A 1JWBB 2CXPA 3T1TA 2ZUWA 4TRRA 4A16A 4BN5A 3HA7A 5AVRA 3B9PA 4BO2A 5JCOC 3D8UA 1J42A 4JFAA 4RGVA 5A1JA 2QD1A 5EE5B 1JN0A 3L7CA 4HNRA 3RS9A 3WLSA 5IG2A 4TZ0A 1JV2B 3URKA 5K9ZA 1GYQA 5ICCA 2ODQA 1RWQA 1V96A 4CG0A 1C50A 1OPRA 2XMCA 3EOAI 5M34A 3CCCA 1UFRA 5JC1A 2PBZA 4YBRA 4NOJA 2OHXA 1FXUA 2EG9A 3BWCA 3K2QA 3F7NA 3MJRA 3NDJA 3EFOA 2R79A 3FVTA 1WA5A 2R96A 2G06A 3IRUA 1I4LD 3ETHA 5IAAA 3LT2A 3C1UA 3T7SA 4MS4A 4DYHA 5T41A 3ZNNA 1R4AA 3IT2A 1ZXBA 2YYSA 3L0SA 4DJJA 1PL7A 1Z3CA 2QWXA 1N6HA 3NTVA 3RIEA 4KNVA 1LBEA 3ICWA 4WT7A 5BXYA 1X74A 4IIUA 1Y4DE 4DVJA 5INTA 4GC5A 2CXHA 2Y0DA 3A05A 5JRZA 3EZ9A 1Y7TA 1CDDA 2I6XA 2Y1KA 1E9AA 4TRJA 1R8SA 1K7SN 2YHUA 5J5VA 2IYVA 4G2NA 2C61A 5FDFA 2BYTA 3C6MA 3I1IA 4UOEA 4IMJB 3A3YA 4MW7A 3IIJA 3LW8A 3PDHA 4G41A 1R0WA 4LIPD 3KT3A 3TZCA 4DBLC 4JMPA 4XLTA 3G2KA 4D3FA 1GEEA 1EFRD 3DH0A 1OW3B 3LDAA 1PKXA 3HCNA 4OAOA 5HS6A 4EUEA 4A8JC 5JYBA 1L5WA 5EHIA 2BRUA 4OXNA 2VYQA 3TRDA 5ALOA 5DYGA 1NN0A 3K1YA 2KWIA 4NCHA 5KS2A 5LJLA 4OU4A 4UCWA 3OLYA 1UPXA 2IWHA 1NUHA 2KX7A 3I62A 2GCGA 1IHXA 3KD3A 2ZFUA 4EKIA 3UHOA 1C0LA 3DWEX 3ELUA 4H7HA 4E30A 4UAVA 1MN6A 1EFTA 4X3CA 1GNPA 1G21E 2AK2A 3C5CA 4FMCB 3NQ41 4RLSA 3GJXC 1XC7A 2NT3A 3KQMA 1NN5A 2Q3LA 1NV8A 2AYZA 1Z2PX 3QLTA 2RHMA 4R0MA 5IJWA 3CLSD 1PJLA 3LPDA 3KSMA 2WLSA 3VSCA 1LPAB 1YRAA 2D7CA 1ZL2A 2WHQA 1KEEB 1D2GA 1R88A 3IRVA 4LOIA 4Y7DA 5SY6A 3TLKA 4B6PA 2BFFA 4B32A 5LQCA 1D9XA 1CDZA 4Q5IA 4LKRA 2GCEA 1VMDA 4P84A 4TX1A 5J23A 3B9BA 1EE1A 1MOQA 1SCUB 4N7BA 7ABPA 4AK9A 4YRIA 3QE9Y 2O9JA 4QDJA 2IDZA 1OFUA 1PW5A 1SU6A 2C9MA 2I1WA 2P75A 5H3LA 4OK6A 3ZDYB 1UPAA 4UUNA 2HMUA 3IC5A 7GPBA 2W7TA 3OEWA 1T4DA 3R0VA 3A3KA 3FOWA 4OXRA 3LUPA 2VK1A 4RMNA 4Z2AA 3AVUA 2BHLA 4M89A 1L7PA 1W6UA 3UK2A 5DLYA 5JQGF 3AIIA 1T3TA 3W2TA 3EJWA 2P11A 1AU9A 4HDMB 2DCUA 3GMIA 3LLUA 2CBZA 1XJ0A 4L8YA 1BOOA 5BQ3A 4PZYA 2BGRA 1V7CA 1OJLA 2G4CA 1SZCA 1N9GA 2FAXA 1KYTA 4P2BA 4WADA 1JPUA 3AV3A 4AG6A 4MV3A 5E7IA 1G64A 3OCUA 1KFBB 1V3UA 3I72A 2JIZA 4PZLA 2WYHA 2JIBA 3ZLUA 1M0EA 3E3OA 1DKMA 1XZCA 2FX3A 3U61B 2FUKA 5PGMA 1VB3A 1Y6RA 2ALJA 2YRXA 3ZVLA 1ODCA 4RHTA 4AIRA 3AP1A 1CQIB 2IP4A 3S70A 5TIIA 5MHTA 1UXGA 4QM6A 4LXYA 3FKSD 3JR3A 4ZCMA 5JO9A 1X7WB 3MB8A 3BXHA 1W76A 1C3JA 1XPUA 4YV2A 1ZJ4A 4XVCA 3E8XA 3O5AA 3O4JA 4L6AA 2NG1A 3QUTA 4QBIA 2FXIA 3UXEA 3USZA 3ZZTA 2C7OA 5DHRA 1FYWA 2CD7A 2O1XA 4E15A 2XNHA 2IEDA 2UV8A 3SZRA 1DUSA 2W90A 2VWQA 1E62A 4L57A 3NHJA 3SU8A 1RMYA 1MXHA 1MC8A 4O33A 4RK5A 3HZZA 5H59A 2XE7A 2PT9A 4AWXA 2GRUA 2WB2A 1RWKA 1GN8A 4H4EA 4AQYB 1MJGM 4G4JA 5CB6A 3GMSA 2PWAA 1A82A 3JQ7A 3WY9A 3ZV5A 2NTJA 4CKWB 3OJEA 4PZ0A 3DVAA 4NQZA 1GR0A 2FG7C 1GAWA 1ODLA 5HNKA 1XEXB 3D5EA 1XCBA 1FYFA 4R2LA 5TR9A 3AX6A 4AS1A 1EQAA 2I2XB 2EFDB 3SIWA 3PUVA 2Y6UA 3B3AA 4G0OA 4WDRA 1WZIA 2QPAA 3U7QB 4XYLA 3IP3A 5EMNA 3VU9A 3ROMA 2WJWA 1HXHA 3E70C 3FG9A 4F72A 1COWD 3B6MA 3FJYA 5F1OA 5BRAA 1HMYA 1F3LA 1MG0A 3GN1A 1XR3A 2ZQYA 5ELXA 1SIUA 2IWRA 4C2AA 3P20A 2OWDA 3COYA 1XVLA 1QIMA 2REOA 4HAUA 2RB5A 5FBKA 4N9WA 2BLLA 2XF2A 2NZ2A 4WV3A 3VO9A 5K8IA 4Z49A 3L5KA 4UTOA 5LP6F 4QG3A 2ZPAA 4OH7A 5EINA 1FJGB 5KX5F 4CE6A 1MF7A 4H0CA 1EWTA 2OXCA 1I4WA 4W1QA 5EP4A 3TSYA 1POXA 3JZIA 1MPXA 2FRXA 3ZTTA 3ZY5A 2FX5A 3FJOA 1AQNA 3NHWA 4NE2A 2EJTA 4LNUB 1GPUA 4XD2A 3RSSA 3TZ6A 3V97A 5F7XA 1C2YA 1YBAA 1RYEA 2C7VA 4H3KB 5IH7A 4D92A 1YTUA 1EVYA 2C4UA 1A7KA 1FZTA 1Y3FE 2NUAB 3IOYA 4K9OA 1Q11A 3I45A 2ZTHA 3FFXA 2XXBA 3KYDA 4X61A 2UXBB 4FWBA 3ZK7A 3WKDA 4E4RA 3AHDA 3EIFA 1TO2E 2PBRA 3NI2A 1PQUA 4I5EA 1X6VA 2R87A 2VHWA 3DMDA 4OP3A 4YDSA 2X3FA 1TQ8A 2PS1A 5HJ2A 4BV9A 4F0JA 1NMSA 2EF0A 2F3QA 4RIIA 2H65A 2AHRA 5MGNA 1ZXLA 3DTYA 4TGLA 5ERGB 5EZ6B 2XGJA 1ZN2A 2UZ0A 5EIAA 1ZNXA 2BMEA 1NVMB 5F9FA 4NNJA 2OB2A 2YN0A 3Q11A 4HMOA 5KDLA 5BUSA 4YJKA 3DMTC 3TLCA 2PGJA 3NOQA 4GPZA 3COWA 3QJGA 3AONB 4RGBA 5G4KB 5TC4A 3D4BA 3JZAA 5J1TB 4BCCA 4GGPA 2UUPA 1G3MA 1PT6A 3JQAA 3KUUA 2IU3A 1DJNA 3GMTA 3GOQA 2ODAA 1MRZA 5DYWA 5IN4A 1WXGA 1UM8A 1YWGO 3QIAA 5D3KA 3ICCA 2WVGA 1FDUA 2GAAA 4QPZA 5ER6A 2DOKA 2H4JA 4FKMA 1J25A 2IXEA 3N2KB 5DLEA 3F7TA 3CN9A 4MVJE 3C3BA 1Q74A 1RLIA 1XJ5A 3L1JA 3QWAA 4QT0A 5TSDA 2IBMA 3GFBA 5H16A 3FMFA 3GZNB 3HM9A 2ZW9A 3RHSA 4N76A 2H4WA 4LN1A 1STOA 2QJRA 4HI0E 3NDRA 5FAXA 3VR5A 1BHO1 1R5JA 4HDMA 1NC1A 5L4SA 1NLUA 2ZI3A 3F47A 4PNEA 5G0WA 2MINB 2QDKA 1KQPA 2ZAIA 4IO0A 3LYHA 4G5OA 5DGIA 1GM5A 3WJ2A 3FX2A 1KQFA 1JBEA 4GF5A 1PWYE 2PQ2A 2QQGA 3AG6A 4MI6A 3QTTA 4TL7A 4X20B 1BX0A 2JVIA 2NU7B 3RNOA 2XNJA 3ZDXB 1RC1A 4D3SA 4AI6A 4EKNB 1P1JA 4YMGA 4OI4A 3DBLA 4FSHA 3ZGYA 1JSCA 3BORA 4E32A 1OR8A 3BFKA 4A2WA 4Z7JA 1PZNA 5BURA 1RHUA 1WKCA 2EV9A 2YUIA 3ZGNA 4CYMA 1LBHA 1KI4A 1PR4A 3H13A 3CIOA 1E2HA 4D9BA 4L5BA 3ZNPA 3DLHA 1FYXA 1JNXX 1GL3A 3EY9A 1L5OA 3H5OA 3WLOA 4WD3A 1GGVA 1U7XA 3R3ZA 1U3GA 2A9KA 2VUSA 1SHLA 2AFHA 4AX8A 4EZEA 3KVOA 1BXRB 5JECA 3H83A 3T7JA 1IVYA 2I9KA 2EGHA 4NAUA 2P4QA 2QI9C 4GI5A 1BWRA 3GAMA 4UOQA 4ZOLA 3IOMA 3RVQA 4PNHA 2WF5A 3AR8A 4LV5B 3PRKE 4HXFB 4C7OB 2W6QA 4IGIA 1MAVA 2B6NA 2PV7A 3ZV7A 2WKRA 2OFOA 1EUYA 2B9VA 3P2KA 4DDKA 1TGVA 1OD6A 4G1BA 3MUEA 1YT5A 2O3JA 3OP1A 4J75A 3UXYA 3C8HA 3DL2A 2XLCA 2Q0SA 3SF8B 3UK1A 3PL5A 3SZLA 5JNLA 1E9RA 4B7AA 3QWBA 1P2UA 5CPBA 4OQYA 4NX2A 3N53A 4M0UA 4P3XA 3U4AA 1CP2A 3VNAA 2AR0A 2FGJA 1OJ7A 2A0FA 2D5IA 2IYWA 2QRVA 2H2HA 2Y77A 2PSEA 3DM9B 4RYDA 3RK1A 2AD5A 2J9XB 2M1ZA 2RDMA 1BD4A 1MOPA 2W83A 3HEAA 3L4SO 1FBTA 3QKSA 4YV0A 3PC8C 4EFLA 1MO4A 5EIEA 2PK3A 2W2KA 2ZI4A 3ANYB 4MGKR 2CHGA 2DR2A 5B7QA 2IDJA 4ZQIA 3UB3A 3G13A 3VKWA 3ZCTA 1PN3A 1KIFA 1FFEA 3RLIA 1CW2B 4G67A 3F5FA 3RF7A 1XD9A 3SF8A 2GWHA 4PLFA 2P3OA 2AI3A 4BNIA 3TFOA 3BE5A 3IAXA 4JEHA 2JA1A 2WJ3A 1U9CA 2PIDA 4B09A 2Z5FA 1G1AA 1I3NA 1SVWA 3V7FA 5BNIA 4DB2A 2OPHA 4IVPA 2C03A 3ZJVA 1PK8A 1H8ED 3C24A 2TS1A 2WM9B 1NR5A 5K3OA 2VUIB 3MLAA 1C1YA 1O0BA 1P60A 1BW9B 5G40A 4D1YA 1SUFA 3V1UA 1GRCA 3C3PA 2EOAA 4KMRA 1UXHA 1ORDA 3UN1A 4AZSA 4DDMA 1A8UA 3N5KA 3PUHA 1MEEA 3IBSA 3IKTA 3PQ7A 5DSTA 5FOTA 2WAOA 3ZHUA 2P9ZA 2VRBA 4RY2A 2YBEA 1UC8A 4DE5A 2BUCA 1SEVA 4MARA 3BZUA 1KJWA 4A92A 3EF1A 2Y4OA 4CEIA 2QP3A 1T5BA 2RGWA 4D6YA 3CNOA 1L4BA 4OSPA 4RGYA 4JGGA 4I8DA 4WXMA 4PLPA 5C5EA 2HEIA 2OBNA 3FYUB 5CT5A 3COJA 1P7CA 3STWA 2IX9A 1MVNA 4OMCA 4DT1B 4BLPA 1YRWA 3ZS9A 1IM2A 4IJVA 2VO1A 2X2OA 5FOWA 2AMLA 1H65A 3LY8A 4LC9A 5CJ2A 1E4YA 4MUYA 3HJBA 3WXMA 3UV3A 5E4FA 5CLGA 3GJ5A 3LRXA 2Q49A 4MJ3A 1M67A 3VNBA 5F98A 2ZRBA 3EASA 5B36A 4JYAB 2I6SA 2JAHA 4KMSA 2TMKA 1XMJA 4EBBA 2NADA 2WTNA 4PCUA 5H9WA 3CLUD 1U99A 1EQUA 4RWZA 4EO9A 4EG8A 5H81A 3RTDA 3K9WA 1E9BA 4PYLA 3RM3A 3R0IA 2MR5A 2QJTA 2OYRA 4CGYA 5CXQA 4MKGA 2W6OA 3U62A 2XVMA 2QRLA 4KG7A 3K5HA 3LO5A 3X3HA 3Q40A 4JBYA 2WZCA 1A27A 3PEFA 4MDEA 1JQLB 1XQ6A 4TMTA 4D43A 2FDRA 3GUCA 2VWHA 4JVNA 4CKYA 1ECJA 2XIQA 3OHPA 4DR4B 1RKXA 5K4GA 1QXSA 3V80A 1O5IA 1Y1PA 4OXQA 1V4NA 3K9CA 1AS2A 1LRLA 3EZ7A 4JUDX 5SYMA 1TYAE 3CRMA 2CB9A 1VRCA 4CIXA 3IELA 2BGWA 4BNJA 1IN5A 1H0KA 1KSGA 3IDOA 4HXGA 2P91A 1SCDA 5ISMA 2M32A 2Y4NA 2H31A 2LZ0A 5GM2A 4Q9LA 1ZSVA 3E81A 4BB5A 2A58A 1I80A 3R75A 2W2XA 1E59A 3KALA 3M3HA 4EJ0A 5ETJA 2QTGA 3JQ9C 4UE6A 3BJIC 4DIMA 1FQJA 1KGSA 3FLAA 4KGVA 5FADA 3AQIA 2VT6A 5BNWA 3K32A 2H85A 5ENDA 1E61A 1X86B 1W4RA 3E48A 4NOLA 4X85A 1JR2A 4MXDA 3T7AA 1NRJB 5EWLB 1HT3A 1CHDA 4M6WA 3ZIDA 4CF3A 2JRLA 1I6LA 4MA5A 2XUHA 1HEUA 2DFKB 5KVCA 4Y2HA 2ONCA 1BQ3A 2NZWA 2XSZA 2IPOA 1ZVQA 2WSYB 3DP7A 4OUDB 2OENG 3PQ5A 4KO8A 1GR1A 2B4YA 1DARA 1UZNA 5HM6A 3TB4A 4US2R 2QN3A 1EX7A 4WZZA 1CUJA 1MNQA 2N0SA 3NOXA 1C7ZA 1FB5A 3I01A 3TO5A 4X62B 2E21A 4KN5A 2OPBA 3FPAA 4LHVA 2I2BA 3LDGA 3MD9A 4MPDA 3LPLA 2GZ1A 4P4SA 3U5TA 1B1CA 2FHPA 1DX9A 3E9YA 4ZQBA 3TFWA 2G76A 4BS9A 1JG1A 3LNTA 4E3ZA 1J6UA 2HREA 3N07A 5H3HA 3REGA 2YW9A 2D62A 2QHXA 3AP2A 4U7PB 3S7TA 3ZIUA 4DSAA 3TE7A 2G5TA 3WRWA 2ASVA 4TSRA 1GGFA 1YHNA 5BOVA 4DJDC 3C6ZA 1P31A 1OWLA 5U9CA 1KU0A 1MB3A 1XPOA 2P41A 4NWIA 3DLAA 1YBHA 1SCBA 1FVFA 1HK7A 4ITVA 5K3CA 5B37A 3O3NB 3RS4A 1ZG3A 3K0KA 1J9ZA 1Q3KA 3BWYA 2Q9CA 3BSFA 5A3SA 3QG5A 3UMJA 1DAGA 4DPMA 4PINA 4D4LA 3AVOA 4N03A 1WHSB 1P4SA 1YFZA 3PFGA 3BS4A 3RTCA 1PZMA 2GXQA 3D7SA 4GP9A 4K2AA 3OOSA 2DWQA 1GYPA 1S2OA 2P6UA 5KNCH 1AQJA 2K2WA 4MVXA 3F6CA 1RAHA 4DUPA 1ZQ9A 3TBFA 3SC3A 4ISCA 3ZNQA 3RHZA 4QATA 1TM5E 4JSTA 3KKNA 3O92A 5H0IA 3NAZA 5CT8A 3CE9A 5J4HA 1PEAA 2AT1A 3VHXA 1ATIA 4RV5A 1E7SA 1FNBA 2HIHA 3L6OO 4AF6A 1ZA2A 4DAOA 4DLPA 3SY8A 5K01A 1P1HA 2BE7A 1I0IA 1UK7A 4DA9A 4R05A 1ZKDA 4ETWA 3OZVA 1Q14A 4MLPA 2Q2OA 2K4MA 4GWGA 1AT1A 4Z51A 1JTFA 2JH9A 2Q6TA 3GRCA 9ATCA 1XN1A 4Q7MB 3UPUA 2VDWB 2VDLB 1U9IA 1W25A 2P6MA 4IAOA 2VHYA 1YQWA 3BTSA 2X7XA 2OKGA 4YT4A 1ID1A 3DW3X 3LCCA 4A8PA 5MF6A 2E4WA 1OTHA 2DUUA 1XTJA 2I71A 3GFOA 1RTTA 3DOUA 5EFOA 5KYWB 4JAVC 1RC8A 1YQUA 1E60A 1BMFA 1CERA 3FWNA 1P1IA 2W2LA 3R41A 2AQ8A 3SOPA 4KWEA 3IH5A 5IC6A 5A5FA 3SEAA 1Z2CA 4EFNA 1PRYA 1HTWA 1Q16A 5L3RA 4N0PA 2WY2D 3SKYA 1REQA 2FEOA 3RAJA 1XP5A 5JS6A 4MUHA 4Y2TA 2IHZA 3ENVA 5L95A 5LIPA 3LBYA 5LZ8A 4FILA 4JQOA 3V8MA 1DX4A 2Y99A 1A4UA 4JB8A 4MRPA 5JCXA 2CNDA 1U8XX 4L5IA 1R9MA 2HTFA 3DE3X 5CFOA 1NIJA 1CNFA 2VF4X 1UDCA 2F8LA 4O1MA 2QT9A 1W0JD 1KZHA 4JVSB 3L4JA 1IUPA 3ONNA 1NURA 3CUKA 4UE2A 1L7MA 3DVQX 3LXRA 1HH4A 2QU7A 2SBTA 2BDTA 1R16A 2WU8A 1AURA 3BWVA 3HCRA 1X77A 3S5JA 1P29A 1QHYA 2MSKA 2KLHA 3HUEA 4CQJA 1DJOA 2BMDA 2J3HA 2V6MA 2P5YA 3ZKAA 2I78A 1M8GA 3L8MA 3IT1A 4N4AA 2VK4A 1GL6A 2E6KA 4NIMA 2IZ7A 1OFIA 2BR3A 2CNNA 2HCBA 2XH8A 1G5TA 4M88A 4ND8B 5GJVC 4D26A 1GKLA 1WSBA 3F4LA 1DZ3A 1QOZA 3CVYA 3GLUA 3LLSA 5LKAA 2O57A 2Q6IA 4PN7A 1SXQA 3HU3A 2RAUA 2PBLA 4IV0A 1GFSA 3VBEA 4AY3A 3C5VA 3LKDA 3KG2A 3TLYA 4JWKA 3PJFA 3TQTA 5LYJF 1IZ8A 1DOAA 3UMVA 2YXBA 4NJEA 4DQXA 4NZYA 3X1ZA 5ESWA 5JV5A 5IKXA 1Y3BE 3CF2A 4L50A 3ZW9A 1SC1A 4FYWA 3DOCA 3WRVA 3AUFA 3CNEA 3K9NA 1Y6FA 1QHXA 2F8SA 5DT2A 1N0HA 1XCPA 1MBZA 1R15A 5DGXA 1IOWA 2YJ4A 3OEHD 3QOWA 1OILA 4M0MA 4BNUA 2WWTA 4IICA 4UM9B 4CIAA 4RVFA 4HAOA 1XALA 3S2FA 1MOSA 4ZKEA 5LZ9A 2FWBA 2KPOA 2XBUA 2ZCVA 4BQFA 3D6MA 4DANA 2O8NA 1IL0A 5DYNA 4DCNA 5BVGB 4V2UA 3GDOA 4YAGA 2Y0EA 2QR2A 5JDCA 4HK4A 4S3MA