3T1YI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3t1yI00
2EFGA 4JI3I 5GMEA 1IBKE 1N32E 5A2QQ 2ZM6I 4DV7E 2UU9E 4DPUA 5LMNE 4DR4I 4DR2E 4EMDA 4FN5A 4YHHI 1ZM3A 2X36A 3M6AA 2E5LI 3J81C 1FWKA 4B3ME 1N36E 3WU4A 2HKJA 3J80Q 2V2ZA 3ZKDA 1Z5CA 4YY3E 5IWAI 1D6TA 1IBME 4HACB 5FLXC 4LF8I 1PVGA 2R42A 4DR1E 4M1KA 1Z59A 4JI3E 2HFSA 4X66I 5A2QC 4XTJA 1FI4A 3D4JA 4DU8A 2E5LE 1HR0E 4X65E 2V34A 4DPXA 3ZZTA 3T1YE 4R1FA 4JI1I 4DR3E 2UUCE 4DR2I 4LF9I 2BV3A 4LFCI 1MU5A 4K0KE 3LPSA 3LTOA 3WU3A 1NZ0A 4FWDA 2UUAE 5IT9Q 1ZM9A 4JI0I 1Z5AA 3ZM7A 2BM0A 3K17A 3J81Q 4JV5E 3QT8A 4LFAE 3T1HE 4DUZE 2UXCI 4UT4A 4DV5E 4DPWA 1FJGE 1PIEA 1N34E 4P52A 5BR8E 4DV4I 1UEKA 1MG7A 4DV4E 2VQFI 2UUCI 4B3SE 1KKHA 3T1YI 4JYAI 4NXMI 4NXNI 4LF7E 3V2UC 4B3TI 4JI2I 1ELOA 4PRXA 1IBLI 5IT9C 3ZKBA 1U2RA 2F4VE 4LFBI 1OJ4A 3F0NA 3B8HA 2OI2A 2X7IA 5GMDA 2V2QA 1IBMI 2V2VA 2V8PA 1ZM2A 4I3HA 1H73A 1J5EI 4LFAI 1HNWI 2UUBI 4URLA 5LL6R 4USKA 2UUBE 4DV0E 2UXBE 1HNZE 3H4LA 3Q1QA 1RR9A 1XNQI 1XHKA 2UUAI 4ZVIA 2AJ4A 4JI5E 1BKNA 4PRVA 1IBLE 4DPYA 1S4EA 4FWGA 2HKEA 3WU6A 4B3TE 4DV1I 4NXME 3QT6A 4DV1E 4GKJE 4YHHE 2E1RA 1KVKA 2VQFE 3GONA 4JI4E 1DARA 1FWLA 4HACA 3PYEA 4LFBE 1ZXNA 4MYTA 2VQEE 4DUZI 1XNQE 2UXCE 3QT5A 1FKAE 4DR5E 4LF5E 1HNZI 4JG4A 1HNXI 4DR7E 4DV0I 2UXBI 4OX9I 4B3RI 1Z0CA 4LF7I 1N36I 1I94E 2HHHE 3QT7A 3ZZ0A 1H72C 4HYMA 2XEXA 2LJPA 4PU9A 4GKKI 4DV7I 4LF9E 1NHJA 1N34I 2F4VI 3V5RA 1Z5BA 1IBKI 1N32I 1Z0BA 4JI8E 2HK2A 1HR0I 4DV5I 4ED4A 1Z0GA 2HHHI 1NHHA 4B3RE 1XMOI 4DR7I 1XMOE 3OTOI 2ZITA 4DV2I 4DR6E 4JI6I 2VF3A 3LNUA 4JYAE 4HY1A 4Z7CA 4WUBA 3JAMQ 2GS8A 4JI8I 4K0KI 4B3SI 3WU5A 1N0VC 5BR8I 4LF4I 4WUCA 1H74A 3PYFA 1FJGI 4X65I 3HULA 1A6FA 4JV5I 5L3JA 3J80C 1HNXE 4JI0E 1B62A 4JI7I 1XNRE 4X64E 1RREA 1Z0EA 4DR5I 4LF5I 2VQEI 2UXDI 4RPFA 2UU9I 1B63A 4DUYI 4HXZA 4LFCE 4JI5I 2Q2EB 1Z0VA 2UXDE 4KHPI 4DR3I 4JI1E 1FNMA 1XNRI 1Z0WA 1XMQI 4YY3I 5IWAE 1QZRA 4DV6I 1KTVA 4P7AA 4DV3E 1J5EE 4MYUA 1KIJA 4X66E 1N0UA 1MX0A 4AQYE 3B78A 3CWVA 2HFUA 3B82A 4X62I 4FW9A 2R3VA 4DR1I 3J7AG 2ZM6E 4LF8E 4DUYE 4UTGA 4X62E 4AQYI 2DEJA 4Z7YA 3OTOE 4JI7E 1PKPA 2WW4A 4DU7A 3J7AM 2DEIA 1HNWE 4B3MI 2A2DA 2J7KA 1H7UA 2CZ9A 4FWHA 4LF4E 4KHPE 5LMNI 1H7SA 4LF6E 4DR4E 4GKKE 1WUUA 4USMA 2ZBKB 4DXLA 3ZZUA 4DR6I 4X64I 3PYGA 4OX9E 1K47A 1S16A 4JI2E 1ZXMA 5LMUE 1EI1A 4NXNE 1NHIA 3K1JA 1N33E 1Z0TA 2BM1A 1EA6A 2A2CA 4KQVA 3PYDA 5FLXQ 4LF6I 4JI4I 2NPFA 3JAMC 4WUDA 4DPTA 4GKJI 1VISA 4DV3I 1N33I 1ZM4A 4DV6E 3T1HI 1I94I 4JI6E 4DV2E 5LMUI 1XMQE 2HK3A
chains in the Genus database with same CATH superfamily
2EFGA 4JI3I 1R6LA 5GMEA 4BA2B 3CDJA 1IBKE 1N32E 5A2QQ 2ZM6I 4DV7E 2UU9E 4DPUA 5LMNE 4DR4I 4DR2E 4EMDA 4FN5A 4YHHI 1ZM3A 2X36A 3M6AA 2E5LI 1RHYA 3J81C 1FWKA 4B3ME 4AIMA 1OYPA 1N36E 3WU4A 2HKJA 4LCGA 3J80Q 4OO1C 2V2ZA 3ZKDA 1Z5CA 4YY3E 5IWAI 2BA0D 1Y6ZA 3Q6MA 1D6TA 1IBME 3M85D 4HACB 5FLXC 4LF8I 2AE8A 2JT2A 1PVGA 2R42A 3PRYA 4DR1E 2Z5CB 4M1KA 1Z59A 4JI3E 3HKMA 2HFSA 4X66I 5A2QC 5K36B 4XTJA 4OZEA 1FI4A 3D4JA 4DU8A 2Z5EA 4U3DA 3CDIA 2E5LE 1HR0E 4X65E 2V34A 4DPXA 4MU0A 3ZZTA 3T1YE 1YHCA 4R1FA 4JI1I 4DR3E 2UUCE 4DR2I 4LF9I 2PO2B 2BV3A 4OO1F 5DNLA 4LFCI 2PO0B 2F1DA 2JEBB 1MU5A 2PO1B 4K0KE 3LPSA 3LTOA 5EKWA 3WU3A 1NZ0A 4FWDA 4MU4A 3PS1A 2UUAE 5IT9Q 1ZM9A 1R6MA 3B4TA 1E3HA 4JI0I 1Y4SA 1Z5AA 5C0XB 3ZM7A 2BM0A 4LCFA 3K17A 3J81Q 3L7ZA 4JV5E 3QT8A 4LFAE 3T1HE 4DUZE 2UXCI 4UT4A 4DV5E 4LPFA 4DPWA 5JEAB 1FJGE 1PIEA 3U1YA 3GCMA 1N34E 4P52A 5BR8E 4DV4I 4AIDA 1UEKA 1MG7A 4DV4E 4FW5A 2VQFI 4OO1D 3UHMA 2UUCI 4B3SE 2C38A 2IOPA 1KKHA 3T1YI 4JYAI 3L7ZB 3P3EA 4NXMI 4NXNI 4LF7E 5C0XA 3V2UC 4B3TI 4JI2I 1ELOA 4PRXA 4U3BA 2PNZB 5FWKA 2JE6B 1IBLI 3PS3A 4IZKB 2BR2B 5IT9C 3ZKBA 5JEAE 1U2RA 2F4VE 4LFBI 4IZJA 1OJ4A 3F0NA 3B8HA 2OI2A 2X7IA 4GQUA 5GMDA 2NN6C 2V2QA 1IBMI 2V2VA 2V8PA 5C0XC 1UDOA 1ZM2A 4IS9A 4I3HA 1H73A 1J5EI 2PNLA 4LFAI 1HNWI 2UUBI 4URLA 2BA1D 5LL6R 4USKA 2IESA 2UUBE 5K36C 4DV0E 2UXBE 5JEAC 5DRRA 1HNZE 2O1WA 3H4LA 3Q1QA 1RR9A 5DRQA 1XNQI 4AM3A 1XHKA 2UUAI 4ZVIA 4OO1E 3KRNA 2BA1G 5K36E 2AJ4A 4JI5E 2WP8B 1OYSA 2GQ0A 1BKNA 4PRVA 5DROA 1IBLE 4DPYA 4BA1A 1S4EA 4FWGA 1Y4UA 2HKEA 2CVEA 1VI7A 3WU6A 4B3TE 4DV1I 4NXME 3QT6A 2Z5BB 4DV1E 2NN6B 2JEAB 3P3CA 4GKJE 4YHHE 2E1RA 1KVKA 4IZJD 2VQFE 3GONA 4JI4E 1DARA 1FWLA 4HACA 3PYEA 4LFBE 1ZXNA 5K36A 4MYTA 3K85A 4FW3A 4IFDC 2VQEE 4DUZI 1XNQE 2UXCE 3QT5A 1FKAE 4DR5E 4LF5E 4LCHA 1HNZI 4JG4A 1UDSA 1HNXI 4DR7E 3P3GA 2PO1A 4DV0I 2UXBI 4OX9I 1UDNA 2NN6D 4B3RI 1Z0CA 4LF7I 2NN6E 1N36I 1I94E 2HHHE 3QT7A 2O1VA 2WNRA 3P06A 4IZKA 3ZZ0A 1H72C 4HYMA 1P42A 2XEXA 2LJPA 4PU9A 4OO1B 4BA2A 4GKKI 4DV7I 4LF9E 1NHJA 1N34I 2F4VI 3V5RA 1Z5BA 1IBKI 1N32I 3M85G 1Z0BA 4JI8E 2IERA 2HK2A 5C0XE 1HR0I 4DV5I 4ED4A 2O1TA 1Z0GA 2GO3A 2HHHI 4IFDF 1NHHA 4IFDA 4B3RE 2Z5CA 1XMOI 5EL9A 4DR7I 1XMOE 3OTOI 2ZITA 3GMEA 4DV2I 4JI6I 4DR6E 4IFDB 2VF3A 3LNUA 4JYAE 4HY1A 4Z7CA 2J65A 4WUBA 3JAMQ 2GS8A 4JI8I 5JEAA 4K0KI 4B3SI 3WU5A 1USUA 1N0VC 2JEBA 5BR8I 4LF4I 4MU3A 4WUCA 1H74A 3PYFA 1FJGI 2O1UA 4X65I 3HULA 1A6FA 4JV5I 2C39B 5L3JA 4IFDD 4J3DA 3J80C 4IFDE 1HNXE 2C37B 4JI0E 1B62A 4JI7I 3GLLA 1USVA 1XNRE 4X64E 1RREA 1Z0EA 4DR5I 4LF5I 4N3OA 2VQEI 2UXDI 4RPFA 3HJCA 4FW6A 2UU9I 2IOQA 3DD6A 1B63A 4DUYI 4HXZA 4LFCE 2Q2EB 1Z0VA 4JI5I 2UXDE 4KHPI 4DR3I 5C0XD 5ELWA 4JI1E 1FNMA 5C0XF 1XNRI 1Z0WA 2NN6F 1XMQI 4YY3I 5IWAE 2NN6A 4FW7A 2JEAA 2Z5BA 2O3ZA 1QZRA 2PNZA 4DV6I 1KTVA 4P7AA 4DV3E 1J5EE 4MYUA 1KIJA 4X66E 1N0UA 1MX0A 4AQYE 3B78A 3CWVA 2HFUA 3B82A 3PS2A 4X62I 4FW9A 2PO2A 2R3VA 4DR1I 1Y5YA 3J7AG 2PNMA 2ZM6E 4LF8E 2BR2A 4DUYE 4UTGA 2JE6A 4X62E 2CGEA 1YH8A 4AQYI 2DEJA 2C37A 4Z7YA 3OTOE 4JI7E 1PKPA 2WW4A 4DU7A 3J7AM 4BA1B 2VESA 2DEIA 1HNWE 4B3MI 4MDTA 2A2DA 2J7KA 1OYRA 1Y60A 1H7UA 2C38B 2CZ9A 4LOMA 4FWHA 5JEAF 4LF4E 4KHPE 4OKGA 5LMNI 1H7SA 4LF6E 4FW4A 4DR4E 4GKKE 5K36F 5DRPA 5K36D 1WUUA 4USMA 4QNJA 2ZBKB 4DXLA 2GO4A 2PO0A 4MU1A 3U1KA 3ZZUA 4DR6I 1XXEA 4X64I 3PYGA 4NBQA 4QNKA 4OX9E 1K47A 1S16A 4JI2E 3M7NG 3P76A 1HK7A 1ZXMA 5LMUE 1EI1A 2WP8A 4NXNE 1NHIA 3K1JA 1N33E 1Z0TA 1UDQA 2BM1A 1E3PA 1EA6A 2C39A 3M7ND 2A2CA 2BA0G 5JEAD 4KQVA 3PYDA 4OO1A 5FLXQ 4LF6I 4JI4I 2NPFA 3Q6NA 3JAMC 4WUDA 4DPTA 4MQYA 4GKJI 2CG9A 1VISA 4DV3I 2WNRB 1N33I 1ZM4A 3NZKA 4DV6E 3T1HI 1I94I 5DNXA 4JI6E 4DV2E 3H1CA 4ISAA 5LMUI 1XMQE 4IZJB 2HK3A
chains in the Genus database with same CATH topology
2EFGA 4JI3I 5GMEA 1IBKE 1N32E 5A2QQ 2ZM6I 4DV7E 2UU9E 4DPUA 5LMNE 4DR4I 4DR2E 4EMDA 4FN5A 4YHHI 1ZM3A 2X36A 3M6AA 2E5LI 3J81C 1FWKA 4B3ME 1N36E 3WU4A 2HKJA 3J80Q 2V2ZA 3ZKDA 1Z5CA 4YY3E 5IWAI 1Y6ZA 3Q6MA 1D6TA 1IBME 4HACB 5FLXC 4LF8I 1PVGA 2R42A 3PRYA 4DR1E 2Z5CB 4M1KA 1Z59A 4JI3E 2HFSA 4X66I 5A2QC 4XTJA 1FI4A 3D4JA 4DU8A 2Z5EA 2E5LE 1HR0E 4X65E 2V34A 4DPXA 3ZZTA 3T1YE 4R1FA 4JI1I 4DR3E 2UUCE 4DR2I 4LF9I 2BV3A 4LFCI 1MU5A 4K0KE 3LPSA 3LTOA 3WU3A 1NZ0A 4FWDA 2UUAE 5IT9Q 1ZM9A 4JI0I 1Y4SA 1Z5AA 3ZM7A 2BM0A 3K17A 3J81Q 4JV5E 3QT8A 4LFAE 3T1HE 4DUZE 2UXCI 4UT4A 4DV5E 4DPWA 1FJGE 1PIEA 1N34E 4P52A 5BR8E 4DV4I 1UEKA 1MG7A 4DV4E 2VQFI 2UUCI 4B3SE 2IOPA 1KKHA 3T1YI 4JYAI 4NXMI 4NXNI 4LF7E 3V2UC 4B3TI 4JI2I 1ELOA 4PRXA 5FWKA 1IBLI 4IZKB 5IT9C 3ZKBA 1U2RA 2F4VE 4LFBI 4IZJA 1OJ4A 3F0NA 3B8HA 2OI2A 2X7IA 5GMDA 2V2QA 1IBMI 2V2VA 2V8PA 1ZM2A 4I3HA 1H73A 1J5EI 2PNLA 4LFAI 1HNWI 2UUBI 4URLA 5LL6R 4USKA 2UUBE 4DV0E 2UXBE 1HNZE 2O1WA 3H4LA 3Q1QA 1RR9A 1XNQI 1XHKA 2UUAI 4ZVIA 2AJ4A 4JI5E 2GQ0A 1BKNA 4PRVA 1IBLE 4DPYA 1S4EA 4FWGA 1Y4UA 2HKEA 3WU6A 4B3TE 4DV1I 4NXME 3QT6A 2Z5BB 4DV1E 4GKJE 4YHHE 2E1RA 1KVKA 4IZJD 2VQFE 3GONA 4JI4E 1DARA 1FWLA 4HACA 3PYEA 4LFBE 1ZXNA 4MYTA 3K85A 2VQEE 4DUZI 1XNQE 2UXCE 3QT5A 1FKAE 4DR5E 4LF5E 1HNZI 4JG4A 1HNXI 4DR7E 4DV0I 2UXBI 4OX9I 4B3RI 1Z0CA 4LF7I 1N36I 1I94E 2HHHE 3QT7A 2O1VA 3P06A 4IZKA 3ZZ0A 1H72C 4HYMA 2XEXA 2LJPA 4PU9A 4GKKI 4DV7I 4LF9E 1NHJA 1N34I 2F4VI 3V5RA 1Z5BA 1IBKI 1N32I 1Z0BA 4JI8E 2HK2A 1HR0I 4DV5I 4ED4A 2O1TA 1Z0GA 2HHHI 1NHHA 4B3RE 2Z5CA 1XMOI 4DR7I 1XMOE 3OTOI 2ZITA 4DV2I 4DR6E 4JI6I 2VF3A 3LNUA 4JYAE 4HY1A 4Z7CA 4WUBA 3JAMQ 2GS8A 4JI8I 4K0KI 4B3SI 3WU5A 1USUA 1N0VC 5BR8I 4LF4I 4WUCA 1H74A 3PYFA 1FJGI 2O1UA 4X65I 3HULA 1A6FA 4JV5I 5L3JA 3J80C 1HNXE 4JI0E 1B62A 4JI7I 1XNRE 1USVA 4X64E 1RREA 1Z0EA 4DR5I 4LF5I 4N3OA 2VQEI 2UXDI 4RPFA 3HJCA 2UU9I 2IOQA 1B63A 4DUYI 4HXZA 4LFCE 2Q2EB 1Z0VA 4JI5I 2UXDE 4KHPI 4DR3I 4JI1E 1FNMA 1XNRI 1Z0WA 1XMQI 4YY3I 5IWAE 2Z5BA 1QZRA 4DV6I 1KTVA 4P7AA 4DV3E 1J5EE 4MYUA 1KIJA 4X66E 1N0UA 1MX0A 4AQYE 3B78A 3CWVA 2HFUA 3B82A 4X62I 4FW9A 2R3VA 4DR1I 3J7AG 2PNMA 2ZM6E 4LF8E 4DUYE 4UTGA 4X62E 2CGEA 4AQYI 2DEJA 4Z7YA 3OTOE 4JI7E 1PKPA 2WW4A 4DU7A 3J7AM 2DEIA 1HNWE 4B3MI 2A2DA 2J7KA 1H7UA 2CZ9A 4FWHA 4LF4E 4KHPE 5LMNI 1H7SA 4LF6E 4DR4E 4GKKE 1WUUA 4USMA 2ZBKB 4DXLA 3ZZUA 4DR6I 4X64I 3PYGA 4OX9E 1K47A 1S16A 4JI2E 1HK7A 1ZXMA 5LMUE 1EI1A 4NXNE 1NHIA 3K1JA 1N33E 1Z0TA 2BM1A 1EA6A 2A2CA 4KQVA 3PYDA 5FLXQ 4LF6I 4JI4I 2NPFA 3Q6NA 3JAMC 4WUDA 4DPTA 4GKJI 2CG9A 1VISA 4DV3I 1N33I 1ZM4A 4DV6E 3T1HI 1I94I 4JI6E 4DV2E 5LMUI 1XMQE 4IZJB 2HK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFG A;  4JI3 I;  5GME A;  1IBK E;  1N32 E;  5A2Q Q;  2ZM6 I;  4DV7 E;  2UU9 E;  4DPU A;  5LMN E;  4DR4 I;  4DR2 E;  4EMD A;  4FN5 A;  4YHH I;  1ZM3 A;  2X36 A;  3M6A A;  2E5L I;  3J81 C;  1FWK A;  4B3M E;  1N36 E;  3WU4 A;  2HKJ A;  3J80 Q;  2V2Z A;  3ZKD A;  1Z5C A;  4YY3 E;  5IWA I;  1D6T A;  1IBM E;  4HAC B;  5FLX C;  4LF8 I;  1PVG A;  2R42 A;  4DR1 E;  4M1K A;  1Z59 A;  4JI3 E;  2HFS A;  4X66 I;  5A2Q C;  4XTJ A;  1FI4 A;  3D4J A;  4DU8 A;  2E5L E;  1HR0 E;  4X65 E;  2V34 A;  4DPX A;  3ZZT A;  3T1Y E;  4R1F A;  4JI1 I;  4DR3 E;  2UUC E;  4DR2 I;  4LF9 I;  2BV3 A;  4LFC I;  1MU5 A;  4K0K E;  3LPS A;  3LTO A;  3WU3 A;  1NZ0 A;  4FWD A;  2UUA E;  5IT9 Q;  1ZM9 A;  4JI0 I;  1Z5A A;  3ZM7 A;  2BM0 A;  3K17 A;  3J81 Q;  4JV5 E;  3QT8 A;  4LFA E;  3T1H E;  4DUZ E;  2UXC I;  4UT4 A;  4DV5 E;  4DPW A;  1FJG E;  1PIE A;  1N34 E;  4P52 A;  5BR8 E;  4DV4 I;  1UEK A;  1MG7 A;  4DV4 E;  2VQF I;  2UUC I;  4B3S E;  1KKH A;  3T1Y I;  4JYA I;  4NXM I;  4NXN I;  4LF7 E;  3V2U C;  4B3T I;  4JI2 I;  1ELO A;  4PRX A;  1IBL I;  5IT9 C;  3ZKB A;  1U2R A;  2F4V E;  4LFB I;  1OJ4 A;  3F0N A;  3B8H A;  2OI2 A;  2X7I A;  5GMD A;  2V2Q A;  1IBM I;  2V2V A;  2V8P A;  1ZM2 A;  4I3H A;  1H73 A;  1J5E I;  4LFA I;  1HNW I;  2UUB I;  4URL A;  5LL6 R;  4USK A;  2UUB E;  4DV0 E;  2UXB E;  1HNZ E;  3H4L A;  3Q1Q A;  1RR9 A;  1XNQ I;  1XHK A;  2UUA I;  4ZVI A;  2AJ4 A;  4JI5 E;  1BKN A;  4PRV A;  1IBL E;  4DPY A;  1S4E A;  4FWG A;  2HKE A;  3WU6 A;  4B3T E;  4DV1 I;  4NXM E;  3QT6 A;  4DV1 E;  4GKJ E;  4YHH E;  2E1R A;  1KVK A;  2VQF E;  3GON A;  4JI4 E;  1DAR A;  1FWL A;  4HAC A;  3PYE A;  4LFB E;  1ZXN A;  4MYT A;  2VQE E;  4DUZ I;  1XNQ E;  2UXC E;  3QT5 A;  1FKA E;  4DR5 E;  4LF5 E;  1HNZ I;  4JG4 A;  1HNX I;  4DR7 E;  4DV0 I;  2UXB I;  4OX9 I;  4B3R I;  1Z0C A;  4LF7 I;  1N36 I;  1I94 E;  2HHH E;  3QT7 A;  3ZZ0 A;  1H72 C;  4HYM A;  2XEX A;  2LJP A;  4PU9 A;  4GKK I;  4DV7 I;  4LF9 E;  1NHJ A;  1N34 I;  2F4V I;  3V5R A;  1Z5B A;  1IBK I;  1N32 I;  1Z0B A;  4JI8 E;  2HK2 A;  1HR0 I;  4DV5 I;  4ED4 A;  1Z0G A;  2HHH I;  1NHH A;  4B3R E;  1XMO I;  4DR7 I;  1XMO E;  3OTO I;  2ZIT A;  4DV2 I;  4DR6 E;  4JI6 I;  2VF3 A;  3LNU A;  4JYA E;  4HY1 A;  4Z7C A;  4WUB A;  3JAM Q;  2GS8 A;  4JI8 I;  4K0K I;  4B3S I;  3WU5 A;  1N0V C;  5BR8 I;  4LF4 I;  4WUC A;  1H74 A;  3PYF A;  1FJG I;  4X65 I;  3HUL A;  1A6F A;  4JV5 I;  5L3J A;  3J80 C;  1HNX E;  4JI0 E;  1B62 A;  4JI7 I;  1XNR E;  4X64 E;  1RRE A;  1Z0E A;  4DR5 I;  4LF5 I;  2VQE I;  2UXD I;  4RPF A;  2UU9 I;  1B63 A;  4DUY I;  4HXZ A;  4LFC E;  4JI5 I;  2Q2E B;  1Z0V A;  2UXD E;  4KHP I;  4DR3 I;  4JI1 E;  1FNM A;  1XNR I;  1Z0W A;  1XMQ I;  4YY3 I;  5IWA E;  1QZR A;  4DV6 I;  1KTV A;  4P7A A;  4DV3 E;  1J5E E;  4MYU A;  1KIJ A;  4X66 E;  1N0U A;  1MX0 A;  4AQY E;  3B78 A;  3CWV A;  2HFU A;  3B82 A;  4X62 I;  4FW9 A;  2R3V A;  4DR1 I;  3J7A G;  2ZM6 E;  4LF8 E;  4DUY E;  4UTG A;  4X62 E;  4AQY I;  2DEJ A;  4Z7Y A;  3OTO E;  4JI7 E;  1PKP A;  2WW4 A;  4DU7 A;  3J7A M;  2DEI A;  1HNW E;  4B3M I;  2A2D A;  2J7K A;  1H7U A;  2CZ9 A;  4FWH A;  4LF4 E;  4KHP E;  5LMN I;  1H7S A;  4LF6 E;  4DR4 E;  4GKK E;  1WUU A;  4USM A;  2ZBK B;  4DXL A;  3ZZU A;  4DR6 I;  4X64 I;  3PYG A;  4OX9 E;  1K47 A;  1S16 A;  4JI2 E;  1ZXM A;  5LMU E;  1EI1 A;  4NXN E;  1NHI A;  3K1J A;  1N33 E;  1Z0T A;  2BM1 A;  1EA6 A;  2A2C A;  4KQV A;  3PYD A;  5FLX Q;  4LF6 I;  4JI4 I;  2NPF A;  3JAM C;  4WUD A;  4DPT A;  4GKJ I;  1VIS A;  4DV3 I;  1N33 I;  1ZM4 A;  4DV6 E;  3T1H I;  1I94 I;  4JI6 E;  4DV2 E;  5LMU I;  1XMQ E;  2HK3 A; 
#chains in the Genus database with same CATH topology
 2EFG A;  4JI3 I;  1R6L A;  5GME A;  4BA2 B;  3CDJ A;  1IBK E;  1N32 E;  5A2Q Q;  2ZM6 I;  4DV7 E;  2UU9 E;  4DPU A;  5LMN E;  4DR4 I;  4DR2 E;  4EMD A;  4FN5 A;  4YHH I;  1ZM3 A;  2X36 A;  3M6A A;  2E5L I;  1RHY A;  3J81 C;  1FWK A;  4B3M E;  4AIM A;  1OYP A;  1N36 E;  3WU4 A;  2HKJ A;  4LCG A;  3J80 Q;  4OO1 C;  2V2Z A;  3ZKD A;  1Z5C A;  4YY3 E;  5IWA I;  2BA0 D;  1Y6Z A;  3Q6M A;  1D6T A;  1IBM E;  3M85 D;  4HAC B;  5FLX C;  4LF8 I;  2AE8 A;  2JT2 A;  1PVG A;  2R42 A;  3PRY A;  4DR1 E;  2Z5C B;  4M1K A;  1Z59 A;  4JI3 E;  3HKM A;  2HFS A;  4X66 I;  5A2Q C;  5K36 B;  4XTJ A;  4OZE A;  1FI4 A;  3D4J A;  4DU8 A;  2Z5E A;  4U3D A;  3CDI A;  2E5L E;  1HR0 E;  4X65 E;  2V34 A;  4DPX A;  4MU0 A;  3ZZT A;  3T1Y E;  1YHC A;  4R1F A;  4JI1 I;  4DR3 E;  2UUC E;  4DR2 I;  4LF9 I;  2PO2 B;  2BV3 A;  4OO1 F;  5DNL A;  4LFC I;  2PO0 B;  2F1D A;  2JEB B;  1MU5 A;  2PO1 B;  4K0K E;  3LPS A;  3LTO A;  5EKW A;  3WU3 A;  1NZ0 A;  4FWD A;  4MU4 A;  3PS1 A;  2UUA E;  5IT9 Q;  1ZM9 A;  1R6M A;  3B4T A;  1E3H A;  4JI0 I;  1Y4S A;  1Z5A A;  5C0X B;  3ZM7 A;  2BM0 A;  4LCF A;  3K17 A;  3J81 Q;  3L7Z A;  4JV5 E;  3QT8 A;  4LFA E;  3T1H E;  4DUZ E;  2UXC I;  4UT4 A;  4DV5 E;  4LPF A;  4DPW A;  5JEA B;  1FJG E;  1PIE A;  3U1Y A;  3GCM A;  1N34 E;  4P52 A;  5BR8 E;  4DV4 I;  4AID A;  1UEK A;  1MG7 A;  4DV4 E;  4FW5 A;  2VQF I;  4OO1 D;  3UHM A;  2UUC I;  4B3S E;  2C38 A;  2IOP A;  1KKH A;  3T1Y I;  4JYA I;  3L7Z B;  3P3E A;  4NXM I;  4NXN I;  4LF7 E;  5C0X A;  3V2U C;  4B3T I;  4JI2 I;  1ELO A;  4PRX A;  4U3B A;  2PNZ B;  5FWK A;  2JE6 B;  1IBL I;  3PS3 A;  4IZK B;  2BR2 B;  5IT9 C;  3ZKB A;  5JEA E;  1U2R A;  2F4V E;  4LFB I;  4IZJ A;  1OJ4 A;  3F0N A;  3B8H A;  2OI2 A;  2X7I A;  4GQU A;  5GMD A;  2NN6 C;  2V2Q A;  1IBM I;  2V2V A;  2V8P A;  5C0X C;  1UDO A;  1ZM2 A;  4IS9 A;  4I3H A;  1H73 A;  1J5E I;  2PNL A;  4LFA I;  1HNW I;  2UUB I;  4URL A;  2BA1 D;  5LL6 R;  4USK A;  2IES A;  2UUB E;  5K36 C;  4DV0 E;  2UXB E;  5JEA C;  5DRR A;  1HNZ E;  2O1W A;  3H4L A;  3Q1Q A;  1RR9 A;  5DRQ A;  1XNQ I;  4AM3 A;  1XHK A;  2UUA I;  4ZVI A;  4OO1 E;  3KRN A;  2BA1 G;  5K36 E;  2AJ4 A;  4JI5 E;  2WP8 B;  1OYS A;  2GQ0 A;  1BKN A;  4PRV A;  5DRO A;  1IBL E;  4DPY A;  4BA1 A;  1S4E A;  4FWG A;  1Y4U A;  2HKE A;  2CVE A;  1VI7 A;  3WU6 A;  4B3T E;  4DV1 I;  4NXM E;  3QT6 A;  2Z5B B;  4DV1 E;  2NN6 B;  2JEA B;  3P3C A;  4GKJ E;  4YHH E;  2E1R A;  1KVK A;  4IZJ D;  2VQF E;  3GON A;  4JI4 E;  1DAR A;  1FWL A;  4HAC A;  3PYE A;  4LFB E;  1ZXN A;  5K36 A;  4MYT A;  3K85 A;  4FW3 A;  4IFD C;  2VQE E;  4DUZ I;  1XNQ E;  2UXC E;  3QT5 A;  1FKA E;  4DR5 E;  4LF5 E;  4LCH A;  1HNZ I;  4JG4 A;  1UDS A;  1HNX I;  4DR7 E;  3P3G A;  2PO1 A;  4DV0 I;  2UXB I;  4OX9 I;  1UDN A;  2NN6 D;  4B3R I;  1Z0C A;  4LF7 I;  2NN6 E;  1N36 I;  1I94 E;  2HHH E;  3QT7 A;  2O1V A;  2WNR A;  3P06 A;  4IZK A;  3ZZ0 A;  1H72 C;  4HYM A;  1P42 A;  2XEX A;  2LJP A;  4PU9 A;  4OO1 B;  4BA2 A;  4GKK I;  4DV7 I;  4LF9 E;  1NHJ A;  1N34 I;  2F4V I;  3V5R A;  1Z5B A;  1IBK I;  1N32 I;  3M85 G;  1Z0B A;  4JI8 E;  2IER A;  2HK2 A;  5C0X E;  1HR0 I;  4DV5 I;  4ED4 A;  2O1T A;  1Z0G A;  2GO3 A;  2HHH I;  4IFD F;  1NHH A;  4IFD A;  4B3R E;  2Z5C A;  1XMO I;  5EL9 A;  4DR7 I;  1XMO E;  3OTO I;  2ZIT A;  3GME A;  4DV2 I;  4JI6 I;  4DR6 E;  4IFD B;  2VF3 A;  3LNU A;  4JYA E;  4HY1 A;  4Z7C A;  2J65 A;  4WUB A;  3JAM Q;  2GS8 A;  4JI8 I;  5JEA A;  4K0K I;  4B3S I;  3WU5 A;  1USU A;  1N0V C;  2JEB A;  5BR8 I;  4LF4 I;  4MU3 A;  4WUC A;  1H74 A;  3PYF A;  1FJG I;  2O1U A;  4X65 I;  3HUL A;  1A6F A;  4JV5 I;  2C39 B;  5L3J A;  4IFD D;  4J3D A;  3J80 C;  4IFD E;  1HNX E;  2C37 B;  4JI0 E;  1B62 A;  4JI7 I;  3GLL A;  1USV A;  1XNR E;  4X64 E;  1RRE A;  1Z0E A;  4DR5 I;  4LF5 I;  4N3O A;  2VQE I;  2UXD I;  4RPF A;  3HJC A;  4FW6 A;  2UU9 I;  2IOQ A;  3DD6 A;  1B63 A;  4DUY I;  4HXZ A;  4LFC E;  2Q2E B;  1Z0V A;  4JI5 I;  2UXD E;  4KHP I;  4DR3 I;  5C0X D;  5ELW A;  4JI1 E;  1FNM A;  5C0X F;  1XNR I;  1Z0W A;  2NN6 F;  1XMQ I;  4YY3 I;  5IWA E;  2NN6 A;  4FW7 A;  2JEA A;  2Z5B A;  2O3Z A;  1QZR A;  2PNZ A;  4DV6 I;  1KTV A;  4P7A A;  4DV3 E;  1J5E E;  4MYU A;  1KIJ A;  4X66 E;  1N0U A;  1MX0 A;  4AQY E;  3B78 A;  3CWV A;  2HFU A;  3B82 A;  3PS2 A;  4X62 I;  4FW9 A;  2PO2 A;  2R3V A;  4DR1 I;  1Y5Y A;  3J7A G;  2PNM A;  2ZM6 E;  4LF8 E;  2BR2 A;  4DUY E;  4UTG A;  2JE6 A;  4X62 E;  2CGE A;  1YH8 A;  4AQY I;  2DEJ A;  2C37 A;  4Z7Y A;  3OTO E;  4JI7 E;  1PKP A;  2WW4 A;  4DU7 A;  3J7A M;  4BA1 B;  2VES A;  2DEI A;  1HNW E;  4B3M I;  4MDT A;  2A2D A;  2J7K A;  1OYR A;  1Y60 A;  1H7U A;  2C38 B;  2CZ9 A;  4LOM A;  4FWH A;  5JEA F;  4LF4 E;  4KHP E;  4OKG A;  5LMN I;  1H7S A;  4LF6 E;  4FW4 A;  4DR4 E;  4GKK E;  5K36 F;  5DRP A;  5K36 D;  1WUU A;  4USM A;  4QNJ A;  2ZBK B;  4DXL A;  2GO4 A;  2PO0 A;  4MU1 A;  3U1K A;  3ZZU A;  4DR6 I;  1XXE A;  4X64 I;  3PYG A;  4NBQ A;  4QNK A;  4OX9 E;  1K47 A;  1S16 A;  4JI2 E;  3M7N G;  3P76 A;  1HK7 A;  1ZXM A;  5LMU E;  1EI1 A;  2WP8 A;  4NXN E;  1NHI A;  3K1J A;  1N33 E;  1Z0T A;  1UDQ A;  2BM1 A;  1E3P A;  1EA6 A;  2C39 A;  3M7N D;  2A2C A;  2BA0 G;  5JEA D;  4KQV A;  3PYD A;  4OO1 A;  5FLX Q;  4LF6 I;  4JI4 I;  2NPF A;  3Q6N A;  3JAM C;  4WUD A;  4DPT A;  4MQY A;  4GKJ I;  2CG9 A;  1VIS A;  4DV3 I;  2WNR B;  1N33 I;  1ZM4 A;  3NZK A;  4DV6 E;  3T1H I;  1I94 I;  5DNX A;  4JI6 E;  4DV2 E;  3H1C A;  4ISA A;  5LMU I;  1XMQ E;  4IZJ B;  2HK3 A; 
#chains in the Genus database with same CATH homology
 2EFG A;  4JI3 I;  5GME A;  1IBK E;  1N32 E;  5A2Q Q;  2ZM6 I;  4DV7 E;  2UU9 E;  4DPU A;  5LMN E;  4DR4 I;  4DR2 E;  4EMD A;  4FN5 A;  4YHH I;  1ZM3 A;  2X36 A;  3M6A A;  2E5L I;  3J81 C;  1FWK A;  4B3M E;  1N36 E;  3WU4 A;  2HKJ A;  3J80 Q;  2V2Z A;  3ZKD A;  1Z5C A;  4YY3 E;  5IWA I;  1Y6Z A;  3Q6M A;  1D6T A;  1IBM E;  4HAC B;  5FLX C;  4LF8 I;  1PVG A;  2R42 A;  3PRY A;  4DR1 E;  2Z5C B;  4M1K A;  1Z59 A;  4JI3 E;  2HFS A;  4X66 I;  5A2Q C;  4XTJ A;  1FI4 A;  3D4J A;  4DU8 A;  2Z5E A;  2E5L E;  1HR0 E;  4X65 E;  2V34 A;  4DPX A;  3ZZT A;  3T1Y E;  4R1F A;  4JI1 I;  4DR3 E;  2UUC E;  4DR2 I;  4LF9 I;  2BV3 A;  4LFC I;  1MU5 A;  4K0K E;  3LPS A;  3LTO A;  3WU3 A;  1NZ0 A;  4FWD A;  2UUA E;  5IT9 Q;  1ZM9 A;  4JI0 I;  1Y4S A;  1Z5A A;  3ZM7 A;  2BM0 A;  3K17 A;  3J81 Q;  4JV5 E;  3QT8 A;  4LFA E;  3T1H E;  4DUZ E;  2UXC I;  4UT4 A;  4DV5 E;  4DPW A;  1FJG E;  1PIE A;  1N34 E;  4P52 A;  5BR8 E;  4DV4 I;  1UEK A;  1MG7 A;  4DV4 E;  2VQF I;  2UUC I;  4B3S E;  2IOP A;  1KKH A;  3T1Y I;  4JYA I;  4NXM I;  4NXN I;  4LF7 E;  3V2U C;  4B3T I;  4JI2 I;  1ELO A;  4PRX A;  5FWK A;  1IBL I;  4IZK B;  5IT9 C;  3ZKB A;  1U2R A;  2F4V E;  4LFB I;  4IZJ A;  1OJ4 A;  3F0N A;  3B8H A;  2OI2 A;  2X7I A;  5GMD A;  2V2Q A;  1IBM I;  2V2V A;  2V8P A;  1ZM2 A;  4I3H A;  1H73 A;  1J5E I;  2PNL A;  4LFA I;  1HNW I;  2UUB I;  4URL A;  5LL6 R;  4USK A;  2UUB E;  4DV0 E;  2UXB E;  1HNZ E;  2O1W A;  3H4L A;  3Q1Q A;  1RR9 A;  1XNQ I;  1XHK A;  2UUA I;  4ZVI A;  2AJ4 A;  4JI5 E;  2GQ0 A;  1BKN A;  4PRV A;  1IBL E;  4DPY A;  1S4E A;  4FWG A;  1Y4U A;  2HKE A;  3WU6 A;  4B3T E;  4DV1 I;  4NXM E;  3QT6 A;  2Z5B B;  4DV1 E;  4GKJ E;  4YHH E;  2E1R A;  1KVK A;  4IZJ D;  2VQF E;  3GON A;  4JI4 E;  1DAR A;  1FWL A;  4HAC A;  3PYE A;  4LFB E;  1ZXN A;  4MYT A;  3K85 A;  2VQE E;  4DUZ I;  1XNQ E;  2UXC E;  3QT5 A;  1FKA E;  4DR5 E;  4LF5 E;  1HNZ I;  4JG4 A;  1HNX I;  4DR7 E;  4DV0 I;  2UXB I;  4OX9 I;  4B3R I;  1Z0C A;  4LF7 I;  1N36 I;  1I94 E;  2HHH E;  3QT7 A;  2O1V A;  3P06 A;  4IZK A;  3ZZ0 A;  1H72 C;  4HYM A;  2XEX A;  2LJP A;  4PU9 A;  4GKK I;  4DV7 I;  4LF9 E;  1NHJ A;  1N34 I;  2F4V I;  3V5R A;  1Z5B A;  1IBK I;  1N32 I;  1Z0B A;  4JI8 E;  2HK2 A;  1HR0 I;  4DV5 I;  4ED4 A;  2O1T A;  1Z0G A;  2HHH I;  1NHH A;  4B3R E;  2Z5C A;  1XMO I;  4DR7 I;  1XMO E;  3OTO I;  2ZIT A;  4DV2 I;  4DR6 E;  4JI6 I;  2VF3 A;  3LNU A;  4JYA E;  4HY1 A;  4Z7C A;  4WUB A;  3JAM Q;  2GS8 A;  4JI8 I;  4K0K I;  4B3S I;  3WU5 A;  1USU A;  1N0V C;  5BR8 I;  4LF4 I;  4WUC A;  1H74 A;  3PYF A;  1FJG I;  2O1U A;  4X65 I;  3HUL A;  1A6F A;  4JV5 I;  5L3J A;  3J80 C;  1HNX E;  4JI0 E;  1B62 A;  4JI7 I;  1XNR E;  1USV A;  4X64 E;  1RRE A;  1Z0E A;  4DR5 I;  4LF5 I;  4N3O A;  2VQE I;  2UXD I;  4RPF A;  3HJC A;  2UU9 I;  2IOQ A;  1B63 A;  4DUY I;  4HXZ A;  4LFC E;  2Q2E B;  1Z0V A;  4JI5 I;  2UXD E;  4KHP I;  4DR3 I;  4JI1 E;  1FNM A;  1XNR I;  1Z0W A;  1XMQ I;  4YY3 I;  5IWA E;  2Z5B A;  1QZR A;  4DV6 I;  1KTV A;  4P7A A;  4DV3 E;  1J5E E;  4MYU A;  1KIJ A;  4X66 E;  1N0U A;  1MX0 A;  4AQY E;  3B78 A;  3CWV A;  2HFU A;  3B82 A;  4X62 I;  4FW9 A;  2R3V A;  4DR1 I;  3J7A G;  2PNM A;  2ZM6 E;  4LF8 E;  4DUY E;  4UTG A;  4X62 E;  2CGE A;  4AQY I;  2DEJ A;  4Z7Y A;  3OTO E;  4JI7 E;  1PKP A;  2WW4 A;  4DU7 A;  3J7A M;  2DEI A;  1HNW E;  4B3M I;  2A2D A;  2J7K A;  1H7U A;  2CZ9 A;  4FWH A;  4LF4 E;  4KHP E;  5LMN I;  1H7S A;  4LF6 E;  4DR4 E;  4GKK E;  1WUU A;  4USM A;  2ZBK B;  4DXL A;  3ZZU A;  4DR6 I;  4X64 I;  3PYG A;  4OX9 E;  1K47 A;  1S16 A;  4JI2 E;  1HK7 A;  1ZXM A;  5LMU E;  1EI1 A;  4NXN E;  1NHI A;  3K1J A;  1N33 E;  1Z0T A;  2BM1 A;  1EA6 A;  2A2C A;  4KQV A;  3PYD A;  5FLX Q;  4LF6 I;  4JI4 I;  2NPF A;  3Q6N A;  3JAM C;  4WUD A;  4DPT A;  4GKJ I;  2CG9 A;  1VIS A;  4DV3 I;  1N33 I;  1ZM4 A;  4DV6 E;  3T1H I;  1I94 I;  4JI6 E;  4DV2 E;  5LMU I;  1XMQ E;  4IZJ B;  2HK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...