3T1YI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3t1yI00
4X62E 1H72C 1HNXE 2R42A 2X7IA 2UU9I 2VQEI 3J7AG 1Z0GA 5IWAE 1N33I 1Z5CA 4B3SI 4DR6E 4YY3I 4DV6E 3OTOI 4KHPI 1H74A 2ZM6E 4NXME 4DR4I 4PU9A 4FWDA 4FWGA 1ZM3A 1I94I 3CWVA 1XHKA 4P52A 2VQFE 3J81C 4JI3E 4DR7I 1XMQI 4DUYI 2LJPA 4NXNI 2HFUA 2V2VA 2E5LI 3V2UC 4DV5I 4LF6E 2HKJA 4NXNE 2F4VE 1HNWI 4LF4I 1Z5BA 2X36A 3D4JA 5LL6R 4JI3I 3B8HA 4DV1I 2UXBI 4K0KI 4XTJA 4DUZI 2OI2A 4X66E 4DU8A 1FI4A 4DR5E 4DPYA 4ZVIA 1FNMA 1J5EI 1IBLI 4B3RI 4JI2E 4JI5I 1WUUA 4B3RE 3GONA 4RPFA 4LFBE 1HNZE 4DV7I 2NPFA 4YHHE 4X66I 1B63A 1XMOI 1EA6A 3B82A 3ZZTA 4JG4A 4I3HA 1S16A 1HR0E 1Z0CA 1Z0EA 5BR8E 1KIJA 4LFAE 1Z0WA 2HKEA 4WUDA 1D6TA 1B62A 4AQYI 2UUAI 5LMUI 4JI5E 4DV3I 4JI7I 2V34A 4LFCE 2AJ4A 1QZRA 2BV3A 1N36I 4JI4I 1IBKI 1XNRI 4WUBA 1MG7A 1IBLE 4Z7CA 3ZKDA 4JYAI 4X65I 1KTVA 1FKAE 4LF5I 1HNWE 4LF4E 4YHHI 4JV5I 3QT7A 1ELOA 5FLXQ 4GKKE 4FWHA 4FW9A 4JI2I 4JI0E 1H73A 4B3SE 4AQYE 2UUAE 2VQFI 1UEKA 4JI6E 3J7AM 4JI6I 2UXCI 2HHHE 1RR9A 1N36E 2GS8A 3K17A 1NHHA 1RREA 4LF6I 4JI0I 2A2DA 4DR4E 3QT8A 1MU5A 1N32E 1K47A 4LFBI 5GMDA 3J80Q 3ZM7A 2ZBKB 3PYEA 2CZ9A 2J7KA 3QT5A 4B3TI 4DPWA 2Q2EB 1Z0VA 5IT9C 3J80C 3PYFA 4JYAE 4DV7E 1IBKE 1XNRE 4FN5A 1EI1A 4P7AA 3WU6A 4DR3I 1I94E 4LF8I 3T1YI 3PYDA 5A2QC 2XEXA 1IBME 2ZM6I 5LMUE 3LNUA 3QT6A 3Q1QA 4JV5E 3OTOE 4KHPE 4K0KE 4DU7A 5IWAI 2UXDI 4JI8I 4DV1E 4DV4I 2V2ZA 1HR0I 2HHHI 4JI1I 3V5RA 1NHJA 1HNXI 2EFGA 2E1RA 4X64I 2UUCE 4USMA 3LTOA 4DR1E 5FLXC 1PKPA 4LFCI 4DPTA 1KVKA 4WUCA 4DV0E 3JAMQ 4B3MI 3ZKBA 4OX9I 4B3TE 1VISA 1ZM9A 1FWLA 4YY3E 4DV4E 4DUZE 2DEJA 2VQEE 4LF5E 2F4VI 1FJGI 2UXDE 3J81Q 1XMOE 3WU3A 3B78A 1PIEA 4JI4E 3ZZ0A 2E5LE 1J5EE 4HACB 3T1YE 4DPUA 4MYTA 1ZXNA 2R3VA 4DR1I 2V2QA 1N33E 2UXCE 4DR7E 4DR5I 2UXBE 1N0VC 3F0NA 4DR2E 4Z7YA 1N34I 4KQVA 4LF7E 2UUBE 3WU4A 5LMNI 4JI8E 2HK3A 3HULA 4ED4A 4HYMA 3ZZUA 3T1HE 2HFSA 4GKJE 1ZXMA 4PRVA 4HACA 4DV2E 1FJGE 1N34E 3JAMC 1A6FA 4DR2I 5IT9Q 2UU9E 4DV6I 2ZITA 4X62I 1NHIA 4USKA 4R1FA 4JI7E 1DARA 1S4EA 1FWKA 3WU5A 1KKHA 4DV5E 4X64E 2UUCI 4LFAI 1Z59A 4NXMI 3T1HI 5LMNE 2UUBI 3K1JA 1H7SA 3M6AA 4LF7I 4DR6I 2A2CA 4URLA 4HXZA 1Z0BA 2BM1A 5GMEA 4X65E 4LF9E 4EMDA 1Z0TA 4PRXA 4DV3E 1BKNA 1U2RA 1ZM2A 1PVGA 4DXLA 1H7UA 4GKKI 4LF9I 2HK2A 3H4LA 1Z5AA 5BR8I 1XNQI 1N0UA 4UT4A 4UTGA 5L3JA 4JI1E 4DPXA 2WW4A 4B3ME 4DV2I 1N32I 4OX9E 1XNQE 1ZM4A 4DV0I 1OJ4A 4M1KA 4GKJI 2VF3A 4HY1A 5A2QQ 4DUYE 1IBMI 2V8PA 3LPSA 1HNZI 1XMQE 3PYGA 4LF8E 1NZ0A 2DEIA 4MYUA 4DR3E 2BM0A 1MX0A
chains in the Genus database with same CATH superfamily
5EL9A 4GQUA 4X62E 1H72C 1HNXE 2R42A 2X7IA 4LOMA 2UU9I 2VQEI 3J7AG 1Z0GA 5IWAE 1N33I 1VI7A 1Z5CA 4B3SI 4DR6E 4IFDD 4YY3I 5JEAA 4DV6E 2C37A 2CGEA 3OTOI 4KHPI 1H74A 2ZM6E 3HJCA 4NXME 4IFDB 4DR4I 3Q6MA 4PU9A 4FWDA 4FWGA 5K36C 1ZM3A 1I94I 3CWVA 1XHKA 5ELWA 1UDOA 4P52A 2VQFE 3PS1A 5K36F 3J81C 4JI3E 4DR7I 1XMQI 2JEBB 2PO2A 1USVA 4DUYI 2LJPA 4NXNI 2HFUA 4OO1F 2V2VA 4IFDF 2E5LI 3V2UC 4DV5I 4LF6E 4OO1B 2HKJA 4NXNE 2F4VE 2NN6E 1HNWI 4LF4I 1Z5BA 2X36A 3D4JA 5LL6R 4JI3I 3B8HA 4DV1I 2UXBI 2VESA 4K0KI 4XTJA 4DUZI 2OI2A 4X66E 4DU8A 5C0XE 2O1TA 1FI4A 4DR5E 4DPYA 4ZVIA 1FNMA 1XXEA 1J5EI 1IBLI 1USUA 4B3RI 4MDTA 1Y4SA 2PO0A 2C37B 4JI5I 4JI2E 1WUUA 4B3RE 3GONA 4RPFA 4LFBE 1HNZE 4OKGA 3K85A 3P76A 5JEAC 3PS2A 2O1UA 4DV7I 2NPFA 1Y5YA 4YHHE 4X66I 1B63A 4IS9A 1XMOI 3KRNA 1EA6A 3B82A 3ZZTA 4JG4A 4I3HA 1S16A 2Z5EA 1HR0E 1Z0CA 1Z0EA 5BR8E 2O1VA 1KIJA 4IZKA 4OZEA 1RHYA 4LFAE 1Z0WA 2HKEA 3P3CA 4WUDA 1D6TA 1B62A 2BA1G 4AQYI 2Z5BB 2UUAI 5LMUI 4LCHA 4JI5E 4DV3I 4JI7I 2V34A 4LFCE 2AJ4A 1QZRA 2BV3A 1N36I 5DROA 3DD6A 1IBKI 4JI4I 4WUBA 1MG7A 1IBLE 1XNRI 5DNXA 3ZKDA 4Z7CA 4JYAI 2PNZA 4X65I 1KTVA 1FKAE 1HK7A 2C39A 4U3BA 4LF5I 3UHMA 4AM3A 2IESA 4OO1E 4AIMA 1HNWE 3U1KA 3P3EA 2NN6B 4LF4E 2WNRA 4YHHI 4JV5I 5C0XF 3QT7A 1ELOA 5DRQA 5FLXQ 4GKKE 2Z5CB 1OYSA 4FWHA 4FW9A 4JI2I 3PRYA 4JI0E 5C0XB 1H73A 4U3DA 4B3SE 4AQYE 2UUAE 5DRPA 2VQFI 1UEKA 4JI6E 2PNMA 3J7AM 4QNKA 4JI6I 2BR2B 2UXCI 2HHHE 3M7ND 1RR9A 1N36E 2GS8A 3K17A 2Z5BA 2F1DA 2O1WA 1NHHA 1RREA 4LF6I 1UDNA 4JI0I 2A2DA 4DR4E 5K36A 3PS3A 3QT8A 1MU5A 3HKMA 1N32E 1K47A 4LFBI 2C38A 5GMDA 3J80Q 3ZM7A 2O3ZA 2ZBKB 4IFDA 3PYEA 2GO3A 2CZ9A 2J7KA 3QT5A 4B3TI 4DPWA 2Q2EB 1Z0VA 5IT9C 3J80C 3PYFA 4JYAE 4DV7E 2WNRB 1IBKE 1XNRE 4FN5A 5C0XD 1EI1A 4OO1C 4P7AA 3L7ZB 3WU6A 4DR3I 3M85D 1I94E 4LF8I 3T1YI 2J65A 3PYDA 5A2QC 2XEXA 4IZJD 1IBME 2ZM6I 1OYRA 5LMUE 3LNUA 3QT6A 1OYPA 3Q1QA 4JV5E 3OTOE 4KHPE 4K0KE 4DU7A 5IWAI 2UXDI 4JI8I 4AIDA 4DV1E 4DV4I 2V2ZA 1HR0I 2HHHI 4JI1I 4OO1A 3V5RA 4MQYA 1NHJA 1HNXI 2EFGA 5EKWA 4J3DA 2E1RA 4X64I 2UUCE 4LPFA 4MU4A 4USMA 3LTOA 4DR1E 5FLXC 2PO1A 1PKPA 5JEAF 4LFCI 4DPTA 1KVKA 2NN6F 4IZJA 4WUCA 4DV0E 3JAMQ 4B3MI 3ZKBA 2C38B 4B3TE 1VISA 4OX9I 5DRRA 1ZM9A 4BA2A 1UDSA 1FWLA 4YY3E 4DV4E 4DUZE 2JE6A 2DEJA 2VQEE 4LF5E 2F4VI 1FJGI 4OO1D 3B4TA 2UXDE 3J81Q 1XMOE 3WU3A 5FWKA 3B78A 5C0XC 1PIEA 2PNZB 3P3GA 4N3OA 4JI4E 3ZZ0A 5JEAB 2E5LE 1J5EE 4IZKB 4HACB 3T1YE 4DPUA 4MYTA 1ZXNA 2R3VA 4BA1A 2BA0D 3M7NG 4DR1I 2V2QA 1N33E 2JT2A 2PO1B 2UXCE 4DR7E 4DR5I 1E3PA 2UXBE 1N0VC 3F0NA 4DR2E 4Z7YA 4LCGA 4QNJA 4KQVA 1N34I 2PO2B 5LMNI 2IERA 4LCFA 3WU4A 2UUBE 4LF7E 4JI8E 2HK3A 3HULA 4ED4A 3CDIA 4HYMA 2BR2A 2GQ0A 4MU0A 3ZZUA 3T1HE 2HFSA 4GKJE 1R6MA 3GCMA 2NN6C 1ZXMA 4PRVA 4HACA 4DV2E 1FJGE 1N34E 4FW4A 4BA1B 2JEAB 3JAMC 1YHCA 1A6FA 4DR2I 4IZJB 3M85G 5K36B 5IT9Q 2UU9E 4DV6I 2ZITA 2GO4A 2PO0B 4X62I 1R6LA 4MU1A 1UDQA 5C0XA 1Y6ZA 1NHIA 2PNLA 4USKA 4R1FA 2BA0G 4NBQA 4JI7E 1DARA 1S4EA 1FWKA 2IOPA 3WU5A 1KKHA 4DV5E 4X64E 2UUCI 4LFAI 1Z59A 4NXMI 4MU3A 2WP8B 3T1HI 5LMNE 2UUBI 3K1JA 1H7SA 2CG9A 3M6AA 4LF7I 4DR6I 2A2CA 4URLA 4HXZA 3U1YA 3NZKA 3Q6NA 1Z0BA 2NN6D 5JEAE 2BM1A 1E3HA 4IFDE 5GMEA 4X65E 4LF9E 4EMDA 1P42A 1Z0TA 4PRXA 4DV3E 2CVEA 5DNLA 1BKNA 3L7ZA 2IOQA 1U2RA 1ZM2A 1PVGA 4DXLA 2JEAA 1H7UA 4GKKI 1Y4UA 4LF9I 2HK2A 5K36D 3H4LA 1Z5AA 2WP8A 5BR8I 1XNQI 1N0UA 5JEAD 4UT4A 4FW3A 4UTGA 5L3JA 3H1CA 4JI1E 3GMEA 2NN6A 2Z5CA 4DPXA 2WW4A 4B3ME 4FW5A 4DV2I 1N32I 3CDJA 4OX9E 4BA2B 5K36E 1XNQE 1ZM4A 4DV0I 1OJ4A 4M1KA 4ISAA 2JE6B 4GKJI 2JEBA 2VF3A 3GLLA 4HY1A 5A2QQ 4DUYE 4IFDC 3P06A 2V8PA 1IBMI 3LPSA 1HNZI 1XMQE 3PYGA 2C39B 4LF8E 1NZ0A 1Y60A 2DEIA 4MYUA 4DR3E 4FW7A 1YH8A 2BM0A 1MX0A 2BA1D 4FW6A 2AE8A
chains in the Genus database with same CATH topology
4X62E 1H72C 1HNXE 2R42A 2X7IA 2UU9I 2VQEI 3J7AG 1Z0GA 5IWAE 1N33I 1Z5CA 4B3SI 4DR6E 4YY3I 4DV6E 2CGEA 3OTOI 4KHPI 1H74A 2ZM6E 3HJCA 4NXME 4DR4I 3Q6MA 4PU9A 4FWDA 4FWGA 1ZM3A 1I94I 3CWVA 1XHKA 4P52A 2VQFE 3J81C 4JI3E 4DR7I 1XMQI 1USVA 4DUYI 2LJPA 4NXNI 2HFUA 2V2VA 2E5LI 3V2UC 4DV5I 4LF6E 2HKJA 4NXNE 2F4VE 1HNWI 4LF4I 1Z5BA 2X36A 3D4JA 5LL6R 4JI3I 3B8HA 4DV1I 2UXBI 4K0KI 4XTJA 4DUZI 2OI2A 4X66E 4DU8A 2O1TA 1FI4A 4DR5E 4DPYA 4ZVIA 1FNMA 1J5EI 1IBLI 1USUA 4B3RI 4JI2E 1Y4SA 4JI5I 1WUUA 4B3RE 3GONA 4RPFA 4LFBE 1HNZE 3K85A 2O1UA 4DV7I 2NPFA 4YHHE 4X66I 1B63A 1XMOI 1EA6A 3B82A 3ZZTA 4JG4A 4I3HA 1S16A 2Z5EA 1HR0E 1Z0CA 1Z0EA 5BR8E 2O1VA 1KIJA 4IZKA 4LFAE 1Z0WA 2HKEA 4WUDA 1D6TA 1B62A 4AQYI 2Z5BB 2UUAI 5LMUI 4JI5E 4DV3I 4JI7I 2V34A 4LFCE 2AJ4A 1QZRA 2BV3A 1N36I 4JI4I 1IBKI 1XNRI 4WUBA 1MG7A 1IBLE 4Z7CA 3ZKDA 4JYAI 4X65I 1KTVA 1FKAE 1HK7A 4LF5I 1HNWE 4LF4E 4YHHI 4JV5I 3QT7A 1ELOA 5FLXQ 4GKKE 2Z5CB 4FWHA 4FW9A 4JI2I 3PRYA 4JI0E 1H73A 4B3SE 4AQYE 2UUAE 2VQFI 1UEKA 4JI6E 2PNMA 3J7AM 4JI6I 2UXCI 2HHHE 1RR9A 1N36E 2GS8A 3K17A 2Z5BA 2O1WA 1NHHA 1RREA 4LF6I 4JI0I 2A2DA 4DR4E 3QT8A 1MU5A 1N32E 1K47A 4LFBI 5GMDA 3J80Q 3ZM7A 2ZBKB 3PYEA 2CZ9A 2J7KA 3QT5A 4B3TI 4DPWA 2Q2EB 1Z0VA 5IT9C 3J80C 3PYFA 4JYAE 4DV7E 1IBKE 1XNRE 4FN5A 1EI1A 4P7AA 3WU6A 4DR3I 1I94E 4LF8I 3T1YI 3PYDA 5A2QC 2XEXA 4IZJD 1IBME 2ZM6I 5LMUE 3LNUA 3QT6A 3Q1QA 4JV5E 3OTOE 4KHPE 4K0KE 4DU7A 5IWAI 2UXDI 4JI8I 4DV1E 4DV4I 2V2ZA 1HR0I 2HHHI 4JI1I 3V5RA 1NHJA 1HNXI 2EFGA 2E1RA 4X64I 2UUCE 4USMA 3LTOA 4DR1E 5FLXC 1PKPA 4LFCI 4DPTA 1KVKA 4IZJA 4WUCA 4DV0E 3JAMQ 4B3MI 3ZKBA 4OX9I 4B3TE 1VISA 1ZM9A 1FWLA 4YY3E 4DV4E 4DUZE 2DEJA 2VQEE 4LF5E 2F4VI 1FJGI 2UXDE 3J81Q 1XMOE 3WU3A 5FWKA 3B78A 1PIEA 4N3OA 4JI4E 3ZZ0A 2E5LE 1J5EE 4IZKB 4HACB 3T1YE 4DPUA 4MYTA 1ZXNA 2R3VA 4DR1I 2V2QA 1N33E 2UXCE 4DR7E 4DR5I 2UXBE 1N0VC 3F0NA 4DR2E 4Z7YA 1N34I 4KQVA 2UUBE 5LMNI 3WU4A 4LF7E 4JI8E 2HK3A 3HULA 4ED4A 4HYMA 2GQ0A 3ZZUA 3T1HE 2HFSA 4GKJE 1ZXMA 4PRVA 4HACA 4DV2E 1FJGE 1N34E 3JAMC 1A6FA 4DR2I 4IZJB 5IT9Q 2UU9E 4DV6I 2ZITA 4X62I 1Y6ZA 1NHIA 2PNLA 4USKA 4R1FA 4JI7E 1DARA 1S4EA 1FWKA 2IOPA 3WU5A 1KKHA 4DV5E 4X64E 2UUCI 4LFAI 1Z59A 4NXMI 3T1HI 5LMNE 2UUBI 3K1JA 1H7SA 2CG9A 3M6AA 4LF7I 4DR6I 2A2CA 4URLA 4HXZA 3Q6NA 1Z0BA 2BM1A 5GMEA 4X65E 4LF9E 4EMDA 1Z0TA 4PRXA 4DV3E 1BKNA 2IOQA 1U2RA 1ZM2A 1PVGA 4DXLA 1H7UA 4GKKI 1Y4UA 4LF9I 2HK2A 3H4LA 1Z5AA 5BR8I 1XNQI 1N0UA 4UT4A 4UTGA 5L3JA 4JI1E 2Z5CA 4DPXA 2WW4A 4B3ME 4DV2I 1N32I 4OX9E 1XNQE 1ZM4A 4DV0I 1OJ4A 4M1KA 4GKJI 2VF3A 4HY1A 5A2QQ 4DUYE 1IBMI 3P06A 2V8PA 3LPSA 1HNZI 1XMQE 3PYGA 4LF8E 1NZ0A 2DEIA 4MYUA 4DR3E 2BM0A 1MX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 E;  1H72 C;  1HNX E;  2R42 A;  2X7I A;  2UU9 I;  2VQE I;  3J7A G;  1Z0G A;  5IWA E;  1N33 I;  1Z5C A;  4B3S I;  4DR6 E;  4YY3 I;  4DV6 E;  3OTO I;  4KHP I;  1H74 A;  2ZM6 E;  4NXM E;  4DR4 I;  4PU9 A;  4FWD A;  4FWG A;  1ZM3 A;  1I94 I;  3CWV A;  1XHK A;  4P52 A;  2VQF E;  3J81 C;  4JI3 E;  4DR7 I;  1XMQ I;  4DUY I;  2LJP A;  4NXN I;  2HFU A;  2V2V A;  2E5L I;  3V2U C;  4DV5 I;  4LF6 E;  2HKJ A;  4NXN E;  2F4V E;  1HNW I;  4LF4 I;  1Z5B A;  2X36 A;  3D4J A;  5LL6 R;  4JI3 I;  3B8H A;  4DV1 I;  2UXB I;  4K0K I;  4XTJ A;  4DUZ I;  2OI2 A;  4X66 E;  4DU8 A;  1FI4 A;  4DR5 E;  4DPY A;  4ZVI A;  1FNM A;  1J5E I;  1IBL I;  4B3R I;  4JI2 E;  4JI5 I;  1WUU A;  4B3R E;  3GON A;  4RPF A;  4LFB E;  1HNZ E;  4DV7 I;  2NPF A;  4YHH E;  4X66 I;  1B63 A;  1XMO I;  1EA6 A;  3B82 A;  3ZZT A;  4JG4 A;  4I3H A;  1S16 A;  1HR0 E;  1Z0C A;  1Z0E A;  5BR8 E;  1KIJ A;  4LFA E;  1Z0W A;  2HKE A;  4WUD A;  1D6T A;  1B62 A;  4AQY I;  2UUA I;  5LMU I;  4JI5 E;  4DV3 I;  4JI7 I;  2V34 A;  4LFC E;  2AJ4 A;  1QZR A;  2BV3 A;  1N36 I;  4JI4 I;  1IBK I;  1XNR I;  4WUB A;  1MG7 A;  1IBL E;  4Z7C A;  3ZKD A;  4JYA I;  4X65 I;  1KTV A;  1FKA E;  4LF5 I;  1HNW E;  4LF4 E;  4YHH I;  4JV5 I;  3QT7 A;  1ELO A;  5FLX Q;  4GKK E;  4FWH A;  4FW9 A;  4JI2 I;  4JI0 E;  1H73 A;  4B3S E;  4AQY E;  2UUA E;  2VQF I;  1UEK A;  4JI6 E;  3J7A M;  4JI6 I;  2UXC I;  2HHH E;  1RR9 A;  1N36 E;  2GS8 A;  3K17 A;  1NHH A;  1RRE A;  4LF6 I;  4JI0 I;  2A2D A;  4DR4 E;  3QT8 A;  1MU5 A;  1N32 E;  1K47 A;  4LFB I;  5GMD A;  3J80 Q;  3ZM7 A;  2ZBK B;  3PYE A;  2CZ9 A;  2J7K A;  3QT5 A;  4B3T I;  4DPW A;  2Q2E B;  1Z0V A;  5IT9 C;  3J80 C;  3PYF A;  4JYA E;  4DV7 E;  1IBK E;  1XNR E;  4FN5 A;  1EI1 A;  4P7A A;  3WU6 A;  4DR3 I;  1I94 E;  4LF8 I;  3T1Y I;  3PYD A;  5A2Q C;  2XEX A;  1IBM E;  2ZM6 I;  5LMU E;  3LNU A;  3QT6 A;  3Q1Q A;  4JV5 E;  3OTO E;  4KHP E;  4K0K E;  4DU7 A;  5IWA I;  2UXD I;  4JI8 I;  4DV1 E;  4DV4 I;  2V2Z A;  1HR0 I;  2HHH I;  4JI1 I;  3V5R A;  1NHJ A;  1HNX I;  2EFG A;  2E1R A;  4X64 I;  2UUC E;  4USM A;  3LTO A;  4DR1 E;  5FLX C;  1PKP A;  4LFC I;  4DPT A;  1KVK A;  4WUC A;  4DV0 E;  3JAM Q;  4B3M I;  3ZKB A;  4OX9 I;  4B3T E;  1VIS A;  1ZM9 A;  1FWL A;  4YY3 E;  4DV4 E;  4DUZ E;  2DEJ A;  2VQE E;  4LF5 E;  2F4V I;  1FJG I;  2UXD E;  3J81 Q;  1XMO E;  3WU3 A;  3B78 A;  1PIE A;  4JI4 E;  3ZZ0 A;  2E5L E;  1J5E E;  4HAC B;  3T1Y E;  4DPU A;  4MYT A;  1ZXN A;  2R3V A;  4DR1 I;  2V2Q A;  1N33 E;  2UXC E;  4DR7 E;  4DR5 I;  2UXB E;  1N0V C;  3F0N A;  4DR2 E;  4Z7Y A;  1N34 I;  4KQV A;  4LF7 E;  2UUB E;  3WU4 A;  5LMN I;  4JI8 E;  2HK3 A;  3HUL A;  4ED4 A;  4HYM A;  3ZZU A;  3T1H E;  2HFS A;  4GKJ E;  1ZXM A;  4PRV A;  4HAC A;  4DV2 E;  1FJG E;  1N34 E;  3JAM C;  1A6F A;  4DR2 I;  5IT9 Q;  2UU9 E;  4DV6 I;  2ZIT A;  4X62 I;  1NHI A;  4USK A;  4R1F A;  4JI7 E;  1DAR A;  1S4E A;  1FWK A;  3WU5 A;  1KKH A;  4DV5 E;  4X64 E;  2UUC I;  4LFA I;  1Z59 A;  4NXM I;  3T1H I;  5LMN E;  2UUB I;  3K1J A;  1H7S A;  3M6A A;  4LF7 I;  4DR6 I;  2A2C A;  4URL A;  4HXZ A;  1Z0B A;  2BM1 A;  5GME A;  4X65 E;  4LF9 E;  4EMD A;  1Z0T A;  4PRX A;  4DV3 E;  1BKN A;  1U2R A;  1ZM2 A;  1PVG A;  4DXL A;  1H7U A;  4GKK I;  4LF9 I;  2HK2 A;  3H4L A;  1Z5A A;  5BR8 I;  1XNQ I;  1N0U A;  4UT4 A;  4UTG A;  5L3J A;  4JI1 E;  4DPX A;  2WW4 A;  4B3M E;  4DV2 I;  1N32 I;  4OX9 E;  1XNQ E;  1ZM4 A;  4DV0 I;  1OJ4 A;  4M1K A;  4GKJ I;  2VF3 A;  4HY1 A;  5A2Q Q;  4DUY E;  1IBM I;  2V8P A;  3LPS A;  1HNZ I;  1XMQ E;  3PYG A;  4LF8 E;  1NZ0 A;  2DEI A;  4MYU A;  4DR3 E;  2BM0 A;  1MX0 A; 
#chains in the Genus database with same CATH topology
 5EL9 A;  4GQU A;  4X62 E;  1H72 C;  1HNX E;  2R42 A;  2X7I A;  4LOM A;  2UU9 I;  2VQE I;  3J7A G;  1Z0G A;  5IWA E;  1N33 I;  1VI7 A;  1Z5C A;  4B3S I;  4DR6 E;  4IFD D;  4YY3 I;  5JEA A;  4DV6 E;  2C37 A;  2CGE A;  3OTO I;  4KHP I;  1H74 A;  2ZM6 E;  3HJC A;  4NXM E;  4IFD B;  4DR4 I;  3Q6M A;  4PU9 A;  4FWD A;  4FWG A;  5K36 C;  1ZM3 A;  1I94 I;  3CWV A;  1XHK A;  5ELW A;  1UDO A;  4P52 A;  2VQF E;  3PS1 A;  5K36 F;  3J81 C;  4JI3 E;  4DR7 I;  1XMQ I;  2JEB B;  2PO2 A;  1USV A;  4DUY I;  2LJP A;  4NXN I;  2HFU A;  4OO1 F;  2V2V A;  4IFD F;  2E5L I;  3V2U C;  4DV5 I;  4LF6 E;  4OO1 B;  2HKJ A;  4NXN E;  2F4V E;  2NN6 E;  1HNW I;  4LF4 I;  1Z5B A;  2X36 A;  3D4J A;  5LL6 R;  4JI3 I;  3B8H A;  4DV1 I;  2UXB I;  2VES A;  4K0K I;  4XTJ A;  4DUZ I;  2OI2 A;  4X66 E;  4DU8 A;  5C0X E;  2O1T A;  1FI4 A;  4DR5 E;  4DPY A;  4ZVI A;  1FNM A;  1XXE A;  1J5E I;  1IBL I;  1USU A;  4B3R I;  4MDT A;  1Y4S A;  2PO0 A;  2C37 B;  4JI5 I;  4JI2 E;  1WUU A;  4B3R E;  3GON A;  4RPF A;  4LFB E;  1HNZ E;  4OKG A;  3K85 A;  3P76 A;  5JEA C;  3PS2 A;  2O1U A;  4DV7 I;  2NPF A;  1Y5Y A;  4YHH E;  4X66 I;  1B63 A;  4IS9 A;  1XMO I;  3KRN A;  1EA6 A;  3B82 A;  3ZZT A;  4JG4 A;  4I3H A;  1S16 A;  2Z5E A;  1HR0 E;  1Z0C A;  1Z0E A;  5BR8 E;  2O1V A;  1KIJ A;  4IZK A;  4OZE A;  1RHY A;  4LFA E;  1Z0W A;  2HKE A;  3P3C A;  4WUD A;  1D6T A;  1B62 A;  2BA1 G;  4AQY I;  2Z5B B;  2UUA I;  5LMU I;  4LCH A;  4JI5 E;  4DV3 I;  4JI7 I;  2V34 A;  4LFC E;  2AJ4 A;  1QZR A;  2BV3 A;  1N36 I;  5DRO A;  3DD6 A;  1IBK I;  4JI4 I;  4WUB A;  1MG7 A;  1IBL E;  1XNR I;  5DNX A;  3ZKD A;  4Z7C A;  4JYA I;  2PNZ A;  4X65 I;  1KTV A;  1FKA E;  1HK7 A;  2C39 A;  4U3B A;  4LF5 I;  3UHM A;  4AM3 A;  2IES A;  4OO1 E;  4AIM A;  1HNW E;  3U1K A;  3P3E A;  2NN6 B;  4LF4 E;  2WNR A;  4YHH I;  4JV5 I;  5C0X F;  3QT7 A;  1ELO A;  5DRQ A;  5FLX Q;  4GKK E;  2Z5C B;  1OYS A;  4FWH A;  4FW9 A;  4JI2 I;  3PRY A;  4JI0 E;  5C0X B;  1H73 A;  4U3D A;  4B3S E;  4AQY E;  2UUA E;  5DRP A;  2VQF I;  1UEK A;  4JI6 E;  2PNM A;  3J7A M;  4QNK A;  4JI6 I;  2BR2 B;  2UXC I;  2HHH E;  3M7N D;  1RR9 A;  1N36 E;  2GS8 A;  3K17 A;  2Z5B A;  2F1D A;  2O1W A;  1NHH A;  1RRE A;  4LF6 I;  1UDN A;  4JI0 I;  2A2D A;  4DR4 E;  5K36 A;  3PS3 A;  3QT8 A;  1MU5 A;  3HKM A;  1N32 E;  1K47 A;  4LFB I;  2C38 A;  5GMD A;  3J80 Q;  3ZM7 A;  2O3Z A;  2ZBK B;  4IFD A;  3PYE A;  2GO3 A;  2CZ9 A;  2J7K A;  3QT5 A;  4B3T I;  4DPW A;  2Q2E B;  1Z0V A;  5IT9 C;  3J80 C;  3PYF A;  4JYA E;  4DV7 E;  2WNR B;  1IBK E;  1XNR E;  4FN5 A;  5C0X D;  1EI1 A;  4OO1 C;  4P7A A;  3L7Z B;  3WU6 A;  4DR3 I;  3M85 D;  1I94 E;  4LF8 I;  3T1Y I;  2J65 A;  3PYD A;  5A2Q C;  2XEX A;  4IZJ D;  1IBM E;  2ZM6 I;  1OYR A;  5LMU E;  3LNU A;  3QT6 A;  1OYP A;  3Q1Q A;  4JV5 E;  3OTO E;  4KHP E;  4K0K E;  4DU7 A;  5IWA I;  2UXD I;  4JI8 I;  4AID A;  4DV1 E;  4DV4 I;  2V2Z A;  1HR0 I;  2HHH I;  4JI1 I;  4OO1 A;  3V5R A;  4MQY A;  1NHJ A;  1HNX I;  2EFG A;  5EKW A;  4J3D A;  2E1R A;  4X64 I;  2UUC E;  4LPF A;  4MU4 A;  4USM A;  3LTO A;  4DR1 E;  5FLX C;  2PO1 A;  1PKP A;  5JEA F;  4LFC I;  4DPT A;  1KVK A;  2NN6 F;  4IZJ A;  4WUC A;  4DV0 E;  3JAM Q;  4B3M I;  3ZKB A;  2C38 B;  4B3T E;  1VIS A;  4OX9 I;  5DRR A;  1ZM9 A;  4BA2 A;  1UDS A;  1FWL A;  4YY3 E;  4DV4 E;  4DUZ E;  2JE6 A;  2DEJ A;  2VQE E;  4LF5 E;  2F4V I;  1FJG I;  4OO1 D;  3B4T A;  2UXD E;  3J81 Q;  1XMO E;  3WU3 A;  5FWK A;  3B78 A;  5C0X C;  1PIE A;  2PNZ B;  3P3G A;  4N3O A;  4JI4 E;  3ZZ0 A;  5JEA B;  2E5L E;  1J5E E;  4IZK B;  4HAC B;  3T1Y E;  4DPU A;  4MYT A;  1ZXN A;  2R3V A;  4BA1 A;  2BA0 D;  3M7N G;  4DR1 I;  2V2Q A;  1N33 E;  2JT2 A;  2PO1 B;  2UXC E;  4DR7 E;  4DR5 I;  1E3P A;  2UXB E;  1N0V C;  3F0N A;  4DR2 E;  4Z7Y A;  4LCG A;  4QNJ A;  4KQV A;  1N34 I;  2PO2 B;  5LMN I;  2IER A;  4LCF A;  3WU4 A;  2UUB E;  4LF7 E;  4JI8 E;  2HK3 A;  3HUL A;  4ED4 A;  3CDI A;  4HYM A;  2BR2 A;  2GQ0 A;  4MU0 A;  3ZZU A;  3T1H E;  2HFS A;  4GKJ E;  1R6M A;  3GCM A;  2NN6 C;  1ZXM A;  4PRV A;  4HAC A;  4DV2 E;  1FJG E;  1N34 E;  4FW4 A;  4BA1 B;  2JEA B;  3JAM C;  1YHC A;  1A6F A;  4DR2 I;  4IZJ B;  3M85 G;  5K36 B;  5IT9 Q;  2UU9 E;  4DV6 I;  2ZIT A;  2GO4 A;  2PO0 B;  4X62 I;  1R6L A;  4MU1 A;  1UDQ A;  5C0X A;  1Y6Z A;  1NHI A;  2PNL A;  4USK A;  4R1F A;  2BA0 G;  4NBQ A;  4JI7 E;  1DAR A;  1S4E A;  1FWK A;  2IOP A;  3WU5 A;  1KKH A;  4DV5 E;  4X64 E;  2UUC I;  4LFA I;  1Z59 A;  4NXM I;  4MU3 A;  2WP8 B;  3T1H I;  5LMN E;  2UUB I;  3K1J A;  1H7S A;  2CG9 A;  3M6A A;  4LF7 I;  4DR6 I;  2A2C A;  4URL A;  4HXZ A;  3U1Y A;  3NZK A;  3Q6N A;  1Z0B A;  2NN6 D;  5JEA E;  2BM1 A;  1E3H A;  4IFD E;  5GME A;  4X65 E;  4LF9 E;  4EMD A;  1P42 A;  1Z0T A;  4PRX A;  4DV3 E;  2CVE A;  5DNL A;  1BKN A;  3L7Z A;  2IOQ A;  1U2R A;  1ZM2 A;  1PVG A;  4DXL A;  2JEA A;  1H7U A;  4GKK I;  1Y4U A;  4LF9 I;  2HK2 A;  5K36 D;  3H4L A;  1Z5A A;  2WP8 A;  5BR8 I;  1XNQ I;  1N0U A;  5JEA D;  4UT4 A;  4FW3 A;  4UTG A;  5L3J A;  3H1C A;  4JI1 E;  3GME A;  2NN6 A;  2Z5C A;  4DPX A;  2WW4 A;  4B3M E;  4FW5 A;  4DV2 I;  1N32 I;  3CDJ A;  4OX9 E;  4BA2 B;  5K36 E;  1XNQ E;  1ZM4 A;  4DV0 I;  1OJ4 A;  4M1K A;  4ISA A;  2JE6 B;  4GKJ I;  2JEB A;  2VF3 A;  3GLL A;  4HY1 A;  5A2Q Q;  4DUY E;  4IFD C;  3P06 A;  2V8P A;  1IBM I;  3LPS A;  1HNZ I;  1XMQ E;  3PYG A;  2C39 B;  4LF8 E;  1NZ0 A;  1Y60 A;  2DEI A;  4MYU A;  4DR3 E;  4FW7 A;  1YH8 A;  2BM0 A;  1MX0 A;  2BA1 D;  4FW6 A;  2AE8 A; 
#chains in the Genus database with same CATH homology
 4X62 E;  1H72 C;  1HNX E;  2R42 A;  2X7I A;  2UU9 I;  2VQE I;  3J7A G;  1Z0G A;  5IWA E;  1N33 I;  1Z5C A;  4B3S I;  4DR6 E;  4YY3 I;  4DV6 E;  2CGE A;  3OTO I;  4KHP I;  1H74 A;  2ZM6 E;  3HJC A;  4NXM E;  4DR4 I;  3Q6M A;  4PU9 A;  4FWD A;  4FWG A;  1ZM3 A;  1I94 I;  3CWV A;  1XHK A;  4P52 A;  2VQF E;  3J81 C;  4JI3 E;  4DR7 I;  1XMQ I;  1USV A;  4DUY I;  2LJP A;  4NXN I;  2HFU A;  2V2V A;  2E5L I;  3V2U C;  4DV5 I;  4LF6 E;  2HKJ A;  4NXN E;  2F4V E;  1HNW I;  4LF4 I;  1Z5B A;  2X36 A;  3D4J A;  5LL6 R;  4JI3 I;  3B8H A;  4DV1 I;  2UXB I;  4K0K I;  4XTJ A;  4DUZ I;  2OI2 A;  4X66 E;  4DU8 A;  2O1T A;  1FI4 A;  4DR5 E;  4DPY A;  4ZVI A;  1FNM A;  1J5E I;  1IBL I;  1USU A;  4B3R I;  4JI2 E;  1Y4S A;  4JI5 I;  1WUU A;  4B3R E;  3GON A;  4RPF A;  4LFB E;  1HNZ E;  3K85 A;  2O1U A;  4DV7 I;  2NPF A;  4YHH E;  4X66 I;  1B63 A;  1XMO I;  1EA6 A;  3B82 A;  3ZZT A;  4JG4 A;  4I3H A;  1S16 A;  2Z5E A;  1HR0 E;  1Z0C A;  1Z0E A;  5BR8 E;  2O1V A;  1KIJ A;  4IZK A;  4LFA E;  1Z0W A;  2HKE A;  4WUD A;  1D6T A;  1B62 A;  4AQY I;  2Z5B B;  2UUA I;  5LMU I;  4JI5 E;  4DV3 I;  4JI7 I;  2V34 A;  4LFC E;  2AJ4 A;  1QZR A;  2BV3 A;  1N36 I;  4JI4 I;  1IBK I;  1XNR I;  4WUB A;  1MG7 A;  1IBL E;  4Z7C A;  3ZKD A;  4JYA I;  4X65 I;  1KTV A;  1FKA E;  1HK7 A;  4LF5 I;  1HNW E;  4LF4 E;  4YHH I;  4JV5 I;  3QT7 A;  1ELO A;  5FLX Q;  4GKK E;  2Z5C B;  4FWH A;  4FW9 A;  4JI2 I;  3PRY A;  4JI0 E;  1H73 A;  4B3S E;  4AQY E;  2UUA E;  2VQF I;  1UEK A;  4JI6 E;  2PNM A;  3J7A M;  4JI6 I;  2UXC I;  2HHH E;  1RR9 A;  1N36 E;  2GS8 A;  3K17 A;  2Z5B A;  2O1W A;  1NHH A;  1RRE A;  4LF6 I;  4JI0 I;  2A2D A;  4DR4 E;  3QT8 A;  1MU5 A;  1N32 E;  1K47 A;  4LFB I;  5GMD A;  3J80 Q;  3ZM7 A;  2ZBK B;  3PYE A;  2CZ9 A;  2J7K A;  3QT5 A;  4B3T I;  4DPW A;  2Q2E B;  1Z0V A;  5IT9 C;  3J80 C;  3PYF A;  4JYA E;  4DV7 E;  1IBK E;  1XNR E;  4FN5 A;  1EI1 A;  4P7A A;  3WU6 A;  4DR3 I;  1I94 E;  4LF8 I;  3T1Y I;  3PYD A;  5A2Q C;  2XEX A;  4IZJ D;  1IBM E;  2ZM6 I;  5LMU E;  3LNU A;  3QT6 A;  3Q1Q A;  4JV5 E;  3OTO E;  4KHP E;  4K0K E;  4DU7 A;  5IWA I;  2UXD I;  4JI8 I;  4DV1 E;  4DV4 I;  2V2Z A;  1HR0 I;  2HHH I;  4JI1 I;  3V5R A;  1NHJ A;  1HNX I;  2EFG A;  2E1R A;  4X64 I;  2UUC E;  4USM A;  3LTO A;  4DR1 E;  5FLX C;  1PKP A;  4LFC I;  4DPT A;  1KVK A;  4IZJ A;  4WUC A;  4DV0 E;  3JAM Q;  4B3M I;  3ZKB A;  4OX9 I;  4B3T E;  1VIS A;  1ZM9 A;  1FWL A;  4YY3 E;  4DV4 E;  4DUZ E;  2DEJ A;  2VQE E;  4LF5 E;  2F4V I;  1FJG I;  2UXD E;  3J81 Q;  1XMO E;  3WU3 A;  5FWK A;  3B78 A;  1PIE A;  4N3O A;  4JI4 E;  3ZZ0 A;  2E5L E;  1J5E E;  4IZK B;  4HAC B;  3T1Y E;  4DPU A;  4MYT A;  1ZXN A;  2R3V A;  4DR1 I;  2V2Q A;  1N33 E;  2UXC E;  4DR7 E;  4DR5 I;  2UXB E;  1N0V C;  3F0N A;  4DR2 E;  4Z7Y A;  1N34 I;  4KQV A;  2UUB E;  5LMN I;  3WU4 A;  4LF7 E;  4JI8 E;  2HK3 A;  3HUL A;  4ED4 A;  4HYM A;  2GQ0 A;  3ZZU A;  3T1H E;  2HFS A;  4GKJ E;  1ZXM A;  4PRV A;  4HAC A;  4DV2 E;  1FJG E;  1N34 E;  3JAM C;  1A6F A;  4DR2 I;  4IZJ B;  5IT9 Q;  2UU9 E;  4DV6 I;  2ZIT A;  4X62 I;  1Y6Z A;  1NHI A;  2PNL A;  4USK A;  4R1F A;  4JI7 E;  1DAR A;  1S4E A;  1FWK A;  2IOP A;  3WU5 A;  1KKH A;  4DV5 E;  4X64 E;  2UUC I;  4LFA I;  1Z59 A;  4NXM I;  3T1H I;  5LMN E;  2UUB I;  3K1J A;  1H7S A;  2CG9 A;  3M6A A;  4LF7 I;  4DR6 I;  2A2C A;  4URL A;  4HXZ A;  3Q6N A;  1Z0B A;  2BM1 A;  5GME A;  4X65 E;  4LF9 E;  4EMD A;  1Z0T A;  4PRX A;  4DV3 E;  1BKN A;  2IOQ A;  1U2R A;  1ZM2 A;  1PVG A;  4DXL A;  1H7U A;  4GKK I;  1Y4U A;  4LF9 I;  2HK2 A;  3H4L A;  1Z5A A;  5BR8 I;  1XNQ I;  1N0U A;  4UT4 A;  4UTG A;  5L3J A;  4JI1 E;  2Z5C A;  4DPX A;  2WW4 A;  4B3M E;  4DV2 I;  1N32 I;  4OX9 E;  1XNQ E;  1ZM4 A;  4DV0 I;  1OJ4 A;  4M1K A;  4GKJ I;  2VF3 A;  4HY1 A;  5A2Q Q;  4DUY E;  1IBM I;  3P06 A;  2V8P A;  3LPS A;  1HNZ I;  1XMQ E;  3PYG A;  4LF8 E;  1NZ0 A;  2DEI A;  4MYU A;  4DR3 E;  2BM0 A;  1MX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...