3T1YI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3t1yI00
5LMUI 1NHIA 1Z5AA 4DPUA 4DR3E 3LTOA 4DR1E 2UXCI 4HY1A 4JI3I 4DPTA 1XNRE 3LPSA 2UUBE 3QT8A 1IBLI 1XMOE 3QT6A 4X66E 4LFBE 4P7AA 2OI2A 4AQYI 4LFAI 1ZM4A 4DR2I 5IT9Q 5BR8I 1N0UA 1Z0CA 2EFGA 1HNZE 4USKA 1PVGA 5A2QQ 4DR4I 2UUAI 3OTOE 2E5LI 1EA6A 4KHPE 2UXDI 4B3SE 4NXMI 4DV2E 5GMDA 1N34E 3WU3A 4ED4A 4X62E 4LF5E 4JI6I 1B62A 2HK3A 1N32E 3WU6A 1FWKA 4WUBA 4MYUA 1ZXMA 1N36E 4X64I 4DR1I 3ZZ0A 4JI8E 1IBME 1I94I 1S16A 4DUZE 1XNRI 2UUBI 1S4EA 4JI2I 2UU9E 1XMOI 2UXBE 2NPFA 1HNWE 1RREA 3CWVA 1DARA 3B82A 2DEIA 4DV0E 3OTOI 1FWLA 4B3SI 4Z7CA 4LFAE 4FN5A 4DR6I 2UUCI 4FWDA 2HFUA 2E1RA 4DR2E 5BR8E 2HHHE 1B63A 1N34I 2V8PA 2UUAE 1NHJA 4X62I 4LFCE 4GKKE 1Z0VA 1Z0TA 1Z0BA 2UXDE 5L3JA 4RPFA 1N36I 4YY3E 4OX9I 2XEXA 4JI8I 3LNUA 1BKNA 4USMA 3B8HA 1Z59A 4DUZI 4LF6E 4DV1E 1PIEA 2UU9I 2X36A 3ZKBA 2UXBI 1HNWI 1KVKA 1HR0E 4X64E 3WU4A 4LF4E 2X7IA 2HKJA 1I94E 2BV3A 2J7KA 1RR9A 4GKJE 3D4JA 3K17A 4JI2E 4DV0I 1FJGI 1KTVA 4DV5I 4DPWA 3T1HE 1H74A 2A2DA 1WUUA 2R3VA 1OJ4A 5LL6R 2HHHI 1ZM9A 4B3ME 3H4LA 3V2UC 4GKKI 2BM0A 4LFCI 4I3HA 4DV4I 4DR5E 2HFSA 3PYFA 4DR6E 4YY3I 4DUYI 2UUCE 4JI0I 2V34A 1MX0A 1HNXE 4HACA 2ZITA 4LF6I 4JG4A 4DV1I 3J7AG 2LJPA 1MU5A 1Z5CA 1NHHA 3T1YE 1HR0I 4X65E 1H7UA 4OX9E 4HACB 5LMNI 4LF8E 4YHHE 4LF4I 4GKJI 1ELOA 3PYEA 4WUDA 1FKAE 3T1HI 1N33E 4FWHA 3B78A 1XNQI 3ZKDA 4B3MI 1EI1A 4PRXA 1KIJA 3WU5A 4DR5I 4NXNI 4DPYA 1U2RA 1FJGE 4P52A 4LF7E 4DV5E 2DEJA 1UEKA 2A2CA 2V2ZA 1HNXI 4B3RI 5IWAI 1NZ0A 4DV4E 4ZVIA 4WUCA 2CZ9A 4DV3I 2R42A 4DXLA 2GS8A 3T1YI 4X65I 4DUYE 4JI0E 4LF8I 2BM1A 4YHHI 3GONA 4M1KA 1Z5BA 4K0KE 4DU7A 1N33I 3M6AA 4FWGA 1XHKA 5GMEA 3J81C 4DV7I 5FLXQ 4Z7YA 5LMNE 1XMQI 4JI7E 2HK2A 4B3TE 4URLA 3JAMC 1PKPA 4LF9I 4LF7I 2VQFE 1D6TA 2V2QA 4JI6E 1QZRA 3J80C 1XNQE 4KQVA 3V5RA 4DPXA 2V2VA 4NXNE 1ZM2A 1KKHA 4JV5I 1VISA 1FNMA 3Q1QA 2F4VI 4B3RE 5IWAE 4MYTA 4K0KI 4DV3E 4JI1E 4DV6E 3J7AM 1ZM3A 4JYAI 2VQEE 4JI7I 4HXZA 4DU8A 4PU9A 1IBKE 4B3TI 3J81Q 3HULA 5FLXC 3F0NA 4UT4A 3K1JA 2VQFI 1ZXNA 1N0VC 4DV7E 4JI4E 4DR7E 3JAMQ 1J5EE 4JI5E 4DR3I 1XMQE 4R1FA 3ZZTA 4FW9A 2ZM6E 3J80Q 3QT7A 1H72C 4UTGA 4LF9E 1A6FA 4LFBI 4X66I 5LMUE 1H7SA 1Z0WA 2Q2EB 2UXCE 4JI3E 1HNZI 4HYMA 3ZZUA 2ZBKB 1Z0EA 4JI1I 5IT9C 1IBLE 4KHPI 4EMDA 4DV6I 3ZM7A 5A2QC 4AQYE 4JV5E 3QT5A 2AJ4A 2VQEI 2F4VE 1IBKI 4DV2I 4DR4E 1FI4A 3PYGA 4LF5I 1N32I 2E5LE 3PYDA 4JI4I 4DR7I 1J5EI 4JI5I 4PRVA 4JYAE 4NXME 1IBMI 2ZM6I 1H73A 4XTJA 1K47A 2WW4A 2VF3A 1MG7A 1Z0GA 2HKEA
chains in the Genus database with same CATH superfamily
5LMUI 1NHIA 2BR2A 1Z5AA 4DPUA 3CDJA 4DR3E 3LTOA 3CDIA 1UDQA 4DR1E 5C0XA 2NN6B 2UXCI 2WNRA 4HY1A 4JI3I 1VI7A 1E3HA 4DPTA 4U3DA 3P3EA 1XNRE 3LPSA 2C39A 2UUBE 3QT8A 1IBLI 2AE8A 1XMOE 3QT6A 4X66E 4LFBE 2BR2B 4P7AA 3KRNA 2OI2A 4AQYI 4LFAI 5JEAC 5C0XB 1ZM4A 2PNLA 2WNRB 4DR2I 5BR8I 5IT9Q 1N0UA 1Z0CA 2C37A 2EFGA 1HNZE 4USKA 1PVGA 5A2QQ 4DR4I 2UUAI 2C39B 4MU3A 4LCGA 3U1KA 3OTOE 2E5LI 1EA6A 4KHPE 2UXDI 4MDTA 4B3SE 1YHCA 4NXMI 3HJCA 2C37B 4DV2E 2O3ZA 5GMDA 2CGEA 1N34E 3WU3A 4ED4A 5K36E 2IOQA 4FW4A 4NBQA 4X62E 4LF5E 4JI6I 1B62A 4OO1C 2HK3A 1N32E 3WU6A 1FWKA 4WUBA 4FW6A 4MYUA 2O1WA 1ZXMA 1N36E 4X64I 3Q6NA 4IZKA 4DR1I 3ZZ0A 4JI8E 1IBME 2JT2A 1I94I 2JEAA 1S16A 4LPFA 2F1DA 4DUZE 1XNRI 2UUBI 1S4EA 4JI2I 2UU9E 5K36F 1XMOI 1UDNA 2PO0A 2UXBE 2NPFA 1HNWE 1RREA 4IZKB 3CWVA 1DARA 4IZJD 3B82A 2JEAB 1OYRA 3PRYA 3PS1A 2CG9A 2DEIA 4DV0E 3OTOI 1FWLA 2PO0B 4J3DA 4B3SI 4Z7CA 4LFAE 4FN5A 4DR6I 4U3BA 2Z5EA 2UUCI 4FWDA 2HFUA 2E1RA 4FW3A 4DR2E 5BR8E 2HHHE 1B63A 3H1CA 1OYSA 1E3PA 1N34I 2PNZA 2V8PA 4IFDA 5JEAD 2UUAE 1NHJA 2GO3A 4X62I 2C38A 4LFCE 1Z0VA 1Z0TA 4GKKE 1Z0BA 2UXDE 5L3JA 4RPFA 1N36I 4YY3E 4OX9I 2XEXA 2JE6A 4JI8I 3LNUA 3M85G 1BKNA 4USMA 2O1VA 3B8HA 2PNZB 4IFDB 1Z59A 4DUZI 4LF6E 2C38B 4DV1E 1PIEA 2UU9I 3PS2A 5C0XE 2X36A 3ZKBA 5ELWA 2O1TA 2UXBI 2NN6F 1HNWI 1Y60A 1KVKA 1HR0E 3B4TA 2JE6B 4OO1D 4X64E 3P3GA 3WU4A 4LF4E 2X7IA 2HKJA 1I94E 2BV3A 2J7KA 1RR9A 4GKJE 3D4JA 4QNKA 3K17A 4JI2E 4DV0I 1FJGI 1KTVA 2IESA 4DV5I 5C0XF 4DPWA 1XXEA 1Y6ZA 2GO4A 1H74A 3T1HE 5K36C 2A2DA 1WUUA 2R3VA 1OJ4A 3K85A 5LL6R 2HHHI 1ZM9A 1P42A 4B3ME 3H4LA 3V2UC 4GKKI 2BM0A 4LFCI 4I3HA 4DV4I 4DR5E 2PO2A 2HFSA 3L7ZA 4GQUA 3PYFA 4DR6E 4YY3I 4LOMA 4DUYI 2UUCE 4JI0I 3M7NG 2V34A 1MX0A 1HNXE 2JEBA 4HACA 2ZITA 1Y4UA 4LF6I 4JG4A 2PO2B 4DV1I 3J7AG 3L7ZB 2LJPA 2BA1G 1MU5A 1Y5YA 1Z5CA 1NHHA 4IZJA 3T1YE 1HR0I 4X65E 1H7UA 4OX9E 2JEBB 1USVA 4HACB 5LMNI 4LF8E 4YHHE 3GCMA 4LF4I 4GKJI 1ELOA 3PYEA 4WUDA 5DROA 5JEAE 1FKAE 3T1HI 1N33E 4FWHA 4IZJB 3B78A 2NN6C 1XNQI 3M85D 3ZKDA 5JEAA 4B3MI 3HKMA 5DRPA 2PO1A 1EI1A 4PRXA 4QNJA 1KIJA 3WU5A 4DR5I 4NXNI 4DPYA 1U2RA 1FJGE 4P52A 3Q6MA 4LF7E 4DV5E 2DEJA 1UEKA 4IFDE 2A2CA 2V2ZA 5C0XC 1HNXI 5JEAB 2PO1B 4B3RI 5DRQA 5K36D 4OO1E 5IWAI 1NZ0A 4DV4E 4ZVIA 4WUCA 2CZ9A 4DV3I 2R42A 2WP8A 4DXLA 2GS8A 3T1YI 4OO1A 4X65I 4IFDF 3GMEA 4DUYE 4JI0E 4LF8I 2BM1A 4YHHI 3GONA 4M1KA 1Z5BA 5DNXA 1HK7A 4K0KE 4DU7A 4BA1A 2WP8B 2GQ0A 1N33I 3M6AA 4FWGA 4OO1B 3DD6A 1XHKA 5GMEA 2Z5CA 3J81C 4DV7I 5FLXQ 4Z7YA 5LMNE 3M7ND 1XMQI 3P3CA 4JI7E 2HK2A 4FW5A 4B3TE 4URLA 3NZKA 3JAMC 4BA1B 1PKPA 4LF9I 4LF7I 2VQFE 1D6TA 1USUA 2V2QA 2BA1D 4JI6E 2Z5CB 1QZRA 3J80C 4LCHA 1XNQE 1RHYA 4KQVA 3V5RA 4DPXA 2V2VA 4NXNE 1ZM2A 2NN6D 2BA0G 1KKHA 2J65A 4MU0A 4JV5I 1VISA 1Y4SA 4MQYA 1FNMA 3Q1QA 3GLLA 2F4VI 4AIMA 4B3RE 4AIDA 5IWAE 5C0XD 4MYTA 4K0KI 4DV3E 3P76A 4JI1E 4DV6E 3J7AM 1ZM3A 4JYAI 2VQEE 1R6MA 4JI7I 4HXZA 4DU8A 4PU9A 4IFDC 4MU4A 1IBKE 4B3TI 3U1YA 3J81Q 2O1UA 3HULA 5DRRA 5FLXC 3F0NA 4MU1A 4UT4A 3K1JA 2VQFI 1ZXNA 3P06A 1R6LA 2IOPA 1N0VC 5EL9A 4BA2A 4DV7E 4JI4E 4DR7E 3JAMQ 1J5EE 4JI5E 1UDOA 5K36A 4DR3I 1XMQE 2IERA 4IS9A 4R1FA 3ZZTA 4FW9A 2ZM6E 4OKGA 3J80Q 4OZEA 1OYPA 3QT7A 2VESA 1H72C 4UTGA 4LF9E 1A6FA 1YH8A 4BA2B 4LFBI 4X66I 4FW7A 5LMUE 5JEAF 1H7SA 4LCFA 5K36B 1Z0WA 2Q2EB 2UXCE 4JI3E 1HNZI 4AM3A 4HYMA 3ZZUA 2ZBKB 5FWKA 1Z0EA 2CVEA 4N3OA 4JI1I 5IT9C 1IBLE 4KHPI 4EMDA 4DV6I 3ZM7A 5A2QC 4AQYE 4JV5E 3QT5A 2AJ4A 2VQEI 5EKWA 2F4VE 1IBKI 4DV2I 5DNLA 4OO1F 2Z5BA 1UDSA 4DR4E 4ISAA 1FI4A 3PYGA 4LF5I 2BA0D 1N32I 3PS3A 2NN6E 3PYDA 2E5LE 4JI4I 4DR7I 1J5EI 4JI5I 4PRVA 2PNMA 4JYAE 3UHMA 4NXME 1IBMI 2ZM6I 1H73A 4XTJA 2NN6A 2Z5BB 1K47A 2WW4A 2VF3A 4IFDD 1MG7A 1Z0GA 2HKEA
chains in the Genus database with same CATH topology
5LMUI 1NHIA 1Z5AA 4DPUA 4DR3E 3LTOA 4DR1E 2UXCI 4HY1A 4JI3I 4DPTA 1XNRE 3LPSA 2UUBE 3QT8A 1IBLI 1XMOE 3QT6A 4X66E 4LFBE 4P7AA 2OI2A 4AQYI 4LFAI 1ZM4A 2PNLA 4DR2I 5IT9Q 5BR8I 1N0UA 1Z0CA 2EFGA 1HNZE 4USKA 1PVGA 5A2QQ 4DR4I 2UUAI 3OTOE 2E5LI 1EA6A 4KHPE 2UXDI 4B3SE 4NXMI 3HJCA 4DV2E 5GMDA 2CGEA 1N34E 3WU3A 4ED4A 2IOQA 4X62E 4LF5E 4JI6I 1B62A 2HK3A 1N32E 3WU6A 1FWKA 4WUBA 4MYUA 2O1WA 1ZXMA 1N36E 4X64I 3Q6NA 4IZKA 4DR1I 3ZZ0A 4JI8E 1IBME 1I94I 1S16A 4DUZE 1XNRI 2UUBI 1S4EA 4JI2I 2UU9E 1XMOI 2UXBE 2NPFA 1HNWE 1RREA 4IZKB 3CWVA 1DARA 4IZJD 3B82A 3PRYA 2CG9A 2DEIA 4DV0E 3OTOI 1FWLA 4B3SI 4Z7CA 4LFAE 4FN5A 4DR6I 2UUCI 2Z5EA 4FWDA 2HFUA 2E1RA 4DR2E 5BR8E 2HHHE 1B63A 1N34I 2V8PA 2UUAE 1NHJA 4X62I 4LFCE 4GKKE 1Z0VA 1Z0TA 1Z0BA 2UXDE 5L3JA 4RPFA 1N36I 4YY3E 4OX9I 2XEXA 4JI8I 3LNUA 1BKNA 4USMA 2O1VA 3B8HA 1Z59A 4DUZI 4LF6E 4DV1E 1PIEA 2UU9I 2X36A 3ZKBA 2O1TA 2UXBI 1HNWI 1KVKA 1HR0E 4X64E 3WU4A 4LF4E 2X7IA 2HKJA 1I94E 2BV3A 2J7KA 1RR9A 4GKJE 3D4JA 3K17A 4JI2E 4DV0I 1FJGI 1KTVA 4DV5I 4DPWA 3T1HE 1Y6ZA 1H74A 2A2DA 1WUUA 2R3VA 1OJ4A 3K85A 5LL6R 2HHHI 1ZM9A 4B3ME 3H4LA 3V2UC 4GKKI 2BM0A 4LFCI 4I3HA 4DV4I 4DR5E 2HFSA 3PYFA 4DR6E 4YY3I 4DUYI 2UUCE 4JI0I 2V34A 1MX0A 1HNXE 4HACA 2ZITA 1Y4UA 4LF6I 4JG4A 4DV1I 3J7AG 2LJPA 1MU5A 1Z5CA 1NHHA 4IZJA 3T1YE 1HR0I 4X65E 1H7UA 4OX9E 1USVA 4HACB 5LMNI 4LF8E 4YHHE 4LF4I 4GKJI 1ELOA 3PYEA 4WUDA 1FKAE 3T1HI 1N33E 4FWHA 4IZJB 3B78A 1XNQI 3ZKDA 4B3MI 1EI1A 4PRXA 1KIJA 3WU5A 4DR5I 4NXNI 4DPYA 1U2RA 1FJGE 4P52A 3Q6MA 4LF7E 4DV5E 2DEJA 1UEKA 2A2CA 2V2ZA 1HNXI 4B3RI 5IWAI 1NZ0A 4DV4E 4ZVIA 4WUCA 2CZ9A 4DV3I 2R42A 4DXLA 2GS8A 3T1YI 4X65I 4DUYE 4JI0E 4LF8I 2BM1A 4YHHI 3GONA 4M1KA 1Z5BA 1HK7A 4K0KE 4DU7A 2GQ0A 1N33I 3M6AA 4FWGA 1XHKA 5GMEA 2Z5CA 3J81C 4DV7I 5FLXQ 4Z7YA 5LMNE 1XMQI 4JI7E 2HK2A 4B3TE 4URLA 3JAMC 1PKPA 4LF9I 4LF7I 2VQFE 1D6TA 1USUA 2V2QA 4JI6E 2Z5CB 1QZRA 3J80C 1XNQE 4KQVA 3V5RA 4DPXA 2V2VA 4NXNE 1ZM2A 1KKHA 4JV5I 1VISA 1Y4SA 1FNMA 3Q1QA 2F4VI 4B3RE 5IWAE 4MYTA 4K0KI 4DV3E 4JI1E 4DV6E 3J7AM 1ZM3A 4JYAI 2VQEE 4JI7I 4HXZA 4DU8A 4PU9A 1IBKE 4B3TI 3J81Q 2O1UA 3HULA 5FLXC 3F0NA 4UT4A 3K1JA 2VQFI 1ZXNA 3P06A 2IOPA 1N0VC 4DV7E 4JI4E 4DR7E 3JAMQ 1J5EE 4JI5E 4DR3I 1XMQE 4R1FA 3ZZTA 4FW9A 2ZM6E 3J80Q 3QT7A 1H72C 4UTGA 4LF9E 1A6FA 4LFBI 4X66I 5LMUE 1H7SA 1Z0WA 2Q2EB 2UXCE 4JI3E 1HNZI 4HYMA 3ZZUA 2ZBKB 5FWKA 1Z0EA 4N3OA 4JI1I 5IT9C 1IBLE 4KHPI 4EMDA 4DV6I 3ZM7A 5A2QC 4AQYE 4JV5E 3QT5A 2AJ4A 2VQEI 2F4VE 1IBKI 4DV2I 2Z5BA 4DR4E 1FI4A 3PYGA 4LF5I 1N32I 2E5LE 3PYDA 4JI4I 4DR7I 1J5EI 4JI5I 4PRVA 2PNMA 4JYAE 4NXME 1IBMI 2ZM6I 1H73A 4XTJA 2Z5BB 1K47A 2WW4A 2VF3A 1MG7A 1Z0GA 2HKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU I;  1NHI A;  1Z5A A;  4DPU A;  4DR3 E;  3LTO A;  4DR1 E;  2UXC I;  4HY1 A;  4JI3 I;  4DPT A;  1XNR E;  3LPS A;  2UUB E;  3QT8 A;  1IBL I;  1XMO E;  3QT6 A;  4X66 E;  4LFB E;  4P7A A;  2OI2 A;  4AQY I;  4LFA I;  1ZM4 A;  4DR2 I;  5IT9 Q;  5BR8 I;  1N0U A;  1Z0C A;  2EFG A;  1HNZ E;  4USK A;  1PVG A;  5A2Q Q;  4DR4 I;  2UUA I;  3OTO E;  2E5L I;  1EA6 A;  4KHP E;  2UXD I;  4B3S E;  4NXM I;  4DV2 E;  5GMD A;  1N34 E;  3WU3 A;  4ED4 A;  4X62 E;  4LF5 E;  4JI6 I;  1B62 A;  2HK3 A;  1N32 E;  3WU6 A;  1FWK A;  4WUB A;  4MYU A;  1ZXM A;  1N36 E;  4X64 I;  4DR1 I;  3ZZ0 A;  4JI8 E;  1IBM E;  1I94 I;  1S16 A;  4DUZ E;  1XNR I;  2UUB I;  1S4E A;  4JI2 I;  2UU9 E;  1XMO I;  2UXB E;  2NPF A;  1HNW E;  1RRE A;  3CWV A;  1DAR A;  3B82 A;  2DEI A;  4DV0 E;  3OTO I;  1FWL A;  4B3S I;  4Z7C A;  4LFA E;  4FN5 A;  4DR6 I;  2UUC I;  4FWD A;  2HFU A;  2E1R A;  4DR2 E;  5BR8 E;  2HHH E;  1B63 A;  1N34 I;  2V8P A;  2UUA E;  1NHJ A;  4X62 I;  4LFC E;  4GKK E;  1Z0V A;  1Z0T A;  1Z0B A;  2UXD E;  5L3J A;  4RPF A;  1N36 I;  4YY3 E;  4OX9 I;  2XEX A;  4JI8 I;  3LNU A;  1BKN A;  4USM A;  3B8H A;  1Z59 A;  4DUZ I;  4LF6 E;  4DV1 E;  1PIE A;  2UU9 I;  2X36 A;  3ZKB A;  2UXB I;  1HNW I;  1KVK A;  1HR0 E;  4X64 E;  3WU4 A;  4LF4 E;  2X7I A;  2HKJ A;  1I94 E;  2BV3 A;  2J7K A;  1RR9 A;  4GKJ E;  3D4J A;  3K17 A;  4JI2 E;  4DV0 I;  1FJG I;  1KTV A;  4DV5 I;  4DPW A;  3T1H E;  1H74 A;  2A2D A;  1WUU A;  2R3V A;  1OJ4 A;  5LL6 R;  2HHH I;  1ZM9 A;  4B3M E;  3H4L A;  3V2U C;  4GKK I;  2BM0 A;  4LFC I;  4I3H A;  4DV4 I;  4DR5 E;  2HFS A;  3PYF A;  4DR6 E;  4YY3 I;  4DUY I;  2UUC E;  4JI0 I;  2V34 A;  1MX0 A;  1HNX E;  4HAC A;  2ZIT A;  4LF6 I;  4JG4 A;  4DV1 I;  3J7A G;  2LJP A;  1MU5 A;  1Z5C A;  1NHH A;  3T1Y E;  1HR0 I;  4X65 E;  1H7U A;  4OX9 E;  4HAC B;  5LMN I;  4LF8 E;  4YHH E;  4LF4 I;  4GKJ I;  1ELO A;  3PYE A;  4WUD A;  1FKA E;  3T1H I;  1N33 E;  4FWH A;  3B78 A;  1XNQ I;  3ZKD A;  4B3M I;  1EI1 A;  4PRX A;  1KIJ A;  3WU5 A;  4DR5 I;  4NXN I;  4DPY A;  1U2R A;  1FJG E;  4P52 A;  4LF7 E;  4DV5 E;  2DEJ A;  1UEK A;  2A2C A;  2V2Z A;  1HNX I;  4B3R I;  5IWA I;  1NZ0 A;  4DV4 E;  4ZVI A;  4WUC A;  2CZ9 A;  4DV3 I;  2R42 A;  4DXL A;  2GS8 A;  3T1Y I;  4X65 I;  4DUY E;  4JI0 E;  4LF8 I;  2BM1 A;  4YHH I;  3GON A;  4M1K A;  1Z5B A;  4K0K E;  4DU7 A;  1N33 I;  3M6A A;  4FWG A;  1XHK A;  5GME A;  3J81 C;  4DV7 I;  5FLX Q;  4Z7Y A;  5LMN E;  1XMQ I;  4JI7 E;  2HK2 A;  4B3T E;  4URL A;  3JAM C;  1PKP A;  4LF9 I;  4LF7 I;  2VQF E;  1D6T A;  2V2Q A;  4JI6 E;  1QZR A;  3J80 C;  1XNQ E;  4KQV A;  3V5R A;  4DPX A;  2V2V A;  4NXN E;  1ZM2 A;  1KKH A;  4JV5 I;  1VIS A;  1FNM A;  3Q1Q A;  2F4V I;  4B3R E;  5IWA E;  4MYT A;  4K0K I;  4DV3 E;  4JI1 E;  4DV6 E;  3J7A M;  1ZM3 A;  4JYA I;  2VQE E;  4JI7 I;  4HXZ A;  4DU8 A;  4PU9 A;  1IBK E;  4B3T I;  3J81 Q;  3HUL A;  5FLX C;  3F0N A;  4UT4 A;  3K1J A;  2VQF I;  1ZXN A;  1N0V C;  4DV7 E;  4JI4 E;  4DR7 E;  3JAM Q;  1J5E E;  4JI5 E;  4DR3 I;  1XMQ E;  4R1F A;  3ZZT A;  4FW9 A;  2ZM6 E;  3J80 Q;  3QT7 A;  1H72 C;  4UTG A;  4LF9 E;  1A6F A;  4LFB I;  4X66 I;  5LMU E;  1H7S A;  1Z0W A;  2Q2E B;  2UXC E;  4JI3 E;  1HNZ I;  4HYM A;  3ZZU A;  2ZBK B;  1Z0E A;  4JI1 I;  5IT9 C;  1IBL E;  4KHP I;  4EMD A;  4DV6 I;  3ZM7 A;  5A2Q C;  4AQY E;  4JV5 E;  3QT5 A;  2AJ4 A;  2VQE I;  2F4V E;  1IBK I;  4DV2 I;  4DR4 E;  1FI4 A;  3PYG A;  4LF5 I;  1N32 I;  2E5L E;  3PYD A;  4JI4 I;  4DR7 I;  1J5E I;  4JI5 I;  4PRV A;  4JYA E;  4NXM E;  1IBM I;  2ZM6 I;  1H73 A;  4XTJ A;  1K47 A;  2WW4 A;  2VF3 A;  1MG7 A;  1Z0G A;  2HKE A; 
#chains in the Genus database with same CATH topology
 5LMU I;  1NHI A;  2BR2 A;  1Z5A A;  4DPU A;  3CDJ A;  4DR3 E;  3LTO A;  3CDI A;  1UDQ A;  4DR1 E;  5C0X A;  2NN6 B;  2UXC I;  2WNR A;  4HY1 A;  4JI3 I;  1VI7 A;  1E3H A;  4DPT A;  4U3D A;  3P3E A;  1XNR E;  3LPS A;  2C39 A;  2UUB E;  3QT8 A;  1IBL I;  2AE8 A;  1XMO E;  3QT6 A;  4X66 E;  4LFB E;  2BR2 B;  4P7A A;  3KRN A;  2OI2 A;  4AQY I;  4LFA I;  5JEA C;  5C0X B;  1ZM4 A;  2PNL A;  2WNR B;  4DR2 I;  5BR8 I;  5IT9 Q;  1N0U A;  1Z0C A;  2C37 A;  2EFG A;  1HNZ E;  4USK A;  1PVG A;  5A2Q Q;  4DR4 I;  2UUA I;  2C39 B;  4MU3 A;  4LCG A;  3U1K A;  3OTO E;  2E5L I;  1EA6 A;  4KHP E;  2UXD I;  4MDT A;  4B3S E;  1YHC A;  4NXM I;  3HJC A;  2C37 B;  4DV2 E;  2O3Z A;  5GMD A;  2CGE A;  1N34 E;  3WU3 A;  4ED4 A;  5K36 E;  2IOQ A;  4FW4 A;  4NBQ A;  4X62 E;  4LF5 E;  4JI6 I;  1B62 A;  4OO1 C;  2HK3 A;  1N32 E;  3WU6 A;  1FWK A;  4WUB A;  4FW6 A;  4MYU A;  2O1W A;  1ZXM A;  1N36 E;  4X64 I;  3Q6N A;  4IZK A;  4DR1 I;  3ZZ0 A;  4JI8 E;  1IBM E;  2JT2 A;  1I94 I;  2JEA A;  1S16 A;  4LPF A;  2F1D A;  4DUZ E;  1XNR I;  2UUB I;  1S4E A;  4JI2 I;  2UU9 E;  5K36 F;  1XMO I;  1UDN A;  2PO0 A;  2UXB E;  2NPF A;  1HNW E;  1RRE A;  4IZK B;  3CWV A;  1DAR A;  4IZJ D;  3B82 A;  2JEA B;  1OYR A;  3PRY A;  3PS1 A;  2CG9 A;  2DEI A;  4DV0 E;  3OTO I;  1FWL A;  2PO0 B;  4J3D A;  4B3S I;  4Z7C A;  4LFA E;  4FN5 A;  4DR6 I;  4U3B A;  2Z5E A;  2UUC I;  4FWD A;  2HFU A;  2E1R A;  4FW3 A;  4DR2 E;  5BR8 E;  2HHH E;  1B63 A;  3H1C A;  1OYS A;  1E3P A;  1N34 I;  2PNZ A;  2V8P A;  4IFD A;  5JEA D;  2UUA E;  1NHJ A;  2GO3 A;  4X62 I;  2C38 A;  4LFC E;  1Z0V A;  1Z0T A;  4GKK E;  1Z0B A;  2UXD E;  5L3J A;  4RPF A;  1N36 I;  4YY3 E;  4OX9 I;  2XEX A;  2JE6 A;  4JI8 I;  3LNU A;  3M85 G;  1BKN A;  4USM A;  2O1V A;  3B8H A;  2PNZ B;  4IFD B;  1Z59 A;  4DUZ I;  4LF6 E;  2C38 B;  4DV1 E;  1PIE A;  2UU9 I;  3PS2 A;  5C0X E;  2X36 A;  3ZKB A;  5ELW A;  2O1T A;  2UXB I;  2NN6 F;  1HNW I;  1Y60 A;  1KVK A;  1HR0 E;  3B4T A;  2JE6 B;  4OO1 D;  4X64 E;  3P3G A;  3WU4 A;  4LF4 E;  2X7I A;  2HKJ A;  1I94 E;  2BV3 A;  2J7K A;  1RR9 A;  4GKJ E;  3D4J A;  4QNK A;  3K17 A;  4JI2 E;  4DV0 I;  1FJG I;  1KTV A;  2IES A;  4DV5 I;  5C0X F;  4DPW A;  1XXE A;  1Y6Z A;  2GO4 A;  1H74 A;  3T1H E;  5K36 C;  2A2D A;  1WUU A;  2R3V A;  1OJ4 A;  3K85 A;  5LL6 R;  2HHH I;  1ZM9 A;  1P42 A;  4B3M E;  3H4L A;  3V2U C;  4GKK I;  2BM0 A;  4LFC I;  4I3H A;  4DV4 I;  4DR5 E;  2PO2 A;  2HFS A;  3L7Z A;  4GQU A;  3PYF A;  4DR6 E;  4YY3 I;  4LOM A;  4DUY I;  2UUC E;  4JI0 I;  3M7N G;  2V34 A;  1MX0 A;  1HNX E;  2JEB A;  4HAC A;  2ZIT A;  1Y4U A;  4LF6 I;  4JG4 A;  2PO2 B;  4DV1 I;  3J7A G;  3L7Z B;  2LJP A;  2BA1 G;  1MU5 A;  1Y5Y A;  1Z5C A;  1NHH A;  4IZJ A;  3T1Y E;  1HR0 I;  4X65 E;  1H7U A;  4OX9 E;  2JEB B;  1USV A;  4HAC B;  5LMN I;  4LF8 E;  4YHH E;  3GCM A;  4LF4 I;  4GKJ I;  1ELO A;  3PYE A;  4WUD A;  5DRO A;  5JEA E;  1FKA E;  3T1H I;  1N33 E;  4FWH A;  4IZJ B;  3B78 A;  2NN6 C;  1XNQ I;  3M85 D;  3ZKD A;  5JEA A;  4B3M I;  3HKM A;  5DRP A;  2PO1 A;  1EI1 A;  4PRX A;  4QNJ A;  1KIJ A;  3WU5 A;  4DR5 I;  4NXN I;  4DPY A;  1U2R A;  1FJG E;  4P52 A;  3Q6M A;  4LF7 E;  4DV5 E;  2DEJ A;  1UEK A;  4IFD E;  2A2C A;  2V2Z A;  5C0X C;  1HNX I;  5JEA B;  2PO1 B;  4B3R I;  5DRQ A;  5K36 D;  4OO1 E;  5IWA I;  1NZ0 A;  4DV4 E;  4ZVI A;  4WUC A;  2CZ9 A;  4DV3 I;  2R42 A;  2WP8 A;  4DXL A;  2GS8 A;  3T1Y I;  4OO1 A;  4X65 I;  4IFD F;  3GME A;  4DUY E;  4JI0 E;  4LF8 I;  2BM1 A;  4YHH I;  3GON A;  4M1K A;  1Z5B A;  5DNX A;  1HK7 A;  4K0K E;  4DU7 A;  4BA1 A;  2WP8 B;  2GQ0 A;  1N33 I;  3M6A A;  4FWG A;  4OO1 B;  3DD6 A;  1XHK A;  5GME A;  2Z5C A;  3J81 C;  4DV7 I;  5FLX Q;  4Z7Y A;  5LMN E;  3M7N D;  1XMQ I;  3P3C A;  4JI7 E;  2HK2 A;  4FW5 A;  4B3T E;  4URL A;  3NZK A;  3JAM C;  4BA1 B;  1PKP A;  4LF9 I;  4LF7 I;  2VQF E;  1D6T A;  1USU A;  2V2Q A;  2BA1 D;  4JI6 E;  2Z5C B;  1QZR A;  3J80 C;  4LCH A;  1XNQ E;  1RHY A;  4KQV A;  3V5R A;  4DPX A;  2V2V A;  4NXN E;  1ZM2 A;  2NN6 D;  2BA0 G;  1KKH A;  2J65 A;  4MU0 A;  4JV5 I;  1VIS A;  1Y4S A;  4MQY A;  1FNM A;  3Q1Q A;  3GLL A;  2F4V I;  4AIM A;  4B3R E;  4AID A;  5IWA E;  5C0X D;  4MYT A;  4K0K I;  4DV3 E;  3P76 A;  4JI1 E;  4DV6 E;  3J7A M;  1ZM3 A;  4JYA I;  2VQE E;  1R6M A;  4JI7 I;  4HXZ A;  4DU8 A;  4PU9 A;  4IFD C;  4MU4 A;  1IBK E;  4B3T I;  3U1Y A;  3J81 Q;  2O1U A;  3HUL A;  5DRR A;  5FLX C;  3F0N A;  4MU1 A;  4UT4 A;  3K1J A;  2VQF I;  1ZXN A;  3P06 A;  1R6L A;  2IOP A;  1N0V C;  5EL9 A;  4BA2 A;  4DV7 E;  4JI4 E;  4DR7 E;  3JAM Q;  1J5E E;  4JI5 E;  1UDO A;  5K36 A;  4DR3 I;  1XMQ E;  2IER A;  4IS9 A;  4R1F A;  3ZZT A;  4FW9 A;  2ZM6 E;  4OKG A;  3J80 Q;  4OZE A;  1OYP A;  3QT7 A;  2VES A;  1H72 C;  4UTG A;  4LF9 E;  1A6F A;  1YH8 A;  4BA2 B;  4LFB I;  4X66 I;  4FW7 A;  5LMU E;  5JEA F;  1H7S A;  4LCF A;  5K36 B;  1Z0W A;  2Q2E B;  2UXC E;  4JI3 E;  1HNZ I;  4AM3 A;  4HYM A;  3ZZU A;  2ZBK B;  5FWK A;  1Z0E A;  2CVE A;  4N3O A;  4JI1 I;  5IT9 C;  1IBL E;  4KHP I;  4EMD A;  4DV6 I;  3ZM7 A;  5A2Q C;  4AQY E;  4JV5 E;  3QT5 A;  2AJ4 A;  2VQE I;  5EKW A;  2F4V E;  1IBK I;  4DV2 I;  5DNL A;  4OO1 F;  2Z5B A;  1UDS A;  4DR4 E;  4ISA A;  1FI4 A;  3PYG A;  4LF5 I;  2BA0 D;  1N32 I;  3PS3 A;  2NN6 E;  3PYD A;  2E5L E;  4JI4 I;  4DR7 I;  1J5E I;  4JI5 I;  4PRV A;  2PNM A;  4JYA E;  3UHM A;  4NXM E;  1IBM I;  2ZM6 I;  1H73 A;  4XTJ A;  2NN6 A;  2Z5B B;  1K47 A;  2WW4 A;  2VF3 A;  4IFD D;  1MG7 A;  1Z0G A;  2HKE A; 
#chains in the Genus database with same CATH homology
 5LMU I;  1NHI A;  1Z5A A;  4DPU A;  4DR3 E;  3LTO A;  4DR1 E;  2UXC I;  4HY1 A;  4JI3 I;  4DPT A;  1XNR E;  3LPS A;  2UUB E;  3QT8 A;  1IBL I;  1XMO E;  3QT6 A;  4X66 E;  4LFB E;  4P7A A;  2OI2 A;  4AQY I;  4LFA I;  1ZM4 A;  2PNL A;  4DR2 I;  5IT9 Q;  5BR8 I;  1N0U A;  1Z0C A;  2EFG A;  1HNZ E;  4USK A;  1PVG A;  5A2Q Q;  4DR4 I;  2UUA I;  3OTO E;  2E5L I;  1EA6 A;  4KHP E;  2UXD I;  4B3S E;  4NXM I;  3HJC A;  4DV2 E;  5GMD A;  2CGE A;  1N34 E;  3WU3 A;  4ED4 A;  2IOQ A;  4X62 E;  4LF5 E;  4JI6 I;  1B62 A;  2HK3 A;  1N32 E;  3WU6 A;  1FWK A;  4WUB A;  4MYU A;  2O1W A;  1ZXM A;  1N36 E;  4X64 I;  3Q6N A;  4IZK A;  4DR1 I;  3ZZ0 A;  4JI8 E;  1IBM E;  1I94 I;  1S16 A;  4DUZ E;  1XNR I;  2UUB I;  1S4E A;  4JI2 I;  2UU9 E;  1XMO I;  2UXB E;  2NPF A;  1HNW E;  1RRE A;  4IZK B;  3CWV A;  1DAR A;  4IZJ D;  3B82 A;  3PRY A;  2CG9 A;  2DEI A;  4DV0 E;  3OTO I;  1FWL A;  4B3S I;  4Z7C A;  4LFA E;  4FN5 A;  4DR6 I;  2UUC I;  2Z5E A;  4FWD A;  2HFU A;  2E1R A;  4DR2 E;  5BR8 E;  2HHH E;  1B63 A;  1N34 I;  2V8P A;  2UUA E;  1NHJ A;  4X62 I;  4LFC E;  4GKK E;  1Z0V A;  1Z0T A;  1Z0B A;  2UXD E;  5L3J A;  4RPF A;  1N36 I;  4YY3 E;  4OX9 I;  2XEX A;  4JI8 I;  3LNU A;  1BKN A;  4USM A;  2O1V A;  3B8H A;  1Z59 A;  4DUZ I;  4LF6 E;  4DV1 E;  1PIE A;  2UU9 I;  2X36 A;  3ZKB A;  2O1T A;  2UXB I;  1HNW I;  1KVK A;  1HR0 E;  4X64 E;  3WU4 A;  4LF4 E;  2X7I A;  2HKJ A;  1I94 E;  2BV3 A;  2J7K A;  1RR9 A;  4GKJ E;  3D4J A;  3K17 A;  4JI2 E;  4DV0 I;  1FJG I;  1KTV A;  4DV5 I;  4DPW A;  3T1H E;  1Y6Z A;  1H74 A;  2A2D A;  1WUU A;  2R3V A;  1OJ4 A;  3K85 A;  5LL6 R;  2HHH I;  1ZM9 A;  4B3M E;  3H4L A;  3V2U C;  4GKK I;  2BM0 A;  4LFC I;  4I3H A;  4DV4 I;  4DR5 E;  2HFS A;  3PYF A;  4DR6 E;  4YY3 I;  4DUY I;  2UUC E;  4JI0 I;  2V34 A;  1MX0 A;  1HNX E;  4HAC A;  2ZIT A;  1Y4U A;  4LF6 I;  4JG4 A;  4DV1 I;  3J7A G;  2LJP A;  1MU5 A;  1Z5C A;  1NHH A;  4IZJ A;  3T1Y E;  1HR0 I;  4X65 E;  1H7U A;  4OX9 E;  1USV A;  4HAC B;  5LMN I;  4LF8 E;  4YHH E;  4LF4 I;  4GKJ I;  1ELO A;  3PYE A;  4WUD A;  1FKA E;  3T1H I;  1N33 E;  4FWH A;  4IZJ B;  3B78 A;  1XNQ I;  3ZKD A;  4B3M I;  1EI1 A;  4PRX A;  1KIJ A;  3WU5 A;  4DR5 I;  4NXN I;  4DPY A;  1U2R A;  1FJG E;  4P52 A;  3Q6M A;  4LF7 E;  4DV5 E;  2DEJ A;  1UEK A;  2A2C A;  2V2Z A;  1HNX I;  4B3R I;  5IWA I;  1NZ0 A;  4DV4 E;  4ZVI A;  4WUC A;  2CZ9 A;  4DV3 I;  2R42 A;  4DXL A;  2GS8 A;  3T1Y I;  4X65 I;  4DUY E;  4JI0 E;  4LF8 I;  2BM1 A;  4YHH I;  3GON A;  4M1K A;  1Z5B A;  1HK7 A;  4K0K E;  4DU7 A;  2GQ0 A;  1N33 I;  3M6A A;  4FWG A;  1XHK A;  5GME A;  2Z5C A;  3J81 C;  4DV7 I;  5FLX Q;  4Z7Y A;  5LMN E;  1XMQ I;  4JI7 E;  2HK2 A;  4B3T E;  4URL A;  3JAM C;  1PKP A;  4LF9 I;  4LF7 I;  2VQF E;  1D6T A;  1USU A;  2V2Q A;  4JI6 E;  2Z5C B;  1QZR A;  3J80 C;  1XNQ E;  4KQV A;  3V5R A;  4DPX A;  2V2V A;  4NXN E;  1ZM2 A;  1KKH A;  4JV5 I;  1VIS A;  1Y4S A;  1FNM A;  3Q1Q A;  2F4V I;  4B3R E;  5IWA E;  4MYT A;  4K0K I;  4DV3 E;  4JI1 E;  4DV6 E;  3J7A M;  1ZM3 A;  4JYA I;  2VQE E;  4JI7 I;  4HXZ A;  4DU8 A;  4PU9 A;  1IBK E;  4B3T I;  3J81 Q;  2O1U A;  3HUL A;  5FLX C;  3F0N A;  4UT4 A;  3K1J A;  2VQF I;  1ZXN A;  3P06 A;  2IOP A;  1N0V C;  4DV7 E;  4JI4 E;  4DR7 E;  3JAM Q;  1J5E E;  4JI5 E;  4DR3 I;  1XMQ E;  4R1F A;  3ZZT A;  4FW9 A;  2ZM6 E;  3J80 Q;  3QT7 A;  1H72 C;  4UTG A;  4LF9 E;  1A6F A;  4LFB I;  4X66 I;  5LMU E;  1H7S A;  1Z0W A;  2Q2E B;  2UXC E;  4JI3 E;  1HNZ I;  4HYM A;  3ZZU A;  2ZBK B;  5FWK A;  1Z0E A;  4N3O A;  4JI1 I;  5IT9 C;  1IBL E;  4KHP I;  4EMD A;  4DV6 I;  3ZM7 A;  5A2Q C;  4AQY E;  4JV5 E;  3QT5 A;  2AJ4 A;  2VQE I;  2F4V E;  1IBK I;  4DV2 I;  2Z5B A;  4DR4 E;  1FI4 A;  3PYG A;  4LF5 I;  1N32 I;  2E5L E;  3PYD A;  4JI4 I;  4DR7 I;  1J5E I;  4JI5 I;  4PRV A;  2PNM A;  4JYA E;  4NXM E;  1IBM I;  2ZM6 I;  1H73 A;  4XTJ A;  2Z5B B;  1K47 A;  2WW4 A;  2VF3 A;  1MG7 A;  1Z0G A;  2HKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...