3T1YI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3t1yI00
1KKHA 4P7AA 4DPTA 4FWHA 5IT9C 3LTOA 2V8PA 1N32I 3Q1QA 4WUDA 4YY3I 2BM1A 4DR3I 1PIEA 1XNQI 2VQEE 4LF8E 2UUAE 4LFBE 4LF9E 4P52A 3ZKDA 2GS8A 4LF5E 2ZM6E 1HNWE 4DU7A 3PYEA 1XMOE 2A2DA 4GKJE 4JI5I 3QT7A 2UU9E 1HR0E 4DR5E 1OJ4A 5LMNI 4FN5A 2UUBE 1IBME 3B8HA 3B78A 4WUBA 3J81Q 1KIJA 3T1HI 4JI7I 3ZZ0A 3QT6A 1HNXE 1I94I 4DPUA 4JI8E 1KVKA 4JG4A 1ZXNA 2HKJA 4DV2I 4LF4I 1H73A 2UXCI 1XNRE 4LFCI 4JI1I 4YHHE 1D6TA 1NZ0A 1QZRA 1A6FA 1IBLE 3WU6A 1ZM3A 4DR7I 1Z59A 4DV0I 4JI3E 1S4EA 2UXBE 4DV1I 2E1RA 4DV7E 3JAMC 4FWDA 4X64E 1HNZE 4X62E 3J7AG 4K0KI 2A2CA 2F4VE 1FWLA 3D4JA 4DV5E 4NXME 4XTJA 2AJ4A 2Q2EB 1MU5A 4NXNI 1Z0BA 4B3SE 4B3ME 4OX9I 5BR8I 2V2ZA 4JI2E 1WUUA 5A2QQ 2UUCE 3OTOI 4DUYI 4JI0E 4HACB 2HK2A 5IWAI 2E5LE 1NHIA 2VF3A 4DR1I 1N34I 2EFGA 2VQFI 4DR4E 2X7IA 4X66I 5FLXC 2UXDE 1K47A 4DR2E 1XHKA 1J5EE 1FI4A 1MX0A 1Z0CA 1IBKE 4DV4E 4DXLA 4JI4E 4GKKE 5IT9Q 2V2VA 4X65E 4KHPE 3T1YI 3ZKBA 4FWGA 2WW4A 1H72C 3ZM7A 4DU8A 2VQEI 4LF8I 4AQYE 4LF7E 1N0UA 4B3TE 2ZM6I 1HNWI 1N0VC 4JI6I 1XMOI 2BM0A 1B62A 2UU9I 4DR3E 4DR5I 2R42A 2ZITA 3QT8A 3WU5A 1BKNA 1Z0WA 1FJGI 4HACA 1EA6A 3WU4A 1NHJA 3V5RA 5LMUE 4LFAE 1FKAE 3J7AM 1H7UA 3J80C 1ELOA 3GONA 3F0NA 3T1HE 4JI7E 1XMQE 4YHHI 1N36E 1IBLI 3PYFA 3LPSA 1ZM4A 3PYDA 4JYAE 4EMDA 2HHHE 3JAMQ 2DEJA 4DV2E 4JI3I 1U2RA 4I3HA 4HXZA 1ZXMA 4DV7I 4LF4E 2UXCE 2HFUA 4LFCE 1RR9A 4DV0E 2F4VI 2DEIA 4JV5I 3HULA 1N33E 1H7SA 3K1JA 1UEKA 1FWKA 2V2QA 2HFSA 4K0KE 4Z7CA 5L3JA 4M1KA 2R3VA 2NPFA 1Z0GA 2V34A 4DV6E 4B3RE 4B3SI 3K17A 3WU3A 4DUZE 1DARA 4PRXA 4JI2I 2UUCI 4JI0I 4ZVIA 1Z0VA 2HK3A 4DPYA 4DR4I 1ZM2A 1S16A 4KQVA 1J5EI 1Z0TA 4DV3E 1N34E 3QT5A 1IBKI 4DV4I 4DR6E 4DPWA 2LJPA 4X65I 3CWVA 4LF6E 4UTGA 2OI2A 2UUAI 4LFBI 4LF9I 3M6AA 5LL6R 2X36A 4LF5I 4MYTA 4AQYI 4MYUA 2ZBKB 3ZZUA 4LF7I 4B3TI 3T1YE 4FW9A 1N32E 1Z5CA 3V2UC 4GKJI 4YY3E 1HR0I 1XNQE 1EI1A 4USMA 2UUBI 1Z5BA 1IBMI 1NHHA 4PU9A 4JI5E 4JI6E 3PYGA 5LMNE 1RREA 2J7KA 1HNXI 5LMUI 4JI8I 2CZ9A 4LFAI 1MG7A 3J80Q 1Z0EA 1FJGE 3ZZTA 5GMEA 1XNRI 3J81C 1I94E 1XMQI 1PKPA 1N36I 4UT4A 4JYAI 2UXBI 2HHHI 3LNUA 4HYMA 4X64I 4JI1E 1HNZI 4X62I 1VISA 3H4LA 4DR7E 2XEXA 4WUCA 1PVGA 4DV1E 4DV5I 2HKEA 4NXMI 1Z5AA 1N33I 1KTVA 4DPXA 4PRVA 3B82A 5GMDA 4JV5E 4USKA 4DV6I 4B3MI 4B3RI 4Z7YA 4DUZI 4NXNE 2E5LI 1ZM9A 4HY1A 4URLA 4RPFA 1FNMA 4OX9E 5FLXQ 5BR8E 4R1FA 2UXDI 4ED4A 3OTOE 4DUYE 1H74A 5IWAE 4DR2I 5A2QC 4DR1E 2VQFE 4DV3I 4JI4I 4GKKI 1B63A 4X66E 4DR6I 4KHPI 2BV3A 4LF6I
chains in the Genus database with same CATH superfamily
1KKHA 5DNXA 5C0XE 2JE6A 2JEAA 4OO1D 4P7AA 4MU1A 4DPTA 3DD6A 4FWHA 5K36F 5IT9C 2C37A 5JEAE 3LTOA 2V8PA 1N32I 3Q1QA 4OO1A 4WUDA 4YY3I 3NZKA 2BM1A 4DR3I 1PIEA 1XNQI 2VQEE 4LF8E 2UUAE 4LFBE 4LF9E 2C38B 4P52A 3ZKDA 2GS8A 4LF5E 5K36E 2ZM6E 1HNWE 1HK7A 4DU7A 3PYEA 1XMOE 2A2DA 4GKJE 4JI5I 3QT7A 2UU9E 1HR0E 4DR5E 3P3EA 1OJ4A 5LMNI 4IFDC 4FN5A 3PS1A 2UUBE 1IBME 5JEAD 3GLLA 5C0XA 3B8HA 3B78A 4BA1B 4WUBA 2PO2A 2C39B 3J81Q 1KIJA 3T1HI 3P3GA 4JI7I 3ZZ0A 4FW4A 5JEAA 5K36D 3QT6A 1HNXE 1I94I 4DPUA 4JI8E 1KVKA 1Y4SA 1ZXNA 4JG4A 2HKJA 1R6LA 4DV2I 4LF4I 1H73A 2O3ZA 2UXCI 5K36A 1XNRE 2BA0G 4LFCI 4JI1I 4YHHE 1D6TA 1NZ0A 1QZRA 1A6FA 1IBLE 3WU6A 1ZM3A 4DR7I 1Z59A 4DV0I 3HKMA 4JI3E 1S4EA 5DRRA 2UXBE 2PNZB 4DV1I 2E1RA 4DV7E 3JAMC 4FWDA 2NN6C 4X64E 1HNZE 4X62E 3J7AG 4K0KI 2C38A 2A2CA 4LPFA 4FW5A 2F4VE 1FWLA 3D4JA 2IOPA 1VI7A 4DV5E 4NXME 3P06A 4XTJA 2AJ4A 2Q2EB 4U3BA 2VESA 3HJCA 1MU5A 4NBQA 4BA1A 4NXNI 4IS9A 1Z0BA 4B3SE 4LCHA 1P42A 4B3ME 5C0XB 4OX9I 3L7ZB 2CVEA 5BR8I 2V2ZA 4JI2E 1WUUA 2IERA 5A2QQ 2UUCE 3OTOI 4DUYI 4QNJA 2IESA 2HK2A 4HACB 2F1DA 4ISAA 5C0XF 5IWAI 2E5LE 1NHIA 2O1TA 5DNLA 5DROA 2VF3A 4DR1I 1N34I 2EFGA 2VQFI 4DR4E 2X7IA 4X66I 2J65A 5FLXC 2UXDE 4BA2B 1K47A 4DR2E 1XHKA 1J5EE 4MU3A 2PNZA 3B4TA 1FI4A 1MX0A 1Z0CA 2PO1A 1IBKE 4DV4E 4DXLA 2O1WA 4JI4E 4GKKE 5IT9Q 2Z5CB 2V2VA 4X65E 4KHPE 3T1YI 3ZKBA 4FWGA 4OKGA 2WW4A 2IOQA 1H72C 3ZM7A 4DU8A 2VQEI 3UHMA 4LF8I 4AQYE 2BA1G 3PS3A 4LF7E 4MQYA 1N0UA 4B3TE 2ZM6I 5C0XD 1USUA 2GQ0A 1OYSA 1HNWI 4IFDE 2Z5EA 1N0VC 4JI6I 1XMOI 3GMEA 2BM0A 1B62A 2UU9I 4FW3A 4DR3E 4DR5I 2R42A 5JEAC 2ZITA 3QT8A 3WU5A 1YHCA 3L7ZA 2O1UA 1BKNA 1Z0WA 1FJGI 2GO4A 4HACA 3M7ND 1EA6A 3WU4A 5K36C 2PO0B 1NHJA 3V5RA 5LMUE 4LFAE 1FKAE 3J7AM 1UDSA 1H7UA 4BA2A 3J80C 1ELOA 3P76A 3GONA 3F0NA 1R6MA 3T1HE 4JI7E 1XMQE 4YHHI 4IFDA 2Z5CA 1N36E 1IBLI 3PYFA 3LPSA 1ZM4A 3PYDA 4JYAE 4EMDA 2HHHE 3JAMQ 2DEJA 4DV2E 4JI3I 1U2RA 2PO1B 4HXZA 4I3HA 3Q6MA 1ZXMA 5FWKA 4DV7I 4IZJB 4LF4E 2UXCE 2HFUA 4LFCE 1RR9A 1UDNA 4DV0E 2F4VI 2DEIA 4JV5I 3HULA 3U1YA 1N33E 1H7SA 3K1JA 1UEKA 4MU0A 1FWKA 2V2QA 1Y5YA 1RHYA 2HFSA 4K0KE 4Z7CA 5L3JA 4M1KA 4N3OA 2R3VA 2NPFA 1Z0GA 2V34A 4DV6E 4B3RE 2PO0A 4B3SI 3K17A 3PS2A 3WU3A 4DUZE 3M85D 3H1CA 1DARA 4PRXA 4JI2I 4MU4A 2UUCI 4JI0I 4ZVIA 1Z0VA 2CGEA 2HK3A 4DPYA 4FW6A 3GCMA 4IZJD 4DR4I 1ZM2A 1E3PA 1S16A 4KQVA 4OO1C 1J5EI 1Z0TA 4DV3E 4IZJA 4IFDB 1N34E 3QT5A 1IBKI 4DV4I 4DR6E 2PNMA 4DPWA 2LJPA 3P3CA 4X65I 4LOMA 3CWVA 4IFDF 4LF6E 4UTGA 2OI2A 2UUAI 4LFBI 4LF9I 3M6AA 5LL6R 4J3DA 2X36A 5EKWA 4MYTA 4LF5I 4AQYI 4MYUA 3K85A 5C0XC 2ZBKB 3ZZUA 4LF7I 3Q6NA 1UDOA 3KRNA 4FW9A 3T1YE 4B3TI 1N32E 1Z5CA 3V2UC 4GKJI 4YY3E 1HR0I 1UDQA 1XNQE 1EI1A 4USMA 2UUBI 1Z5BA 1IBMI 1OYPA 4AIDA 5DRPA 2BA0D 1NHHA 2PNLA 4PU9A 2NN6B 4JI5E 4JI6E 2Z5BB 3PYGA 5LMNE 1RREA 2J7KA 4LCFA 2AE8A 1HNXI 5LMUI 4IFDD 2NN6F 4JI8I 5DRQA 2CZ9A 4LFAI 1MG7A 3J80Q 2JEBB 1Z0EA 1FJGE 3ZZTA 5GMEA 1XNRI 3J81C 1E3HA 1I94E 1XMQI 2NN6E 4IZKB 1PKPA 2WNRB 4LCGA 1N36I 4UT4A 4JYAI 2UXBI 1Y4UA 2HHHI 3LNUA 4HYMA 1Y6ZA 2BR2B 4X64I 1USVA 1HNZI 2WP8A 4JI1E 4X62I 4FW7A 1VISA 3H4LA 4OZEA 3M7NG 2XEXA 4WUCA 4DR7E 1PVGA 4MDTA 4DV1E 4DV5I 2HKEA 4NXMI 1Z5AA 5EL9A 2CG9A 2JE6B 1N33I 1XXEA 2JEAB 2NN6D 1KTVA 4DPXA 4PRVA 2C37B 4AIMA 2O1VA 3B82A 5GMDA 3CDIA 4OO1B 2NN6A 4JV5E 4USKA 2JT2A 2Z5BA 4DV6I 4GQUA 4B3MI 4B3RI 4Z7YA 3PRYA 4DUZI 4OO1F 4U3DA 5ELWA 2JEBA 4NXNE 2E5LI 1OYRA 1ZM9A 4HY1A 2C39A 3CDJA 4URLA 4RPFA 3U1KA 1FNMA 4OX9E 5FLXQ 4OO1E 5BR8E 4R1FA 4IZKA 4AM3A 2WNRA 1YH8A 2UXDI 4ED4A 3OTOE 2PO2B 4DUYE 1H74A 5IWAE 4DR2I 2BA1D 5A2QC 4DR1E 2BR2A 2VQFE 4QNKA 4DV3I 1Y60A 4JI4I 5JEAB 4GKKI 1B63A 4X66E 4DR6I 2GO3A 4KHPI 5JEAF 2BV3A 4LF6I 4JI0E 3M85G 5K36B 2WP8B
chains in the Genus database with same CATH topology
1KKHA 4P7AA 4DPTA 4FWHA 5IT9C 3LTOA 2V8PA 1N32I 3Q1QA 4WUDA 4YY3I 2BM1A 4DR3I 1PIEA 1XNQI 2VQEE 4LF8E 2UUAE 4LFBE 4LF9E 4P52A 3ZKDA 2GS8A 4LF5E 2ZM6E 1HNWE 1HK7A 4DU7A 3PYEA 1XMOE 2A2DA 4GKJE 4JI5I 3QT7A 2UU9E 1HR0E 4DR5E 1OJ4A 5LMNI 4FN5A 2UUBE 1IBME 3B8HA 3B78A 4WUBA 3J81Q 1KIJA 3T1HI 4JI7I 3ZZ0A 3QT6A 1HNXE 1I94I 4DPUA 4JI8E 1KVKA 1Y4SA 1ZXNA 4JG4A 2HKJA 4DV2I 4LF4I 1H73A 2UXCI 1XNRE 4LFCI 4JI1I 4YHHE 1D6TA 1NZ0A 1QZRA 1A6FA 1IBLE 3WU6A 1ZM3A 4DR7I 1Z59A 4DV0I 4JI3E 1S4EA 2UXBE 4DV1I 2E1RA 4DV7E 3JAMC 4FWDA 4X64E 1HNZE 4X62E 3J7AG 4K0KI 2A2CA 2F4VE 1FWLA 3D4JA 2IOPA 4DV5E 4NXME 3P06A 4XTJA 2AJ4A 2Q2EB 3HJCA 1MU5A 4NXNI 1Z0BA 4B3SE 4B3ME 4OX9I 5BR8I 2V2ZA 4JI2E 1WUUA 5A2QQ 2UUCE 3OTOI 4DUYI 4JI0E 4HACB 2HK2A 5IWAI 2E5LE 1NHIA 2O1TA 2VF3A 4DR1I 1N34I 2EFGA 2VQFI 4DR4E 2X7IA 4X66I 5FLXC 2UXDE 1K47A 4DR2E 1XHKA 1J5EE 1FI4A 1MX0A 1Z0CA 1IBKE 4DV4E 4DXLA 2O1WA 4JI4E 4GKKE 5IT9Q 2Z5CB 2V2VA 4X65E 4KHPE 3T1YI 3ZKBA 4FWGA 2WW4A 2IOQA 1H72C 3ZM7A 4DU8A 2VQEI 4LF8I 4AQYE 4LF7E 1N0UA 4B3TE 2ZM6I 1USUA 2GQ0A 1HNWI 2Z5EA 1N0VC 4JI6I 1XMOI 2BM0A 1B62A 2UU9I 4DR3E 4DR5I 2R42A 2ZITA 3QT8A 3WU5A 2O1UA 1BKNA 1Z0WA 1FJGI 4HACA 1EA6A 3WU4A 1NHJA 3V5RA 5LMUE 4LFAE 1FKAE 3J7AM 1H7UA 3J80C 1ELOA 3GONA 3F0NA 3T1HE 4JI7E 1XMQE 4YHHI 2Z5CA 1N36E 1IBLI 3PYFA 3LPSA 1ZM4A 3PYDA 4JYAE 4EMDA 2HHHE 3JAMQ 2DEJA 4DV2E 4JI3I 1U2RA 4I3HA 4HXZA 3Q6MA 5FWKA 1ZXMA 4DV7I 4IZJB 4LF4E 2UXCE 2HFUA 4LFCE 1RR9A 4DV0E 2F4VI 2DEIA 4JV5I 3HULA 1N33E 1H7SA 3K1JA 1UEKA 1FWKA 2V2QA 2HFSA 4K0KE 4Z7CA 5L3JA 4M1KA 4N3OA 2R3VA 2NPFA 1Z0GA 2V34A 4DV6E 4B3RE 4B3SI 3K17A 3WU3A 4DUZE 1DARA 4PRXA 4JI2I 2UUCI 4JI0I 4ZVIA 1Z0VA 2CGEA 2HK3A 4DPYA 4IZJD 4DR4I 1ZM2A 1S16A 4KQVA 1J5EI 1Z0TA 4DV3E 4IZJA 1N34E 3QT5A 1IBKI 4DV4I 4DR6E 2PNMA 4DPWA 2LJPA 4X65I 3CWVA 4LF6E 4UTGA 2OI2A 2UUAI 4LFBI 4LF9I 3M6AA 5LL6R 2X36A 4LF5I 4MYTA 4AQYI 4MYUA 3K85A 2ZBKB 3ZZUA 4LF7I 3Q6NA 4FW9A 3T1YE 4B3TI 1N32E 1Z5CA 3V2UC 4GKJI 4YY3E 1HR0I 1XNQE 1EI1A 4USMA 2UUBI 1Z5BA 1IBMI 1NHHA 2PNLA 4PU9A 4JI5E 4JI6E 2Z5BB 3PYGA 5LMNE 1RREA 2J7KA 1HNXI 5LMUI 4JI8I 2CZ9A 4LFAI 1MG7A 3J80Q 1Z0EA 1FJGE 3ZZTA 5GMEA 1XNRI 3J81C 1I94E 1XMQI 4IZKB 1PKPA 1N36I 4UT4A 4JYAI 2UXBI 1Y4UA 2HHHI 3LNUA 4HYMA 1Y6ZA 4X64I 1USVA 1HNZI 4JI1E 4X62I 1VISA 3H4LA 4DR7E 2XEXA 4WUCA 1PVGA 4DV1E 4DV5I 2HKEA 4NXMI 1Z5AA 2CG9A 1N33I 1KTVA 4DPXA 4PRVA 2O1VA 3B82A 5GMDA 4JV5E 4USKA 2Z5BA 4DV6I 4B3MI 4B3RI 4Z7YA 3PRYA 4DUZI 4NXNE 2E5LI 1ZM9A 4HY1A 4URLA 4RPFA 1FNMA 4OX9E 5FLXQ 5BR8E 4R1FA 4IZKA 2UXDI 4ED4A 3OTOE 4DUYE 1H74A 5IWAE 4DR2I 5A2QC 4DR1E 2VQFE 4DV3I 4JI4I 4GKKI 1B63A 4X66E 4DR6I 4KHPI 2BV3A 4LF6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKH A;  4P7A A;  4DPT A;  4FWH A;  5IT9 C;  3LTO A;  2V8P A;  1N32 I;  3Q1Q A;  4WUD A;  4YY3 I;  2BM1 A;  4DR3 I;  1PIE A;  1XNQ I;  2VQE E;  4LF8 E;  2UUA E;  4LFB E;  4LF9 E;  4P52 A;  3ZKD A;  2GS8 A;  4LF5 E;  2ZM6 E;  1HNW E;  4DU7 A;  3PYE A;  1XMO E;  2A2D A;  4GKJ E;  4JI5 I;  3QT7 A;  2UU9 E;  1HR0 E;  4DR5 E;  1OJ4 A;  5LMN I;  4FN5 A;  2UUB E;  1IBM E;  3B8H A;  3B78 A;  4WUB A;  3J81 Q;  1KIJ A;  3T1H I;  4JI7 I;  3ZZ0 A;  3QT6 A;  1HNX E;  1I94 I;  4DPU A;  4JI8 E;  1KVK A;  4JG4 A;  1ZXN A;  2HKJ A;  4DV2 I;  4LF4 I;  1H73 A;  2UXC I;  1XNR E;  4LFC I;  4JI1 I;  4YHH E;  1D6T A;  1NZ0 A;  1QZR A;  1A6F A;  1IBL E;  3WU6 A;  1ZM3 A;  4DR7 I;  1Z59 A;  4DV0 I;  4JI3 E;  1S4E A;  2UXB E;  4DV1 I;  2E1R A;  4DV7 E;  3JAM C;  4FWD A;  4X64 E;  1HNZ E;  4X62 E;  3J7A G;  4K0K I;  2A2C A;  2F4V E;  1FWL A;  3D4J A;  4DV5 E;  4NXM E;  4XTJ A;  2AJ4 A;  2Q2E B;  1MU5 A;  4NXN I;  1Z0B A;  4B3S E;  4B3M E;  4OX9 I;  5BR8 I;  2V2Z A;  4JI2 E;  1WUU A;  5A2Q Q;  2UUC E;  3OTO I;  4DUY I;  4JI0 E;  4HAC B;  2HK2 A;  5IWA I;  2E5L E;  1NHI A;  2VF3 A;  4DR1 I;  1N34 I;  2EFG A;  2VQF I;  4DR4 E;  2X7I A;  4X66 I;  5FLX C;  2UXD E;  1K47 A;  4DR2 E;  1XHK A;  1J5E E;  1FI4 A;  1MX0 A;  1Z0C A;  1IBK E;  4DV4 E;  4DXL A;  4JI4 E;  4GKK E;  5IT9 Q;  2V2V A;  4X65 E;  4KHP E;  3T1Y I;  3ZKB A;  4FWG A;  2WW4 A;  1H72 C;  3ZM7 A;  4DU8 A;  2VQE I;  4LF8 I;  4AQY E;  4LF7 E;  1N0U A;  4B3T E;  2ZM6 I;  1HNW I;  1N0V C;  4JI6 I;  1XMO I;  2BM0 A;  1B62 A;  2UU9 I;  4DR3 E;  4DR5 I;  2R42 A;  2ZIT A;  3QT8 A;  3WU5 A;  1BKN A;  1Z0W A;  1FJG I;  4HAC A;  1EA6 A;  3WU4 A;  1NHJ A;  3V5R A;  5LMU E;  4LFA E;  1FKA E;  3J7A M;  1H7U A;  3J80 C;  1ELO A;  3GON A;  3F0N A;  3T1H E;  4JI7 E;  1XMQ E;  4YHH I;  1N36 E;  1IBL I;  3PYF A;  3LPS A;  1ZM4 A;  3PYD A;  4JYA E;  4EMD A;  2HHH E;  3JAM Q;  2DEJ A;  4DV2 E;  4JI3 I;  1U2R A;  4I3H A;  4HXZ A;  1ZXM A;  4DV7 I;  4LF4 E;  2UXC E;  2HFU A;  4LFC E;  1RR9 A;  4DV0 E;  2F4V I;  2DEI A;  4JV5 I;  3HUL A;  1N33 E;  1H7S A;  3K1J A;  1UEK A;  1FWK A;  2V2Q A;  2HFS A;  4K0K E;  4Z7C A;  5L3J A;  4M1K A;  2R3V A;  2NPF A;  1Z0G A;  2V34 A;  4DV6 E;  4B3R E;  4B3S I;  3K17 A;  3WU3 A;  4DUZ E;  1DAR A;  4PRX A;  4JI2 I;  2UUC I;  4JI0 I;  4ZVI A;  1Z0V A;  2HK3 A;  4DPY A;  4DR4 I;  1ZM2 A;  1S16 A;  4KQV A;  1J5E I;  1Z0T A;  4DV3 E;  1N34 E;  3QT5 A;  1IBK I;  4DV4 I;  4DR6 E;  4DPW A;  2LJP A;  4X65 I;  3CWV A;  4LF6 E;  4UTG A;  2OI2 A;  2UUA I;  4LFB I;  4LF9 I;  3M6A A;  5LL6 R;  2X36 A;  4LF5 I;  4MYT A;  4AQY I;  4MYU A;  2ZBK B;  3ZZU A;  4LF7 I;  4B3T I;  3T1Y E;  4FW9 A;  1N32 E;  1Z5C A;  3V2U C;  4GKJ I;  4YY3 E;  1HR0 I;  1XNQ E;  1EI1 A;  4USM A;  2UUB I;  1Z5B A;  1IBM I;  1NHH A;  4PU9 A;  4JI5 E;  4JI6 E;  3PYG A;  5LMN E;  1RRE A;  2J7K A;  1HNX I;  5LMU I;  4JI8 I;  2CZ9 A;  4LFA I;  1MG7 A;  3J80 Q;  1Z0E A;  1FJG E;  3ZZT A;  5GME A;  1XNR I;  3J81 C;  1I94 E;  1XMQ I;  1PKP A;  1N36 I;  4UT4 A;  4JYA I;  2UXB I;  2HHH I;  3LNU A;  4HYM A;  4X64 I;  4JI1 E;  1HNZ I;  4X62 I;  1VIS A;  3H4L A;  4DR7 E;  2XEX A;  4WUC A;  1PVG A;  4DV1 E;  4DV5 I;  2HKE A;  4NXM I;  1Z5A A;  1N33 I;  1KTV A;  4DPX A;  4PRV A;  3B82 A;  5GMD A;  4JV5 E;  4USK A;  4DV6 I;  4B3M I;  4B3R I;  4Z7Y A;  4DUZ I;  4NXN E;  2E5L I;  1ZM9 A;  4HY1 A;  4URL A;  4RPF A;  1FNM A;  4OX9 E;  5FLX Q;  5BR8 E;  4R1F A;  2UXD I;  4ED4 A;  3OTO E;  4DUY E;  1H74 A;  5IWA E;  4DR2 I;  5A2Q C;  4DR1 E;  2VQF E;  4DV3 I;  4JI4 I;  4GKK I;  1B63 A;  4X66 E;  4DR6 I;  4KHP I;  2BV3 A;  4LF6 I; 
#chains in the Genus database with same CATH topology
 1KKH A;  5DNX A;  5C0X E;  2JE6 A;  2JEA A;  4OO1 D;  4P7A A;  4MU1 A;  4DPT A;  3DD6 A;  4FWH A;  5K36 F;  5IT9 C;  2C37 A;  5JEA E;  3LTO A;  2V8P A;  1N32 I;  3Q1Q A;  4OO1 A;  4WUD A;  4YY3 I;  3NZK A;  2BM1 A;  4DR3 I;  1PIE A;  1XNQ I;  2VQE E;  4LF8 E;  2UUA E;  4LFB E;  4LF9 E;  2C38 B;  4P52 A;  3ZKD A;  2GS8 A;  4LF5 E;  5K36 E;  2ZM6 E;  1HNW E;  1HK7 A;  4DU7 A;  3PYE A;  1XMO E;  2A2D A;  4GKJ E;  4JI5 I;  3QT7 A;  2UU9 E;  1HR0 E;  4DR5 E;  3P3E A;  1OJ4 A;  5LMN I;  4IFD C;  4FN5 A;  3PS1 A;  2UUB E;  1IBM E;  5JEA D;  3GLL A;  5C0X A;  3B8H A;  3B78 A;  4BA1 B;  4WUB A;  2PO2 A;  2C39 B;  3J81 Q;  1KIJ A;  3T1H I;  3P3G A;  4JI7 I;  3ZZ0 A;  4FW4 A;  5JEA A;  5K36 D;  3QT6 A;  1HNX E;  1I94 I;  4DPU A;  4JI8 E;  1KVK A;  1Y4S A;  1ZXN A;  4JG4 A;  2HKJ A;  1R6L A;  4DV2 I;  4LF4 I;  1H73 A;  2O3Z A;  2UXC I;  5K36 A;  1XNR E;  2BA0 G;  4LFC I;  4JI1 I;  4YHH E;  1D6T A;  1NZ0 A;  1QZR A;  1A6F A;  1IBL E;  3WU6 A;  1ZM3 A;  4DR7 I;  1Z59 A;  4DV0 I;  3HKM A;  4JI3 E;  1S4E A;  5DRR A;  2UXB E;  2PNZ B;  4DV1 I;  2E1R A;  4DV7 E;  3JAM C;  4FWD A;  2NN6 C;  4X64 E;  1HNZ E;  4X62 E;  3J7A G;  4K0K I;  2C38 A;  2A2C A;  4LPF A;  4FW5 A;  2F4V E;  1FWL A;  3D4J A;  2IOP A;  1VI7 A;  4DV5 E;  4NXM E;  3P06 A;  4XTJ A;  2AJ4 A;  2Q2E B;  4U3B A;  2VES A;  3HJC A;  1MU5 A;  4NBQ A;  4BA1 A;  4NXN I;  4IS9 A;  1Z0B A;  4B3S E;  4LCH A;  1P42 A;  4B3M E;  5C0X B;  4OX9 I;  3L7Z B;  2CVE A;  5BR8 I;  2V2Z A;  4JI2 E;  1WUU A;  2IER A;  5A2Q Q;  2UUC E;  3OTO I;  4DUY I;  4QNJ A;  2IES A;  2HK2 A;  4HAC B;  2F1D A;  4ISA A;  5C0X F;  5IWA I;  2E5L E;  1NHI A;  2O1T A;  5DNL A;  5DRO A;  2VF3 A;  4DR1 I;  1N34 I;  2EFG A;  2VQF I;  4DR4 E;  2X7I A;  4X66 I;  2J65 A;  5FLX C;  2UXD E;  4BA2 B;  1K47 A;  4DR2 E;  1XHK A;  1J5E E;  4MU3 A;  2PNZ A;  3B4T A;  1FI4 A;  1MX0 A;  1Z0C A;  2PO1 A;  1IBK E;  4DV4 E;  4DXL A;  2O1W A;  4JI4 E;  4GKK E;  5IT9 Q;  2Z5C B;  2V2V A;  4X65 E;  4KHP E;  3T1Y I;  3ZKB A;  4FWG A;  4OKG A;  2WW4 A;  2IOQ A;  1H72 C;  3ZM7 A;  4DU8 A;  2VQE I;  3UHM A;  4LF8 I;  4AQY E;  2BA1 G;  3PS3 A;  4LF7 E;  4MQY A;  1N0U A;  4B3T E;  2ZM6 I;  5C0X D;  1USU A;  2GQ0 A;  1OYS A;  1HNW I;  4IFD E;  2Z5E A;  1N0V C;  4JI6 I;  1XMO I;  3GME A;  2BM0 A;  1B62 A;  2UU9 I;  4FW3 A;  4DR3 E;  4DR5 I;  2R42 A;  5JEA C;  2ZIT A;  3QT8 A;  3WU5 A;  1YHC A;  3L7Z A;  2O1U A;  1BKN A;  1Z0W A;  1FJG I;  2GO4 A;  4HAC A;  3M7N D;  1EA6 A;  3WU4 A;  5K36 C;  2PO0 B;  1NHJ A;  3V5R A;  5LMU E;  4LFA E;  1FKA E;  3J7A M;  1UDS A;  1H7U A;  4BA2 A;  3J80 C;  1ELO A;  3P76 A;  3GON A;  3F0N A;  1R6M A;  3T1H E;  4JI7 E;  1XMQ E;  4YHH I;  4IFD A;  2Z5C A;  1N36 E;  1IBL I;  3PYF A;  3LPS A;  1ZM4 A;  3PYD A;  4JYA E;  4EMD A;  2HHH E;  3JAM Q;  2DEJ A;  4DV2 E;  4JI3 I;  1U2R A;  2PO1 B;  4HXZ A;  4I3H A;  3Q6M A;  1ZXM A;  5FWK A;  4DV7 I;  4IZJ B;  4LF4 E;  2UXC E;  2HFU A;  4LFC E;  1RR9 A;  1UDN A;  4DV0 E;  2F4V I;  2DEI A;  4JV5 I;  3HUL A;  3U1Y A;  1N33 E;  1H7S A;  3K1J A;  1UEK A;  4MU0 A;  1FWK A;  2V2Q A;  1Y5Y A;  1RHY A;  2HFS A;  4K0K E;  4Z7C A;  5L3J A;  4M1K A;  4N3O A;  2R3V A;  2NPF A;  1Z0G A;  2V34 A;  4DV6 E;  4B3R E;  2PO0 A;  4B3S I;  3K17 A;  3PS2 A;  3WU3 A;  4DUZ E;  3M85 D;  3H1C A;  1DAR A;  4PRX A;  4JI2 I;  4MU4 A;  2UUC I;  4JI0 I;  4ZVI A;  1Z0V A;  2CGE A;  2HK3 A;  4DPY A;  4FW6 A;  3GCM A;  4IZJ D;  4DR4 I;  1ZM2 A;  1E3P A;  1S16 A;  4KQV A;  4OO1 C;  1J5E I;  1Z0T A;  4DV3 E;  4IZJ A;  4IFD B;  1N34 E;  3QT5 A;  1IBK I;  4DV4 I;  4DR6 E;  2PNM A;  4DPW A;  2LJP A;  3P3C A;  4X65 I;  4LOM A;  3CWV A;  4IFD F;  4LF6 E;  4UTG A;  2OI2 A;  2UUA I;  4LFB I;  4LF9 I;  3M6A A;  5LL6 R;  4J3D A;  2X36 A;  5EKW A;  4MYT A;  4LF5 I;  4AQY I;  4MYU A;  3K85 A;  5C0X C;  2ZBK B;  3ZZU A;  4LF7 I;  3Q6N A;  1UDO A;  3KRN A;  4FW9 A;  3T1Y E;  4B3T I;  1N32 E;  1Z5C A;  3V2U C;  4GKJ I;  4YY3 E;  1HR0 I;  1UDQ A;  1XNQ E;  1EI1 A;  4USM A;  2UUB I;  1Z5B A;  1IBM I;  1OYP A;  4AID A;  5DRP A;  2BA0 D;  1NHH A;  2PNL A;  4PU9 A;  2NN6 B;  4JI5 E;  4JI6 E;  2Z5B B;  3PYG A;  5LMN E;  1RRE A;  2J7K A;  4LCF A;  2AE8 A;  1HNX I;  5LMU I;  4IFD D;  2NN6 F;  4JI8 I;  5DRQ A;  2CZ9 A;  4LFA I;  1MG7 A;  3J80 Q;  2JEB B;  1Z0E A;  1FJG E;  3ZZT A;  5GME A;  1XNR I;  3J81 C;  1E3H A;  1I94 E;  1XMQ I;  2NN6 E;  4IZK B;  1PKP A;  2WNR B;  4LCG A;  1N36 I;  4UT4 A;  4JYA I;  2UXB I;  1Y4U A;  2HHH I;  3LNU A;  4HYM A;  1Y6Z A;  2BR2 B;  4X64 I;  1USV A;  1HNZ I;  2WP8 A;  4JI1 E;  4X62 I;  4FW7 A;  1VIS A;  3H4L A;  4OZE A;  3M7N G;  2XEX A;  4WUC A;  4DR7 E;  1PVG A;  4MDT A;  4DV1 E;  4DV5 I;  2HKE A;  4NXM I;  1Z5A A;  5EL9 A;  2CG9 A;  2JE6 B;  1N33 I;  1XXE A;  2JEA B;  2NN6 D;  1KTV A;  4DPX A;  4PRV A;  2C37 B;  4AIM A;  2O1V A;  3B82 A;  5GMD A;  3CDI A;  4OO1 B;  2NN6 A;  4JV5 E;  4USK A;  2JT2 A;  2Z5B A;  4DV6 I;  4GQU A;  4B3M I;  4B3R I;  4Z7Y A;  3PRY A;  4DUZ I;  4OO1 F;  4U3D A;  5ELW A;  2JEB A;  4NXN E;  2E5L I;  1OYR A;  1ZM9 A;  4HY1 A;  2C39 A;  3CDJ A;  4URL A;  4RPF A;  3U1K A;  1FNM A;  4OX9 E;  5FLX Q;  4OO1 E;  5BR8 E;  4R1F A;  4IZK A;  4AM3 A;  2WNR A;  1YH8 A;  2UXD I;  4ED4 A;  3OTO E;  2PO2 B;  4DUY E;  1H74 A;  5IWA E;  4DR2 I;  2BA1 D;  5A2Q C;  4DR1 E;  2BR2 A;  2VQF E;  4QNK A;  4DV3 I;  1Y60 A;  4JI4 I;  5JEA B;  4GKK I;  1B63 A;  4X66 E;  4DR6 I;  2GO3 A;  4KHP I;  5JEA F;  2BV3 A;  4LF6 I;  4JI0 E;  3M85 G;  5K36 B;  2WP8 B; 
#chains in the Genus database with same CATH homology
 1KKH A;  4P7A A;  4DPT A;  4FWH A;  5IT9 C;  3LTO A;  2V8P A;  1N32 I;  3Q1Q A;  4WUD A;  4YY3 I;  2BM1 A;  4DR3 I;  1PIE A;  1XNQ I;  2VQE E;  4LF8 E;  2UUA E;  4LFB E;  4LF9 E;  4P52 A;  3ZKD A;  2GS8 A;  4LF5 E;  2ZM6 E;  1HNW E;  1HK7 A;  4DU7 A;  3PYE A;  1XMO E;  2A2D A;  4GKJ E;  4JI5 I;  3QT7 A;  2UU9 E;  1HR0 E;  4DR5 E;  1OJ4 A;  5LMN I;  4FN5 A;  2UUB E;  1IBM E;  3B8H A;  3B78 A;  4WUB A;  3J81 Q;  1KIJ A;  3T1H I;  4JI7 I;  3ZZ0 A;  3QT6 A;  1HNX E;  1I94 I;  4DPU A;  4JI8 E;  1KVK A;  1Y4S A;  1ZXN A;  4JG4 A;  2HKJ A;  4DV2 I;  4LF4 I;  1H73 A;  2UXC I;  1XNR E;  4LFC I;  4JI1 I;  4YHH E;  1D6T A;  1NZ0 A;  1QZR A;  1A6F A;  1IBL E;  3WU6 A;  1ZM3 A;  4DR7 I;  1Z59 A;  4DV0 I;  4JI3 E;  1S4E A;  2UXB E;  4DV1 I;  2E1R A;  4DV7 E;  3JAM C;  4FWD A;  4X64 E;  1HNZ E;  4X62 E;  3J7A G;  4K0K I;  2A2C A;  2F4V E;  1FWL A;  3D4J A;  2IOP A;  4DV5 E;  4NXM E;  3P06 A;  4XTJ A;  2AJ4 A;  2Q2E B;  3HJC A;  1MU5 A;  4NXN I;  1Z0B A;  4B3S E;  4B3M E;  4OX9 I;  5BR8 I;  2V2Z A;  4JI2 E;  1WUU A;  5A2Q Q;  2UUC E;  3OTO I;  4DUY I;  4JI0 E;  4HAC B;  2HK2 A;  5IWA I;  2E5L E;  1NHI A;  2O1T A;  2VF3 A;  4DR1 I;  1N34 I;  2EFG A;  2VQF I;  4DR4 E;  2X7I A;  4X66 I;  5FLX C;  2UXD E;  1K47 A;  4DR2 E;  1XHK A;  1J5E E;  1FI4 A;  1MX0 A;  1Z0C A;  1IBK E;  4DV4 E;  4DXL A;  2O1W A;  4JI4 E;  4GKK E;  5IT9 Q;  2Z5C B;  2V2V A;  4X65 E;  4KHP E;  3T1Y I;  3ZKB A;  4FWG A;  2WW4 A;  2IOQ A;  1H72 C;  3ZM7 A;  4DU8 A;  2VQE I;  4LF8 I;  4AQY E;  4LF7 E;  1N0U A;  4B3T E;  2ZM6 I;  1USU A;  2GQ0 A;  1HNW I;  2Z5E A;  1N0V C;  4JI6 I;  1XMO I;  2BM0 A;  1B62 A;  2UU9 I;  4DR3 E;  4DR5 I;  2R42 A;  2ZIT A;  3QT8 A;  3WU5 A;  2O1U A;  1BKN A;  1Z0W A;  1FJG I;  4HAC A;  1EA6 A;  3WU4 A;  1NHJ A;  3V5R A;  5LMU E;  4LFA E;  1FKA E;  3J7A M;  1H7U A;  3J80 C;  1ELO A;  3GON A;  3F0N A;  3T1H E;  4JI7 E;  1XMQ E;  4YHH I;  2Z5C A;  1N36 E;  1IBL I;  3PYF A;  3LPS A;  1ZM4 A;  3PYD A;  4JYA E;  4EMD A;  2HHH E;  3JAM Q;  2DEJ A;  4DV2 E;  4JI3 I;  1U2R A;  4I3H A;  4HXZ A;  3Q6M A;  5FWK A;  1ZXM A;  4DV7 I;  4IZJ B;  4LF4 E;  2UXC E;  2HFU A;  4LFC E;  1RR9 A;  4DV0 E;  2F4V I;  2DEI A;  4JV5 I;  3HUL A;  1N33 E;  1H7S A;  3K1J A;  1UEK A;  1FWK A;  2V2Q A;  2HFS A;  4K0K E;  4Z7C A;  5L3J A;  4M1K A;  4N3O A;  2R3V A;  2NPF A;  1Z0G A;  2V34 A;  4DV6 E;  4B3R E;  4B3S I;  3K17 A;  3WU3 A;  4DUZ E;  1DAR A;  4PRX A;  4JI2 I;  2UUC I;  4JI0 I;  4ZVI A;  1Z0V A;  2CGE A;  2HK3 A;  4DPY A;  4IZJ D;  4DR4 I;  1ZM2 A;  1S16 A;  4KQV A;  1J5E I;  1Z0T A;  4DV3 E;  4IZJ A;  1N34 E;  3QT5 A;  1IBK I;  4DV4 I;  4DR6 E;  2PNM A;  4DPW A;  2LJP A;  4X65 I;  3CWV A;  4LF6 E;  4UTG A;  2OI2 A;  2UUA I;  4LFB I;  4LF9 I;  3M6A A;  5LL6 R;  2X36 A;  4LF5 I;  4MYT A;  4AQY I;  4MYU A;  3K85 A;  2ZBK B;  3ZZU A;  4LF7 I;  3Q6N A;  4FW9 A;  3T1Y E;  4B3T I;  1N32 E;  1Z5C A;  3V2U C;  4GKJ I;  4YY3 E;  1HR0 I;  1XNQ E;  1EI1 A;  4USM A;  2UUB I;  1Z5B A;  1IBM I;  1NHH A;  2PNL A;  4PU9 A;  4JI5 E;  4JI6 E;  2Z5B B;  3PYG A;  5LMN E;  1RRE A;  2J7K A;  1HNX I;  5LMU I;  4JI8 I;  2CZ9 A;  4LFA I;  1MG7 A;  3J80 Q;  1Z0E A;  1FJG E;  3ZZT A;  5GME A;  1XNR I;  3J81 C;  1I94 E;  1XMQ I;  4IZK B;  1PKP A;  1N36 I;  4UT4 A;  4JYA I;  2UXB I;  1Y4U A;  2HHH I;  3LNU A;  4HYM A;  1Y6Z A;  4X64 I;  1USV A;  1HNZ I;  4JI1 E;  4X62 I;  1VIS A;  3H4L A;  4DR7 E;  2XEX A;  4WUC A;  1PVG A;  4DV1 E;  4DV5 I;  2HKE A;  4NXM I;  1Z5A A;  2CG9 A;  1N33 I;  1KTV A;  4DPX A;  4PRV A;  2O1V A;  3B82 A;  5GMD A;  4JV5 E;  4USK A;  2Z5B A;  4DV6 I;  4B3M I;  4B3R I;  4Z7Y A;  3PRY A;  4DUZ I;  4NXN E;  2E5L I;  1ZM9 A;  4HY1 A;  4URL A;  4RPF A;  1FNM A;  4OX9 E;  5FLX Q;  5BR8 E;  4R1F A;  4IZK A;  2UXD I;  4ED4 A;  3OTO E;  4DUY E;  1H74 A;  5IWA E;  4DR2 I;  5A2Q C;  4DR1 E;  2VQF E;  4DV3 I;  4JI4 I;  4GKK I;  1B63 A;  4X66 E;  4DR6 I;  4KHP I;  2BV3 A;  4LF6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...