3T1YQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3t1yQ00
5J3BA 5GAGC 3JAMc 2R6GA 5GADC 4DV1Q 3HOUH 3S2DH 4OO1I 2WAQG 3F2BA 2F4VL 1KL9A 3GTMH 2JA6G 2L15A 4JOIA 4DV3L 4LFBL 4A93G 4A3KG 3J81c 4JI5Q 4KHZA 3GTLH 1JJGA 4GN5A 1LM0A 4YHHL 4HIKA 1GVPA 1NY4A 3W5OA 2ZM6L 3CCLA 4BBSG 2KHIA 1JE5A 3I2ZA 4AYBG 4IO9A 3ULPA 1JB7A 1E7ZA 2LXJA 2KHJA 1HNXL 4UP8A 3JAMi 2Q2TA 2BH8A 2F4VQ 3CW2C 1CSPA 4DV3Q 4LFBQ 5C0XG 1VQIA 3G4SA 4GNXC 1W2BA 1Q82C 2ASBA 2UXCL 3TS0A 1Q81C 3CD6A 3TRZA 4YHHQ 4L5RC 2ZM6Q 1EIFA 2D0PA 1HR0L 1CUKA 1RL2A 1BKBA 4GN3B 2N3SA 4UP9A 3J81i 4A3CG 2UXDL 1HNXQ 1KQSA 2JA8H 2MFIA 1OXUA 2QA4A 3RLNA 1X55A 1TWFH 5GAHC 1N33L 4A3JG 1AE3A 4DK6C 4HJAA 2YTYA 4A3LG 3K80C 1PH8A 1XMOL 4DR4L 4LW1A 3UDFA 1HR0Q 2ZJQA 4L5SA 3PF4A 1FGUA 4K0KL 2UXDQ 3CC2A 2AHOB 3NBHB 2NVQH 5IP9G 2Z0SA 3BZCA 3CQZH 1SE8A 1I94L 1GO3E 1IBLL 4GKKL 1N33Q 2UU9L 4R4IA 3J80c 4PG3A 2GN5A 5FJ8H 4JI4L 5JJLA 1K8AC 1YJNA 1XMOQ 3S14H 4DR4Q 1K83H 1Y1VH 2WB1G 4JI3L 1QZGA 4LF8L 4K0KQ 5GAEC 1C9OA 4KI0A 4IOCA 4PMWA 5M5YH 1X3FA 4A3BH 5AJ3L 1OTCA 3TQYA 1VQ8A 1KRSA 1VCIA 4ME3A 5IE8A 3CCVA 5IYDG 3FHWA 1X9NA 1I94Q 1IBLQ 4GKKQ 4C2MH 4IFDG 3PIOA 3FKIH 4DK3C 2UU9Q 3H15A 3F2DA 4A3EG 3RR5A 2KCMA 4JI4Q 4JI3Q 4LF8Q 3J80i 2Y0SG 2R92G 3ICEA 3H0GH 2F3IA 2PNHA 1K9MC 1FVIA 5AJ3Q 1WJJA 1VQ7A 1IL2A 4A3DH 1JJ2A 2YTVA 2ID0A 4GLXA 1XPUA 4JG2A 1D8LA 1Y1VG 4KHPL 1Y1WH 3AYHB 4OWTB 1P16A 2UUBL 1DGSA 3KDFB 2JEAI 4X62Q 1HZAA 2BH2A 3BU2A 2A8VA 3F2CA 1XMQL 1OXTA 2OQ0A 4BBRH 4JV5L 2IX1A 4GS3A 1NJIC 2N49A 2JJQA 4B3ML 1KRTA 2PQAB 1K3RA 4KHPQ 5EAYA 4DR7L 1QVCA 2UUBQ 2Z6KC 1UE7A 3CXCA 3AEVA 1YJWA 2ZJRA 4C3JH 2JQOA 4IJLA 2DUDA 1X3GA 3J81j 4DR6L 1XMQQ 1VS0A 3KJPA 3M9BA 1WFQA 3GTPH 2Q2UA 1M90C 2VNUD 2BA0A 4JV5Q 2K50A 3AFQA 2NN6I 4GOPA 3CPWA 3GTKH 1IYJB 4B3MQ 4DR7Q 3H3VI 1D7QA 1B70B 3RNUA 2ATWA 5IYBH 1SRUA 2NZHA 3PUYA 1EOVA 4DR6Q 1O7IA 3D0FA 2Q2HA 3OYYA 3RN2A 2I5LX 2RHQB 1U0LA 3G48A 1Q8KA 4R1JA 3CC4A 2R7ZH 3M4OH 3STBD 2CCZA 2H5XA 5LMNL 1Q86C 1KC8C 4LUVA 3CCRA 2VUMG 4P72A 4QY7A 1OXXK 3A5ZB 3J7A5 4DV6L 3L2PA 2AWNA 2WFWA 1LYLA 1K73C 5JJIA 1CSQA 2K5NA 2PMZE 1A8VA 2K75A 4DV5L 3S1RH 4X6AH 5FLXc 3HOYG 4A3KH 4WJ3M 3GDEA 4DAYB 1QVGA 1X56A 1YEZA 3U4ZA 3DLLA 1SMXA 5LMNQ 1HZBA 1X3EA 4UPAA 5IYBG 3S1NH 4BBSH 3CMAA 3PO3G 5JJKA 4DV6Q 4XIGS 4P71A 1VQEA 3TEHB 4DR3L 4DV5Q 2VS1A 4AH6A 1PHJA 2R7ZG 4PZ6A 4IJHA 3KF8B 3I56A 3CAMA 2IX0A 3PUVA 4UP7A 3M85A 5M3FG 4NXML 2MO1A 3BJUA 2IY5B 4R4OA 1UE5A 2JA7G 4DV2L 5C4XG 1HNZQ 4A3CH 3Q8DA 4GLVB 1S3OA 1PH1A 4DR3Q 2EQSA 5ELOA 1L1OA 3HOXH 2YTXA 1CKNA 5LMUQ 4GKJL 2VZAA 2A19A 1VQKA 2IHFA 3CP0A 4JCVE 4AQYL 3HKZG 4A3JH 4OX9L 4NXMQ 1BVSA 4OO1G 1VQ6A 3CCUA 2E2HH 4A3LH 3E9IA 3E0EA 1XTDA 4X65L 1MKHA 4DV2Q 1FJGL 2I5MX 3A0JA 4L5TA 4TVAB 3G6EA 2B63H 1JT8A 3CCMA 2BA1A 1EFWA 1C0AA 5IP9H 3PUXA 4GKJQ 1UE1A 4HJ5A 4QJFA 4AQYQ 2JE6I 1KHIA 1VQGA 4OX9Q 5H1SE 1E24A 3GO5A 5IT9c 3UDIA 3K81C 4X65Q 4BY7G 5GROA 5ELNA 4L5QA 1PYBA 3SGIA 3HOXG 4A3IH 1FJGQ 4JI6L 1N34L 1M1KC 1X6OA 3K7AH 2MO0A 3RLFA 1YHQA 5IYDH 2KENA 1CKMA 2JEBI 1B7YB 1HZCA 3K8AA 1YHBA 2GVBA 2PI2A 4A3EH 1XNQL 4BA2I 2R93G 1EIYB 1N32L 2A1AA 4GNXA 2B63G 4Y52H 1ASYA 5IYCG 5C44G 1J6QA 2NVYH 1P8LA 4BXXH 4JI6Q 3CCSA 1PH7A 2R92H 2VW9A 1N34Q 1XJVA 1H95A 5BR8L 4JBMA 1I6HH 1ASZA 2UUAL 1YBYA 5IP7H 4A3MH 2AKWB 1XNQQ 1MJCA 1XPRA 2E2IH 4A3IG 3NEMA 2N78A 1N32Q 1YZ6A 1QUQA 2K52A 4X66L 3HOVG 1S72A 3GD7A 4C3IH 1PVOA 1EWIA 5BR8Q 4FDBA 2KBNA 2UUAQ 2VQFL 1WCMG 1HR0W 4X62L 4BXXG 4LWCA 4LF4L 3EN2A 2HHHL 3KF6A 1N36L 1HZ9A 2JK8A 3TREA 4X66Q 1Z9FA 5IP7G 4A3MG 1VQLA 2HIVA 3PO2G 3T1YL 2ZTEA 1PH5A 1EUJA 2HQLA 2VQFQ 3RZDH 2K14A 4JI2L 1NBWA 1K8GA 4LF4Q 3ZJYC 5IY0A 1JJCB 1VQHA 2B29A 2NZOA 2WAQE 4QGUA 2HHHQ 1N36Q 3GTOH 5HGQA 1Q1BA 2LXKA 1SFOH 1KD1C 2PI2E 2VQEL 1TWHH 3OW2A 1BBUA 1YITA 3T1YQ 4YCUA 4A3GH 1Y14B 4HJ8A 2VUMH 4GLAC 4JI2Q 4JI8L 3U50C 3G71A 4H02A 4NPSA 4C3HH 4AYBE 1PH9A 4QQBX 3S1QH 4JBJA 1Q12A 4BY1H 2VQEQ 1VQAA 2NVTH 3UE0A 1IBML 3HOYH 1OXSC 3M3YH 1E3PA 3U4VA 4LNQA 4LUZA 3HOZH 2OTLA 4JI8Q 3GTJH 4JBKA 3MXNB 3PO3H 2CQOA 1E1TA 2NN6G 1NTGA 3RZOH 3GTGH 4A3GG 2Z6KA 1V1QA 1IBMQ 3STBC 1TWAH 4DR1L 1VQCA 1YHAA 5M3FH 1L2FA 3HOWG 3A5UA 2JA5H 2CFMA 2JA7H 5C4XH 2B3GA 4BY1G 3RN5A 1HJPA 4JYAL 3M4PA 1T9HA 3M4QA 1NE3A 5IWAL 5FLMG 3CCJA 2YU9H 4UY8C 3AQQA 4XTCS 1CKOA 3T1HL 3HOZG 5JEAJ 1VQOA 1VQNA 4DR1Q 1XPOA 4GN4B 3IRBA 4JC0A 4HJ7A 4DAMA 3A74A 3UDGA 1HNZL 2FXQA 3KLWA 2E2JH 4O0AA 3M7NA 2WB1E 2VL6A 3KJOA 2ES2A 4HIOA 1I50H 1PH6A 2UXBQ 4LUOA 4JYAQ 5LMUL 4OWXB 1Z47A 1VQ5A 2OTJA 4YCWA 1WYDA 5IWAQ 2CWAA 2R7FA 1G291 1QZHA 2D62A 3MEFA 3T1HQ 1UWVA 4LF7L 1VQFA 1G51A 4YWMA 2JA5G 1A0IA 1YIJA 3I4MG 2GVAA 3LGJA 3PUWA 1E1OA 1UEBA 3NENA 2V1CC 4RG1A 1OXVA 1VQ4A 4LF9L 3S16H 1K0RA 4IPGA 4JOIC 4BY7H 2K5VA 2XGTA 3KYHC 4HIDA 5K36G 1L1OC 2Y0SE 3VDYA 3ULLA 1PH3A 2ALYB 5LMNW 1YNXA 4RMFA 4LF7Q 3TS2A 1L0WA 4POFA 2R93H 4LF9Q 3PUZA 3J7ZC 4A3FG 1EQQA 1C7YA 5IYCH 5C44H 4GOPB 4YWKA 1V9PA 2ZJPA 3UE1A 5C3EG 4O2DA 1WI5A 3NELA 4BA1I 2XTIA 2YYZA 5DLQE 1TXYA 1LTLA 4LFAL 5C0XI 1YJ9A 1YVCA 2R7DA 4LFCL 1KIXA 2RF4A 4X64L 5C4JH 1VQMA 1MJEA 3HOVH 3ERSX 1IBKL 2N8NA 4IOAA 3B6YA 4DNIA 3F8TA 1J5EL 1EQRA 3KDFA 1WCMH 4OWWB 3JC66 1XNRL 3S1MH 4LFAQ 2AMCB 4DV0L 4B3SL 2UUCL 1PH4A 3HOUG 2C35B 1W3SA 2IT1A 2QGQA 2NVXH 4R4TA 4NXNL 4X64Q 4LFCQ 3E9HA 2D0OA 4HJ9A 2PQAA 1IBKQ 4R4CA 2HT1A 3PO2H 5GQOA 1SLJA 4B3TL 3L7ZC 4JI7L 4P75A 4YWLA 1RIPA 3OTOL 3EBEA 1J5EQ 4LF5L 4AIMA 3I7FA 4ALPA 1XNRQ 4Y7NH 3PSIA 4LF6L 1PYSB 1X65A 4DV0Q 4B3SQ 1NMGA 2UXCQ 1VQBA 1HNWL 5HY6A 2UUCQ 1E22A 4A76A 1Q1EA 1UE6A 2F52A 3I4OA 4MTNA 4NXNQ 2EXDA 1AE2A 4IPDA 4NB3A 2OQKA 4DV4L 4PZ7A 4B3TQ 4JI7Q 3OTOQ 1YI2A 4LF5Q 4J15A 1JMCA 1SN8A 3U58A 1L1OB 4DUYL 1PH2A 1CKNB 4LF6Q 4EX5A 1QVFA 4IFDI 3L0OA 2ZTCA 1HNWQ 1U5KA 2MQHA 2JA8G 4JBWA 5C0XJ 1PV4A 5M3MH 4DKAC 3PF5A 4DV4Q 1N9WA 2ZTDA 4P73A 2OWOA 3I4NH 2K5HA 1TWCH 4DUYQ 4DR2L 3KOJA 1S40A 4QIWE 1KXLA 2OCEA 2KCTA 3CF5A 2RCNA 2CKZB 4MNOA 1PA6A 1LUZA 3HKZE 2E8GA 3H3VH 1HH2P 4QL5A 1GKHA 1V43A 5JEAG 4DV7L 4HIMA 3HOWH 3WWVA 5FJ8G 4DR2Q 2I5HA 4B3RL 4OONA 1R9TH 1N8RC 4GOPC 5FLMH 5M3MG 4A3BG 1KAWA 3DM3A 3ULJA 3UDXA 3CCQA 2K4KA 1MIUA 4GNXB 4YY3L 3I4NG 3HKSA 4P74A 3CPFA 1Q7YC 4DV7Q 3FKIG 3RLOA 1IXRA 3BZKA 1VQDA 4DR5L 4PZ8A 4JI1L 4B3RQ 3KFUA 3W1GA 3K0XA 4R4QA 1WOCA 3CC7A 5E7NA 3H0GG 4APVA 2EIFA 5M5WH 2QEXA 4A3DG 2VY3A 3S17H 4IFDJ 3CCEA 2JA9A 1Q46A 1QUQB 1IZ6A 1SR3A 1FL0A 4YY3Q 5M5XH 2E5LL 3S15H 2CWPA 3I4MH 2UXBL 1AH9A 1Y1WG 4YCVA 3GTQH 4DR5Q 1A62A 1TWGH 1A63A 2IHEA 4JI1Q 1SROA 1I5FA 2AWOA 3D31A 4KLKA 2MNAA 2HIXA 1I3QH 3F1ZA 4BBRG 3KF6B 3EIVA 2E5LQ 4DUZL 4POGA 1PFSA 1BBWA 1EYGA 4TQUS 4A3FH 4IPHA 1NMFA 3HFZB 3CMEA 3AFPA 4IPCA 4MZ9A 1GD7A 5C3EH 1G6PA 4EQ5A 2LSSA 3I55A 2I0QA 2Q2IA 1X54A 2DGYA 2RHSB 4OXPA 4A75A 4JI0L 4DUZQ 3PCOB 2JA6H 1VQ9A 4A93H 1VQJA 3PGZA 3S2HH 4WJ4A 4DV1L 3S24A 4DPGA 3ER0A 2YV5A 4A4IA 2WP8J 3PIPA 3FP9A 3K7UC 1B8AA 1GM5A 1VQPA 3PV0A 4JI5L 3W1BA 4JI0Q
chains in the Genus database with same CATH superfamily
1A2UA 1D5MC 5J3BA 5L37A 3G6JB 5D3IB 1BXTA 4FF2A 2JA6G 2L15A 1NCVA 4LFBL 1CT1D 1Y1VB 5EBCA 2RQXA 2RDGA 2XSCA 3R2TA 4KHZA 3VR6A 1LM0A 4JI5Q 3GTLH 1GVPA 1LTRD 1NY4A 3W5OA 5CBEE 2ZM6L 1ET9A 2F0SA 2NYZD 4HAEA 4A3BB 1WTOA 1HTPA 2D9UA 5I9OA 3ULPA 2F4VQ 1B9NA 2FFKB 1EY5A 5C0XG 4GNXC 2AUKA 2EY6A 1Q82C 1A6XA 3NQIA 3CD6A 4L5RC 4UP9A 2F1MA 2A6HC 1OXUA 4OEMB 2KVMA 5GAHC 2NB0A 1N33L 2Z8LA 1TY2A 4A3JG 1AE3A 4DK6C 2YTYA 3UDFA 3NTIA 2K1BA 4RGTA 1J8IA 3NBHB 2XIWA 2PW5A 5IP9G 1IBLL 3BZCA 4OIKA 3MXNA 4KN4C 4R4IA 3J80c 3IKJA 3SEBA 5ELFA 1K8AC 5EPLA 4DR4Q 1K83H 4JI3L 1QZGA 4LF8L 4IOCA 1C9OA 2DNCA 2IPKD 4FF4A 5T1IA 5AJ3L 1I4QA 1X9NA 1NSNS 3FHWA 4GKKQ 4C2MH 5FLXE 2FINB 4KN7C 3NHHA 3H0GH 2PNHA 2EJFC 4H0LC 1EZ6A 1Y1VG 4KHPL 1F9RA 2QEJC 3AYHB 1DOLA 2VB2X 2UUBL 4NMZA 5C3WA 1SMYC 2JEAI 4A3KB 2CQAA 3ERQA 1CK1A 1EY8A 3GV6A 1TY0A 1CA5A 1VDZA 3BYTB 2IX1A 1LACA 2JJQA 1JB3A 2PQAB 4DR7L 4KJNA 2ZJRA 4IJLA 3T16A 4DR6L 2B2VC 2Q2UA 2BA0A 3Q22A 2K50A 3GTKH 4JV5Q 2X6GA 4B3MQ 1B70B 5FO8B 2SNSA 2NZHA 4K6LA 5CV4A 4ZQ3A 2Q2HA 2RHQB 2R7ZH 1T5XD 1RKNA 2H5XA 5LMNL 4LUVA 1BBXC 3DHQA 1Z7TA 4RCNA 2EOTA 1SJED 2AWNA 2EY1A 1K73C 2K5NA 2K75A 5FLXc 5IGCA 4WJ3M 3I8ZA 1U4LA 1YEZA 3U4ZA 5M5YB 2J0TD 3M7GA 4DV6Q 1VQEA 3SDZA 2FHTA 2E74C 4DV5Q 2VS1A 4AH6A 4PZ6A 1EWHA 2A68C 3KF8B 4KD4A 1PRTD 2IX0A 2PO4A 3PUVA 5M3FG 1CA6A 4NXML 1HA5A 2IY5B 2RDHA 4R4OA 5LL6S 3IAYA 5ELOA 5IOCA 3HOXH 2YTXA 1CKNA 2A19A 3HGBA 2E2IB 2EYFA 1JWSD 3CP0A 2DNEA 4XT1B 5KNDA 4OX9L 4OO1G 1GUWA 2E2HH 4X65L 1R4QB 1MKHA 1TS5A 4C3IB 1A3VA 1HTLD 4L5TA 4DA2A 2B63H 1JT8A 2BA1A 1JOOA 1RODA 4GKJQ 1AN8A 5I2YA 3UDIA 4I7AA 3LWUA 2K5QA 1X6OA 3K7AH 3H91A 1YHQA 2KENA 2JEBI 2SEBD 2GVBA 4BA2I 4DN4M 5IGDA 1EIYB 2H4OA 2A1AA 3TMEA 4GNXA 4Y52H 3QWNA 5C44G 2NVYH 5KEEA 1WD1A 3CCSA 2F4IA 1PH7A 4DAPA 4A3GB 3J7AV 4JBMA 3LWEA 1I6HH 2VUMB 5A2QE 2F0EA 2L9HA 3PMFA 4A3MH 1SYEA 2K05A 3GTPB 2N78A 3BS1A 2J4XA 1QUQA 3MXGA 4J8QA 2MPMA 5BR8Q 3PO3B 1WTVA 3QR8A 4BXXG 1JCKB 2A73B 2K6AA 2HHHL 1HZ9A 2JK8A 3TREA 1CZWA 2L1BA 5IP7G 2HIVA 3CU7A 1EY9A 5G3LF 2NBFA 2VQFQ 2EYOA 2E76C 5DEHA 1N36Q 3GTOH 1Q1BA 1KABA 4KHVA 4DNRB 3T1YQ 1Y14B 4HJ8A 3G71A 4H02A 2AQ1B 4QCLA 4ME5A 4CDEC 3KLSX 4AYBE 3CRLC 4HCEA 3S1QH 4QQBX 2E75C 2F0FA 4BY1H 3EQLC 3M3YH 1OXSC 4CHTB 2KA7A 4BY7B 1F77A 3HOZH 3EVQA 2OTLA 1CQFA 1VF5C 3NP8A 3MXNB 1BCPC 2CQOA 4R8NA 1EIHA 2NN6G 4C56C 4OELB 2R93B 3GTGH 4A3GG 1GJXA 2B2VA 1F2MA 2JA5H 5KRUA 3RN5A 2EZVA 3M4QA 1T9HA 1IHZA 4K5VA 4K6DA 4A3IB 5JEAJ 2XNAC 3S1MH 2PPBC 3UDGA 1PTOH 3OHXC 4O0AA 2VL6A 1RCVD 1I50H 4HIOA 5IGBA 1S5ED 5COYA 4RFBA 2L4NA 2KECA 1SBBB 4YWMA 3PUWA 1E1OA 4LF9L 3VR5A 1OXVA 3S16H 2XGTA 4HMJA 4Y7NB 1PH3A 2ALYB 5LMNW 1IW7D 4CGYB 2EVBA 3PUZA 3D6WA 2KCCA 2F0PA 3UE1A 4XQJA 1WI5A 3K5OA 1LT4D 1A15A 5DLQE 3VR2A 2IX3A 1E0BA 1YJ9A 1B4OA 1AZQA 1Y69U 4KKTA 1YVCA 2ZXOA 5EKLA 5C4JH 3HOVH 3T51B 1IBKL 2HQEA 3DWAA 2JYOA 4ZKCB 4RKLA 4IOAA 3B6YA 4LK1C 5JPNC 3BZDB 4OWWB 3V05A 2AMCB 2UUCL 2IT1A 1WTXA 4R4TA 4X64Q 1PZID 2XWBB 3SK5A 3PO2H 1DOMA 1F2LA 5GQOA 4FXKC 4CKCA 3EBEA 4AIMA 1CFMA 4ALPA 3PSIA 2AUJD 1X65A 2K5DA 2UXCQ 1HHVA 1ICFB 1O7YA 4A76A 5CV6A 2F52A 1AE2A 3HP3A 4H13C 4CDDC 3KBGA 1JMCA 1CKNB 4LF6Q 1QVFA 4IFDI 2A69D 2ZTCA 1HNWQ 2MQHA 4JBWA 3VA5A 2LKVA 3QG1A 5C0XJ 1PV4A 3PF5A 1QB5D 1SXTA 1TWGB 2ZTDA 3KK7A 1EZ8A 2BE5D 1FYCA 2K5HA 3TP8A 4QB4A 4DUYQ 4DR2L 5JVG3 3NTKA 4ZCKA 4JPBW 4PQXA 1LUZA 2E8GA 4QL5A 4HIMA 5C3EB 2I5HA 2WAQB 3KUPA 1N8RC 4MTKA 2EYJA 5FLMH 2OT2A 4GOPC 1F2ZA 3BDLA 4GNXB 2L5TA 3HKSA 3CPFA 3BDCA 4DV7Q 4O42A 1Q7YC 3BZKA 4U673 4DXGA 4JI1L 1II3A 3J81E 1PXUA 4R4QA 1TS2A 5FLXL 4CKEA 3H0GG 5M5WH 2QEXA 2BOSA 1QUQB 1IZ6A 1SE2A 2PNRC 2CWPA 3OWEB 3GTQH 3GP7A 1A62A 4JVZA 1A63A 2IHEA 4DNTB 1G6ZA 1SROA 3NWTA 4KLKA 1G2SA 2MNAA 1F2YA 3KLSA 1PFSA 1EYGA 1HRJA 1TT2A 1JR0D 1SNOA 4EQ5A 3I55A 1X54A 5NUCA 5D3DA 3PCOB 1VQJA 3S2HH 3S24A 3ER0A 2YV5A 3PIPA 3FP9A 5E3FA 3K7UC 1IW7C 3PV0A 4R9WA 4JI5L 3OMGA 3Q24A 2CVRA 2R6GA 2NVQB 4NP5A 2KUMA 3NPPA 4XYQA 5GADC 3CQZB 2WAQG 1SYGA 3ND9A 4CKBA 3F2BA 2F4VL 1RTNA 1H9MA 1SYCA 4FF3A 3S14B 2MP1A 1EFID 3J81c 3BVGA 3P7JA 1LABA 1JJGA 4GN5A 4V190 5M3MB 1LLRD 3KLRA 2LXJA 3E0JA 3JAMi 2WIIB 3CW2C 4OL7A 1ENFA 1W2BA 4FP5D 1EIFA 2D0PA 1CUKA 4A3DB 2N3SA 3PIP3 2I46A 5F2DA 1HNXQ 1KQSA 2A6HD 3SR1A 4BWGB 1X55A 1TWFH 2M2LA 2RVLA 3D4WA 5FKAC 1Y1WB 1I4XA 5J1ZA 4WRDA 5EKIA 2N55A 3K80C 1PH8A 4DR4L 4KTAA 4L5SA 4IQZA 4BBRB 1V8QA 2AHOB 5I9PA 4GKKL 3EROA 1IYUA 4FYDA 2A69C 4PG3A 3HG9A 5LHY1 5IGFA 2WB1G 4K0KQ 4KD3A 2OEOA 5ELBA 5IE8A 1HA6A 2K01A 3PIOA 3FKIH 3DMUA 4KKSA 1PZJD 4RHRA 4JI4Q 2Y0SG 1FVIA 1H9SA 4IUVA 1VQ7A 1JJ2A 2MHVA 1F9SA 4GLXA 2WACA 1XPUA 1C4QA 4JG2A 1P16A 5A2QL 1SMYD 2F0KA 3S1RB 4LJZC 4X62Q 1HZAA 2K32A 3NQTA 1LTTD 1H9KA 2A5HA 4J6HA 2A8VA 1B50A 2OQ0A 3HKZB 4JV5L 3S1NB 1NJIC 2N49A 1SYDA 3ND8A 4B3ML 4QF4A 2Z6KC 1YJWA 4C3JH 5C4ZA 4DAVA 3J81j 4XXEA 2CHBD 1VS0A 3M9BA 3GTPH 1M90C 4GOPA 3QB3A 3GTMB 1GHKA 3H3VI 4ODGA 5IYBH 1SRUA 4A3JB 2DJFC 1W6KA 3D0FA 3OYYA 3RN2A 3WDNA 1U0LA 3M4OH 1Q8KA 3Q23A 4NKLA 3HS0C 3STBD 3CCRA 1EY0A 3J7A5 4DV6L 4DV5L 3OSOA 2XRQD 4J1MA 4OIJA 4BBSH 1KLGD 3CMAA 1CTMA 4N9PA 4XIGS 4P71A 5CV9A 1KLUD 1UEAB 2LY7A 3TEHB 4HSPA 2ZXRA 5JAVA 2A68D 3I56A 3CAMA 4QUFA 3M85A 3W3AA 2B2WC 2MO1A 3UI2A 3BJUA 1SYFA 3D8GA 1HNZQ 4A3CH 3K5NA 1S3OA 1PH1A 4DR3Q 1L1OA 4HSVA 1Q8IA 3I91A 2VZAA 4G57A 5LMUQ 1AW7A 4GKJL 1AP0A 2IHFA 3HKZG 2PYKA 1BVSA 3T53B 4A3LH 1KNEA 2EY5A 3E0EA 1XTDA 3MTSA 1XXGA 4HR7B 2I5MX 3G6EA 4TVAB 2F0MA 2M00A 3CCMA 1EFWA 2QW7A 3E3XA 4HJ5A 2JE6I 3C1FA 1KHIA 2O5JC 1E24A 1PTOD 1PYWD 1GHJA 1MD2D 1IKMA 1BCPB 4L5QA 3VYRA 4A3IH 1FJGQ 2QCPX 1SJHD 4Q0FA 4K8JA 2MO0A 4H7BA 5IYDH 1SDFA 4IUTA 1HZCA 3LNNA 4A3EH 1SFOB 4K8IA 1J6QA 1P8LA 3BVZA 2R92H 3RMHA 2VW9A 1N34Q 1XJVA 5BR8L 2Q8IB 2AKWB 1XNQQ 1N32Q 1YZ6A 2EJGC 3HOVG 4L8JA 1S72A 1PRTB 3GD7A 1EWIA 3GTJB 1J9OA 2UUAQ 2VQFL 1DOKA 2ZT9C 2WINB 3KF6A 1N36L 4X66Q 1Z9FA 5M3FB 3PO2G 4XDXA 3T1YL 1PH5A 1QWYA 1EUJA 2JN4A 2K14A 4G7ZC 4TKOB 4LF4Q 1L0YB 5DAUA 2B29A 1STYA 1CHQD 4PV1C 4UDUC 1QNUA 5CV8A 1KTKA 2F03A 5HGQA 1KD1C 4CJ2C 2F0NA 2PI2E 2RDFA 1AEXA 1EU4A 1TWHH 1YITA 4RH6A 4YCUA 4G4KA 4HCSA 3TDQA 5DM63 3RUZA 4GLAC 3U50C 4C3HH 3SE0A 3DUZA 2VQEQ 4P2CB 3UE0A 3HOYH 1E3PA 3U4VA 4LUZA 3BDOA 3P20A 1ENCA 1EQTA 1G8ZD 1BUVT 1BCPD 1E1TA 3RZOH 2Z6KA 1IBMQ 3STBC 1TWAH 5C44B 1L2FA 3A5UA 2CFMA 2JA7H 5C4XH 1HJPA 3M4PA 1NE3A 5FLMG 2YU9H 4UY8C 2QKIC 1PFNA 2CH4A 4XTCS 4DR1Q 1ML0D 4HJ7A 3M7NA 4DAMA 3A74A 1KAAA 1H9SB 2FXQA 2E2JH 1C8CA 1YNJC 4LUOA 1Z47A 4YCWA 2PMZB 5IWAQ 3TZUA 1G291 3Q6SA 3J81L 2D62A 1VQFA 2F0JA 1VQ4A 3NENA 4RG1A 4ZLTF 4IPGA 4JOIC 5LL6X 4HIDA 2B8FA 1HQRD 2K5WA 2KEEA 4I7ZC 2RKSA 3VYTA 3VDYA 1BR9A 5T1GA 1S5DD 4RCOA 3ULLA 1CI3M 4LF7Q 1YNXA 4IUUA 3TS2A 4POFA 2IJ0A 1HUNA 3NUCA 1PFMA 1C7YA 2PZTA 5IYCH 4GOPB 4YWKA 2B2WA 2ZJPA 3FDTA 4O2DA 1I6VC 2F0HA 2Q8TA 4BA1I 1PTOC 3TP7A 1TXYA 1LTLA 5C0XI 3RZDB 2RF4A 4X64L 1ZYRD 2O4XA 4V0BA 1T5EA 1JORA 1ZEQX 1JWMD 4DNIA 3KDFA 1WCMH 2XWJB 5BN4A 1PRTF 4Q5VA 1STEA 1VMCA 2C35B 1XX8A 4WFN3 2RCFA 3E9HA 3MFGA 2D0OA 3QOLA 4HJ9A 2HT1A 1SLJA 4YWLA 1RIPA 1J5EQ 3MA2B 1D2BA 1XNRQ 5G3LD 4LF6L 1PYSB 4DV0Q 4B3SQ 1VQBA 2D5DA 1HNWL 1E22A 1DYQA 4MTNA 2EXDA 5IGEA 2QF7A 4YIJA 4PZ7A 3OTOQ 1PH2A 1L1OB 4DUYL 1EWCA 1E2VA 3L0OA 1U5KA 3S15B 2OF1A 3K5LA 3R8BA 5M3MH 3PQIA 3I4NH 1TWCH 3KOJA 1B53A 2B2YC 4FF1A 1I3QB 2CKZB 4MNOA 5CYUA 1HFGA 1SAPA 1XTCD 1STBA 1YNNC 1HH2P 4DV7L 2HD3A 4FNFA 3HOWH 3CHBD 4HN7A 2F0WA 2F0IA 4OONA 1R9TH 3DM3A 3ULJA 3UDXA 5I6YA 2K4KA 3FKIG 2EYHA 1V1OA 4PZ8A 1ZXTA 4X3UA 4B3RQ 3V96A 3KFUA 2EIFA 1FR3A 3S17H 5IIFA 5K5PA 3CCEA 2JA9A 4YY3Q 1FL0A 2UXBL 5M5XH 3I4MH 4K2LA 4YCVA 1KDBA 1SEBD 2QDBA 1D6EC 3D31A 4G7OC 2AQ3B 3GTLB 1RHPA 3QIAA 3KF6B 3EIVA 2E5LQ 2FJ2A 4POGA 1BBWA 4A3FH 1NMFA 1CQVA 3CMEA 2L12A 4C3JG 2Z4HA 2A6EC 1JICA 4ABNA 2Q2IA 2DGYA 2JA6H 4OXPA 1EQVA 4DUZQ 1NR4A 3K0YA 3E6ZX 1GM5A 1VQPA 1WTRA 5GAGC 4DK0A 4DV1Q 1GUTA 3HOUH 3S2DH 4OO1I 2LMCB 5ELCA 4DU9A 3HZXA 3GTMH 1KL9A 3SK8A 1PMRA 1NAPA 4JOIA 5I4DA 4A93G 1K83B 1TU2B 3X3NA 4HIKA 2HDLA 1K8OA 4BBSG 1ZYRC 1JE5A 3I2ZA 2PCFB 1HNXL 2KHJA 2EYPA 4C2MB 4UP8A 2BH8A 1CSPA 1EYAA 4DV3Q 1VQIA 3IFTA 1I4PA 2M9VA 3TS0A 5DM73 1Q81C 4YHHQ 3TRZA 1SNQA 3H0GB 4B9XA 2IW3A 4GZYC 4A3CG 2JA8H 2K28A 2C5CA 2QA4A 3RLNA 1UNSA 3R2IA 1WVLA 3GQBA 4HJAA 2XVSA 4A3LG 2ZJQA 3PF4A 1HR0Q 4K0KL 2UXDQ 1QOHA 3QO2A 3X3MA 2HCIA 1O78A 3CRKC 1SE8A 1GO3E 1PLFA 4B9WA 3I3CA 1X3QA 4JI4L 4DFAA 1YJNA 1XMOQ 1Y1VH 4KI0A 4PMWA 5M5YH 1X3FA 3GTKB 4A3BH 1VQ8A 1I94Q 5IYDG 4G7HC 2UU9Q 4DK3C 3H15A 3F2DA 4A3EG 2KHSA 2GA4B 3RR5A 1LTID 1QG7A 3J80i 3GV3A 2R92G 1U4PA 1VF7A 2YTVA 1D8LA 4QIWB 4RKBA 3KDFB 2BH2A 3BU2A 3SHLA 3F2CA 1OXTA 4CJ1B 2B2YA 3WOFA 4GS3A 4RGMA 4EVOA 3CXCA 1NUCA 2DUDA 4C1NK 5I2XA 3D6CA 3KJPA 1XMQQ 2EXZA 3AFQA 2NN6I 3HOXB 3RNUA 4TRDA 3PUYA 1TS4A 1EOVA 1O7IA 2B2TC 2RSOA 2E2HB 2B63B 4XQNA 3A5ZB 2EPBA 3L2PA 4IALA 5JJIA 1LYLA 1AZPA 1CSQA 1SNDA 4K5XA 4DF7A 3HOYG 4A3KH 2WB1B 3GDEA 1GUNA 1QVGA 1X56A 3JAML 1HZBA 1JQYD 3K7AB 5JJKA 4DR3L 1Z6HA 1HCZA 1PHJA 2R7ZG 2H1EA 1RJTA 4PMBA 2NVYB 2Y0SB 3A56A 1UE5A 2JA7G 5C4XG 3HRZC 1I6HB 4GLVB 1GXDC 4A3MB 1QNKA 4XT3B 4JCVE 1C48A 4ZYSA 5CGKA 2RBMA 1VQ6A 3E9IA 4DV2Q 1ILPA 1FJGL 3A0JA 2EY2A 1Y8PB 1S5CD 3D4DA 1UE1A 2VB3X 4QJFA 3IL8A 4AQYQ 2KJXA 3NE5B 4IZ8A 5CV7A 1LO5D 3W2DA 3GO5A 3K81C 3MAQA 1O80A 3HOXG 2DJGC 2L0CA 1N34L 2Z1CA 3MVVA 3RLFA 2K03A 1G2TA 1SE4A 1RDPD 4IFDH 1XNQL 1FGBD 1GUGA 3BVMA 5KGUA 3GTOB 2JP1A 1N32L 2B63G 1ASYA 5IYCG 4BXXH 2XRSD 4JI6Q 3BG3A 5FO9B 5CV5A 1H95A 2BCOA 4MN3A 3AU7A 2UUAL 1YBYA 5IP7H 1MJCA 1XPRA 4HEDA 2E2IH 3D3RA 3S1QB 4BY1B 5D65A 1K28A 2K52A 3M3YB 4X66L 3HOZB 4C3IH 1WCMG 1V1PA 4FXDA 3OMCA 2QILA 1EOTA 4LF4L 5FO7B 3A54A 3GTGB 1STAA 4S3SA 2IWHA 4L63B 5KNCA 3QOJA 4A3MG 1SSOA 4N8X1 2JA5B 4OGQC 3ZYYX 2HQLA 3RZDH 1NBWA 4EQOA 1K8GA 3ZJYC 4FO2A 2WAQE 4QGUA 1GUOA 1BF4A 2LXKA 4ULLA 4U68A 2VQEL 1CHPD 3S1MB 1PTOB 3OW2A 1BBUA 2NN6H 4F87A 4KY7A 4A3GH 1I50B 3EJIA 5TSSA 4LAAA 2VUMH 4JI2Q 1WD0A 2Q8RE 5EKKA 1O7LA 1R4PB 1S4ZA 1E2WA 1Q12A 1IBML 4ZK9B 2L55A 5EBDA 1BDOA 3K57A 5CORA 4JI8Q 2KQ3A 4ZUIA 4JBKA 3PO3H 2XN9C 1JC7A 1U4RA 2EYMA 1D5XC 2WKCA 2VXWA 4ILWA 1V1QA 1PZKD 4DR1L 1VQCA 3HOWG 1FNUA 2B3GA 4BY1G 3TZDA 3CCJA 5IWAL 1QCBD 1CKOA 3HOZG 1DZ1A 3E5SA 1VQNA 1XPOA 4GN4B 4LMQD 2KEDA 5C4JB 2B2TA 3KLWA 3HOVB 1YNJD 2WB1E 2F0GA 3KJOA 1PH6A 4JYAQ 4OWXB 4IUPA 1VQ5A 2OTJA 1I4GA 1B9MA 2CWAA 2R7FA 2NWGA 3T1HQ 1UWVA 4LF7L 1G51A 2JA5G 1A0IA 1ONLA 3I4MG 2GVAA 3LGJA 2K7VA 4JW0A 1UEBA 2NUCA 2V1CC 1B2TA 1K0RA 4BY7H 3NTHA 3PO2B 3I72A 2CW0D 2Y0SE 5HGTA 4E6IA 2OXPA 1SE3A 2R93H 2Z4IA 1NR2A 2R61A 5IT9L 3MXPA 4A3FG 1WTWA 2JXMB 2WKDA 3NELA 2YYZA 2ICIA 2A74C 5FOBB 5EJWA 1GUSA 1VQMA 1MJEA 2K04A 3ERSX 1LT3D 4B08A 2N8NA 1FNWA 1CM9A 5EGTA 3FEWX 3F8TA 5IGGA 1J5EL 5ELDA 1EQRA 3JC66 1XNRL 4LFAQ 4DV0L 4B3SL 5ELEA 3DEOA 1PH4A 3HOUG 1W3SA 4LFCQ 2G9HD 1SYBA 1EL0A 2EDGA 1XWEA 1LTGD 2R3ZA 1F9PA 3OTOL 3NWSA 3I7FA 5JVH3 2NVTB 4Y7NH 1MSGA 2G9DA 1MGSA 1B3QA 5HY6A 1DXMA 3OPOA 3I4OA 4KY5A 4NXNQ 2NZ1D 4QMGA 4NB3A 1DCZA 1JOQA 2OQKA 4B3TQ 2F0TA 3A8JE 4JI7Q 4LF5Q 4J15A 4OHJA 3U58A 2PW7A 1PTOF 5M5WB 2LFNA 2ICEC 4I65A 2JA8G 4F7XA 2HDMA 4DKAC 3GTQB 4DV4Q 1N9WA 2OWOA 1S40A 1ZKOA 1KXLA 2KCTA 1ENAA 1ICWA 3WOEA 2PZWA 3CF5A 4DAYA 1SNCA 1PA6A 1HQMC 2HUGA 1YNND 5J22A 3HKZE 3MWYW 3H3VH 1GKHA 1V43A 3L9AX 1S5BD 4B3RL 1EEID 1EY6A 2F0LA 4A3BG 1KAWA 3CCQA 1U9RA 3JAME 2TMPA 1MIUA 4YY3L 3S2HB 4UAIA 4P74A 5KNBA 3VYUA 3RLOA 2F0QA 1DD2A 1EEFD 2MJ8A 4R8IA 1M4VA 4AYBB 3W1GA 1ESRA 3K0XA 1WOCA 3CC7A 3C3LA 4RGOS 2JSOA 2VY3A 4CBVA 2P5ZX 3A7LA 5I6WA 1SR3A 4CJ0B 2E5LL 4N9TA 4DR5Q 1TWGH 5K36H 1I5FA 1V1PB 2AWOA 3S9WA 2HIXA 3FRPB 3O13A 4DUZL 1NNXA 4TQUS 2EE1A 3HFZB 3AFPA 3CKIB 5BN3A 2DY8A 4MZ9A 1GD7A 5C3EH 2A6ED 1G6PA 3TP5A 3MEHA 2NVXB 2RHSB 2NTSA 3KBXA 4WJ4A 3PGZA 2X69A 1B44D 2CW0C 4DV1L 4M8AA 4DPGA 3P75A 1TWFB 4A4IA 2RA4A 1BCPF 1HXYD 1PFBA 4X3SA 4WJWA 4JI0Q 1IL8A 1FNVA 2Z9HA 1STGA 1TVXA 2Z6BA 3TSSA 3JAMc 3Q0AA 2KOLA 3G7LA 2B2UC 3A55A 3H6MA 4DV3L 1EIGA 1KDCA 4A3KG 4MIUA 5M9OA 4IUQA 4YHHL 4ZKBB 4M1UB 3CCLA 3NBIA 2KHIA 4IO9A 4AYBG 1JB7A 3OOCA 1E7ZA 2Q2TA 3FKIB 5C6AA 4LFBQ 1SNPA 3G4SA 2ASBA 2UXCL 1VMPA 1W6JA 1JWUD 2ZM6Q 4DGZA 1HR0L 1RL2A 1BKBA 4GN3B 3J81i 2UXDL 2B39A 2MFIA 3I4LA 1EU3A 3M4YA 2WV6D 1XMOL 1D1KA 4LW1A 2KCNA 3T13A 3TBIB 5C4HA 1FGUA 2ZXPA 3CC2A 1KNAA 4KV6A 2TSSA 2NVQH 1I4HA 2Z0SA 3CQZH 1I94L 1PDQA 2D2CC 5C5LA 1N33Q 5JEAH 2UU9L 3K6OA 3T56B 2GN5A 5FJ8H 4C3JB 5JJLA 3S14H 5GAEC 3P1HA 3DWQA 3VR4A 1OTCA 4N8FA 3TQYA 1KRSA 1VCIA 4ME3A 1TR5A 3CCVA 1IBLQ 3ONAB 4IFDG 5AFWA 4KKUA 2KCMA 2IL8A 4JI3Q 4LF8Q 1GOZA 1RD9D 5E4XA 4F8MA 3NK9A 1O7ZA 5C5MA 3ICEA 3K5MA 2SNMA 3M4OB 4NDXA 2F3IA 1K9MC 1IL2A 5AJ3Q 1WJJA 4A3DH 1UAPA 2ID0A 1Y1WH 3R3OA 4OWTB 5CBAE 5D14A 3F2UA 3I73A 1DGSA 2F3VA 4ZRZA 1XYIA 4A93B 1XMQL 1STNA 4C3IG 2FMCA 4RAUC 4BBRH 4BBSB 3SK4A 1QE6A 1WTPA 1KRTA 4KHPQ 1K3RA 5EAYA 1QVCA 2UUBQ 1UE7A 3AEVA 2JQOA 1X3GA 1WFQA 2VNUD 3A7AB 3CPWA 1IYJB 4DR7Q 1D7QA 5EPJA 2ATWA 1TKWB 1DJRD 5EPKA 3H09A 3RD4A 4DR6Q 4MHEA 5IT9E 1Y8NB 2I5LX 1BOSA 1B1ZA 3L3OC 3G48A 5BN5A 4R1JA 3CC4A 2BDNA 2CCZA 1KC8C 2VUMG 1Q86C 1LV9A 4P72A 4QY7A 1OXXK 4NW2A 2WFWA 4KY6A 1TIID 2PMZE 1A8VA 3VYSA 3S1RH 4X6AH 1JE4A 3TN2A 3EA6A 4DAYB 2C9OA 3DLLA 4K2KA 1SMXA 4ZUJA 5LMNQ 4QUCA 1X3EA 4UPAA 5IYBG 3S1NH 3PO3G 1H9JA 5HURA 1Y8OB 3DWPA 1IYVA 4FXGC 4A3EB 5FK9C 3DM1A 5C0XH 4IJHA 5J39A 2J7ZA 2SDFA 4UP7A 1PRTC 1TQOA 3U9OA 3IFDA 1HFNA 1A3UA 2R92B 2F0DA 4DV2L 4O1NA 3A8IE 3Q8DA 3URYA 2HCCA 2EQSA 1VQKA 4AQYL 2V4DA 3H94A 4A3JH 1L0XB 4NXMQ 3CCUA 1BO0A 3AMUA 4KK7A 5A35A 3J7YW 1C0AA 1AFPA 5IP9H 3PUXA 1DONA 2B8GA 1K0SA 1VQGA 4K14A 4OX9Q 2B2UA 5H1SE 5IT9c 4X65Q 4BY7G 5GROA 5ELNA 1PYBA 3SGIA 4DXFA 4JI6L 1LTAD 1M1KC 4C1NI 1CKMA 3J80L 1B7YB 3K8AA 1YHBA 2R93G 2PI2A 1K8MA 1TWHB 4RGNA 2DN8A 3ITPA 3D4RA 1EY7A 5CR3A 3K59A 4C3HB 1ASZA 4K5WA 4EQNA 4A3IG 3NEMA 1X3PA 3HOYB 1MBYA 1PVOA 4FDBA 2DY7A 2KBNA 1HR0W 4ID6A 4X62L 4LWCA 2F0VA 3RZOB 3EN2A 2R7ZB 4WORA 1TWAB 5ISRA 3TP6A 3NXWA 1VQLA 2ZTEA 2JA7B 1A2TA 5C4XB 3FVQA 4JI2L 2YU9B 5IY0A 1JJCB 1VQHA 1X32A 2NZOA 2HHHQ 1M8AA 1SFOH 1OO9B 4IUNA 2F0OA 2E2JB 2N88A 4RHSA 3FMCA 1SNMA 4DK1A 4JI8L 3K58A 4NPSA 1DM0B 1HUMA 1PH9A 1A3TA 4FVMA 2CH4W 4JBJA 1VQAA 2NVTH 1E2ZA 1D5ZC 4LNQA 1Q90A 3GTJH 1MHWC 4X3KA 3N6RA 2MUYA 1NTGA 3C46A 1STHA 4IURA 1YHAA 5M3FH 4C3HG 3BYYB 1MI2A 1S5FD 4JYAL 3OIQA 2O2LD 5CMDA 1ILQA 2F0UA 3AQQA 1EYCA 3OWFA 3T1HL 2LS01 1VQOA 5KIXA 3IRBA 2ENBA 4JC0A 4OO1H 1HNZL 1Q3LA 2UXBQ 2NTTA 3MXUA 2ES2A 2QDLA 4L6TB 1EYDA 4PNYA 5LMUL 2AQ2B 3T4AC 1WYDA 1QJOA 1QZHA 1WCMB 3SVMA 1K3BC 3MEFA 3DXJC 3NSWA 2PZUA 1YIJA 3NBHA 5EQ0A 2K5VA 3KYHC 5K36G 1L1OC 5JOBA 4HTHA 3EFXD 2PQEA 1U4MA 4RMFA 5JPMC 1L0WA 2X6LA 4LF9Q 3J7ZC 3V2TA 1EQQA 3MC0B 5C44H 5C3XA 1V9PA 1ESFA 5C3EG 5CC4A 3R93A 3OW7A 1F9QA 2XTIA 5IODA 4LFAL 3U9SA 2R7DA 1FD7D 4LFCL 1KIXA 5JJZA 3I4NB 2I07B 4EQPA 1TWCB 2EYLA 4HMIA 1CZGA 4KMUC 3MFYA 2NVXH 2QGQA 3VA7A 2BDOA 4NXNL 3LX0A 2PQAA 1IBKQ 5DNFA 4R4CA 1B3AA 3HOWB 4B3TL 3L7ZC 4JI7L 4P75A 4LF5L 1R9TB 1WTHA 3I90A 1NMGA 4BS9A 2UUCQ 1G91A 1MSHA 1Q1EA 1LTBD 1UE6A 4IPDA 4DV4L 1LT5D 1LTSD 2G5DA 1YI2A 1SN8A 3OIPA 4F88A 2RSNA 4EX5A 1IKLA 5KYLA 3SK6A 4EGVA 3S17B 3AB9A 5E1FA 3HEJA 5M5XB 3I4MB 2K33A 4JK1C 1JOKA 4P73A 4UHVA 3FPUB 2BE5C 3DEPA 3C1EA 3I70A 4Z9CB 4QIWE 2OCEA 1I4RA 1KDAA 4KJOA 2RCNA 1HPCA 3N52A 4H44C 3FPPA 1UUPA 4A3FB 5JEAG 3WWVA 5FJ8G 4DR2Q 3KF8A 5M3MG 3S16B 2JA6B 1BQQT 3I4NG 1TS3A 1ET6A 4IN3A 1IXRA 1VQDA 4DR5L 4RWSC 2O5IC 4XQQA 3A8KE 1H9RA 5E7NA 4ZAIA 3MHBA 4APVA 2FMMA 3J7AF 3SXHA 4A3DG 4IFDJ 1Q46A 4PMCA 3S15H 3VR3A 3S2DB 3HOUB 3QJYA 1AH9A 3PIO3 1Y1WG 2MGSA 1WTQA 4JI1Q 2EJMA 1BNZA 4RA8A 2F3WA 3H3VC 1EY4A 1I3QH 1RTOA 3F1ZA 4BBRG 1LT6D 5KYIA 2L11A 4IPHA 4IPCA 4XYOA 2E2DC 2I0QA 2LSSA 4JI0L 4TSSA 1RF2D 4A75A 4X3TA 4A93H 1VQ9A 2JA8B 1D1IA 4CDFC 2WP8J 3J80E 3C2PA 5E4WC 1B8AA 4CDCC 3MZ5A 2SOBA 3W1BA 1QILA
chains in the Genus database with same CATH topology
5J3BA 5GAGC 3JAMc 2R6GA 5GADC 4DV1Q 3HOUH 3S2DH 4OO1I 2WAQG 3F2BA 2F4VL 1KL9A 3GTMH 2JA6G 2L15A 4JOIA 4DV3L 4LFBL 4A93G 4A3KG 3J81c 4JI5Q 4KHZA 3GTLH 1JJGA 4GN5A 1LM0A 4YHHL 4HIKA 1GVPA 1NY4A 3W5OA 2ZM6L 3CCLA 4BBSG 2KHIA 1JE5A 3I2ZA 4AYBG 4IO9A 3ULPA 1JB7A 1E7ZA 2LXJA 2KHJA 1HNXL 4UP8A 3JAMi 2Q2TA 2BH8A 2F4VQ 3CW2C 1CSPA 4DV3Q 4LFBQ 5C0XG 1VQIA 3G4SA 4GNXC 1W2BA 1Q82C 2ASBA 2UXCL 3TS0A 1Q81C 3CD6A 3TRZA 4YHHQ 4L5RC 2ZM6Q 1EIFA 2D0PA 1HR0L 1CUKA 1RL2A 1BKBA 4GN3B 2N3SA 4UP9A 3J81i 4A3CG 2UXDL 1HNXQ 1KQSA 2JA8H 2MFIA 1OXUA 2QA4A 3RLNA 1X55A 1TWFH 5GAHC 1N33L 4A3JG 1AE3A 4DK6C 4HJAA 2YTYA 4A3LG 3K80C 1PH8A 1XMOL 4DR4L 4LW1A 3UDFA 1HR0Q 2ZJQA 4L5SA 3PF4A 1FGUA 4K0KL 2UXDQ 3CC2A 2AHOB 3NBHB 2NVQH 5IP9G 2Z0SA 3BZCA 3CQZH 1SE8A 1I94L 1GO3E 1IBLL 4GKKL 1N33Q 2UU9L 4R4IA 3J80c 4PG3A 2GN5A 5FJ8H 4JI4L 5JJLA 1K8AC 1YJNA 1XMOQ 3S14H 4DR4Q 1K83H 1Y1VH 2WB1G 4JI3L 1QZGA 4LF8L 4K0KQ 5GAEC 1C9OA 4KI0A 4IOCA 4PMWA 5M5YH 1X3FA 4A3BH 5AJ3L 1OTCA 3TQYA 1VQ8A 1KRSA 1VCIA 4ME3A 5IE8A 3CCVA 5IYDG 3FHWA 1X9NA 1I94Q 1IBLQ 4GKKQ 4C2MH 4IFDG 3PIOA 3FKIH 4DK3C 2UU9Q 3H15A 3F2DA 4A3EG 3RR5A 2KCMA 4JI4Q 4JI3Q 4LF8Q 3J80i 2Y0SG 2R92G 3ICEA 3H0GH 2F3IA 2PNHA 1K9MC 1FVIA 5AJ3Q 1WJJA 1VQ7A 1IL2A 4A3DH 1JJ2A 2YTVA 2ID0A 4GLXA 1XPUA 4JG2A 1D8LA 1Y1VG 4KHPL 1Y1WH 3AYHB 4OWTB 1P16A 2UUBL 1DGSA 3KDFB 2JEAI 4X62Q 1HZAA 2BH2A 3BU2A 2A8VA 3F2CA 1XMQL 1OXTA 2OQ0A 4BBRH 4JV5L 2IX1A 4GS3A 1NJIC 2N49A 2JJQA 4B3ML 1KRTA 2PQAB 1K3RA 4KHPQ 5EAYA 4DR7L 1QVCA 2UUBQ 2Z6KC 1UE7A 3CXCA 3AEVA 1YJWA 2ZJRA 4C3JH 2JQOA 4IJLA 2DUDA 1X3GA 3J81j 4DR6L 1XMQQ 1VS0A 3KJPA 3M9BA 1WFQA 3GTPH 2Q2UA 1M90C 2VNUD 2BA0A 4JV5Q 2K50A 3AFQA 2NN6I 4GOPA 3CPWA 3GTKH 1IYJB 4B3MQ 4DR7Q 3H3VI 1D7QA 1B70B 3RNUA 2ATWA 5IYBH 1SRUA 2NZHA 3PUYA 1EOVA 4DR6Q 1O7IA 3D0FA 2Q2HA 3OYYA 3RN2A 2I5LX 2RHQB 1U0LA 3G48A 1Q8KA 4R1JA 3CC4A 2R7ZH 3M4OH 3STBD 2CCZA 2H5XA 5LMNL 1Q86C 1KC8C 4LUVA 3CCRA 2VUMG 4P72A 4QY7A 1OXXK 3A5ZB 3J7A5 4DV6L 3L2PA 2AWNA 2WFWA 1LYLA 1K73C 5JJIA 1CSQA 2K5NA 2PMZE 1A8VA 2K75A 4DV5L 3S1RH 4X6AH 5FLXc 3HOYG 4A3KH 4WJ3M 3GDEA 4DAYB 1QVGA 1X56A 1YEZA 3U4ZA 3DLLA 1SMXA 5LMNQ 1HZBA 1X3EA 4UPAA 5IYBG 3S1NH 4BBSH 3CMAA 3PO3G 5JJKA 4DV6Q 4XIGS 4P71A 1VQEA 3TEHB 4DR3L 4DV5Q 2VS1A 4AH6A 1PHJA 2R7ZG 4PZ6A 4IJHA 3KF8B 3I56A 3CAMA 2IX0A 3PUVA 4UP7A 3M85A 5M3FG 4NXML 2MO1A 3BJUA 2IY5B 4R4OA 1UE5A 2JA7G 4DV2L 5C4XG 1HNZQ 4A3CH 3Q8DA 4GLVB 1S3OA 1PH1A 4DR3Q 2EQSA 5ELOA 1L1OA 3HOXH 2YTXA 1CKNA 5LMUQ 4GKJL 2VZAA 2A19A 1VQKA 2IHFA 3CP0A 4JCVE 4AQYL 3HKZG 4A3JH 4OX9L 4NXMQ 1BVSA 4OO1G 1VQ6A 3CCUA 2E2HH 4A3LH 3E9IA 3E0EA 1XTDA 4X65L 1MKHA 4DV2Q 1FJGL 2I5MX 3A0JA 4L5TA 4TVAB 3G6EA 2B63H 1JT8A 3CCMA 2BA1A 1EFWA 1C0AA 5IP9H 3PUXA 4GKJQ 1UE1A 4HJ5A 4QJFA 4AQYQ 2JE6I 1KHIA 1VQGA 4OX9Q 5H1SE 1E24A 3GO5A 5IT9c 3UDIA 3K81C 4X65Q 4BY7G 5GROA 5ELNA 4L5QA 1PYBA 3SGIA 3HOXG 4A3IH 1FJGQ 4JI6L 1N34L 1M1KC 1X6OA 3K7AH 2MO0A 3RLFA 1YHQA 5IYDH 2KENA 1CKMA 2JEBI 1B7YB 1HZCA 3K8AA 1YHBA 2GVBA 2PI2A 4A3EH 1XNQL 4BA2I 2R93G 1EIYB 1N32L 2A1AA 4GNXA 2B63G 4Y52H 1ASYA 5IYCG 5C44G 1J6QA 2NVYH 1P8LA 4BXXH 4JI6Q 3CCSA 1PH7A 2R92H 2VW9A 1N34Q 1XJVA 1H95A 5BR8L 4JBMA 1I6HH 1ASZA 2UUAL 1YBYA 5IP7H 4A3MH 2AKWB 1XNQQ 1MJCA 1XPRA 2E2IH 4A3IG 3NEMA 2N78A 1N32Q 1YZ6A 1QUQA 2K52A 4X66L 3HOVG 1S72A 3GD7A 4C3IH 1PVOA 1EWIA 5BR8Q 4FDBA 2KBNA 2UUAQ 2VQFL 1WCMG 1HR0W 4X62L 4BXXG 4LWCA 4LF4L 3EN2A 2HHHL 3KF6A 1N36L 1HZ9A 2JK8A 3TREA 4X66Q 1Z9FA 5IP7G 4A3MG 1VQLA 2HIVA 3PO2G 3T1YL 2ZTEA 1PH5A 1EUJA 2HQLA 2VQFQ 3RZDH 2K14A 4JI2L 1NBWA 1K8GA 4LF4Q 3ZJYC 5IY0A 1JJCB 1VQHA 2B29A 2NZOA 2WAQE 4QGUA 2HHHQ 1N36Q 3GTOH 5HGQA 1Q1BA 2LXKA 1SFOH 1KD1C 2PI2E 2VQEL 1TWHH 3OW2A 1BBUA 1YITA 3T1YQ 4YCUA 4A3GH 1Y14B 4HJ8A 2VUMH 4GLAC 4JI2Q 4JI8L 3U50C 3G71A 4H02A 4NPSA 4C3HH 4AYBE 1PH9A 4QQBX 3S1QH 4JBJA 1Q12A 4BY1H 2VQEQ 1VQAA 2NVTH 3UE0A 1IBML 3HOYH 1OXSC 3M3YH 1E3PA 3U4VA 4LNQA 4LUZA 3HOZH 2OTLA 4JI8Q 3GTJH 4JBKA 3MXNB 3PO3H 2CQOA 1E1TA 2NN6G 1NTGA 3RZOH 3GTGH 4A3GG 2Z6KA 1V1QA 1IBMQ 3STBC 1TWAH 4DR1L 1VQCA 1YHAA 5M3FH 1L2FA 3HOWG 3A5UA 2JA5H 2CFMA 2JA7H 5C4XH 2B3GA 4BY1G 3RN5A 1HJPA 4JYAL 3M4PA 1T9HA 3M4QA 1NE3A 5IWAL 5FLMG 3CCJA 2YU9H 4UY8C 3AQQA 4XTCS 1CKOA 3T1HL 3HOZG 5JEAJ 1VQOA 1VQNA 4DR1Q 1XPOA 4GN4B 3IRBA 4JC0A 4HJ7A 4DAMA 3A74A 3UDGA 1HNZL 2FXQA 3KLWA 2E2JH 4O0AA 3M7NA 2WB1E 2VL6A 3KJOA 2ES2A 4HIOA 1I50H 1PH6A 2UXBQ 4LUOA 4JYAQ 5LMUL 4OWXB 1Z47A 1VQ5A 2OTJA 4YCWA 1WYDA 5IWAQ 2CWAA 2R7FA 1G291 1QZHA 2D62A 3MEFA 3T1HQ 1UWVA 4LF7L 1VQFA 1G51A 4YWMA 2JA5G 1A0IA 1YIJA 3I4MG 2GVAA 3LGJA 3PUWA 1E1OA 1UEBA 3NENA 2V1CC 4RG1A 1OXVA 1VQ4A 4LF9L 3S16H 1K0RA 4IPGA 4JOIC 4BY7H 2K5VA 2XGTA 3KYHC 4HIDA 5K36G 1L1OC 2Y0SE 3VDYA 3ULLA 1PH3A 2ALYB 5LMNW 1YNXA 4RMFA 4LF7Q 3TS2A 1L0WA 4POFA 2R93H 4LF9Q 3PUZA 3J7ZC 4A3FG 1EQQA 1C7YA 5IYCH 5C44H 4GOPB 4YWKA 1V9PA 2ZJPA 3UE1A 5C3EG 4O2DA 1WI5A 3NELA 4BA1I 2XTIA 2YYZA 5DLQE 1TXYA 1LTLA 4LFAL 5C0XI 1YJ9A 1YVCA 2R7DA 4LFCL 1KIXA 2RF4A 4X64L 5C4JH 1VQMA 1MJEA 3HOVH 3ERSX 1IBKL 2N8NA 4IOAA 3B6YA 4DNIA 3F8TA 1J5EL 1EQRA 3KDFA 1WCMH 4OWWB 3JC66 1XNRL 3S1MH 4LFAQ 2AMCB 4DV0L 4B3SL 2UUCL 1PH4A 3HOUG 2C35B 1W3SA 2IT1A 2QGQA 2NVXH 4R4TA 4NXNL 4X64Q 4LFCQ 3E9HA 2D0OA 4HJ9A 2PQAA 1IBKQ 4R4CA 2HT1A 3PO2H 5GQOA 1SLJA 4B3TL 3L7ZC 4JI7L 4P75A 4YWLA 1RIPA 3OTOL 3EBEA 1J5EQ 4LF5L 4AIMA 3I7FA 4ALPA 1XNRQ 4Y7NH 3PSIA 4LF6L 1PYSB 1X65A 4DV0Q 4B3SQ 1NMGA 2UXCQ 1VQBA 1HNWL 5HY6A 2UUCQ 1E22A 4A76A 1Q1EA 1UE6A 2F52A 3I4OA 4MTNA 4NXNQ 2EXDA 1AE2A 4IPDA 4NB3A 2OQKA 4DV4L 4PZ7A 4B3TQ 4JI7Q 3OTOQ 1YI2A 4LF5Q 4J15A 1JMCA 1SN8A 3U58A 1L1OB 4DUYL 1PH2A 1CKNB 4LF6Q 4EX5A 1QVFA 4IFDI 3L0OA 2ZTCA 1HNWQ 1U5KA 2MQHA 2JA8G 4JBWA 5C0XJ 1PV4A 5M3MH 4DKAC 3PF5A 4DV4Q 1N9WA 2ZTDA 4P73A 2OWOA 3I4NH 2K5HA 1TWCH 4DUYQ 4DR2L 3KOJA 1S40A 4QIWE 1KXLA 2OCEA 2KCTA 3CF5A 2RCNA 2CKZB 4MNOA 1PA6A 1LUZA 3HKZE 2E8GA 3H3VH 1HH2P 4QL5A 1GKHA 1V43A 5JEAG 4DV7L 4HIMA 3HOWH 3WWVA 5FJ8G 4DR2Q 2I5HA 4B3RL 4OONA 1R9TH 1N8RC 4GOPC 5FLMH 5M3MG 4A3BG 1KAWA 3DM3A 3ULJA 3UDXA 3CCQA 2K4KA 1MIUA 4GNXB 4YY3L 3I4NG 3HKSA 4P74A 3CPFA 1Q7YC 4DV7Q 3FKIG 3RLOA 1IXRA 3BZKA 1VQDA 4DR5L 4PZ8A 4JI1L 4B3RQ 3KFUA 3W1GA 3K0XA 4R4QA 1WOCA 3CC7A 5E7NA 3H0GG 4APVA 2EIFA 5M5WH 2QEXA 4A3DG 2VY3A 3S17H 4IFDJ 3CCEA 2JA9A 1Q46A 1QUQB 1IZ6A 1SR3A 1FL0A 4YY3Q 5M5XH 2E5LL 3S15H 2CWPA 3I4MH 2UXBL 1AH9A 1Y1WG 4YCVA 3GTQH 4DR5Q 1A62A 1TWGH 1A63A 2IHEA 4JI1Q 1SROA 1I5FA 2AWOA 3D31A 4KLKA 2MNAA 2HIXA 1I3QH 3F1ZA 4BBRG 3KF6B 3EIVA 2E5LQ 4DUZL 4POGA 1PFSA 1BBWA 1EYGA 4TQUS 4A3FH 4IPHA 1NMFA 3HFZB 3CMEA 3AFPA 4IPCA 4MZ9A 1GD7A 5C3EH 1G6PA 4EQ5A 2LSSA 3I55A 2I0QA 2Q2IA 1X54A 2DGYA 2RHSB 4OXPA 4A75A 4JI0L 4DUZQ 3PCOB 2JA6H 1VQ9A 4A93H 1VQJA 3PGZA 3S2HH 4WJ4A 4DV1L 3S24A 4DPGA 3ER0A 2YV5A 4A4IA 2WP8J 3PIPA 3FP9A 3K7UC 1B8AA 1GM5A 1VQPA 3PV0A 4JI5L 3W1BA 4JI0Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3B A;  5GAG C;  3JAM c;  2R6G A;  5GAD C;  4DV1 Q;  3HOU H;  3S2D H;  4OO1 I;  2WAQ G;  3F2B A;  2F4V L;  1KL9 A;  3GTM H;  2JA6 G;  2L15 A;  4JOI A;  4DV3 L;  4LFB L;  4A93 G;  4A3K G;  3J81 c;  4JI5 Q;  4KHZ A;  3GTL H;  1JJG A;  4GN5 A;  1LM0 A;  4YHH L;  4HIK A;  1GVP A;  1NY4 A;  3W5O A;  2ZM6 L;  3CCL A;  4BBS G;  2KHI A;  1JE5 A;  3I2Z A;  4AYB G;  4IO9 A;  3ULP A;  1JB7 A;  1E7Z A;  2LXJ A;  2KHJ A;  1HNX L;  4UP8 A;  3JAM i;  2Q2T A;  2BH8 A;  2F4V Q;  3CW2 C;  1CSP A;  4DV3 Q;  4LFB Q;  5C0X G;  1VQI A;  3G4S A;  4GNX C;  1W2B A;  1Q82 C;  2ASB A;  2UXC L;  3TS0 A;  1Q81 C;  3CD6 A;  3TRZ A;  4YHH Q;  4L5R C;  2ZM6 Q;  1EIF A;  2D0P A;  1HR0 L;  1CUK A;  1RL2 A;  1BKB A;  4GN3 B;  2N3S A;  4UP9 A;  3J81 i;  4A3C G;  2UXD L;  1HNX Q;  1KQS A;  2JA8 H;  2MFI A;  1OXU A;  2QA4 A;  3RLN A;  1X55 A;  1TWF H;  5GAH C;  1N33 L;  4A3J G;  1AE3 A;  4DK6 C;  4HJA A;  2YTY A;  4A3L G;  3K80 C;  1PH8 A;  1XMO L;  4DR4 L;  4LW1 A;  3UDF A;  1HR0 Q;  2ZJQ A;  4L5S A;  3PF4 A;  1FGU A;  4K0K L;  2UXD Q;  3CC2 A;  2AHO B;  3NBH B;  2NVQ H;  5IP9 G;  2Z0S A;  3BZC A;  3CQZ H;  1SE8 A;  1I94 L;  1GO3 E;  1IBL L;  4GKK L;  1N33 Q;  2UU9 L;  4R4I A;  3J80 c;  4PG3 A;  2GN5 A;  5FJ8 H;  4JI4 L;  5JJL A;  1K8A C;  1YJN A;  1XMO Q;  3S14 H;  4DR4 Q;  1K83 H;  1Y1V H;  2WB1 G;  4JI3 L;  1QZG A;  4LF8 L;  4K0K Q;  5GAE C;  1C9O A;  4KI0 A;  4IOC A;  4PMW A;  5M5Y H;  1X3F A;  4A3B H;  5AJ3 L;  1OTC A;  3TQY A;  1VQ8 A;  1KRS A;  1VCI A;  4ME3 A;  5IE8 A;  3CCV A;  5IYD G;  3FHW A;  1X9N A;  1I94 Q;  1IBL Q;  4GKK Q;  4C2M H;  4IFD G;  3PIO A;  3FKI H;  4DK3 C;  2UU9 Q;  3H15 A;  3F2D A;  4A3E G;  3RR5 A;  2KCM A;  4JI4 Q;  4JI3 Q;  4LF8 Q;  3J80 i;  2Y0S G;  2R92 G;  3ICE A;  3H0G H;  2F3I A;  2PNH A;  1K9M C;  1FVI A;  5AJ3 Q;  1WJJ A;  1VQ7 A;  1IL2 A;  4A3D H;  1JJ2 A;  2YTV A;  2ID0 A;  4GLX A;  1XPU A;  4JG2 A;  1D8L A;  1Y1V G;  4KHP L;  1Y1W H;  3AYH B;  4OWT B;  1P16 A;  2UUB L;  1DGS A;  3KDF B;  2JEA I;  4X62 Q;  1HZA A;  2BH2 A;  3BU2 A;  2A8V A;  3F2C A;  1XMQ L;  1OXT A;  2OQ0 A;  4BBR H;  4JV5 L;  2IX1 A;  4GS3 A;  1NJI C;  2N49 A;  2JJQ A;  4B3M L;  1KRT A;  2PQA B;  1K3R A;  4KHP Q;  5EAY A;  4DR7 L;  1QVC A;  2UUB Q;  2Z6K C;  1UE7 A;  3CXC A;  3AEV A;  1YJW A;  2ZJR A;  4C3J H;  2JQO A;  4IJL A;  2DUD A;  1X3G A;  3J81 j;  4DR6 L;  1XMQ Q;  1VS0 A;  3KJP A;  3M9B A;  1WFQ A;  3GTP H;  2Q2U A;  1M90 C;  2VNU D;  2BA0 A;  4JV5 Q;  2K50 A;  3AFQ A;  2NN6 I;  4GOP A;  3CPW A;  3GTK H;  1IYJ B;  4B3M Q;  4DR7 Q;  3H3V I;  1D7Q A;  1B70 B;  3RNU A;  2ATW A;  5IYB H;  1SRU A;  2NZH A;  3PUY A;  1EOV A;  4DR6 Q;  1O7I A;  3D0F A;  2Q2H A;  3OYY A;  3RN2 A;  2I5L X;  2RHQ B;  1U0L A;  3G48 A;  1Q8K A;  4R1J A;  3CC4 A;  2R7Z H;  3M4O H;  3STB D;  2CCZ A;  2H5X A;  5LMN L;  1Q86 C;  1KC8 C;  4LUV A;  3CCR A;  2VUM G;  4P72 A;  4QY7 A;  1OXX K;  3A5Z B;  3J7A 5;  4DV6 L;  3L2P A;  2AWN A;  2WFW A;  1LYL A;  1K73 C;  5JJI A;  1CSQ A;  2K5N A;  2PMZ E;  1A8V A;  2K75 A;  4DV5 L;  3S1R H;  4X6A H;  5FLX c;  3HOY G;  4A3K H;  4WJ3 M;  3GDE A;  4DAY B;  1QVG A;  1X56 A;  1YEZ A;  3U4Z A;  3DLL A;  1SMX A;  5LMN Q;  1HZB A;  1X3E A;  4UPA A;  5IYB G;  3S1N H;  4BBS H;  3CMA A;  3PO3 G;  5JJK A;  4DV6 Q;  4XIG S;  4P71 A;  1VQE A;  3TEH B;  4DR3 L;  4DV5 Q;  2VS1 A;  4AH6 A;  1PHJ A;  2R7Z G;  4PZ6 A;  4IJH A;  3KF8 B;  3I56 A;  3CAM A;  2IX0 A;  3PUV A;  4UP7 A;  3M85 A;  5M3F G;  4NXM L;  2MO1 A;  3BJU A;  2IY5 B;  4R4O A;  1UE5 A;  2JA7 G;  4DV2 L;  5C4X G;  1HNZ Q;  4A3C H;  3Q8D A;  4GLV B;  1S3O A;  1PH1 A;  4DR3 Q;  2EQS A;  5ELO A;  1L1O A;  3HOX H;  2YTX A;  1CKN A;  5LMU Q;  4GKJ L;  2VZA A;  2A19 A;  1VQK A;  2IHF A;  3CP0 A;  4JCV E;  4AQY L;  3HKZ G;  4A3J H;  4OX9 L;  4NXM Q;  1BVS A;  4OO1 G;  1VQ6 A;  3CCU A;  2E2H H;  4A3L H;  3E9I A;  3E0E A;  1XTD A;  4X65 L;  1MKH A;  4DV2 Q;  1FJG L;  2I5M X;  3A0J A;  4L5T A;  4TVA B;  3G6E A;  2B63 H;  1JT8 A;  3CCM A;  2BA1 A;  1EFW A;  1C0A A;  5IP9 H;  3PUX A;  4GKJ Q;  1UE1 A;  4HJ5 A;  4QJF A;  4AQY Q;  2JE6 I;  1KHI A;  1VQG A;  4OX9 Q;  5H1S E;  1E24 A;  3GO5 A;  5IT9 c;  3UDI A;  3K81 C;  4X65 Q;  4BY7 G;  5GRO A;  5ELN A;  4L5Q A;  1PYB A;  3SGI A;  3HOX G;  4A3I H;  1FJG Q;  4JI6 L;  1N34 L;  1M1K C;  1X6O A;  3K7A H;  2MO0 A;  3RLF A;  1YHQ A;  5IYD H;  2KEN A;  1CKM A;  2JEB I;  1B7Y B;  1HZC A;  3K8A A;  1YHB A;  2GVB A;  2PI2 A;  4A3E H;  1XNQ L;  4BA2 I;  2R93 G;  1EIY B;  1N32 L;  2A1A A;  4GNX A;  2B63 G;  4Y52 H;  1ASY A;  5IYC G;  5C44 G;  1J6Q A;  2NVY H;  1P8L A;  4BXX H;  4JI6 Q;  3CCS A;  1PH7 A;  2R92 H;  2VW9 A;  1N34 Q;  1XJV A;  1H95 A;  5BR8 L;  4JBM A;  1I6H H;  1ASZ A;  2UUA L;  1YBY A;  5IP7 H;  4A3M H;  2AKW B;  1XNQ Q;  1MJC A;  1XPR A;  2E2I H;  4A3I G;  3NEM A;  2N78 A;  1N32 Q;  1YZ6 A;  1QUQ A;  2K52 A;  4X66 L;  3HOV G;  1S72 A;  3GD7 A;  4C3I H;  1PVO A;  1EWI A;  5BR8 Q;  4FDB A;  2KBN A;  2UUA Q;  2VQF L;  1WCM G;  1HR0 W;  4X62 L;  4BXX G;  4LWC A;  4LF4 L;  3EN2 A;  2HHH L;  3KF6 A;  1N36 L;  1HZ9 A;  2JK8 A;  3TRE A;  4X66 Q;  1Z9F A;  5IP7 G;  4A3M G;  1VQL A;  2HIV A;  3PO2 G;  3T1Y L;  2ZTE A;  1PH5 A;  1EUJ A;  2HQL A;  2VQF Q;  3RZD H;  2K14 A;  4JI2 L;  1NBW A;  1K8G A;  4LF4 Q;  3ZJY C;  5IY0 A;  1JJC B;  1VQH A;  2B29 A;  2NZO A;  2WAQ E;  4QGU A;  2HHH Q;  1N36 Q;  3GTO H;  5HGQ A;  1Q1B A;  2LXK A;  1SFO H;  1KD1 C;  2PI2 E;  2VQE L;  1TWH H;  3OW2 A;  1BBU A;  1YIT A;  3T1Y Q;  4YCU A;  4A3G H;  1Y14 B;  4HJ8 A;  2VUM H;  4GLA C;  4JI2 Q;  4JI8 L;  3U50 C;  3G71 A;  4H02 A;  4NPS A;  4C3H H;  4AYB E;  1PH9 A;  4QQB X;  3S1Q H;  4JBJ A;  1Q12 A;  4BY1 H;  2VQE Q;  1VQA A;  2NVT H;  3UE0 A;  1IBM L;  3HOY H;  1OXS C;  3M3Y H;  1E3P A;  3U4V A;  4LNQ A;  4LUZ A;  3HOZ H;  2OTL A;  4JI8 Q;  3GTJ H;  4JBK A;  3MXN B;  3PO3 H;  2CQO A;  1E1T A;  2NN6 G;  1NTG A;  3RZO H;  3GTG H;  4A3G G;  2Z6K A;  1V1Q A;  1IBM Q;  3STB C;  1TWA H;  4DR1 L;  1VQC A;  1YHA A;  5M3F H;  1L2F A;  3HOW G;  3A5U A;  2JA5 H;  2CFM A;  2JA7 H;  5C4X H;  2B3G A;  4BY1 G;  3RN5 A;  1HJP A;  4JYA L;  3M4P A;  1T9H A;  3M4Q A;  1NE3 A;  5IWA L;  5FLM G;  3CCJ A;  2YU9 H;  4UY8 C;  3AQQ A;  4XTC S;  1CKO A;  3T1H L;  3HOZ G;  5JEA J;  1VQO A;  1VQN A;  4DR1 Q;  1XPO A;  4GN4 B;  3IRB A;  4JC0 A;  4HJ7 A;  4DAM A;  3A74 A;  3UDG A;  1HNZ L;  2FXQ A;  3KLW A;  2E2J H;  4O0A A;  3M7N A;  2WB1 E;  2VL6 A;  3KJO A;  2ES2 A;  4HIO A;  1I50 H;  1PH6 A;  2UXB Q;  4LUO A;  4JYA Q;  5LMU L;  4OWX B;  1Z47 A;  1VQ5 A;  2OTJ A;  4YCW A;  1WYD A;  5IWA Q;  2CWA A;  2R7F A;  1G29 1;  1QZH A;  2D62 A;  3MEF A;  3T1H Q;  1UWV A;  4LF7 L;  1VQF A;  1G51 A;  4YWM A;  2JA5 G;  1A0I A;  1YIJ A;  3I4M G;  2GVA A;  3LGJ A;  3PUW A;  1E1O A;  1UEB A;  3NEN A;  2V1C C;  4RG1 A;  1OXV A;  1VQ4 A;  4LF9 L;  3S16 H;  1K0R A;  4IPG A;  4JOI C;  4BY7 H;  2K5V A;  2XGT A;  3KYH C;  4HID A;  5K36 G;  1L1O C;  2Y0S E;  3VDY A;  3ULL A;  1PH3 A;  2ALY B;  5LMN W;  1YNX A;  4RMF A;  4LF7 Q;  3TS2 A;  1L0W A;  4POF A;  2R93 H;  4LF9 Q;  3PUZ A;  3J7Z C;  4A3F G;  1EQQ A;  1C7Y A;  5IYC H;  5C44 H;  4GOP B;  4YWK A;  1V9P A;  2ZJP A;  3UE1 A;  5C3E G;  4O2D A;  1WI5 A;  3NEL A;  4BA1 I;  2XTI A;  2YYZ A;  5DLQ E;  1TXY A;  1LTL A;  4LFA L;  5C0X I;  1YJ9 A;  1YVC A;  2R7D A;  4LFC L;  1KIX A;  2RF4 A;  4X64 L;  5C4J H;  1VQM A;  1MJE A;  3HOV H;  3ERS X;  1IBK L;  2N8N A;  4IOA A;  3B6Y A;  4DNI A;  3F8T A;  1J5E L;  1EQR A;  3KDF A;  1WCM H;  4OWW B;  3JC6 6;  1XNR L;  3S1M H;  4LFA Q;  2AMC B;  4DV0 L;  4B3S L;  2UUC L;  1PH4 A;  3HOU G;  2C35 B;  1W3S A;  2IT1 A;  2QGQ A;  2NVX H;  4R4T A;  4NXN L;  4X64 Q;  4LFC Q;  3E9H A;  2D0O A;  4HJ9 A;  2PQA A;  1IBK Q;  4R4C A;  2HT1 A;  3PO2 H;  5GQO A;  1SLJ A;  4B3T L;  3L7Z C;  4JI7 L;  4P75 A;  4YWL A;  1RIP A;  3OTO L;  3EBE A;  1J5E Q;  4LF5 L;  4AIM A;  3I7F A;  4ALP A;  1XNR Q;  4Y7N H;  3PSI A;  4LF6 L;  1PYS B;  1X65 A;  4DV0 Q;  4B3S Q;  1NMG A;  2UXC Q;  1VQB A;  1HNW L;  5HY6 A;  2UUC Q;  1E22 A;  4A76 A;  1Q1E A;  1UE6 A;  2F52 A;  3I4O A;  4MTN A;  4NXN Q;  2EXD A;  1AE2 A;  4IPD A;  4NB3 A;  2OQK A;  4DV4 L;  4PZ7 A;  4B3T Q;  4JI7 Q;  3OTO Q;  1YI2 A;  4LF5 Q;  4J15 A;  1JMC A;  1SN8 A;  3U58 A;  1L1O B;  4DUY L;  1PH2 A;  1CKN B;  4LF6 Q;  4EX5 A;  1QVF A;  4IFD I;  3L0O A;  2ZTC A;  1HNW Q;  1U5K A;  2MQH A;  2JA8 G;  4JBW A;  5C0X J;  1PV4 A;  5M3M H;  4DKA C;  3PF5 A;  4DV4 Q;  1N9W A;  2ZTD A;  4P73 A;  2OWO A;  3I4N H;  2K5H A;  1TWC H;  4DUY Q;  4DR2 L;  3KOJ A;  1S40 A;  4QIW E;  1KXL A;  2OCE A;  2KCT A;  3CF5 A;  2RCN A;  2CKZ B;  4MNO A;  1PA6 A;  1LUZ A;  3HKZ E;  2E8G A;  3H3V H;  1HH2 P;  4QL5 A;  1GKH A;  1V43 A;  5JEA G;  4DV7 L;  4HIM A;  3HOW H;  3WWV A;  5FJ8 G;  4DR2 Q;  2I5H A;  4B3R L;  4OON A;  1R9T H;  1N8R C;  4GOP C;  5FLM H;  5M3M G;  4A3B G;  1KAW A;  3DM3 A;  3ULJ A;  3UDX A;  3CCQ A;  2K4K A;  1MIU A;  4GNX B;  4YY3 L;  3I4N G;  3HKS A;  4P74 A;  3CPF A;  1Q7Y C;  4DV7 Q;  3FKI G;  3RLO A;  1IXR A;  3BZK A;  1VQD A;  4DR5 L;  4PZ8 A;  4JI1 L;  4B3R Q;  3KFU A;  3W1G A;  3K0X A;  4R4Q A;  1WOC A;  3CC7 A;  5E7N A;  3H0G G;  4APV A;  2EIF A;  5M5W H;  2QEX A;  4A3D G;  2VY3 A;  3S17 H;  4IFD J;  3CCE A;  2JA9 A;  1Q46 A;  1QUQ B;  1IZ6 A;  1SR3 A;  1FL0 A;  4YY3 Q;  5M5X H;  2E5L L;  3S15 H;  2CWP A;  3I4M H;  2UXB L;  1AH9 A;  1Y1W G;  4YCV A;  3GTQ H;  4DR5 Q;  1A62 A;  1TWG H;  1A63 A;  2IHE A;  4JI1 Q;  1SRO A;  1I5F A;  2AWO A;  3D31 A;  4KLK A;  2MNA A;  2HIX A;  1I3Q H;  3F1Z A;  4BBR G;  3KF6 B;  3EIV A;  2E5L Q;  4DUZ L;  4POG A;  1PFS A;  1BBW A;  1EYG A;  4TQU S;  4A3F H;  4IPH A;  1NMF A;  3HFZ B;  3CME A;  3AFP A;  4IPC A;  4MZ9 A;  1GD7 A;  5C3E H;  1G6P A;  4EQ5 A;  2LSS A;  3I55 A;  2I0Q A;  2Q2I A;  1X54 A;  2DGY A;  2RHS B;  4OXP A;  4A75 A;  4JI0 L;  4DUZ Q;  3PCO B;  2JA6 H;  1VQ9 A;  4A93 H;  1VQJ A;  3PGZ A;  3S2H H;  4WJ4 A;  4DV1 L;  3S24 A;  4DPG A;  3ER0 A;  2YV5 A;  4A4I A;  2WP8 J;  3PIP A;  3FP9 A;  3K7U C;  1B8A A;  1GM5 A;  1VQP A;  3PV0 A;  4JI5 L;  3W1B A;  4JI0 Q; 
#chains in the Genus database with same CATH topology
 1A2U A;  1D5M C;  5J3B A;  5L37 A;  3G6J B;  5D3I B;  1BXT A;  4FF2 A;  2JA6 G;  2L15 A;  1NCV A;  4LFB L;  1CT1 D;  1Y1V B;  5EBC A;  2RQX A;  2RDG A;  2XSC A;  3R2T A;  4KHZ A;  3VR6 A;  1LM0 A;  4JI5 Q;  3GTL H;  1GVP A;  1LTR D;  1NY4 A;  3W5O A;  5CBE E;  2ZM6 L;  1ET9 A;  2F0S A;  2NYZ D;  4HAE A;  4A3B B;  1WTO A;  1HTP A;  2D9U A;  5I9O A;  3ULP A;  2F4V Q;  1B9N A;  2FFK B;  1EY5 A;  5C0X G;  4GNX C;  2AUK A;  2EY6 A;  1Q82 C;  1A6X A;  3NQI A;  3CD6 A;  4L5R C;  4UP9 A;  2F1M A;  2A6H C;  1OXU A;  4OEM B;  2KVM A;  5GAH C;  2NB0 A;  1N33 L;  2Z8L A;  1TY2 A;  4A3J G;  1AE3 A;  4DK6 C;  2YTY A;  3UDF A;  3NTI A;  2K1B A;  4RGT A;  1J8I A;  3NBH B;  2XIW A;  2PW5 A;  5IP9 G;  1IBL L;  3BZC A;  4OIK A;  3MXN A;  4KN4 C;  4R4I A;  3J80 c;  3IKJ A;  3SEB A;  5ELF A;  1K8A C;  5EPL A;  4DR4 Q;  1K83 H;  4JI3 L;  1QZG A;  4LF8 L;  4IOC A;  1C9O A;  2DNC A;  2IPK D;  4FF4 A;  5T1I A;  5AJ3 L;  1I4Q A;  1X9N A;  1NSN S;  3FHW A;  4GKK Q;  4C2M H;  5FLX E;  2FIN B;  4KN7 C;  3NHH A;  3H0G H;  2PNH A;  2EJF C;  4H0L C;  1EZ6 A;  1Y1V G;  4KHP L;  1F9R A;  2QEJ C;  3AYH B;  1DOL A;  2VB2 X;  2UUB L;  4NMZ A;  5C3W A;  1SMY C;  2JEA I;  4A3K B;  2CQA A;  3ERQ A;  1CK1 A;  1EY8 A;  3GV6 A;  1TY0 A;  1CA5 A;  1VDZ A;  3BYT B;  2IX1 A;  1LAC A;  2JJQ A;  1JB3 A;  2PQA B;  4DR7 L;  4KJN A;  2ZJR A;  4IJL A;  3T16 A;  4DR6 L;  2B2V C;  2Q2U A;  2BA0 A;  3Q22 A;  2K50 A;  3GTK H;  4JV5 Q;  2X6G A;  4B3M Q;  1B70 B;  5FO8 B;  2SNS A;  2NZH A;  4K6L A;  5CV4 A;  4ZQ3 A;  2Q2H A;  2RHQ B;  2R7Z H;  1T5X D;  1RKN A;  2H5X A;  5LMN L;  4LUV A;  1BBX C;  3DHQ A;  1Z7T A;  4RCN A;  2EOT A;  1SJE D;  2AWN A;  2EY1 A;  1K73 C;  2K5N A;  2K75 A;  5FLX c;  5IGC A;  4WJ3 M;  3I8Z A;  1U4L A;  1YEZ A;  3U4Z A;  5M5Y B;  2J0T D;  3M7G A;  4DV6 Q;  1VQE A;  3SDZ A;  2FHT A;  2E74 C;  4DV5 Q;  2VS1 A;  4AH6 A;  4PZ6 A;  1EWH A;  2A68 C;  3KF8 B;  4KD4 A;  1PRT D;  2IX0 A;  2PO4 A;  3PUV A;  5M3F G;  1CA6 A;  4NXM L;  1HA5 A;  2IY5 B;  2RDH A;  4R4O A;  5LL6 S;  3IAY A;  5ELO A;  5IOC A;  3HOX H;  2YTX A;  1CKN A;  2A19 A;  3HGB A;  2E2I B;  2EYF A;  1JWS D;  3CP0 A;  2DNE A;  4XT1 B;  5KND A;  4OX9 L;  4OO1 G;  1GUW A;  2E2H H;  4X65 L;  1R4Q B;  1MKH A;  1TS5 A;  4C3I B;  1A3V A;  1HTL D;  4L5T A;  4DA2 A;  2B63 H;  1JT8 A;  2BA1 A;  1JOO A;  1ROD A;  4GKJ Q;  1AN8 A;  5I2Y A;  3UDI A;  4I7A A;  3LWU A;  2K5Q A;  1X6O A;  3K7A H;  3H91 A;  1YHQ A;  2KEN A;  2JEB I;  2SEB D;  2GVB A;  4BA2 I;  4DN4 M;  5IGD A;  1EIY B;  2H4O A;  2A1A A;  3TME A;  4GNX A;  4Y52 H;  3QWN A;  5C44 G;  2NVY H;  5KEE A;  1WD1 A;  3CCS A;  2F4I A;  1PH7 A;  4DAP A;  4A3G B;  3J7A V;  4JBM A;  3LWE A;  1I6H H;  2VUM B;  5A2Q E;  2F0E A;  2L9H A;  3PMF A;  4A3M H;  1SYE A;  2K05 A;  3GTP B;  2N78 A;  3BS1 A;  2J4X A;  1QUQ A;  3MXG A;  4J8Q A;  2MPM A;  5BR8 Q;  3PO3 B;  1WTV A;  3QR8 A;  4BXX G;  1JCK B;  2A73 B;  2K6A A;  2HHH L;  1HZ9 A;  2JK8 A;  3TRE A;  1CZW A;  2L1B A;  5IP7 G;  2HIV A;  3CU7 A;  1EY9 A;  5G3L F;  2NBF A;  2VQF Q;  2EYO A;  2E76 C;  5DEH A;  1N36 Q;  3GTO H;  1Q1B A;  1KAB A;  4KHV A;  4DNR B;  3T1Y Q;  1Y14 B;  4HJ8 A;  3G71 A;  4H02 A;  2AQ1 B;  4QCL A;  4ME5 A;  4CDE C;  3KLS X;  4AYB E;  3CRL C;  4HCE A;  3S1Q H;  4QQB X;  2E75 C;  2F0F A;  4BY1 H;  3EQL C;  3M3Y H;  1OXS C;  4CHT B;  2KA7 A;  4BY7 B;  1F77 A;  3HOZ H;  3EVQ A;  2OTL A;  1CQF A;  1VF5 C;  3NP8 A;  3MXN B;  1BCP C;  2CQO A;  4R8N A;  1EIH A;  2NN6 G;  4C56 C;  4OEL B;  2R93 B;  3GTG H;  4A3G G;  1GJX A;  2B2V A;  1F2M A;  2JA5 H;  5KRU A;  3RN5 A;  2EZV A;  3M4Q A;  1T9H A;  1IHZ A;  4K5V A;  4K6D A;  4A3I B;  5JEA J;  2XNA C;  3S1M H;  2PPB C;  3UDG A;  1PTO H;  3OHX C;  4O0A A;  2VL6 A;  1RCV D;  1I50 H;  4HIO A;  5IGB A;  1S5E D;  5COY A;  4RFB A;  2L4N A;  2KEC A;  1SBB B;  4YWM A;  3PUW A;  1E1O A;  4LF9 L;  3VR5 A;  1OXV A;  3S16 H;  2XGT A;  4HMJ A;  4Y7N B;  1PH3 A;  2ALY B;  5LMN W;  1IW7 D;  4CGY B;  2EVB A;  3PUZ A;  3D6W A;  2KCC A;  2F0P A;  3UE1 A;  4XQJ A;  1WI5 A;  3K5O A;  1LT4 D;  1A15 A;  5DLQ E;  3VR2 A;  2IX3 A;  1E0B A;  1YJ9 A;  1B4O A;  1AZQ A;  1Y69 U;  4KKT A;  1YVC A;  2ZXO A;  5EKL A;  5C4J H;  3HOV H;  3T51 B;  1IBK L;  2HQE A;  3DWA A;  2JYO A;  4ZKC B;  4RKL A;  4IOA A;  3B6Y A;  4LK1 C;  5JPN C;  3BZD B;  4OWW B;  3V05 A;  2AMC B;  2UUC L;  2IT1 A;  1WTX A;  4R4T A;  4X64 Q;  1PZI D;  2XWB B;  3SK5 A;  3PO2 H;  1DOM A;  1F2L A;  5GQO A;  4FXK C;  4CKC A;  3EBE A;  4AIM A;  1CFM A;  4ALP A;  3PSI A;  2AUJ D;  1X65 A;  2K5D A;  2UXC Q;  1HHV A;  1ICF B;  1O7Y A;  4A76 A;  5CV6 A;  2F52 A;  1AE2 A;  3HP3 A;  4H13 C;  4CDD C;  3KBG A;  1JMC A;  1CKN B;  4LF6 Q;  1QVF A;  4IFD I;  2A69 D;  2ZTC A;  1HNW Q;  2MQH A;  4JBW A;  3VA5 A;  2LKV A;  3QG1 A;  5C0X J;  1PV4 A;  3PF5 A;  1QB5 D;  1SXT A;  1TWG B;  2ZTD A;  3KK7 A;  1EZ8 A;  2BE5 D;  1FYC A;  2K5H A;  3TP8 A;  4QB4 A;  4DUY Q;  4DR2 L;  5JVG 3;  3NTK A;  4ZCK A;  4JPB W;  4PQX A;  1LUZ A;  2E8G A;  4QL5 A;  4HIM A;  5C3E B;  2I5H A;  2WAQ B;  3KUP A;  1N8R C;  4MTK A;  2EYJ A;  5FLM H;  2OT2 A;  4GOP C;  1F2Z A;  3BDL A;  4GNX B;  2L5T A;  3HKS A;  3CPF A;  3BDC A;  4DV7 Q;  4O42 A;  1Q7Y C;  3BZK A;  4U67 3;  4DXG A;  4JI1 L;  1II3 A;  3J81 E;  1PXU A;  4R4Q A;  1TS2 A;  5FLX L;  4CKE A;  3H0G G;  5M5W H;  2QEX A;  2BOS A;  1QUQ B;  1IZ6 A;  1SE2 A;  2PNR C;  2CWP A;  3OWE B;  3GTQ H;  3GP7 A;  1A62 A;  4JVZ A;  1A63 A;  2IHE A;  4DNT B;  1G6Z A;  1SRO A;  3NWT A;  4KLK A;  1G2S A;  2MNA A;  1F2Y A;  3KLS A;  1PFS A;  1EYG A;  1HRJ A;  1TT2 A;  1JR0 D;  1SNO A;  4EQ5 A;  3I55 A;  1X54 A;  5NUC A;  5D3D A;  3PCO B;  1VQJ A;  3S2H H;  3S24 A;  3ER0 A;  2YV5 A;  3PIP A;  3FP9 A;  5E3F A;  3K7U C;  1IW7 C;  3PV0 A;  4R9W A;  4JI5 L;  3OMG A;  3Q24 A;  2CVR A;  2R6G A;  2NVQ B;  4NP5 A;  2KUM A;  3NPP A;  4XYQ A;  5GAD C;  3CQZ B;  2WAQ G;  1SYG A;  3ND9 A;  4CKB A;  3F2B A;  2F4V L;  1RTN A;  1H9M A;  1SYC A;  4FF3 A;  3S14 B;  2MP1 A;  1EFI D;  3J81 c;  3BVG A;  3P7J A;  1LAB A;  1JJG A;  4GN5 A;  4V19 0;  5M3M B;  1LLR D;  3KLR A;  2LXJ A;  3E0J A;  3JAM i;  2WII B;  3CW2 C;  4OL7 A;  1ENF A;  1W2B A;  4FP5 D;  1EIF A;  2D0P A;  1CUK A;  4A3D B;  2N3S A;  3PIP 3;  2I46 A;  5F2D A;  1HNX Q;  1KQS A;  2A6H D;  3SR1 A;  4BWG B;  1X55 A;  1TWF H;  2M2L A;  2RVL A;  3D4W A;  5FKA C;  1Y1W B;  1I4X A;  5J1Z A;  4WRD A;  5EKI A;  2N55 A;  3K80 C;  1PH8 A;  4DR4 L;  4KTA A;  4L5S A;  4IQZ A;  4BBR B;  1V8Q A;  2AHO B;  5I9P A;  4GKK L;  3ERO A;  1IYU A;  4FYD A;  2A69 C;  4PG3 A;  3HG9 A;  5LHY 1;  5IGF A;  2WB1 G;  4K0K Q;  4KD3 A;  2OEO A;  5ELB A;  5IE8 A;  1HA6 A;  2K01 A;  3PIO A;  3FKI H;  3DMU A;  4KKS A;  1PZJ D;  4RHR A;  4JI4 Q;  2Y0S G;  1FVI A;  1H9S A;  4IUV A;  1VQ7 A;  1JJ2 A;  2MHV A;  1F9S A;  4GLX A;  2WAC A;  1XPU A;  1C4Q A;  4JG2 A;  1P16 A;  5A2Q L;  1SMY D;  2F0K A;  3S1R B;  4LJZ C;  4X62 Q;  1HZA A;  2K32 A;  3NQT A;  1LTT D;  1H9K A;  2A5H A;  4J6H A;  2A8V A;  1B50 A;  2OQ0 A;  3HKZ B;  4JV5 L;  3S1N B;  1NJI C;  2N49 A;  1SYD A;  3ND8 A;  4B3M L;  4QF4 A;  2Z6K C;  1YJW A;  4C3J H;  5C4Z A;  4DAV A;  3J81 j;  4XXE A;  2CHB D;  1VS0 A;  3M9B A;  3GTP H;  1M90 C;  4GOP A;  3QB3 A;  3GTM B;  1GHK A;  3H3V I;  4ODG A;  5IYB H;  1SRU A;  4A3J B;  2DJF C;  1W6K A;  3D0F A;  3OYY A;  3RN2 A;  3WDN A;  1U0L A;  3M4O H;  1Q8K A;  3Q23 A;  4NKL A;  3HS0 C;  3STB D;  3CCR A;  1EY0 A;  3J7A 5;  4DV6 L;  4DV5 L;  3OSO A;  2XRQ D;  4J1M A;  4OIJ A;  4BBS H;  1KLG D;  3CMA A;  1CTM A;  4N9P A;  4XIG S;  4P71 A;  5CV9 A;  1KLU D;  1UEA B;  2LY7 A;  3TEH B;  4HSP A;  2ZXR A;  5JAV A;  2A68 D;  3I56 A;  3CAM A;  4QUF A;  3M85 A;  3W3A A;  2B2W C;  2MO1 A;  3UI2 A;  3BJU A;  1SYF A;  3D8G A;  1HNZ Q;  4A3C H;  3K5N A;  1S3O A;  1PH1 A;  4DR3 Q;  1L1O A;  4HSV A;  1Q8I A;  3I91 A;  2VZA A;  4G57 A;  5LMU Q;  1AW7 A;  4GKJ L;  1AP0 A;  2IHF A;  3HKZ G;  2PYK A;  1BVS A;  3T53 B;  4A3L H;  1KNE A;  2EY5 A;  3E0E A;  1XTD A;  3MTS A;  1XXG A;  4HR7 B;  2I5M X;  3G6E A;  4TVA B;  2F0M A;  2M00 A;  3CCM A;  1EFW A;  2QW7 A;  3E3X A;  4HJ5 A;  2JE6 I;  3C1F A;  1KHI A;  2O5J C;  1E24 A;  1PTO D;  1PYW D;  1GHJ A;  1MD2 D;  1IKM A;  1BCP B;  4L5Q A;  3VYR A;  4A3I H;  1FJG Q;  2QCP X;  1SJH D;  4Q0F A;  4K8J A;  2MO0 A;  4H7B A;  5IYD H;  1SDF A;  4IUT A;  1HZC A;  3LNN A;  4A3E H;  1SFO B;  4K8I A;  1J6Q A;  1P8L A;  3BVZ A;  2R92 H;  3RMH A;  2VW9 A;  1N34 Q;  1XJV A;  5BR8 L;  2Q8I B;  2AKW B;  1XNQ Q;  1N32 Q;  1YZ6 A;  2EJG C;  3HOV G;  4L8J A;  1S72 A;  1PRT B;  3GD7 A;  1EWI A;  3GTJ B;  1J9O A;  2UUA Q;  2VQF L;  1DOK A;  2ZT9 C;  2WIN B;  3KF6 A;  1N36 L;  4X66 Q;  1Z9F A;  5M3F B;  3PO2 G;  4XDX A;  3T1Y L;  1PH5 A;  1QWY A;  1EUJ A;  2JN4 A;  2K14 A;  4G7Z C;  4TKO B;  4LF4 Q;  1L0Y B;  5DAU A;  2B29 A;  1STY A;  1CHQ D;  4PV1 C;  4UDU C;  1QNU A;  5CV8 A;  1KTK A;  2F03 A;  5HGQ A;  1KD1 C;  4CJ2 C;  2F0N A;  2PI2 E;  2RDF A;  1AEX A;  1EU4 A;  1TWH H;  1YIT A;  4RH6 A;  4YCU A;  4G4K A;  4HCS A;  3TDQ A;  5DM6 3;  3RUZ A;  4GLA C;  3U50 C;  4C3H H;  3SE0 A;  3DUZ A;  2VQE Q;  4P2C B;  3UE0 A;  3HOY H;  1E3P A;  3U4V A;  4LUZ A;  3BDO A;  3P20 A;  1ENC A;  1EQT A;  1G8Z D;  1BUV T;  1BCP D;  1E1T A;  3RZO H;  2Z6K A;  1IBM Q;  3STB C;  1TWA H;  5C44 B;  1L2F A;  3A5U A;  2CFM A;  2JA7 H;  5C4X H;  1HJP A;  3M4P A;  1NE3 A;  5FLM G;  2YU9 H;  4UY8 C;  2QKI C;  1PFN A;  2CH4 A;  4XTC S;  4DR1 Q;  1ML0 D;  4HJ7 A;  3M7N A;  4DAM A;  3A74 A;  1KAA A;  1H9S B;  2FXQ A;  2E2J H;  1C8C A;  1YNJ C;  4LUO A;  1Z47 A;  4YCW A;  2PMZ B;  5IWA Q;  3TZU A;  1G29 1;  3Q6S A;  3J81 L;  2D62 A;  1VQF A;  2F0J A;  1VQ4 A;  3NEN A;  4RG1 A;  4ZLT F;  4IPG A;  4JOI C;  5LL6 X;  4HID A;  2B8F A;  1HQR D;  2K5W A;  2KEE A;  4I7Z C;  2RKS A;  3VYT A;  3VDY A;  1BR9 A;  5T1G A;  1S5D D;  4RCO A;  3ULL A;  1CI3 M;  4LF7 Q;  1YNX A;  4IUU A;  3TS2 A;  4POF A;  2IJ0 A;  1HUN A;  3NUC A;  1PFM A;  1C7Y A;  2PZT A;  5IYC H;  4GOP B;  4YWK A;  2B2W A;  2ZJP A;  3FDT A;  4O2D A;  1I6V C;  2F0H A;  2Q8T A;  4BA1 I;  1PTO C;  3TP7 A;  1TXY A;  1LTL A;  5C0X I;  3RZD B;  2RF4 A;  4X64 L;  1ZYR D;  2O4X A;  4V0B A;  1T5E A;  1JOR A;  1ZEQ X;  1JWM D;  4DNI A;  3KDF A;  1WCM H;  2XWJ B;  5BN4 A;  1PRT F;  4Q5V A;  1STE A;  1VMC A;  2C35 B;  1XX8 A;  4WFN 3;  2RCF A;  3E9H A;  3MFG A;  2D0O A;  3QOL A;  4HJ9 A;  2HT1 A;  1SLJ A;  4YWL A;  1RIP A;  1J5E Q;  3MA2 B;  1D2B A;  1XNR Q;  5G3L D;  4LF6 L;  1PYS B;  4DV0 Q;  4B3S Q;  1VQB A;  2D5D A;  1HNW L;  1E22 A;  1DYQ A;  4MTN A;  2EXD A;  5IGE A;  2QF7 A;  4YIJ A;  4PZ7 A;  3OTO Q;  1PH2 A;  1L1O B;  4DUY L;  1EWC A;  1E2V A;  3L0O A;  1U5K A;  3S15 B;  2OF1 A;  3K5L A;  3R8B A;  5M3M H;  3PQI A;  3I4N H;  1TWC H;  3KOJ A;  1B53 A;  2B2Y C;  4FF1 A;  1I3Q B;  2CKZ B;  4MNO A;  5CYU A;  1HFG A;  1SAP A;  1XTC D;  1STB A;  1YNN C;  1HH2 P;  4DV7 L;  2HD3 A;  4FNF A;  3HOW H;  3CHB D;  4HN7 A;  2F0W A;  2F0I A;  4OON A;  1R9T H;  3DM3 A;  3ULJ A;  3UDX A;  5I6Y A;  2K4K A;  3FKI G;  2EYH A;  1V1O A;  4PZ8 A;  1ZXT A;  4X3U A;  4B3R Q;  3V96 A;  3KFU A;  2EIF A;  1FR3 A;  3S17 H;  5IIF A;  5K5P A;  3CCE A;  2JA9 A;  4YY3 Q;  1FL0 A;  2UXB L;  5M5X H;  3I4M H;  4K2L A;  4YCV A;  1KDB A;  1SEB D;  2QDB A;  1D6E C;  3D31 A;  4G7O C;  2AQ3 B;  3GTL B;  1RHP A;  3QIA A;  3KF6 B;  3EIV A;  2E5L Q;  2FJ2 A;  4POG A;  1BBW A;  4A3F H;  1NMF A;  1CQV A;  3CME A;  2L12 A;  4C3J G;  2Z4H A;  2A6E C;  1JIC A;  4ABN A;  2Q2I A;  2DGY A;  2JA6 H;  4OXP A;  1EQV A;  4DUZ Q;  1NR4 A;  3K0Y A;  3E6Z X;  1GM5 A;  1VQP A;  1WTR A;  5GAG C;  4DK0 A;  4DV1 Q;  1GUT A;  3HOU H;  3S2D H;  4OO1 I;  2LMC B;  5ELC A;  4DU9 A;  3HZX A;  3GTM H;  1KL9 A;  3SK8 A;  1PMR A;  1NAP A;  4JOI A;  5I4D A;  4A93 G;  1K83 B;  1TU2 B;  3X3N A;  4HIK A;  2HDL A;  1K8O A;  4BBS G;  1ZYR C;  1JE5 A;  3I2Z A;  2PCF B;  1HNX L;  2KHJ A;  2EYP A;  4C2M B;  4UP8 A;  2BH8 A;  1CSP A;  1EYA A;  4DV3 Q;  1VQI A;  3IFT A;  1I4P A;  2M9V A;  3TS0 A;  5DM7 3;  1Q81 C;  4YHH Q;  3TRZ A;  1SNQ A;  3H0G B;  4B9X A;  2IW3 A;  4GZY C;  4A3C G;  2JA8 H;  2K28 A;  2C5C A;  2QA4 A;  3RLN A;  1UNS A;  3R2I A;  1WVL A;  3GQB A;  4HJA A;  2XVS A;  4A3L G;  2ZJQ A;  3PF4 A;  1HR0 Q;  4K0K L;  2UXD Q;  1QOH A;  3QO2 A;  3X3M A;  2HCI A;  1O78 A;  3CRK C;  1SE8 A;  1GO3 E;  1PLF A;  4B9W A;  3I3C A;  1X3Q A;  4JI4 L;  4DFA A;  1YJN A;  1XMO Q;  1Y1V H;  4KI0 A;  4PMW A;  5M5Y H;  1X3F A;  3GTK B;  4A3B H;  1VQ8 A;  1I94 Q;  5IYD G;  4G7H C;  2UU9 Q;  4DK3 C;  3H15 A;  3F2D A;  4A3E G;  2KHS A;  2GA4 B;  3RR5 A;  1LTI D;  1QG7 A;  3J80 i;  3GV3 A;  2R92 G;  1U4P A;  1VF7 A;  2YTV A;  1D8L A;  4QIW B;  4RKB A;  3KDF B;  2BH2 A;  3BU2 A;  3SHL A;  3F2C A;  1OXT A;  4CJ1 B;  2B2Y A;  3WOF A;  4GS3 A;  4RGM A;  4EVO A;  3CXC A;  1NUC A;  2DUD A;  4C1N K;  5I2X A;  3D6C A;  3KJP A;  1XMQ Q;  2EXZ A;  3AFQ A;  2NN6 I;  3HOX B;  3RNU A;  4TRD A;  3PUY A;  1TS4 A;  1EOV A;  1O7I A;  2B2T C;  2RSO A;  2E2H B;  2B63 B;  4XQN A;  3A5Z B;  2EPB A;  3L2P A;  4IAL A;  5JJI A;  1LYL A;  1AZP A;  1CSQ A;  1SND A;  4K5X A;  4DF7 A;  3HOY G;  4A3K H;  2WB1 B;  3GDE A;  1GUN A;  1QVG A;  1X56 A;  3JAM L;  1HZB A;  1JQY D;  3K7A B;  5JJK A;  4DR3 L;  1Z6H A;  1HCZ A;  1PHJ A;  2R7Z G;  2H1E A;  1RJT A;  4PMB A;  2NVY B;  2Y0S B;  3A56 A;  1UE5 A;  2JA7 G;  5C4X G;  3HRZ C;  1I6H B;  4GLV B;  1GXD C;  4A3M B;  1QNK A;  4XT3 B;  4JCV E;  1C48 A;  4ZYS A;  5CGK A;  2RBM A;  1VQ6 A;  3E9I A;  4DV2 Q;  1ILP A;  1FJG L;  3A0J A;  2EY2 A;  1Y8P B;  1S5C D;  3D4D A;  1UE1 A;  2VB3 X;  4QJF A;  3IL8 A;  4AQY Q;  2KJX A;  3NE5 B;  4IZ8 A;  5CV7 A;  1LO5 D;  3W2D A;  3GO5 A;  3K81 C;  3MAQ A;  1O80 A;  3HOX G;  2DJG C;  2L0C A;  1N34 L;  2Z1C A;  3MVV A;  3RLF A;  2K03 A;  1G2T A;  1SE4 A;  1RDP D;  4IFD H;  1XNQ L;  1FGB D;  1GUG A;  3BVM A;  5KGU A;  3GTO B;  2JP1 A;  1N32 L;  2B63 G;  1ASY A;  5IYC G;  4BXX H;  2XRS D;  4JI6 Q;  3BG3 A;  5FO9 B;  5CV5 A;  1H95 A;  2BCO A;  4MN3 A;  3AU7 A;  2UUA L;  1YBY A;  5IP7 H;  1MJC A;  1XPR A;  4HED A;  2E2I H;  3D3R A;  3S1Q B;  4BY1 B;  5D65 A;  1K28 A;  2K52 A;  3M3Y B;  4X66 L;  3HOZ B;  4C3I H;  1WCM G;  1V1P A;  4FXD A;  3OMC A;  2QIL A;  1EOT A;  4LF4 L;  5FO7 B;  3A54 A;  3GTG B;  1STA A;  4S3S A;  2IWH A;  4L63 B;  5KNC A;  3QOJ A;  4A3M G;  1SSO A;  4N8X 1;  2JA5 B;  4OGQ C;  3ZYY X;  2HQL A;  3RZD H;  1NBW A;  4EQO A;  1K8G A;  3ZJY C;  4FO2 A;  2WAQ E;  4QGU A;  1GUO A;  1BF4 A;  2LXK A;  4ULL A;  4U68 A;  2VQE L;  1CHP D;  3S1M B;  1PTO B;  3OW2 A;  1BBU A;  2NN6 H;  4F87 A;  4KY7 A;  4A3G H;  1I50 B;  3EJI A;  5TSS A;  4LAA A;  2VUM H;  4JI2 Q;  1WD0 A;  2Q8R E;  5EKK A;  1O7L A;  1R4P B;  1S4Z A;  1E2W A;  1Q12 A;  1IBM L;  4ZK9 B;  2L55 A;  5EBD A;  1BDO A;  3K57 A;  5COR A;  4JI8 Q;  2KQ3 A;  4ZUI A;  4JBK A;  3PO3 H;  2XN9 C;  1JC7 A;  1U4R A;  2EYM A;  1D5X C;  2WKC A;  2VXW A;  4ILW A;  1V1Q A;  1PZK D;  4DR1 L;  1VQC A;  3HOW G;  1FNU A;  2B3G A;  4BY1 G;  3TZD A;  3CCJ A;  5IWA L;  1QCB D;  1CKO A;  3HOZ G;  1DZ1 A;  3E5S A;  1VQN A;  1XPO A;  4GN4 B;  4LMQ D;  2KED A;  5C4J B;  2B2T A;  3KLW A;  3HOV B;  1YNJ D;  2WB1 E;  2F0G A;  3KJO A;  1PH6 A;  4JYA Q;  4OWX B;  4IUP A;  1VQ5 A;  2OTJ A;  1I4G A;  1B9M A;  2CWA A;  2R7F A;  2NWG A;  3T1H Q;  1UWV A;  4LF7 L;  1G51 A;  2JA5 G;  1A0I A;  1ONL A;  3I4M G;  2GVA A;  3LGJ A;  2K7V A;  4JW0 A;  1UEB A;  2NUC A;  2V1C C;  1B2T A;  1K0R A;  4BY7 H;  3NTH A;  3PO2 B;  3I72 A;  2CW0 D;  2Y0S E;  5HGT A;  4E6I A;  2OXP A;  1SE3 A;  2R93 H;  2Z4I A;  1NR2 A;  2R61 A;  5IT9 L;  3MXP A;  4A3F G;  1WTW A;  2JXM B;  2WKD A;  3NEL A;  2YYZ A;  2ICI A;  2A74 C;  5FOB B;  5EJW A;  1GUS A;  1VQM A;  1MJE A;  2K04 A;  3ERS X;  1LT3 D;  4B08 A;  2N8N A;  1FNW A;  1CM9 A;  5EGT A;  3FEW X;  3F8T A;  5IGG A;  1J5E L;  5ELD A;  1EQR A;  3JC6 6;  1XNR L;  4LFA Q;  4DV0 L;  4B3S L;  5ELE A;  3DEO A;  1PH4 A;  3HOU G;  1W3S A;  4LFC Q;  2G9H D;  1SYB A;  1EL0 A;  2EDG A;  1XWE A;  1LTG D;  2R3Z A;  1F9P A;  3OTO L;  3NWS A;  3I7F A;  5JVH 3;  2NVT B;  4Y7N H;  1MSG A;  2G9D A;  1MGS A;  1B3Q A;  5HY6 A;  1DXM A;  3OPO A;  3I4O A;  4KY5 A;  4NXN Q;  2NZ1 D;  4QMG A;  4NB3 A;  1DCZ A;  1JOQ A;  2OQK A;  4B3T Q;  2F0T A;  3A8J E;  4JI7 Q;  4LF5 Q;  4J15 A;  4OHJ A;  3U58 A;  2PW7 A;  1PTO F;  5M5W B;  2LFN A;  2ICE C;  4I65 A;  2JA8 G;  4F7X A;  2HDM A;  4DKA C;  3GTQ B;  4DV4 Q;  1N9W A;  2OWO A;  1S40 A;  1ZKO A;  1KXL A;  2KCT A;  1ENA A;  1ICW A;  3WOE A;  2PZW A;  3CF5 A;  4DAY A;  1SNC A;  1PA6 A;  1HQM C;  2HUG A;  1YNN D;  5J22 A;  3HKZ E;  3MWY W;  3H3V H;  1GKH A;  1V43 A;  3L9A X;  1S5B D;  4B3R L;  1EEI D;  1EY6 A;  2F0L A;  4A3B G;  1KAW A;  3CCQ A;  1U9R A;  3JAM E;  2TMP A;  1MIU A;  4YY3 L;  3S2H B;  4UAI A;  4P74 A;  5KNB A;  3VYU A;  3RLO A;  2F0Q A;  1DD2 A;  1EEF D;  2MJ8 A;  4R8I A;  1M4V A;  4AYB B;  3W1G A;  1ESR A;  3K0X A;  1WOC A;  3CC7 A;  3C3L A;  4RGO S;  2JSO A;  2VY3 A;  4CBV A;  2P5Z X;  3A7L A;  5I6W A;  1SR3 A;  4CJ0 B;  2E5L L;  4N9T A;  4DR5 Q;  1TWG H;  5K36 H;  1I5F A;  1V1P B;  2AWO A;  3S9W A;  2HIX A;  3FRP B;  3O13 A;  4DUZ L;  1NNX A;  4TQU S;  2EE1 A;  3HFZ B;  3AFP A;  3CKI B;  5BN3 A;  2DY8 A;  4MZ9 A;  1GD7 A;  5C3E H;  2A6E D;  1G6P A;  3TP5 A;  3MEH A;  2NVX B;  2RHS B;  2NTS A;  3KBX A;  4WJ4 A;  3PGZ A;  2X69 A;  1B44 D;  2CW0 C;  4DV1 L;  4M8A A;  4DPG A;  3P75 A;  1TWF B;  4A4I A;  2RA4 A;  1BCP F;  1HXY D;  1PFB A;  4X3S A;  4WJW A;  4JI0 Q;  1IL8 A;  1FNV A;  2Z9H A;  1STG A;  1TVX A;  2Z6B A;  3TSS A;  3JAM c;  3Q0A A;  2KOL A;  3G7L A;  2B2U C;  3A55 A;  3H6M A;  4DV3 L;  1EIG A;  1KDC A;  4A3K G;  4MIU A;  5M9O A;  4IUQ A;  4YHH L;  4ZKB B;  4M1U B;  3CCL A;  3NBI A;  2KHI A;  4IO9 A;  4AYB G;  1JB7 A;  3OOC A;  1E7Z A;  2Q2T A;  3FKI B;  5C6A A;  4LFB Q;  1SNP A;  3G4S A;  2ASB A;  2UXC L;  1VMP A;  1W6J A;  1JWU D;  2ZM6 Q;  4DGZ A;  1HR0 L;  1RL2 A;  1BKB A;  4GN3 B;  3J81 i;  2UXD L;  2B39 A;  2MFI A;  3I4L A;  1EU3 A;  3M4Y A;  2WV6 D;  1XMO L;  1D1K A;  4LW1 A;  2KCN A;  3T13 A;  3TBI B;  5C4H A;  1FGU A;  2ZXP A;  3CC2 A;  1KNA A;  4KV6 A;  2TSS A;  2NVQ H;  1I4H A;  2Z0S A;  3CQZ H;  1I94 L;  1PDQ A;  2D2C C;  5C5L A;  1N33 Q;  5JEA H;  2UU9 L;  3K6O A;  3T56 B;  2GN5 A;  5FJ8 H;  4C3J B;  5JJL A;  3S14 H;  5GAE C;  3P1H A;  3DWQ A;  3VR4 A;  1OTC A;  4N8F A;  3TQY A;  1KRS A;  1VCI A;  4ME3 A;  1TR5 A;  3CCV A;  1IBL Q;  3ONA B;  4IFD G;  5AFW A;  4KKU A;  2KCM A;  2IL8 A;  4JI3 Q;  4LF8 Q;  1GOZ A;  1RD9 D;  5E4X A;  4F8M A;  3NK9 A;  1O7Z A;  5C5M A;  3ICE A;  3K5M A;  2SNM A;  3M4O B;  4NDX A;  2F3I A;  1K9M C;  1IL2 A;  5AJ3 Q;  1WJJ A;  4A3D H;  1UAP A;  2ID0 A;  1Y1W H;  3R3O A;  4OWT B;  5CBA E;  5D14 A;  3F2U A;  3I73 A;  1DGS A;  2F3V A;  4ZRZ A;  1XYI A;  4A93 B;  1XMQ L;  1STN A;  4C3I G;  2FMC A;  4RAU C;  4BBR H;  4BBS B;  3SK4 A;  1QE6 A;  1WTP A;  1KRT A;  4KHP Q;  1K3R A;  5EAY A;  1QVC A;  2UUB Q;  1UE7 A;  3AEV A;  2JQO A;  1X3G A;  1WFQ A;  2VNU D;  3A7A B;  3CPW A;  1IYJ B;  4DR7 Q;  1D7Q A;  5EPJ A;  2ATW A;  1TKW B;  1DJR D;  5EPK A;  3H09 A;  3RD4 A;  4DR6 Q;  4MHE A;  5IT9 E;  1Y8N B;  2I5L X;  1BOS A;  1B1Z A;  3L3O C;  3G48 A;  5BN5 A;  4R1J A;  3CC4 A;  2BDN A;  2CCZ A;  1KC8 C;  2VUM G;  1Q86 C;  1LV9 A;  4P72 A;  4QY7 A;  1OXX K;  4NW2 A;  2WFW A;  4KY6 A;  1TII D;  2PMZ E;  1A8V A;  3VYS A;  3S1R H;  4X6A H;  1JE4 A;  3TN2 A;  3EA6 A;  4DAY B;  2C9O A;  3DLL A;  4K2K A;  1SMX A;  4ZUJ A;  5LMN Q;  4QUC A;  1X3E A;  4UPA A;  5IYB G;  3S1N H;  3PO3 G;  1H9J A;  5HUR A;  1Y8O B;  3DWP A;  1IYV A;  4FXG C;  4A3E B;  5FK9 C;  3DM1 A;  5C0X H;  4IJH A;  5J39 A;  2J7Z A;  2SDF A;  4UP7 A;  1PRT C;  1TQO A;  3U9O A;  3IFD A;  1HFN A;  1A3U A;  2R92 B;  2F0D A;  4DV2 L;  4O1N A;  3A8I E;  3Q8D A;  3URY A;  2HCC A;  2EQS A;  1VQK A;  4AQY L;  2V4D A;  3H94 A;  4A3J H;  1L0X B;  4NXM Q;  3CCU A;  1BO0 A;  3AMU A;  4KK7 A;  5A35 A;  3J7Y W;  1C0A A;  1AFP A;  5IP9 H;  3PUX A;  1DON A;  2B8G A;  1K0S A;  1VQG A;  4K14 A;  4OX9 Q;  2B2U A;  5H1S E;  5IT9 c;  4X65 Q;  4BY7 G;  5GRO A;  5ELN A;  1PYB A;  3SGI A;  4DXF A;  4JI6 L;  1LTA D;  1M1K C;  4C1N I;  1CKM A;  3J80 L;  1B7Y B;  3K8A A;  1YHB A;  2R93 G;  2PI2 A;  1K8M A;  1TWH B;  4RGN A;  2DN8 A;  3ITP A;  3D4R A;  1EY7 A;  5CR3 A;  3K59 A;  4C3H B;  1ASZ A;  4K5W A;  4EQN A;  4A3I G;  3NEM A;  1X3P A;  3HOY B;  1MBY A;  1PVO A;  4FDB A;  2DY7 A;  2KBN A;  1HR0 W;  4ID6 A;  4X62 L;  4LWC A;  2F0V A;  3RZO B;  3EN2 A;  2R7Z B;  4WOR A;  1TWA B;  5ISR A;  3TP6 A;  3NXW A;  1VQL A;  2ZTE A;  2JA7 B;  1A2T A;  5C4X B;  3FVQ A;  4JI2 L;  2YU9 B;  5IY0 A;  1JJC B;  1VQH A;  1X32 A;  2NZO A;  2HHH Q;  1M8A A;  1SFO H;  1OO9 B;  4IUN A;  2F0O A;  2E2J B;  2N88 A;  4RHS A;  3FMC A;  1SNM A;  4DK1 A;  4JI8 L;  3K58 A;  4NPS A;  1DM0 B;  1HUM A;  1PH9 A;  1A3T A;  4FVM A;  2CH4 W;  4JBJ A;  1VQA A;  2NVT H;  1E2Z A;  1D5Z C;  4LNQ A;  1Q90 A;  3GTJ H;  1MHW C;  4X3K A;  3N6R A;  2MUY A;  1NTG A;  3C46 A;  1STH A;  4IUR A;  1YHA A;  5M3F H;  4C3H G;  3BYY B;  1MI2 A;  1S5F D;  4JYA L;  3OIQ A;  2O2L D;  5CMD A;  1ILQ A;  2F0U A;  3AQQ A;  1EYC A;  3OWF A;  3T1H L;  2LS0 1;  1VQO A;  5KIX A;  3IRB A;  2ENB A;  4JC0 A;  4OO1 H;  1HNZ L;  1Q3L A;  2UXB Q;  2NTT A;  3MXU A;  2ES2 A;  2QDL A;  4L6T B;  1EYD A;  4PNY A;  5LMU L;  2AQ2 B;  3T4A C;  1WYD A;  1QJO A;  1QZH A;  1WCM B;  3SVM A;  1K3B C;  3MEF A;  3DXJ C;  3NSW A;  2PZU A;  1YIJ A;  3NBH A;  5EQ0 A;  2K5V A;  3KYH C;  5K36 G;  1L1O C;  5JOB A;  4HTH A;  3EFX D;  2PQE A;  1U4M A;  4RMF A;  5JPM C;  1L0W A;  2X6L A;  4LF9 Q;  3J7Z C;  3V2T A;  1EQQ A;  3MC0 B;  5C44 H;  5C3X A;  1V9P A;  1ESF A;  5C3E G;  5CC4 A;  3R93 A;  3OW7 A;  1F9Q A;  2XTI A;  5IOD A;  4LFA L;  3U9S A;  2R7D A;  1FD7 D;  4LFC L;  1KIX A;  5JJZ A;  3I4N B;  2I07 B;  4EQP A;  1TWC B;  2EYL A;  4HMI A;  1CZG A;  4KMU C;  3MFY A;  2NVX H;  2QGQ A;  3VA7 A;  2BDO A;  4NXN L;  3LX0 A;  2PQA A;  1IBK Q;  5DNF A;  4R4C A;  1B3A A;  3HOW B;  4B3T L;  3L7Z C;  4JI7 L;  4P75 A;  4LF5 L;  1R9T B;  1WTH A;  3I90 A;  1NMG A;  4BS9 A;  2UUC Q;  1G91 A;  1MSH A;  1Q1E A;  1LTB D;  1UE6 A;  4IPD A;  4DV4 L;  1LT5 D;  1LTS D;  2G5D A;  1YI2 A;  1SN8 A;  3OIP A;  4F88 A;  2RSN A;  4EX5 A;  1IKL A;  5KYL A;  3SK6 A;  4EGV A;  3S17 B;  3AB9 A;  5E1F A;  3HEJ A;  5M5X B;  3I4M B;  2K33 A;  4JK1 C;  1JOK A;  4P73 A;  4UHV A;  3FPU B;  2BE5 C;  3DEP A;  3C1E A;  3I70 A;  4Z9C B;  4QIW E;  2OCE A;  1I4R A;  1KDA A;  4KJO A;  2RCN A;  1HPC A;  3N52 A;  4H44 C;  3FPP A;  1UUP A;  4A3F B;  5JEA G;  3WWV A;  5FJ8 G;  4DR2 Q;  3KF8 A;  5M3M G;  3S16 B;  2JA6 B;  1BQQ T;  3I4N G;  1TS3 A;  1ET6 A;  4IN3 A;  1IXR A;  1VQD A;  4DR5 L;  4RWS C;  2O5I C;  4XQQ A;  3A8K E;  1H9R A;  5E7N A;  4ZAI A;  3MHB A;  4APV A;  2FMM A;  3J7A F;  3SXH A;  4A3D G;  4IFD J;  1Q46 A;  4PMC A;  3S15 H;  3VR3 A;  3S2D B;  3HOU B;  3QJY A;  1AH9 A;  3PIO 3;  1Y1W G;  2MGS A;  1WTQ A;  4JI1 Q;  2EJM A;  1BNZ A;  4RA8 A;  2F3W A;  3H3V C;  1EY4 A;  1I3Q H;  1RTO A;  3F1Z A;  4BBR G;  1LT6 D;  5KYI A;  2L11 A;  4IPH A;  4IPC A;  4XYO A;  2E2D C;  2I0Q A;  2LSS A;  4JI0 L;  4TSS A;  1RF2 D;  4A75 A;  4X3T A;  4A93 H;  1VQ9 A;  2JA8 B;  1D1I A;  4CDF C;  2WP8 J;  3J80 E;  3C2P A;  5E4W C;  1B8A A;  4CDC C;  3MZ5 A;  2SOB A;  3W1B A;  1QIL A; 
#chains in the Genus database with same CATH homology
 5J3B A;  5GAG C;  3JAM c;  2R6G A;  5GAD C;  4DV1 Q;  3HOU H;  3S2D H;  4OO1 I;  2WAQ G;  3F2B A;  2F4V L;  1KL9 A;  3GTM H;  2JA6 G;  2L15 A;  4JOI A;  4DV3 L;  4LFB L;  4A93 G;  4A3K G;  3J81 c;  4JI5 Q;  4KHZ A;  3GTL H;  1JJG A;  4GN5 A;  1LM0 A;  4YHH L;  4HIK A;  1GVP A;  1NY4 A;  3W5O A;  2ZM6 L;  3CCL A;  4BBS G;  2KHI A;  1JE5 A;  3I2Z A;  4AYB G;  4IO9 A;  3ULP A;  1JB7 A;  1E7Z A;  2LXJ A;  2KHJ A;  1HNX L;  4UP8 A;  3JAM i;  2Q2T A;  2BH8 A;  2F4V Q;  3CW2 C;  1CSP A;  4DV3 Q;  4LFB Q;  5C0X G;  1VQI A;  3G4S A;  4GNX C;  1W2B A;  1Q82 C;  2ASB A;  2UXC L;  3TS0 A;  1Q81 C;  3CD6 A;  3TRZ A;  4YHH Q;  4L5R C;  2ZM6 Q;  1EIF A;  2D0P A;  1HR0 L;  1CUK A;  1RL2 A;  1BKB A;  4GN3 B;  2N3S A;  4UP9 A;  3J81 i;  4A3C G;  2UXD L;  1HNX Q;  1KQS A;  2JA8 H;  2MFI A;  1OXU A;  2QA4 A;  3RLN A;  1X55 A;  1TWF H;  5GAH C;  1N33 L;  4A3J G;  1AE3 A;  4DK6 C;  4HJA A;  2YTY A;  4A3L G;  3K80 C;  1PH8 A;  1XMO L;  4DR4 L;  4LW1 A;  3UDF A;  1HR0 Q;  2ZJQ A;  4L5S A;  3PF4 A;  1FGU A;  4K0K L;  2UXD Q;  3CC2 A;  2AHO B;  3NBH B;  2NVQ H;  5IP9 G;  2Z0S A;  3BZC A;  3CQZ H;  1SE8 A;  1I94 L;  1GO3 E;  1IBL L;  4GKK L;  1N33 Q;  2UU9 L;  4R4I A;  3J80 c;  4PG3 A;  2GN5 A;  5FJ8 H;  4JI4 L;  5JJL A;  1K8A C;  1YJN A;  1XMO Q;  3S14 H;  4DR4 Q;  1K83 H;  1Y1V H;  2WB1 G;  4JI3 L;  1QZG A;  4LF8 L;  4K0K Q;  5GAE C;  1C9O A;  4KI0 A;  4IOC A;  4PMW A;  5M5Y H;  1X3F A;  4A3B H;  5AJ3 L;  1OTC A;  3TQY A;  1VQ8 A;  1KRS A;  1VCI A;  4ME3 A;  5IE8 A;  3CCV A;  5IYD G;  3FHW A;  1X9N A;  1I94 Q;  1IBL Q;  4GKK Q;  4C2M H;  4IFD G;  3PIO A;  3FKI H;  4DK3 C;  2UU9 Q;  3H15 A;  3F2D A;  4A3E G;  3RR5 A;  2KCM A;  4JI4 Q;  4JI3 Q;  4LF8 Q;  3J80 i;  2Y0S G;  2R92 G;  3ICE A;  3H0G H;  2F3I A;  2PNH A;  1K9M C;  1FVI A;  5AJ3 Q;  1WJJ A;  1VQ7 A;  1IL2 A;  4A3D H;  1JJ2 A;  2YTV A;  2ID0 A;  4GLX A;  1XPU A;  4JG2 A;  1D8L A;  1Y1V G;  4KHP L;  1Y1W H;  3AYH B;  4OWT B;  1P16 A;  2UUB L;  1DGS A;  3KDF B;  2JEA I;  4X62 Q;  1HZA A;  2BH2 A;  3BU2 A;  2A8V A;  3F2C A;  1XMQ L;  1OXT A;  2OQ0 A;  4BBR H;  4JV5 L;  2IX1 A;  4GS3 A;  1NJI C;  2N49 A;  2JJQ A;  4B3M L;  1KRT A;  2PQA B;  1K3R A;  4KHP Q;  5EAY A;  4DR7 L;  1QVC A;  2UUB Q;  2Z6K C;  1UE7 A;  3CXC A;  3AEV A;  1YJW A;  2ZJR A;  4C3J H;  2JQO A;  4IJL A;  2DUD A;  1X3G A;  3J81 j;  4DR6 L;  1XMQ Q;  1VS0 A;  3KJP A;  3M9B A;  1WFQ A;  3GTP H;  2Q2U A;  1M90 C;  2VNU D;  2BA0 A;  4JV5 Q;  2K50 A;  3AFQ A;  2NN6 I;  4GOP A;  3CPW A;  3GTK H;  1IYJ B;  4B3M Q;  4DR7 Q;  3H3V I;  1D7Q A;  1B70 B;  3RNU A;  2ATW A;  5IYB H;  1SRU A;  2NZH A;  3PUY A;  1EOV A;  4DR6 Q;  1O7I A;  3D0F A;  2Q2H A;  3OYY A;  3RN2 A;  2I5L X;  2RHQ B;  1U0L A;  3G48 A;  1Q8K A;  4R1J A;  3CC4 A;  2R7Z H;  3M4O H;  3STB D;  2CCZ A;  2H5X A;  5LMN L;  1Q86 C;  1KC8 C;  4LUV A;  3CCR A;  2VUM G;  4P72 A;  4QY7 A;  1OXX K;  3A5Z B;  3J7A 5;  4DV6 L;  3L2P A;  2AWN A;  2WFW A;  1LYL A;  1K73 C;  5JJI A;  1CSQ A;  2K5N A;  2PMZ E;  1A8V A;  2K75 A;  4DV5 L;  3S1R H;  4X6A H;  5FLX c;  3HOY G;  4A3K H;  4WJ3 M;  3GDE A;  4DAY B;  1QVG A;  1X56 A;  1YEZ A;  3U4Z A;  3DLL A;  1SMX A;  5LMN Q;  1HZB A;  1X3E A;  4UPA A;  5IYB G;  3S1N H;  4BBS H;  3CMA A;  3PO3 G;  5JJK A;  4DV6 Q;  4XIG S;  4P71 A;  1VQE A;  3TEH B;  4DR3 L;  4DV5 Q;  2VS1 A;  4AH6 A;  1PHJ A;  2R7Z G;  4PZ6 A;  4IJH A;  3KF8 B;  3I56 A;  3CAM A;  2IX0 A;  3PUV A;  4UP7 A;  3M85 A;  5M3F G;  4NXM L;  2MO1 A;  3BJU A;  2IY5 B;  4R4O A;  1UE5 A;  2JA7 G;  4DV2 L;  5C4X G;  1HNZ Q;  4A3C H;  3Q8D A;  4GLV B;  1S3O A;  1PH1 A;  4DR3 Q;  2EQS A;  5ELO A;  1L1O A;  3HOX H;  2YTX A;  1CKN A;  5LMU Q;  4GKJ L;  2VZA A;  2A19 A;  1VQK A;  2IHF A;  3CP0 A;  4JCV E;  4AQY L;  3HKZ G;  4A3J H;  4OX9 L;  4NXM Q;  1BVS A;  4OO1 G;  1VQ6 A;  3CCU A;  2E2H H;  4A3L H;  3E9I A;  3E0E A;  1XTD A;  4X65 L;  1MKH A;  4DV2 Q;  1FJG L;  2I5M X;  3A0J A;  4L5T A;  4TVA B;  3G6E A;  2B63 H;  1JT8 A;  3CCM A;  2BA1 A;  1EFW A;  1C0A A;  5IP9 H;  3PUX A;  4GKJ Q;  1UE1 A;  4HJ5 A;  4QJF A;  4AQY Q;  2JE6 I;  1KHI A;  1VQG A;  4OX9 Q;  5H1S E;  1E24 A;  3GO5 A;  5IT9 c;  3UDI A;  3K81 C;  4X65 Q;  4BY7 G;  5GRO A;  5ELN A;  4L5Q A;  1PYB A;  3SGI A;  3HOX G;  4A3I H;  1FJG Q;  4JI6 L;  1N34 L;  1M1K C;  1X6O A;  3K7A H;  2MO0 A;  3RLF A;  1YHQ A;  5IYD H;  2KEN A;  1CKM A;  2JEB I;  1B7Y B;  1HZC A;  3K8A A;  1YHB A;  2GVB A;  2PI2 A;  4A3E H;  1XNQ L;  4BA2 I;  2R93 G;  1EIY B;  1N32 L;  2A1A A;  4GNX A;  2B63 G;  4Y52 H;  1ASY A;  5IYC G;  5C44 G;  1J6Q A;  2NVY H;  1P8L A;  4BXX H;  4JI6 Q;  3CCS A;  1PH7 A;  2R92 H;  2VW9 A;  1N34 Q;  1XJV A;  1H95 A;  5BR8 L;  4JBM A;  1I6H H;  1ASZ A;  2UUA L;  1YBY A;  5IP7 H;  4A3M H;  2AKW B;  1XNQ Q;  1MJC A;  1XPR A;  2E2I H;  4A3I G;  3NEM A;  2N78 A;  1N32 Q;  1YZ6 A;  1QUQ A;  2K52 A;  4X66 L;  3HOV G;  1S72 A;  3GD7 A;  4C3I H;  1PVO A;  1EWI A;  5BR8 Q;  4FDB A;  2KBN A;  2UUA Q;  2VQF L;  1WCM G;  1HR0 W;  4X62 L;  4BXX G;  4LWC A;  4LF4 L;  3EN2 A;  2HHH L;  3KF6 A;  1N36 L;  1HZ9 A;  2JK8 A;  3TRE A;  4X66 Q;  1Z9F A;  5IP7 G;  4A3M G;  1VQL A;  2HIV A;  3PO2 G;  3T1Y L;  2ZTE A;  1PH5 A;  1EUJ A;  2HQL A;  2VQF Q;  3RZD H;  2K14 A;  4JI2 L;  1NBW A;  1K8G A;  4LF4 Q;  3ZJY C;  5IY0 A;  1JJC B;  1VQH A;  2B29 A;  2NZO A;  2WAQ E;  4QGU A;  2HHH Q;  1N36 Q;  3GTO H;  5HGQ A;  1Q1B A;  2LXK A;  1SFO H;  1KD1 C;  2PI2 E;  2VQE L;  1TWH H;  3OW2 A;  1BBU A;  1YIT A;  3T1Y Q;  4YCU A;  4A3G H;  1Y14 B;  4HJ8 A;  2VUM H;  4GLA C;  4JI2 Q;  4JI8 L;  3U50 C;  3G71 A;  4H02 A;  4NPS A;  4C3H H;  4AYB E;  1PH9 A;  4QQB X;  3S1Q H;  4JBJ A;  1Q12 A;  4BY1 H;  2VQE Q;  1VQA A;  2NVT H;  3UE0 A;  1IBM L;  3HOY H;  1OXS C;  3M3Y H;  1E3P A;  3U4V A;  4LNQ A;  4LUZ A;  3HOZ H;  2OTL A;  4JI8 Q;  3GTJ H;  4JBK A;  3MXN B;  3PO3 H;  2CQO A;  1E1T A;  2NN6 G;  1NTG A;  3RZO H;  3GTG H;  4A3G G;  2Z6K A;  1V1Q A;  1IBM Q;  3STB C;  1TWA H;  4DR1 L;  1VQC A;  1YHA A;  5M3F H;  1L2F A;  3HOW G;  3A5U A;  2JA5 H;  2CFM A;  2JA7 H;  5C4X H;  2B3G A;  4BY1 G;  3RN5 A;  1HJP A;  4JYA L;  3M4P A;  1T9H A;  3M4Q A;  1NE3 A;  5IWA L;  5FLM G;  3CCJ A;  2YU9 H;  4UY8 C;  3AQQ A;  4XTC S;  1CKO A;  3T1H L;  3HOZ G;  5JEA J;  1VQO A;  1VQN A;  4DR1 Q;  1XPO A;  4GN4 B;  3IRB A;  4JC0 A;  4HJ7 A;  4DAM A;  3A74 A;  3UDG A;  1HNZ L;  2FXQ A;  3KLW A;  2E2J H;  4O0A A;  3M7N A;  2WB1 E;  2VL6 A;  3KJO A;  2ES2 A;  4HIO A;  1I50 H;  1PH6 A;  2UXB Q;  4LUO A;  4JYA Q;  5LMU L;  4OWX B;  1Z47 A;  1VQ5 A;  2OTJ A;  4YCW A;  1WYD A;  5IWA Q;  2CWA A;  2R7F A;  1G29 1;  1QZH A;  2D62 A;  3MEF A;  3T1H Q;  1UWV A;  4LF7 L;  1VQF A;  1G51 A;  4YWM A;  2JA5 G;  1A0I A;  1YIJ A;  3I4M G;  2GVA A;  3LGJ A;  3PUW A;  1E1O A;  1UEB A;  3NEN A;  2V1C C;  4RG1 A;  1OXV A;  1VQ4 A;  4LF9 L;  3S16 H;  1K0R A;  4IPG A;  4JOI C;  4BY7 H;  2K5V A;  2XGT A;  3KYH C;  4HID A;  5K36 G;  1L1O C;  2Y0S E;  3VDY A;  3ULL A;  1PH3 A;  2ALY B;  5LMN W;  1YNX A;  4RMF A;  4LF7 Q;  3TS2 A;  1L0W A;  4POF A;  2R93 H;  4LF9 Q;  3PUZ A;  3J7Z C;  4A3F G;  1EQQ A;  1C7Y A;  5IYC H;  5C44 H;  4GOP B;  4YWK A;  1V9P A;  2ZJP A;  3UE1 A;  5C3E G;  4O2D A;  1WI5 A;  3NEL A;  4BA1 I;  2XTI A;  2YYZ A;  5DLQ E;  1TXY A;  1LTL A;  4LFA L;  5C0X I;  1YJ9 A;  1YVC A;  2R7D A;  4LFC L;  1KIX A;  2RF4 A;  4X64 L;  5C4J H;  1VQM A;  1MJE A;  3HOV H;  3ERS X;  1IBK L;  2N8N A;  4IOA A;  3B6Y A;  4DNI A;  3F8T A;  1J5E L;  1EQR A;  3KDF A;  1WCM H;  4OWW B;  3JC6 6;  1XNR L;  3S1M H;  4LFA Q;  2AMC B;  4DV0 L;  4B3S L;  2UUC L;  1PH4 A;  3HOU G;  2C35 B;  1W3S A;  2IT1 A;  2QGQ A;  2NVX H;  4R4T A;  4NXN L;  4X64 Q;  4LFC Q;  3E9H A;  2D0O A;  4HJ9 A;  2PQA A;  1IBK Q;  4R4C A;  2HT1 A;  3PO2 H;  5GQO A;  1SLJ A;  4B3T L;  3L7Z C;  4JI7 L;  4P75 A;  4YWL A;  1RIP A;  3OTO L;  3EBE A;  1J5E Q;  4LF5 L;  4AIM A;  3I7F A;  4ALP A;  1XNR Q;  4Y7N H;  3PSI A;  4LF6 L;  1PYS B;  1X65 A;  4DV0 Q;  4B3S Q;  1NMG A;  2UXC Q;  1VQB A;  1HNW L;  5HY6 A;  2UUC Q;  1E22 A;  4A76 A;  1Q1E A;  1UE6 A;  2F52 A;  3I4O A;  4MTN A;  4NXN Q;  2EXD A;  1AE2 A;  4IPD A;  4NB3 A;  2OQK A;  4DV4 L;  4PZ7 A;  4B3T Q;  4JI7 Q;  3OTO Q;  1YI2 A;  4LF5 Q;  4J15 A;  1JMC A;  1SN8 A;  3U58 A;  1L1O B;  4DUY L;  1PH2 A;  1CKN B;  4LF6 Q;  4EX5 A;  1QVF A;  4IFD I;  3L0O A;  2ZTC A;  1HNW Q;  1U5K A;  2MQH A;  2JA8 G;  4JBW A;  5C0X J;  1PV4 A;  5M3M H;  4DKA C;  3PF5 A;  4DV4 Q;  1N9W A;  2ZTD A;  4P73 A;  2OWO A;  3I4N H;  2K5H A;  1TWC H;  4DUY Q;  4DR2 L;  3KOJ A;  1S40 A;  4QIW E;  1KXL A;  2OCE A;  2KCT A;  3CF5 A;  2RCN A;  2CKZ B;  4MNO A;  1PA6 A;  1LUZ A;  3HKZ E;  2E8G A;  3H3V H;  1HH2 P;  4QL5 A;  1GKH A;  1V43 A;  5JEA G;  4DV7 L;  4HIM A;  3HOW H;  3WWV A;  5FJ8 G;  4DR2 Q;  2I5H A;  4B3R L;  4OON A;  1R9T H;  1N8R C;  4GOP C;  5FLM H;  5M3M G;  4A3B G;  1KAW A;  3DM3 A;  3ULJ A;  3UDX A;  3CCQ A;  2K4K A;  1MIU A;  4GNX B;  4YY3 L;  3I4N G;  3HKS A;  4P74 A;  3CPF A;  1Q7Y C;  4DV7 Q;  3FKI G;  3RLO A;  1IXR A;  3BZK A;  1VQD A;  4DR5 L;  4PZ8 A;  4JI1 L;  4B3R Q;  3KFU A;  3W1G A;  3K0X A;  4R4Q A;  1WOC A;  3CC7 A;  5E7N A;  3H0G G;  4APV A;  2EIF A;  5M5W H;  2QEX A;  4A3D G;  2VY3 A;  3S17 H;  4IFD J;  3CCE A;  2JA9 A;  1Q46 A;  1QUQ B;  1IZ6 A;  1SR3 A;  1FL0 A;  4YY3 Q;  5M5X H;  2E5L L;  3S15 H;  2CWP A;  3I4M H;  2UXB L;  1AH9 A;  1Y1W G;  4YCV A;  3GTQ H;  4DR5 Q;  1A62 A;  1TWG H;  1A63 A;  2IHE A;  4JI1 Q;  1SRO A;  1I5F A;  2AWO A;  3D31 A;  4KLK A;  2MNA A;  2HIX A;  1I3Q H;  3F1Z A;  4BBR G;  3KF6 B;  3EIV A;  2E5L Q;  4DUZ L;  4POG A;  1PFS A;  1BBW A;  1EYG A;  4TQU S;  4A3F H;  4IPH A;  1NMF A;  3HFZ B;  3CME A;  3AFP A;  4IPC A;  4MZ9 A;  1GD7 A;  5C3E H;  1G6P A;  4EQ5 A;  2LSS A;  3I55 A;  2I0Q A;  2Q2I A;  1X54 A;  2DGY A;  2RHS B;  4OXP A;  4A75 A;  4JI0 L;  4DUZ Q;  3PCO B;  2JA6 H;  1VQ9 A;  4A93 H;  1VQJ A;  3PGZ A;  3S2H H;  4WJ4 A;  4DV1 L;  3S24 A;  4DPG A;  3ER0 A;  2YV5 A;  4A4I A;  2WP8 J;  3PIP A;  3FP9 A;  3K7U C;  1B8A A;  1GM5 A;  1VQP A;  3PV0 A;  4JI5 L;  3W1B A;  4JI0 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...