3T28A

Tmao-grown trypsin (bovine)-previously unreported tetragonal crystal form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title The use of trimethylamine N-oxide as a primary precipitating agent and related methylamine osmolytes as cryoprotective agents for macromolecular crystallography.
pubmed doi rcsb
molecule tags Hydrolase
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t28A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t28A02
2OUAA 3RXUA 1HIAA 1Z1IA 3SV8A 1WV7H 1EX3A 1QIXB 3T62A 1A2CH 3EA8A 3EA7A 1HXEH 4IS5A 2BOKA 2BLOA 1B7XB 1QGFA 3IITA 2PKAA 2BZAA 2HNTC 5E2PA 1SGEE 2QY0B 1LPGB 3UNQA 1GJ6A 1N6XA 1FY1A 1IQMA 1TRNA 3GCTG 1G3BA 1O2LA 2ZPSA 1NRSH 3SBKA 3PO1C 1YPGH 5EW2H 4TPIZ 5FX5A 3ELAH 4Y6DA 1F5RA 2ZDVH 3BIUH 1W7GH 3F9EA 2PSXA 1AWHB 1QQ4A 2V3OH 2ZFPH 4U30A 1MBQA 1SQTA 1FDPA 2QF3A 4I31A 3VPKA 1P2MA 1CU1A 2Z3DA 1C5XB 1G3CA 3RU4D 3A7ZA 2J2UA 5A8YA 2FOBA 1TBZH 2B8OH 2VIDA 1CHOG 4CR5A 4NIWA 3U69H 3A8BA 4WMFA 5FXLA 1SQAA 3NXPA 3TH3H 1T4VH 3MTYA 1V2JT 1TGTA 1BRCE 2CGAA 2Z9IA 3K6ZA 2BB4A 1O3IA 3FFGA 1AVGH 4HZHA 1E36B 2WPLS 3K65B 2J9NA 2RCEA 2XCFA 1QL8A 4JYVH 1GGDC 5F8ZA 3RXCA 4AG1A 1DS2E 5FPSA 4K8BA 1XX9A 2W3KA 1MKXH 4D9QA 1DDJA 1JOUB 1BOQA 1LKAA 2UUJB 3TLOA 2F9UA 4BNRA 3PLPA 2P3UB 3RXSA 3SUGA 1CA0C 1SGDE 1CHOF 3ZZCA 5HM2A 8LPRA 2Y7ZA 4AG2A 2A2QH 2QF0A 2OC1A 3UUZA 2ZCLP 4GHTA 4UFGH 4NGAH 3ATIA 2BM2A 1BIOA 4O9VA 1O2HA 3RXMA 1QB6A 2FM2A 4QT8C 4R0IA 4B75A 3VFEA 2ILNA 4BAMB 1FLEE 1O2XA 3MNXA 2FIRH 1TOCB 1C1WH 1ETSH 4YO9A 4DGJA 4FUGA 1S0QA 2H1UA 2HNTE 1HLTH 4NG9H 2G52A 1EJMA 2BMGB 3H5CB 3STIA 2FYRA 1C5UA 1U6QA 3KIDU 1DSUA 1ZPCA 2CMYA 2PKSC 2VU8E 6ESTA 1O5DH 1QFKH 4H4FA 2IJOB 3TH2H 5TJXA 4K1SA 1P04A 1P2OA 3MO9A 1FAXA 3GDVA 2FMJA 1ELDE 1W14U 4GLYA 3NK8A 2BVSH 1V2VT 2O8WA 1BUIA 1THPB 4YESB 2QXIA 2VIQA 1O2IA 2VWNA 1EPTC 4CH8B 1YPHC 4WH8A 1SG8B 1WTHD 3ZVFA 4B2CA 4ISOA 4KTCA 3DHKH 4UFEH 1O3HA 2BD2A 5EG4A 1J16A 2AEIH 2QC2A 3MU0A 3ATWA 4ESTE 4THNH 1TPPA 2GKVE 3NCLA 1TX6A 1L4DA 2ZDNA 3HKIB 3C27B 3O8RA 1NFUA 1V2OT 1YPJH 3TJVA 1ZTJA 3M3SA 5C5NA 1WUNH 1EZUC 1UTJA 2GZ9A 2NU0E 3D62A 2VVUA 4X2XA 3KQCA 2B5TB 3KGPA 5LH8A 5F03A 1H9IE 2PGBB 1RIWB 2ZDLA 3PMAB 3PYHA 2BX4A 1JRSA 1MUEB 1GJ9B 4IC5A 1S0RA 1CGIE 1OXGA 2JH0D 4ZROA 3QUMP 1ETRH 1A46H 1C2LA 3ZZ5A 3RDZA 1LKBA 1GJ5H 8ESTE 3OU0A 1ZMLA 3Q3YA 1DXWA 2G55A 2I6SA 5C1XA 2Z3CA 2AYWA 2BD4A 1K1PA 2Y5GA 4MLFB 1NRRH 2A1DB 4INHA 1TNJA 2J34A 1IHTH 1SGCA 4U2WA 2ZU4A 1FZZA 3A7XA 4HFPB 3BG8A 3RXEA 3DT0H 3SQHE 4Y7BA 3UWJH 2BY9X 2SNWA 2ESTE 1A3BH 2XXLA 3P17H 1BMMH 1FNIA 4XSKU 2Y82A 4ABGA 2Q1JA 4OS4A 1GJBB 5ESTE 1QRXA 1UTPA 4A5TS 5CE1A 1K22H 1W13U 2XC0A 2IOTA 3A8AA 2IPHA 4MPVA 1K1IA 5HYOA 5FCRA 4OS2A 2JETC 2WINI 1K2I1 3U98H 1HAHH 2ZDMA 5GCHF 1BT7A 1GHBG 3P8GA 3BEFB 1NFYA 4OS5A 4A92A 1T7CA 1E38B 1ZMNA 3GCNA 3KN2A 5A09A 5A0CA 2OTVA 1KYNA 1TA6A 3T27A 3TJOA 4DURA 1FN8A 5EQSA 1GVZA 1YPHE 5ETXA 1H1BA 2OC8A 3SZNA 1P05A 3A86A 4NIXA 2FO9A 5IYTA 1A5IA 1ZHPA 1C5YB 1KLIH 1NY22 5CHAC 1O2WA 5L6NH 3V0XA 1PYTC 2B9LA 3A7WA 4NFFA 4U32A 2A4RA 3ZZDA 1SGNE 1FMGA 1O2UA 2ZNKH 2GX4A 5AF9H 4DIIH 1CT4E 3LC3A 4BOHA 1SVPA 1GHBF 3E0NB 2FX4A 1C1PA 1SL3A 1DSTA 1W7XH 2ZU1A 1FJSA 2EC9H 3LDXH 3SU1A 1QJ6B 2FTLE 2PUXB 1P11E 2QYIA 3E90B 4I8HA 4PROA 3HATH 1IHSH 4JCNA 4B1TA 3QZQA 2Z6BD 1P9UA 5J4QA 2ZPRA 1A4WH 1VGCC 5DGJA 2V0BA 1MTNC 1OWDA 1KXDA 1HRTH 4Y8YA 4ABHA 1GVLA 3RXGA 2GCTB 1O5BB 3QO6A 1UHBA 1G3EA 2PSYA 1AUJA 1C5LH 1Y5UT 2GZ7A 2G4TA 1C5WB 3UNSA 2ANMH 3RC4A 1O2NA 3LT3A 1QB9A 3SN8A 3LH3A 2BD8A 2ZQ2A 1AVXA 4D7GA 1GBKA 1SC8U 5JYIA 3PTNA 2BD9A 3OSYA 1A7SA 1GI7B 1GHVH 3EE0B 1K1MA 2AFQB 3A83A 4OGXA 1EATA 1JRTA 3A8CA 3O8DA 1TRYA 4DY7B 4X8SH 1IQEA 1FPCH 1ZJKA 3DFLA 1ETTH 2ZO3H 1BA8B 2A7HA 1DWDH 3TIUA 2ZHQH 2R3UA 1G2MA 3FAOA 2PUQH 1P0SH 2GT8A 3MU5A 3T5FH 1P2NA 1ZRBA 2BXTH 1PQ5A 4AYYB 1ZPBA 2SGAA 5HGGA 1AFQB 1SPJA 1BTHH 1DOJA 3NWUA 3I78A 1UTQA 3SJ9A 3RM0H 3U1JB 2O9QA 3TITA 2VJ1A 2UUKB 1TGNA 1VITH 1O3FA 3GCOA 5F8TA 2NU3E 5HXFA 1C1UH 2BDGA 2R2WU 4BAKB 1FQ3A 1MAYA 3U8TH 4H6SB 4ABBA 1OWEA 1OWKA 4AFZA 5EPNA 5I25A 1V2ST 1FY4A 3TK9A 4E06H 1DLKB 2A2XH 1YCPK 2ZTXA 5E2OA 4GCHG 3ZZ3A 1F7ZA 1GCTC 1W12U 2FYQA 4X2WA 5BRRE 1KSNA 4YT7H 2FXRA 1JMOH 4I8GA 5DP7A 5EXNA 1P8VC 1NFWA 1T8LA 4GAWA 1VZQH 4MPXA 3M3VA 1PPFE 2F3CE 1HAIH 1GDUA 1ELBA 2A32A 1GHYH 1CGJE 3VB6A 4NFEA 2ZG0H 2SGDE 1ELFA 1C5MD 4NA7A 4BXSA 1GMDF 4CBNA 3EDXB 1SQOA 1ELGA 4TWYA 2F9OA 2XTTB 2SFAA 1ANDA 3RXOA 1L1NA 1L1JA 1Y3XA 2Y81A 3OY5U 3G01A 1HAZB 3SU2A 3SV6A 5B6OA 3KL6A 1VR1H 2EEKA 3ZVAA 2V35A 1ELTA 5E8EH 4K1TA 1M9UA 3B8JA 3DA9B 3M37A 2GTBA 1D3PB 2W7SA 2DE8A 2CV3A 2HPPH 4WWYA 4X6OA 1A5GH 3RXLA 1Y5BT 2AGGX 1HUTH 1Y59T 1K1LA 4AFQA 1JBUH 5C3NA 3RLYH 2ZFRH 3KQEA 4NCYA 4Q7XA 1YC0A 1XKBC 4FUIA 4ABDA 2BDAA 1AQ7A 3VXEH 1BRBE 1GBMA 1ID5H 4I32A 1E37B 3SNAA 1F0RA 4ZXXH 4R8TB 2ZQ1A 4MPUA 1L0ZA 2ZU2A 1GDNA 3VB4A 4NIYA 5DJ7A 1CE5A 1GBLA 2G81E 1THRH 3LGWA 1W11U 5JDUB 4I7YH 1S85A 1HDTH 1FY3A 3SU0A 1V3XA 2FDAA 1MTSA 1WQSA 3AVZA 3QLPH 1UCYE 2VIOA 2QN5T 3SOSA 1DWEH 3JZ2B 4AORA 1ZSKA 1LVYA 3VEQB 4B74A 1GG6C 2VNTA 2OLGA 3GISB 2WUBA 3KCGH 3ODFA 2J95A 3E1XB 1ELCA 4X8TH 3DD2H 1TA2A 3JZ1B 3BF6H 1RGQA 2CHAB 1FONA 3RXRA 4VGCB 4CRGA 1ZZZA 1SGIB 4YT6H 2BLWA 3T28A 1KTTB 4DIHH 3P92A 1LMWB 1DY8A 1DUEA 1Z6EA 2TBSA 3U9AH 4D7FA 2VB0A 3BTWE 4B76A 2BQ6B 1OYTH 1ACBE 1GBJA 1EAIA 1O3DA 2ANYA 3UOUA 1GBIA 2AERH 4MVNA 3T2NA 2TGAA 2AIQA 1LHGH 2CF9H 3CENA 4GSOA 3U1IB 1G2LA 3PB1E 1PPZA 1A3EH 3MU4A 4A6LA 4ZMAH 1PPBH 5DK1A 1ZR0A 2CF8H 2C8XB 1SGPE 3MFJA 1WYKA 1NM6A 2VIWA 4D76A 3PWBA 1CHGA 1YP9A 1SR5C 1AZ8A 1A0HB 1YPMH 2BY6X 2FI5E 3VXFH 2SGPE 3SJOA 3TNSA 1HXFH 4HI3A 3BTQE 1SI5H 3QGJA 1CT0E 1C1MA 1O2OA 1Y3VA 1EP5A 3RXJA 3OTJE 1GJCB 1EKBB 4FUJA 4TY7A 1AMHA 1GJ8B 2FX6A 4IN2A 1C2IA 1O2RA 2Y7XA 1HBTH 1TAWA 2ZHEH 2XBWA 2BD7A 2P94A 1SFQB 3T26A 4XBDA 3EYDA 2R0LA 4JYUH 1MAXA 1N6YA 4YM9A 2ZGJA 1OPHB 2O8LA 2VGCC 1E35B 5LPFA 4YZUA 5HM9A 3ZZ9A 2AGEX 5A8XA 4AX9H 1G9IE 1HJAC 2PLXA 3B9FH 4I8JA 2BOHB 3SNDA 3D65E 2BY8X 3QDZB 5GDSH 3HK3B 3QZRA 1PQAA 4D8NA 3ZZBA 3V7TA 1EAWA 1TNKA 3BTHE 4B73A 1O3MA 1DM4B 1JIRA 3MH4A 4FU8A 1J15A 1N1LA 1SLWB 1MTWA 5DP5A 2XCNA 2ZHWH 1AGJA 1PQ7A 4JZEH 2BLQA 3MNBA 4HTCH 1P12E 3BG4B 3E3TA 1BHXB 3A88A 3S9CA 4XFQA 1DE7H 4NWKA 1GHWH 1MKWK 2QXHA 1O3JA 1MTVA 1HB0B 1ESBA 5GJ4B 2WPKS 2ZU5A 3GCTF 1GBEA 1A0JA 1ZYOA 2G00A 1C5VA 2GMTC 1IQNA 1NU9A 2BDHA 5EODA 3RXAA 2ZA5A 1K21H 1Y3YA 5SGAE 2FOMB 4AOQA 4U01A 3P95A 1C1SA 4JK5A 2FODA 2F9VA 1P2QA 4KTSA 1IQHA 1YCPH 4K60A 1SLVB 1SGYE 1DLEA 1HGTH 1EPTB 4AYVB 3Q3XA 1G36A 4CHAB 1O2PA 3M36A 1O3PB 4DVAU 3PMHB 1IQLA 1P02A 1QRWA 1HNEE 1Y8TA 3UQVA 3GY2A 2ZTYA 1UTKA 1KXBA 3RC5A 3KQDA 2YNBA 4E7NA 1BDAA 1W0YH 2R9PA 1FPHH 1BTZA 5DP4A 3W94A 3TPIZ 1EOJA 1DVAH 3KHVA 3M7QA 2ZPQA 4FXGH 1K1JA 1DT2A 2YOLA 3MH5A 1Z8IB 6CHAB 1TALA 1YPKH 1C4V2 1TMTH 2A31A 2OXSA 1NC6A 4JYTA 4X0WU 1T8MA 1AWFH 2XBXA 4Y0YE 1O5CB 1DPOA 3BTFE 2HVXA 4JZ1A 2UUYA 1C2HA 2VVCA 2EI7A 1YLCA 5AHGH 1D9IA 3AAUA 2SGEE 1UJ1A 3Q76A 3W95A 1V6DA 5JBTA 2XBVA 3RXDA 1P06A 1EAXA 1UCYH 3SI3H 3RC6A 5LGOA 4X1SU 1BRAA 1KDQB 3URCA 1KXFA 6GCHG 2ZFTA 1HAGE 1YCPM 1HAYB 4MNVA 2G4UA 4WF8A 4UFFH 1K9OE 3CS7A 3SJKA 5JBAS 1O2YA 5A0BA 2EI8A 3QGNB 3P8OA 1CA8B 1KXEA 1ABIH 2XRCA 2CN0H 2Z3EA 2OBOA 1DUAA 1S84A 4IN1A 3PROA 4WH6A 3SO3A 3TU7H 1B5GH 1WTGH 5DKMA 1GBAA 1S82A 3ZVGA 5AFZH 3O8CA 3RLWH 4Y8ZA 5K7RA 1BMLA 1LVOA 2B7DH 1QY6A 2SGFE 1EZQA 1QCPA 4NZQA 7ESTE 1NRQH 3SGBE 3FVFB 1VITG 1N8OB 4RKJB 2ALPA 2VIPA 1C1RA 1YBWA 1O2KA 5C1UA 5T3HA 2W5EA 1HAVB 1C4Y2 5EXMA 4NWLA 2VIVA 4MQAA 1BBRK 1DICA 2A7JA 1O3CA 2OQUA 1AD8H 1C2JA 5JB9S 3DUXH 5FPTA 1J9CH 4ISLA 4CR9A 3UIRA 1G32B 1BQYA 1GI2A 5T6GA 2FZZA 1AIXH 1AB9B 4BTIB 1C9TA 1GMHG 1XKAC 1SOZA 1J14A 1UVSH 1W0ZU 1B0EA 1TPAE 3O8BA 1UTLM 2WYJA 3SNEA 1KDQA 3H7OA 1UTOA 1NU7B 1SGTA 2LPRA 3RXPA 3TVJB 5DO4H 1GL1A 3BTEE 1RIWC 4RN6A 2ODQA 3A89A 1NTPA 1F92A 3SUEA 5EQRA 1CBWB 5TCCA 4B2BA 1P2KA 4YOGA 3GDUA 5FBIA 4B71A 1ZLRA 2AH4X 3NZIA 2H5CA 4Y79A 3ESTA 2Y80A 1V2PT 2VH6A 2UWPA 5JPMH 2TIOA 3K9XB 1NESE 1GMHF 3E91A 2FESH 1O2TA 4IGDA 2VWLA 4J2YB 2ZIQH 2ZFFH 2ZGCA 1UK3A 2FS8A 1HAXB 2AGIX 4FUBA 5DG6A 1C2DA 1HYLA 2Y6TA 3L6PA 4X1RU 3LIWA 3N7OA 4Y11E 2FOGA 4OS6A 1TGBA 2P3FH 2XBYA 4K8YA 1EJAA 2H5DA 3PMJA 2BVRH 3V3MA 1YGCH 2KAIB 4BTTB 4INKA 4X8VH 3T25A 1PQ8A 3TJNA 1RD3B 1PJPA 1AI8H 1O34A 1YF4A 1Z7KA 2C93B 2DE9A 3NPSA 4NSYA 4X6PA 4XE4A 4BAQB 1T4UH 1SLXB 3F1SB 1DANH 3UREA 1PPHE 1O33A 3LU9B 1WAYB 2QGRA 3KNXA 3VB7A 1SMFE 1CQQA 1NFXA 4MTBA 3BV9B 3MO3A 1G30B 1UTMA 1C5NH 1V2QT 2ZI2H 4BAOB 4YOIA 1Z8RA 1BHXF 3F9GA 4I8KA 3ZVCA 3LOXA 4ISIH 1LCYA 1P10A 2QA9E 3RP2A 3MNCA 1SSXA 4ASHA 2R0KA 2NU1E 3EQ0H 1O5FH 3RXBA 3I77A 4O3UA 4UFDH 3TK5A 1P9SA 2QIQA 4Y10E 1H8DH 3AW1A 3OY6U 3LJOA 1UVTH 4JK6A 3TK6A 1J8AA 1W2KH 5C5OA 3EA9A 1AFEH 1IAUA 1W10U 7LPRA 2GVFA 3SW2B 2OC0A 3M5LA 1GMCG 3UFAA 1AU8A 1ZHMA 1BZXE 2A4GA 2F83A 1TFXA 3VGCB 3S0NA 4MNYA 1D6WA 1XUKA 2FPZA 1KIGH 3A8DA 2AMDA 2UWOA 4AGJA 3BTTE 9ESTA 4K1EA 1Y3WA 4ISHH 1FIZA 3MO6A 1MD7A 4IBLH 4SGBE 4TWWA 1GJDB 1V2LT 1CT2E 2GCTC 1O2VA 1ELVA 3TGIE 2A7CA 5TCAA 1MBMA 2NWNA 1Z71A 1E0FD 1V2MT 2KAIA 2OC7A 3RXIA 2GDEH 1ZGVA 3GY4A 1YPEH 3BTGE 5L30H 1O3LA 1GMCF 3P8FA 3H7TA 1KXAA 1EQ9A 2UUFB 1DWCH 1KTSB 1V2KT 1MKXK 1LVMA 1V2TT 1UVOA 3MWIU 1J17T 2D26C 1SB1H 2P8OB 3SV2H 3A7TA 1C2EA 1XUHA 3UOPA 4Y0ZE 5L2ZH 1SGRE 1KLTA 1FUJA 4X2VA 1TNIA 1ANCA 4DW2U 1FI8A 2RA0A 4KGAA 3K6YA 3UQOA 2TGTA 1DX5M 2BX3A 3GCHB 4GCHF 1FY5A 1BTXA 1YPLH 5J4SA 2FTMA 1O2QA 1XM1A 2GD4B 3D23A 3GY7A 4FU9A 3SU4A 2PTNA 1AFQC 1TPOA 1P57B 4IMZA 1BB0B 1C5SA 5T6DA 4RKOB 3EAJA 4Y76A 2R2MB 4ZKRU 3PWCA 1E34B 3ZV9A 1MD8A 2QCYA 4UONA 1EXFA 4Q7ZA 1GHAG 2C8YB 3KEEA 1OS8A 1GBDA 2Z9JA 4I8LA 2XYAA 5EW1H 4OGYA 1T8NA 1LQEA 2DUCA 2ODPA 2TRMA 1O5GH 3ATMA 4DCDA 2RA3A 4SGAE 2WV5A 4ZXYH 2ZHFH 1O37A 1O5EH 1P01A 9LPRA 2SGQE 1V2UT 8GCHG 4YLUA 2FOEA 2BXUH 1C1QA 1QTFA 1Z8JB 4UE7H 1BTPA 1IOEA 2R3YA 5ESBA 1XVMA 1GI3A 1EZSC 2RDLA 4X1QU 2TPIZ 1K28D 1QQUA 2ZWLH 1A5HA 1D6RA 1GBFA 3VB3A 1AO5A 4DT7B 1QJ1B 2C8WB 1GHAF 2BD5A 2OCVB 2G51A 4FU7A 5F8XA 1H8IH 1ELEE 4TY6A 3NUMA 3FZDA 2A5AA 3Q00A 3TJUA 1A61H 4UDWH 4O97A 1O36A 4X1NU 1GI0A 3F9HA 1IQKA 1D4PB 1TNGA 1EB1H 3STJA 7GCHG 4NZLA 3TNTA 1L4ZA 1CVWH 3ZVBA 1ZSJA 2HALA 4Q80A 1GI6A 2O8UA 3ITIA 1CGHA 4ISNA 3RMNH 5GWZA 5DP8A 3GY8A 4ZUHA 1O5AB 3ZZ8A 1O0DH 2VINA 1TPSA 1V2RT 2BDBA 1D3TB 3PO1B 1GVKB 2Z9KA 2JKHA 2BLVA 3UWIA 2JH6D 2ANKH 1O3BA 2F91A 4M7GA 2AS9A 1A0LA 1Q31A 3SUFA 1QURH 4A1TA 2BDCA 1MQ5A 1MQ6A 7GCHF 4CRFA 2FOCA 1XXFA 4AFSA 1C2KA 4CH2B 4X8UH 2Z94A 3U8RH 2CXVA 3SGAE 5L2YH 3LGYA 1LDTT 1NRPH 1RFNA 2WPIS 1C5RA 2JH5D 5EXLA 4WY3A 3RU4T 5JB8S 2J92A 2GMTB 3V12A 4JZFH 2GV6A 1UMAH 1GGDB 1SGFG 3HGPA 3M5NA 1F0TA 4LZ1H 2ANWA 4LOYH 5JBBS 1HJ9A 3I29A 1QL7A 2A4QA 4UEHH 2ZCKP 2C4FH 3U8OH 3UY9A 4ABEA 4ABFA 4LK4A 1GI4A 4Q2KA 2STAE 2AMQA 2CHAC 1EUFA 2OD3B 3SU5A 1YLDA 1S6FA 3BTDE 2ZZUH 1CA0B 4VGCC 1VCPA 3LH1A 2H2ZA 6LPRA 2D1JA 1HAPH 4LXBH 3S9BA 1O2JA 1T8OA 2BZ6H 1L2EA 4JZIA 3UPEA 3NKKA 4MNXA 4DG4A 1O39A 1AVWA 2CJIA 1EOLA 2P16A 4AB8A 3SQEE 3TGKE 3FP6E 2ZGBH 1C1TA 2BVXH 1RS0A 4MG3A 3GYLB 1AUTC 3ZV8A 1QBVH 2Q6DA 1GI5A 3A80A 3SORA 3MNSA 3RXKA 1D3QB 4JZDH 4GPGA 2F9BH 2W3IA 1O3GA 3RMLH 1LHFH 1BTYA 2Z7FE 1DFPA 2ODYB 2ZDKA 3GOVB 2PKSB 3BN9A 3EGKH 2OQ5A 3URDA 2O8TA 1UK4A 4AFUA 2XWBI 3ZZ4A 1G37A 2ZEBA 3RMOH 1JXPA 2THFB 3A85A 1MU6B 1MZDA 2PFEA 4FVDA 1WOFA 1LHDH 4BTUB 1K1NA 2A5IA 5HMAA 2H9EH 2Z9LA 2YNAA 1YM0A 2H6MA 3GY3A 4DOQA 2D8WA 4Y71A 2Y5FA 2J38A 1TGSZ 4NSVA 3ODDA 1GWAA 3BSQA 2NU4E 5GIBA 3RUOA 1ZHRA 3MYWA 2PR3A 1QHRB 2TGDA 1TB6H 2ZDAH 4CRBA 1THSH 2FI4E 1AN1E 1TMBH 1C5PA 4CRAA 2BY7X 1FN6A 1O2GH 2AIPA 2XW9A 1TNLA 1Y3UA 2PTCE 1PYTD 3UR6A 5T6FA 4ZKOU 2VH0A 1WQVH 2BY5X 4ZH8A 1QJ7B 5AFYH 4ZHMU 2G8TA 3F6UH 2A0QB 3S9AA 3SJIA 3ZZ7A 1T31A 2VWMA 3QK1A 1ESTA 3MI4A 4HGCA 1AE5A 3MU8A 1PPCE 1SOTA 2ULLA 1TE0A 2H9HA 3M5MA 4WXIA 5DPAA 4F49A 3SU3A 3BG4C 3ENSB 4ZAEA 2H9TH 2FWWA 2FI3E 1ZMJA 1ZTLA 1NZQH 1BJVA 2F9NA 1O32A 2GDDA 1LHEH 2PHBA 2ZCHP 3S7KB 2FP7B 2C8ZB 1RJXB 2HRVA 1TLDA 5EGMA 2BQ7B 1MMJN 1TNHA 1F2SE 5EOKA 2QXGA 1KLJH 1BTUA 2HLCA 5LPRA 3GY6A 1O31A 4AN7A 1HPGA 1W8BH 4GVUA 1JIMA 3SU6A 3QTOH 1TQ0B 1AKSB 1V2WT 5GXPA 3GICB 5FCKA 2JETB 1DXPA 3AASA 4WMDA 4CHAC 1C4U2 1EPTA 3F9FA 3PM3A 1FAKH 2A5KA 3MOCA 3UR9A 1RTFB 2A4OA 2QAAA 1VCQA 3CS0A 2WV4A 1EB2A 1V2NT 3SI4H 3PLKA 5A8ZA 4RSPA 3K2UA 4ABAA 3HPTB 2ZFSA 3ZZAA 3FP8E 1UO6A 5FPYA 2PW8H 1NROH 3A7VA 3GYMA 4BXWA 5CHAB 1EAUA 4J1YA 3ZYDA 1OP2A 1O35A 1TX7A 3BTME 1O3KA 4BANB 1UK2A 3MHWU 1MTUA 1F5KU 3BEIB 2WPJS 3CP7A 4A1XA 1ZJDA 3MMGA 1RXPA 2GZ8A 6GCHF 3LGIA 2P3TB 4B2AA 1TONA 2HOBA 2V3HH 3A87A 3P8NA 1QNJA 6CHAC 1TBRH 5GCHG 3RXTA 3SGQE 3D49H 2EI6A 4YLQH 2BYAX 2WPHS 2P59A 1GI1A 2K1QA 2GP9B 1VJAU 4D9RA 3M7TA 1XVOA 1WBGB 4KP0A 5H4IB 1AE8H 2RG3A 2ZP0H 1F0SA 3M61U 2V6NA 4H6TA 4X1PU 4E7RG 1H9HE 1ZPZA 1Y5AT 3DFJA 7KMEH 1IQIA 3GY5A 4K2YA 4JMYA 1BBRE 4Z0KA 2P95A 3R3GB 5JBCS 2WUCA 2VVVA 4LZ4B 1VGCB 2ZC9H 2HNTF 1ANEA 1MTNB 4IW4E 1UHBB 3RXVA 1TWXB 8KME2 2NU2E 1O38A 2C3SA 4A1VA 1IQGA 3FANA 2FOHA 4IC6A 1OWIA 5DP6A 1AKSA 1P2JA 1VITF 2XWAA 3UTUH 2M5TA 2HWLB 3VB5A 1GL0E 4MPWA 1TGCA 2J94A 1PPEE 2PGQB 4F4OC 2FEQH 1L1GA 2A45B 2PV9B 1W3CA 1GDQA 3ATKA 1K1OA 1ANBA 5ABWA 2FOAA 3F68H 3PLBA 2XC5A 4TPYA 1H4WA 2Y5HA 1T32A 2FS9A 1QRZA 2I6QA 1GBTA 2HGTH 4K69A 3BIVH 4MDSA 5FBEA 4FUCA 5E0HA 1BRUP 2O8MA 5G4BA 1C1NA 1NRNH 1O3EA 1HV7A 1FY8E 3SUDA 5IDKA 4NA9H 2C90B 3ZZ6A 1N8OC 4I33A 4K3JA 1HAOH 1P2IA 1AY6H 1ZSLA 2STBE 3LJJA 1FIWA 2EA3A 4MNWA 1PPGE 1OP0A 3LPRA 5C1YA 1KXCA 5DP9A 3TGJE 2XNIA 3RU4E 1HAVA 2Z9GA 3QX5H 1MKWH 3E8LA 1TQ7B 1WCZA 1C1VH 3M5OA 1EZXC 1S81A 4FVBA 3L3TA 2W7UA 4OS7A 5C67A 1ZTKA 2BTCE 1GJAB 3SJ8A 2BHGA 3R0FA 4O3TA 1NO9H 1O30A 1AB9C 2ZKSA 1YKTA 1LPZB 4KTUA 5EQQA 2ZTZA 4XBCA 1OSSA 2F9PA 4INLA 1VCWA 1GCTB 3KQBA 1A1RA 5FHTA 4FUFA 1GCDA 1XUFA 1NN6A 1OYQA 1SGQE 1DY9A 1O2ZA 3QWCH 1C5ZB 4O03A 1HCGA 1QB1A 3ATLA 1CBWC 2ZECA 3GDSA 3P6ZB 4Y8XA 5GPIB 4ZKSU 2OINA 1OP8A 3HK6B 1X7AC 4GUXA 1O3OA 4XOJA 3IG6B 4X6MA 1MU8B 1TYNA 2UWLA 2TGPZ 1C2FA 1YYY1 3L33A 1TOMH 1SLUB 1H9LB 5EU8A 5I46H 1P3EA 3A81A 3LC5A 5BPEA 2XC4A 2G5NA 1S83A 1C9PA 1C5TA 2QXJA 2GGVB 1PFXC 1BCUH 1QR3E 2D2DA 1CO7E 4ABIA 1C1OA 1D3DB 4DJZB 3OX7U 3OYPA 1QL9A 2PWXA 1GPZA 1MH0A 4Q7YA 1WSSH 3FP7E 3SV9A 2ZF0H 3RXFA 4AZ2B 3WY8A 4FUHA 1NPMA 3B23B 3M35A 3S69A 5C20A 1LVBA 2FLRH 2LNCA 5AVDA 1C5OH 3MH7A 4FUDA 1HFDA 1XUJA 1SFIA 3LGTA 2BQWB 3E6PH 1O3AA 4BAHB 1EJNA 1F0UA 1QA7A 1VJ9U 1ZGIA 3ZYEA 1UVPA 5PTPA 4WMEA 1GMDG 3FZZA 1SGFA 1TRMA 3M3TA 3A7YA 1O3NA 4X2YA 2Q6GA 5FAHA 4NA8A 4AGKA 1FXYA 4XBBA 4A7IB 4ZKNU 2HPQH 1OOKB 4OS1A 1BMAA 1AHTH 4X6NA 3QN7A 1OKXA 1GG6B 4WXVA 1Z6JH 3RXHA 1NS3A 3UNRA 1LPKB 2GCHG 2ZGXH 1QBNA 1IQFA 2BDYA 1GBCA 1SBWA 3BTKE 5LPEA 3T29A 4E05H 4XDEA 1TMUH 3HKJB 1GI9B 2ASUB 3IWMA 3VGCC 1DITH 3ZVEA 3PMBB 1ARBA 1P09A 1O2MA 1GBHA 1S6HA 5A0AE 5CMXH 3SV7A 3PV4A 4Y7AA 5C2ZA 2OP9A 1TX8A 1LO6A 3QTVH 1SHYA 3C1KA 4AB9A 4UD9H 1TABE 3TH4H 2ZFQH 4GHQA 2ZU3A 3E0PB 4WJG2 1F5LA 4ABJA 1ESAA 3A82A 1RTLA 2GCHF 2WPMS 2J4IA 5E0JA 1Z1JA 1ABJH 1JWTA 1RRKA 1ORFA 3KF2A 1G3DA 4YOJA 1QA0A 1GI8B 1GBBA 1BBRH 1HJ8A 3RXQA 1Q3XA 3RM2H 1IQJA 3RMMH 2G5VA 2ZHDA 1BMNH 1KY9A 1MZAA 1UCYK 3BEUA 3P70B 3MU1A 1BITA 2P8OC 4TYDA 1HIAB 4YTAA 1MCVA 1ARCA 1NT1A 3ZVDA 1SHHB 3E16B 1LQDB 2P93A 1FV9A 1XXDA 8GCHF 2W26A 1GHZA 3GCHC 2WYGA 3M7UA 1B0FA 1RTKA 2PKAB 3MH6A 5DP3A 1LHCH 1C2MA 2FOFA 1Q2WA 1S5SA 4CRDA 3LGUA 5F6MA 1ZRKA 1MCTA 4ZHAA 4NIVA 1C5QA 2GV7A 2VGCB 4KELA 3LKWA 3SHAH 2Q6FA 1UTNA 1OX1A 5A2MH 1P03A 2GT7A 3PTBA 1TIOA 1HJAB 4KKDA 4CBOA 1BTWA 1QBOA 1ZOMA 3Q77A 1INCA 1C2GA 1CSOE 1OWHA 2IN2A 4CREA 1GJ7B 1P3CA 1O2SA 2VWOA 3LONA 1OWJA 5EPYA 1AZZA 3AAVA 1Z8GA 2BDIA 3AW0A 3LGVA 4CRCA 1BJUA 2BD3A 2FLBH 3SNBA 4FUEA 4H42U 1LTOA 3V13A 2OBQA 1GHXH 2B0FA 1XUGA 4Z6AH 4K5ZA 3Q3KA 1EP6A 1UVUH 1EASA 4IMQA 1XMNB 2SNVA 3HGNA 3A84A 5K0HA 2ALVA 1GJ4H 1DWBH 4WVPE 4ZHLU 5E0GA 3SHCH 5FX6A 2ZGHA 1XUIA 1ELAA 3SNCA 3S7HB 2QV1A 1WU1A 2AMPA 1TBQH
chains in the Genus database with same CATH superfamily
2OUAA 3RXUA 1HIAA 1Z1IA 3SV8A 1WV7H 1EX3A 1QIXB 3T62A 1A2CH 3EA8A 2QE7D 3EA7A 1HXEH 4IS5A 2BOKA 2BLOA 1B7XB 1QGFA 3IITA 2PKAA 2BZAA 2HNTC 5E2PA 1SGEE 2QY0B 1LPGB 3UNQA 1GJ6A 1N6XA 1FY1A 1IQMA 1TRNA 3GCTG 1G3BA 1O2LA 2ZPSA 1NRSH 3SBKA 3PO1C 1YPGH 5EW2H 4TPIZ 5FX5A 3ELAH 4Y6DA 1F5RA 2ZDVH 3BIUH 1W7GH 3F9EA 2PSXA 1AWHB 1QQ4A 2V3OH 2ZFPH 4U30A 1MBQA 2QF4A 1SQTA 1FDPA 2QF3A 4I31A 3VPKA 1P2MA 1CU1A 2Z3DA 1C5XB 1G3CA 3RU4D 3A7ZA 2J2UA 5A8YA 2FOBA 1TBZH 2B8OH 2VIDA 1CHOG 4CR5A 4NIWA 3U69H 3A8BA 4WMFA 5FXLA 1SQAA 3NXPA 3TH3H 1T4VH 3MTYA 2F43B 1V2JT 1TGTA 1BRCE 2CGAA 2Z9IA 3K6ZA 2BB4A 1O3IA 3FFGA 1AVGH 4HZHA 1E36B 2WPLS 3K65B 2J9NA 2RCEA 2XCFA 1QL8A 4JYVH 1GGDC 5F8ZA 3RXCA 4AG1A 1DS2E 5FPSA 4K8BA 1XX9A 2W3KA 1MKXH 4D9QA 1DDJA 1JOUB 1BOQA 1LKAA 2UUJB 3TLOA 2F9UA 4BNRA 3PLPA 2P3UB 3RXSA 3SUGA 1CA0C 1W0KD 1SGDE 4P00A 1CHOF 3ZZCA 1E79D 5HM2A 5HIYA 8LPRA 2JJ2D 2Y7ZA 2A2QH 4AG2A 2QF0A 2OC1A 3UUZA 2ZCLP 4GHTA 4UFGH 4NGAH 3ATIA 2BM2A 1BIOA 4O9VA 4RT0A 1O2HA 2AHME 3RXMA 1QB6A 2FM2A 4QT8C 4R0IA 4B75A 5EJLA 3VFEA 2ILNA 4BAMB 1FLEE 1O2XA 3MNXA 2FIRH 1TOCB 1NBMD 1C1WH 1ETSH 4YO9A 4DGJA 4FUGA 1S0QA 2H1UA 2HNTE 1HLTH 4NG9H 2G52A 1EJMA 2BMGB 3H5CB 3STIA 2FYRA 1C5UA 1U6QA 3KIDU 1DSUA 1ZPCA 2CMYA 2PKSC 2VU8E 6ESTA 1O5DH 1QFKH 4H4FA 2IJOB 3TH2H 5TJXA 4K1SA 1P04A 1P2OA 3MO9A 1FAXA 3GDVA 2FMJA 1ELDE 1W14U 4GLYA 3NK8A 2BVSH 5HKKD 1V2VT 2O8WA 1BUIA 1THPB 4YESB 2QXIA 2VIQA 1O2IA 2VWNA 1EPTC 4CH8B 1YPHC 4WH8A 1SG8B 1WTHD 3ZVFA 4B2CA 2KCOA 4ISOA 4KTCA 3DHKH 4UFEH 1O3HA 2BD2A 5EG4A 1J16A 2AEIH 2QC2A 3MU0A 3ATWA 4ESTE 4THNH 1TPPA 2GKVE 3NCLA 1TX6A 1L4DA 2ZDNA 3HKIB 3C27B 3O8RA 1NFUA 1V2OT 1YPJH 3TJVA 1ZTJA 3M3SA 5C5NA 1WUNH 1EZUC 1UTJA 3PV5A 2GZ9A 2NU0E 3D62A 2VVUA 4ASUD 4X2XA 3KQCA 2B5TB 3KGPA 5LH8A 5F03A 1H9IE 2PGBB 1RIWB 2ZDLA 3PMAB 3PYHA 2BX4A 1JRSA 1MUEB 1GJ9B 4IC5A 1S0RA 1CGIE 1OXGA 5FL7D 2JH0D 4ZROA 3QUMP 1ETRH 1A46H 1C2LA 3ZZ5A 3RDZA 1LKBA 1GJ5H 8ESTE 3OU0A 1ZMLA 5C0TA 3Q3YA 1DXWA 2G55A 2I6SA 5C1XA 2Z3CA 2AYWA 2BD4A 3N7DA 1K1PA 2Y5GA 4MLFB 1NRRH 2A1DB 4INHA 1TNJA 2J34A 1IHTH 1SGCA 4U2WA 2ZU4A 1FZZA 3A7XA 4HFPB 2YMSC 3BG8A 3RXEA 2JJ1D 3DT0H 3SQHE 4Y7BA 3UWJH 2BY9X 2SNWA 2ESTE 1A3BH 2XXLA 3P17H 1BMMH 1FNIA 4XSKU 2Y82A 4ABGA 2Q1JA 4OS4A 1GJBB 5ESTE 1QRXA 1UTPA 4A5TS 5CE1A 2WZQA 1K22H 1W13U 2XC0A 2IOTA 3A8AA 2IPHA 4MPVA 1K1IA 5HYOA 5FCRA 4OS2A 2JETC 2WINI 1K2I1 3U98H 3PV2A 1HAHH 2ZDMA 5GCHF 1BT7A 2WSSD 1GHBG 3P8GA 3BEFB 1NFYA 4OS5A 4A92A 1T7CA 1E38B 1ZMNA 3GCNA 3KN2A 5A09A 5A0CA 2OTVA 1KYNA 1TA6A 3T27A 3TJOA 4DURA 1FN8A 5EQSA 1GVZA 1YPHE 5ETXA 1H1BA 2OC8A 3SZNA 3FOAA 1P05A 3A86A 4NIXA 2FO9A 5IYTA 1A5IA 1ZHPA 1C5YB 1KLIH 1NY22 5CHAC 1O2WA 1S6LA 5T1VA 5L6NH 3V0XA 1PYTC 2B9LA 3A7WA 4NFFA 4U32A 2A4RA 3ZZDA 1SGNE 3WWFA 1FMGA 1O2UA 2ZNKH 2GX4A 4TSFD 5AF9H 4DIIH 1CT4E 3LC3A 4BOHA 2V7QD 1SVPA 1GHBF 3E0NB 2FX4A 1C1PA 1SL3A 1DSTA 1W7XH 2ZU1A 2KCPA 1FJSA 2EC9H 3LDXH 3SU1A 1QJ6B 2FTLE 2PUXB 3PRBA 1P11E 2QYIA 3E90B 4I8HA 4PROA 1SKYE 3HATH 1IHSH 4JCNA 4B1TA 3QZQA 2Z6BD 1P9UA 5J4QA 2ZPRA 1A4WH 1VGCC 5DGJA 2V0BA 1MTNC 1OWDA 1KXDA 1HRTH 4Y8YA 4ABHA 1GVLA 3RXGA 2GCTB 1O5BB 3QO6A 1UHBA 1G3EA 2PSYA 1AUJA 1C5LH 1Y5UT 2GZ7A 2G4TA 1C5WB 3UNSA 2ANMH 3RC4A 1O2NA 3LT3A 1QB9A 3SN8A 3LH3A 2BD8A 2ZQ2A 1AVXA 4D7GA 1GBKA 1SC8U 5JYIA 3PTNA 2BD9A 3OSYA 1A7SA 1GI7B 1GHVH 3EE0B 1K1MA 2AFQB 3A83A 4OGXA 1EATA 1JRTA 3A8CA 3O8DA 1TRYA 4DY7B 4X8SH 1IQEA 1FPCH 1ZJKA 3DFLA 1ETTH 2ZO3H 1BA8B 2A7HA 1DWDH 3TIUA 2ZHQH 2R3UA 1G2MA 3FAOA 2PUQH 1P0SH 2GT8A 3MU5A 3T5FH 1P2NA 1ZRBA 2BXTH 1PQ5A 4AYYB 1ZPBA 2KM0A 2SGAA 5HGGA 1AFQB 1SPJA 1BTHH 1DOJA 2KCAA 2WHXA 3NWUA 3I78A 1UTQA 3SJ9A 3RM0H 2OK5A 3U1JB 2O9QA 3TITA 2VJ1A 2UUKB 1TGNA 1VITH 1O3FA 3GCOA 5F8TA 2NU3E 3DSOA 5HXFA 1C1UH 2BDGA 2R2WU 4BAKB 1FQ3A 1MAYA 3U8TH 3DSPA 4H6SB 4ABBA 1OWEA 1OWKA 4AFZA 5EPNA 5I25A 1V2ST 1FY4A 3TK9A 4E06H 4I86A 1DLKB 2A2XH 1YCPK 2ZTXA 5E2OA 5KEDA 4GCHG 3ZZ3A 1F7ZA 1GCTC 1W12U 2FYQA 4X2WA 5BRRE 1KSNA 4YT7H 2FXRA 1JMOH 4I8GA 5DP7A 5EXNA 1P8VC 1NFWA 1T8LA 4GAWA 1VZQH 4MPXA 3M3VA 3FKSD 5EIYA 1PPFE 2F3CE 1HAIH 1GDUA 1ELBA 2A32A 1GHYH 1CGJE 3VB6A 4NFEA 2ZG0H 2SGDE 1ELFA 1C5MD 4NA7A 4BXSA 4FETA 1GMDF 5KGOA 4CBNA 3EDXB 1SQOA 1ELGA 4TWYA 2F9OA 2XTTB 2SFAA 1ANDA 3RXOA 1SQRA 1L1NA 1L1JA 1Y3XA 2Y81A 3OY5U 3G01A 1HAZB 3SU2A 3SV6A 5B6OA 3KL6A 2W6JD 1VR1H 2EEKA 3ZVAA 2V35A 4OM9A 1ELTA 5E8EH 4K1TA 1M9UA 3B8JA 3DA9B 3M37A 2GTBA 1D3PB 2W7SA 2DE8A 2CV3A 2HPPH 4WWYA 4X6OA 1A5GH 2LELA 3RXLA 3W1EA 1Y5BT 2AGGX 1HUTH 1Y59T 1K1LA 4AFQA 1JBUH 5C3NA 3RLYH 2ZFRH 3KQEA 4NCYA 4Q7XA 1YC0A 1XKBC 4FUIA 4ABDA 2BDAA 1AQ7A 2LP6A 3VXEH 1BRBE 1GBMA 1ID5H 3OTPA 1E37B 3KYFA 1F0RA 4I32A 4ZXXH 3SNAA 4R8TB 2ZQ1A 4MPUA 1L0ZA 2ZU2A 1GDNA 3VB4A 4NIYA 5DJ7A 1CE5A 1GBLA 2G81E 1THRH 3LGWA 1W11U 5JDUB 4I7YH 1S85A 1HDTH 1FY3A 3SU0A 1V3XA 2FDAA 1MTSA 1WQSA 3AVZA 3QLPH 1UCYE 2VIOA 2QN5T 3SOSA 1DWEH 5B6LA 3JZ2B 4AORA 1ZSKA 1LVYA 3VEQB 4B74A 1GG6C 2VNTA 2OLGA 3GISB 2WUBA 3KCGH 3ODFA 2J95A 3E1XB 1ELCA 4X8TH 3DD2H 1TA2A 3JZ1B 3BF6H 1RGQA 2CHAB 1FONA 3RXRA 3DSGA 4VGCB 4CRGA 1ZZZA 1SGIB 4YT6H 2BLWA 3T28A 1KTTB 4DIHH 3U28C 3P92A 1LMWB 1DY8A 1DUEA 1Z6EA 2TBSA 2XOKD 3U9AH 4D7FA 2VB0A 3MQKC 3BTWE 4B76A 2BQ6B 1OYTH 1ACBE 1GBJA 1EAIA 1O3DA 2ANYA 4ACAA 3UOUA 1GBIA 2AERH 4MVNA 3T2NA 2TGAA 2AIQA 1LHGH 2CF9H 3CENA 4GSOA 3U1IB 1G2LA 3PB1E 1PPZA 1A3EH 3MU4A 4A6LA 4ZMAH 1PPBH 5DK1A 1ZR0A 2CF8H 2J98B 2C8XB 1SGPE 3MFJA 1WYKA 1NM6A 2VIWA 4D76A 3PWBA 1CHGA 1YP9A 1SR5C 1AZ8A 1A0HB 1YPMH 2BY6X 2FI5E 3VXFH 2SGPE 4M9FA 3SJOA 3TNSA 1HXFH 4HI3A 3BTQE 1SI5H 3QGJA 1CT0E 1C1MA 1O2OA 1Y3VA 1EP5A 3RXJA 3OTJE 1GJCB 1EKBB 2L74A 4FUJA 4TY7A 1AMHA 1GJ8B 2FX6A 4IN2A 1C2IA 1O2RA 2Y7XA 3VG8A 1HBTH 1TAWA 2ZHEH 2XBWA 2BD7A 4B6FA 2P94A 1SFQB 3T26A 4XBDA 3EYDA 2R0LA 4JYUH 1MAXA 1N6YA 4YM9A 2ZGJA 1OPHB 2O8LA 2VGCC 1E35B 5LPFA 4YZUA 5HM9A 3ZZ9A 2AGEX 5A8XA 4AX9H 1G9IE 1HJAC 2PLXA 3B9FH 4I8JA 2BOHB 3SNDA 3D65E 2BY8X 3QDZB 5GDSH 3HK3B 3QZRA 1PQAA 4D8NA 3ZZBA 3V7TA 1EAWA 1TNKA 3BTHE 4B73A 1O3MA 1DM4B 1JIRA 3MH4A 3N7EA 4FU8A 1J15A 1N1LA 1SLWB 1MTWA 5DP5A 2XCNA 2ZHWH 1AGJA 1PQ7A 4JZEH 2BLQA 3MNBA 4HTCH 1P12E 3BG4B 3E3TA 1BHXB 3A88A 3S9CA 4XFQA 1DE7H 4NWKA 1GHWH 1MKWK 2QXHA 1O3JA 2YMSD 1MTVA 1HB0B 1ESBA 5GJ4B 2WPKS 2ZU5A 3GCTF 1GBEA 1A0JA 1ZYOA 2G00A 2J98A 1C5VA 2GMTC 1IQNA 3F2GA 1NU9A 2BDHA 2IPQX 5EODA 3RXAA 2ZA5A 1K21H 1Y3YA 5SGAE 2FOMB 4AOQA 1COWD 4U01A 3P95A 1C1SA 4JK5A 2FODA 2F9VA 1E1QD 1P2QA 4KTSA 1IQHA 1YCPH 4K60A 1SLVB 1SGYE 1DLEA 1HGTH 1EPTB 4AYVB 3Q3XA 1G36A 4CHAB 1O2PA 3M36A 1O3PB 4DVAU 3PMHB 1IQLA 1P02A 3UB0A 1QRWA 1H8ED 1HNEE 1Y8TA 3UQVA 3GY2A 2ZTYA 1UTKA 1KXBA 4Z1MD 3RC5A 3KQDA 2EQNA 2YNBA 4E7NA 1BDAA 1W0YH 2R9PA 1FPHH 1BTZA 5DP4A 3W94A 3TPIZ 1EOJA 1DVAH 3KHVA 3M7QA 2ZPQA 4FXGH 1K1JA 5DSFA 1DT2A 2YOLA 4P02A 3MH5A 1Z8IB 2M2AA 6CHAB 1TALA 1YPKH 1C4V2 1TMTH 2A31A 2OXSA 1NC6A 4JYTA 4X0WU 1T8MA 2JIZD 1AWFH 2XBXA 4Y0YE 1O5CB 1DPOA 3BTFE 2HVXA 4JZ1A 2UUYA 1C2HA 2VVCA 2EI7A 1YLCA 5AHGH 1D9IA 3AAUA 2SGEE 1UJ1A 3Q76A 3W95A 1V6DA 5JBTA 2XBVA 3RXDA 1P06A 1EAXA 1UCYH 3SI3H 3RC6A 5LGOA 4X1SU 2KCYA 1BRAA 1KDQB 3URCA 1KXFA 6GCHG 2ZFTA 1HAGE 1YCPM 1HAYB 4MNVA 2G4UA 4WF8A 4UFFH 1K9OE 3CS7A 3SJKA 3WW7A 5JBAS 1O2YA 5A0BA 2EI8A 3EE7A 3QGNB 3P8OA 1CA8B 1KXEA 1ABIH 2K8IA 2XRCA 2CN0H 2Z3EA 2OBOA 1DUAA 1S84A 4IN1A 3PROA 4WH6A 3SO3A 3TU7H 1B5GH 1WTGH 5DKMA 1GBAA 1S82A 3ZVGA 5AFZH 3O8CA 3RLWH 4Y8ZA 5K7RA 1BMLA 1LVOA 2B7DH 4FOUC 3KYGA 1QY6A 2SGFE 1EZQA 1QCPA 4NZQA 7ESTE 1NRQH 1YWUA 3SGBE 3FVFB 3OFND 1VITG 1N8OB 4RKJB 2ALPA 2VIPA 1C1RA 1YBWA 1O2KA 5C1UA 5T3HA 2W5EA 1HAVB 1C4Y2 5EXMA 4NWLA 2VIVA 4MQAA 1BBRK 1DICA 2A7JA 1O3CA 2OQUA 1AD8H 1C2JA 5JB9S 3DUXH 5FPTA 1J9CH 4ISLA 4CR9A 3UIRA 1G32B 2F4LA 1BQYA 1GI2A 5T6GA 2FZZA 1AIXH 1AB9B 4BTIB 1C9TA 1GMHG 1XKAC 1SOZA 1J14A 1UVSH 1W0ZU 1B0EA 1TPAE 3O8BA 1UTLM 2WYJA 3SNEA 1KDQA 3H7OA 1UTOA 1NU7B 1K0HA 1SGTA 2LPRA 3RXPA 3TVJB 5DO4H 1GL1A 3BTEE 1RIWC 4RN6A 2ODQA 3A89A 1NTPA 1F92A 3SUEA 2QF5A 5EQRA 1CBWB 2RFKC 5TCCA 4B2BA 1P2KA 4YOGA 3GDUA 5FBIA 2CK3D 4B71A 1ZLRA 2AH4X 3NZIA 2H5CA 4Y79A 3ESTA 2Y80A 1V2PT 2VH6A 2UWPA 5JPMH 2TIOA 3K9XB 1NESE 1GMHF 3E91A 2FESH 1O2TA 4IGDA 2VWLA 4J2YB 2ZIQH 2ZFFH 2ZGCA 1UK3A 2FS8A 1HAXB 2AGIX 4FUBA 5DG6A 1C2DA 1HYLA 2Y6TA 3L6PA 4X1RU 3LIWA 3N7OA 4Y11E 2FOGA 4OS6A 1TGBA 2P3FH 2XBYA 4K8YA 1EJAA 2H5DA 3PMJA 2BVRH 4F48B 3V3MA 1YGCH 2KAIB 4BTTB 4INKA 4X8VH 3T25A 1PQ8A 2WPDD 3TJNA 1RD3B 1PJPA 1AI8H 1O34A 1YF4A 1Z7KA 2C93B 2DE9A 3NPSA 4NSYA 4X6PA 4XE4A 4BAQB 1T4UH 1SLXB 3F1SB 1DANH 3UREA 2RDEA 1PPHE 1O33A 3LU9B 1WAYB 2QGRA 3KNXA 3VB7A 1SMFE 1CQQA 1NFXA 4MTBA 3BV9B 3MO3A 1G30B 1UTMA 1C5NH 1V2QT 2ZI2H 4BAOB 4YOIA 1Z8RA 1BHXF 3F9GA 4I8KA 3ZVCA 3LOXA 4ISIH 1LCYA 1P10A 2QA9E 3RP2A 1H8HD 3MNCA 1SSXA 4ASHA 2R0KA 1OHHD 2NU1E 3EQ0H 1O5FH 3RXBA 3I77A 4O3UA 4UFDH 3F2HA 3TK5A 1P9SA 2QIQA 4Y10E 1H8DH 3AW1A 3OY6U 3LJOA 1UVTH 4JK6A 3TK6A 1J8AA 1W2KH 5C5OA 3EA9A 1YLNA 1AFEH 1IAUA 1W10U 7LPRA 2GVFA 3SW2B 2OC0A 3M5LA 1GMCG 3UFAA 1AU8A 1ZHMA 1BZXE 2A4GA 2F83A 1TFXA 3VGCB 5C0UA 3S0NA 4MNYA 1D6WA 1XUKA 2FPZA 1KIGH 3A8DA 2AMDA 2UWOA 4AGJA 3BTTE 5CDFE 9ESTA 4K1EA 5C94A 1Y3WA 3SZEA 4ISHH 1FIZA 3MO6A 1MD7A 3FO8D 4IBLH 4SGBE 2HVYB 4TWWA 1GJDB 1V2LT 1CT2E 2GCTC 1O2VA 1ELVA 3TGIE 2A7CA 5TCAA 1MBMA 2NWNA 1Z71A 1E0FD 1V2MT 2KAIA 2OC7A 3RXIA 2GDEH 1ZGVA 3GY4A 1YPEH 3BTGE 5L30H 1O3LA 5EJ1A 1GMCF 3P8FA 3H7TA 1KXAA 1EQ9A 2UUFB 1DWCH 1KTSB 1V2KT 1MKXK 1LVMA 1V2TT 2WV9A 1UVOA 5F53A 3MWIU 1J17T 2D26C 1SB1H 2P8OB 4AC9A 3SV2H 3A7TA 1C2EA 1XUHA 3UOPA 4Y0ZE 5L2ZH 1SGRE 1KLTA 1FUJA 4X2VA 1TNIA 1ANCA 4DW2U 1FI8A 2RA0A 2HLDD 4KGAA 3K6YA 3UQOA 2TGTA 1DX5M 2BX3A 3PRDA 3GCHB 4GCHF 1FY5A 1BTXA 1YPLH 5J4SA 2FTMA 1O2QA 1XM1A 2GD4B 3D23A 3GY7A 4FU9A 3SU4A 2PTNA 1AFQC 3GS9A 1TPOA 1P57B 4IMZA 1BB0B 1C5SA 5T6DA 4RKOB 3EAJA 4Y76A 2R2MB 4ZKRU 3PWCA 1E34B 3ZV9A 1MD8A 2QCYA 4UONA 1EXFA 2VBCA 4Q7ZA 1GHAG 2C8YB 3KEEA 1OS8A 1GBDA 2Z9JA 4I8LA 2XYAA 5EW1H 4OGYA 1T8NA 1LQEA 2DUCA 2ODPA 2TRMA 1O5GH 3DCLA 3ATMA 4DCDA 2RA3A 4SGAE 2WV5A 4ZXYH 2ZHFH 1O37A 1O5EH 1P01A 9LPRA 2SGQE 1V2UT 8GCHG 4YLUA 2FOEA 2BXUH 1C1QA 1QTFA 1Z8JB 4UE7H 1BTPA 1IOEA 2R3YA 5ESBA 1XVMA 1GI3A 1EZSC 2RDLA 4X1QU 2TPIZ 1K28D 1QQUA 2ZWLH 1A5HA 1D6RA 1GBFA 3VB3A 4ACBA 1AO5A 4DT7B 1QJ1B 2C8WB 1GHAF 2BD5A 2OCVB 2G51A 4FU7A 5F8XA 1H8IH 1ELEE 4TY6A 3NUMA 3FZDA 2A5AA 3Q00A 3TJUA 1A61H 4UDWH 4O97A 1O36A 4X1NU 1GI0A 3F9HA 1IQKA 1D4PB 1TNGA 1EB1H 3STJA 7GCHG 4NZLA 3TNTA 2GJGA 1L4ZA 1CVWH 3ZVBA 1ZSJA 2HALA 4Q80A 1GI6A 3F2FA 2O8UA 3ITIA 1CGHA 4ISNA 3RMNH 5GWZA 5DP8A 3GY8A 4XD7D 4ZUHA 1O5AB 3ZZ8A 1O0DH 2VINA 1TPSA 1V2RT 1BMFD 2BDBA 1D3TB 3PO1B 1GVKB 2L6OA 2Z9KA 2JKHA 2BLVA 3UWIA 2JH6D 2ANKH 1O3BA 2F91A 4M7GA 2AS9A 1A0LA 1Q31A 3SUFA 1QURH 4A1TA 2BDCA 1MQ5A 1MQ6A 7GCHF 4CRFA 2FOCA 1XXFA 4AFSA 5KECA 1C2KA 4CH2B 4X8UH 2Z94A 3U8RH 2CXVA 3SGAE 5L2YH 3LGYA 1LDTT 1NRPH 1RFNA 2WPIS 1C5RA 2JH5D 5EXLA 4WY3A 3RU4T 5JB8S 2J92A 2GMTB 3V12A 2J97A 4JZFH 2GV6A 1UMAH 1GGDB 1SGFG 3HGPA 3M5NA 1F0TA 4LZ1H 2ANWA 4LOYH 5JBBS 1HJ9A 3I29A 1QL7A 2A4QA 4UEHH 2ZCKP 2C4FH 3U8OH 3UY9A 4ABEA 4ABFA 4LK4A 1GI4A 4Q2KA 2STAE 2AMQA 2CHAC 1EUFA 2OD3B 3SU5A 1YLDA 1S6FA 3BTDE 2ZZUH 1CA0B 3NRLA 4VGCC 1VCPA 3LH1A 2H2ZA 6LPRA 2D1JA 1HAPH 4LXBH 3S9BA 1O2JA 1T8OA 2BZ6H 1L2EA 4JZIA 3UPEA 3NKKA 4MNXA 4DG4A 1O39A 1AVWA 2CJIA 1EOLA 2P16A 3OEED 4AB8A 3SQEE 3TGKE 3FP6E 2ZGBH 1C1TA 2BVXH 1RS0A 4MG3A 3GYLB 1AUTC 3ZV8A 1QBVH 2Q6DA 1GI5A 3A80A 3SORA 3MNSA 3RXKA 1D3QB 4JZDH 1KMHB 4GPGA 3N99A 2F9BH 2W3IA 1O3GA 3RMLH 1LHFH 1BTYA 2Z7FE 1DFPA 2KZ4A 2ODYB 2ZDKA 3GOVB 2PKSB 3BN9A 3EGKH 2OQ5A 3URDA 2O8TA 1UK4A 4AFUA 5C17A 2XWBI 3ZZ4A 1G37A 2ZEBA 3RMOH 1JXPA 2THFB 3A85A 1E1RD 1MU6B 1MZDA 2PFEA 4FVDA 1WOFA 1LHDH 4BTUB 1K1NA 2A5IA 5HMAA 2H9EH 2Z9LA 2YNAA 1YM0A 2H6MA 3GY3A 4DOQA 2D8WA 4Y71A 2Y5FA 5EJZA 2J38A 1TGSZ 4NSVA 3ODDA 1GWAA 3BSQA 2NU4E 5GIBA 3RUOA 1ZHRA 4RT1A 3MYWA 2PR3A 1QHRB 2TGDA 1TB6H 2ZDAH 4CRBA 1THSH 2FI4E 1AN1E 1TMBH 1C5PA 4CRAA 2BY7X 1FN6A 1O2GH 2AIPA 2XW9A 1TNLA 1Y3UA 2PTCE 1PYTD 3UR6A 5T6FA 4ZKOU 2VH0A 1WQVH 2BY5X 4ZH8A 1QJ7B 5AFYH 4ZHMU 2G8TA 3F6UH 2A0QB 3S9AA 3SJIA 3ZZ7A 1T31A 2VWMA 3QK1A 1ESTA 3MI4A 4HGCA 1AE5A 3MU8A 3OE7D 1PPCE 1SOTA 2ULLA 1TE0A 2H9HA 3M5MA 4WXIA 5DPAA 3KQ5A 4F49A 3SU3A 3BG4C 3ENSB 4ZAEA 2H9TH 2FWWA 2FI3E 3WWBA 1ZMJA 1ZTLA 1NZQH 1BJVA 2F9NA 1O32A 2GDDA 1LHEH 2YMSB 2PHBA 2ZCHP 3S7KB 2FP7B 2C8ZB 1RJXB 2HRVA 1TLDA 5EGMA 2BQ7B 1MMJN 1TNHA 1F2SE 5EOKA 2QXGA 1KLJH 1BTUA 2HLCA 5LPRA 3GY6A 1O31A 4AN7A 1HPGA 1W8BH 4GVUA 1JIMA 3SU6A 2V3MA 4DT4A 3QTOH 1TQ0B 1AKSB 1V2WT 5GXPA 3GICB 5FCKA 2JETB 1DXPA 3AASA 4WMDA 4CHAC 1C4U2 1EPTA 3F9FA 3PM3A 1FAKH 2A5KA 3MOCA 3UR9A 1RTFB 2A4OA 2QAAA 1VCQA 3CS0A 2WV4A 1EB2A 1V2NT 2KR7A 3SI4H 3PLKA 5A8ZA 4RSPA 3K2UA 4ABAA 3HPTB 2ZFSA 1WDIA 3ZZAA 3FP8E 1UO6A 5FPYA 2PW8H 1NROH 3A7VA 3GYMA 4BXWA 5CHAB 1EAUA 4J1YA 3ZYDA 3F3BA 1OP2A 1O35A 1TX7A 3BTME 1O3KA 4BANB 1UK2A 3MHWU 1MTUA 1F5KU 3BEIB 2WPJS 3CP7A 4A1XA 1ZJDA 3MMGA 1RXPA 2GZ8A 6GCHF 3LGIA 2P3TB 4B2AA 1TONA 2HOBA 2V3HH 3A87A 3P8NA 3AK5A 1QNJA 6CHAC 1TBRH 5GCHG 3RXTA 3SGQE 3D49H 2EI6A 4YLQH 2BYAX 1UW7A 2WPHS 2P59A 1GI1A 2K1QA 2GP9B 1VJAU 4D9RA 3M7TA 1XVOA 1WBGB 4KP0A 5H4IB 1AE8H 2RG3A 2ZP0H 1F0SA 3M61U 2V6NA 4H6TA 4X1PU 4E7RG 1H9HE 1ZPZA 1Y5AT 3DFJA 7KMEH 1IQIA 3GY5A 4K2YA 4JMYA 1BBRE 4Z0KA 2P95A 3R3GB 5JBCS 2WUCA 2VVVA 4LZ4B 1VGCB 2ZC9H 2HNTF 1ANEA 1MTNB 4IW4E 1UHBB 3RXVA 1TWXB 8KME2 2NU2E 1O38A 2C3SA 4A1VA 1IQGA 3FANA 2FOHA 4IC6A 3FN8A 1OWIA 1QZ8A 1VKYA 1AKSA 5DP6A 1P2JA 1VITF 2XWAA 3UTUH 2M5TA 2HWLB 3VB5A 1GL0E 4MPWA 1TGCA 2J94A 1PPEE 2PGQB 4F4OC 2FEQH 1L1GA 2A45B 2PV9B 4B6EA 1W3CA 1GDQA 3ATKA 1K1OA 1ANBA 5ABWA 2FOAA 3F68H 3F0PA 3PLBA 2XC5A 4TPYA 1H4WA 2Y5HA 1T32A 2FS9A 1QRZA 2I6QA 1GBTA 2HGTH 4K69A 3BIVH 4MDSA 4ZCNA 5FBEA 4FUCA 5E0HA 1BRUP 2O8MA 5G4BA 1C1NA 1NRNH 1O3EA 2KX4A 1HV7A 1FY8E 3SUDA 5IDKA 4NA9H 2C90B 3ZZ6A 1N8OC 4I33A 4K3JA 1HAOH 1P2IA 1AY6H 1ZSLA 2STBE 3LJJA 1FIWA 2EA3A 4MNWA 1PPGE 1OP0A 3LPRA 5C1YA 1KXCA 5DP9A 3TGJE 2XNIA 3RU4E 1HAVA 2Z9GA 3QX5H 1MKWH 3E8LA 1TQ7B 1WCZA 1C1VH 3M5OA 4HG6A 1EZXC 1S81A 4FVBA 3L3TA 2W7UA 4OS7A 5C67A 1ZTKA 2BTCE 1GJAB 3SJ8A 2BHGA 3R0FA 4O3TA 1NO9H 1O30A 1AB9C 2ZKSA 1YKTA 1LPZB 4KTUA 5EQQA 2ZTZA 4XBCA 3ZIAD 1OSSA 2F9PA 2JDID 4INLA 1VCWA 1GCTB 3KQBA 4F55A 1A1RA 5FHTA 4FUFA 1GCDA 1XUFA 1NN6A 1OYQA 1SGQE 1DY9A 1O2ZA 3QWCH 1C5ZB 4O03A 1HCGA 4TT3D 1QB1A 3ATLA 1CBWC 2ZECA 3GDSA 3P6ZB 4Y8XA 5GPIB 4ZKSU 2OINA 1OP8A 3HK6B 1X7AC 4GUXA 1O3OA 4XOJA 3IG6B 4X6MA 4YXWD 1MU8B 1TYNA 2UWLA 1W0JD 2TGPZ 1C2FA 1YYY1 3L33A 1TOMH 1SLUB 1H9LB 5EU8A 5I46H 1P3EA 3A81A 3LC5A 5GNDA 5BPEA 2XC4A 2G5NA 1S83A 1C9PA 1C5TA 2QXJA 2GGVB 1PFXC 1BCUH 1QR3E 2D2DA 1NBME 1CO7E 5HIZA 4ABIA 1C1OA 1D3DB 4DJZB 3OX7U 3OYPA 1QL9A 2PWXA 1GPZA 1MH0A 4Q7YA 1WSSH 2KFWA 3FP7E 5CHBA 3SV9A 2ZF0H 3RXFA 4AZ2B 3WY8A 4FUHA 1NPMA 3B23B 3M35A 3S69A 4RI0A 5C20A 1LVBA 2FLRH 2LNCA 5AVDA 1C5OH 3MH7A 4FUDA 1HFDA 1XUJA 1SFIA 3LGTA 2BQWB 3E6PH 1O3AA 4BAHB 1EJNA 1F0UA 1QA7A 1VJ9U 1ZGIA 3ZYEA 1UVPA 5PTPA 4WMEA 1GMDG 3FZZA 1SGFA 1TRMA 3M3TA 3A7YA 1O3NA 4X2YA 2Q6GA 5FAHA 4NA8A 4AGKA 1FXYA 4XBBA 4A7IB 4ZKNU 2HPQH 1OOKB 4OS1A 1BMAA 1AHTH 4X6NA 3QN7A 1OKXA 1GG6B 4WXVA 5IK2D 1Z6JH 2K0QA 3RXHA 1NS3A 3UNRA 1LPKB 2GCHG 2ZGXH 1QBNA 1IQFA 2BDYA 1GBCA 1SBWA 3BTKE 5LPEA 3T29A 4E05H 2XNDD 4XDEA 1TMUH 3HKJB 4XRNA 1GI9B 3OAAD 2ASUB 3IWMA 3VGCC 1DITH 3ZVEA 3PMBB 1ARBA 1P09A 1O2MA 1GBHA 1S6HA 5A0AE 5CMXH 3SV7A 3PV4A 2EY4C 4Y7AA 5C2ZA 2OP9A 1TX8A 1LO6A 3QTVH 1SHYA 3C1KA 4AB9A 4UD9H 1TABE 3TH4H 2ZFQH 4GHQA 2ZU3A 3E0PB 4WJG2 1F5LA 4ABJA 1ESAA 3A82A 1RTLA 2GCHF 2WPMS 2J4IA 5E0JA 1Z1JA 1ABJH 1JWTA 1RRKA 1ORFA 3KF2A 1G3DA 4YOJA 1QA0A 1GI8B 1GBBA 3F0OA 1BBRH 1HJ8A 1YY3A 3RXQA 1Q3XA 3RM2H 1IQJA 3RMMH 2G5VA 2ZHDA 1BMNH 1KY9A 1MZAA 1UCYK 3UAIC 3BEUA 3P70B 5DN6D 3MU1A 1BITA 2P8OC 4TYDA 1HIAB 4YTAA 1MCVA 1ARCA 1NT1A 3ZVDA 1SHHB 3E16B 1LQDB 2P93A 1FV9A 1XXDA 8GCHF 2W26A 1GHZA 3GCHC 2WYGA 3M7UA 1B0FA 1RTKA 2PKAB 3MH6A 5DP3A 1LHCH 2PP6A 1C2MA 2FOFA 1Q2WA 1S5SA 4CRDA 3LGUA 5F6MA 1ZRKA 1MCTA 4ZHAA 4NIVA 1C5QA 2GV7A 2VGCB 4KELA 1WXRA 3H09A 3LKWA 3SHAH 2Q6FA 1UTNA 1OX1A 4Q63A 2W6ID 5A2MH 3CNRA 1P03A 2GT7A 3PTBA 1TIOA 1HJAB 4KKDA 4CBOA 1BTWA 1QBOA 1ZOMA 3Q77A 1INCA 1C2GA 1CSOE 1OWHA 2IN2A 4CREA 1GJ7B 1P3CA 1O2SA 2VWOA 3LONA 2J5UA 1OWJA 2IJD1 5EPYA 1AZZA 1EFRD 3AAVA 1Z8GA 2BDIA 3AW0A 1FX0B 3LGVA 4CRCA 1BJUA 2BD3A 2FLBH 3SNBA 4FUEA 4H42U 3OEHD 1LTOA 3V13A 2OBQA 1GHXH 2B0FA 1XUGA 4Z6AH 4K5ZA 3Q3KA 1EP6A 1UVUH 1EASA 4IMQA 1MABB 4Q4LA 1XMNB 2SNVA 3HGNA 3A84A 5K0HA 2ALVA 1GJ4H 1DWBH 4WVPE 4ZHLU 5E0GA 3SHCH 5FX6A 2ZGHA 1XUIA 1ELAA 3SNCA 3S7HB 2QV1A 3SYJA 1WU1A 2AMPA 1TBQH
chains in the Genus database with same CATH topology
2OUAA 3RXUA 1HIAA 1Z1IA 3SV8A 1WV7H 1EX3A 1QIXB 3T62A 1A2CH 3EA8A 3EA7A 1HXEH 4IS5A 2BOKA 2BLOA 1B7XB 1QGFA 3IITA 2PKAA 2BZAA 2HNTC 5E2PA 1SGEE 2QY0B 1LPGB 3UNQA 1GJ6A 1N6XA 1FY1A 1IQMA 1TRNA 3GCTG 1G3BA 1O2LA 2ZPSA 1NRSH 3SBKA 3PO1C 1YPGH 5EW2H 4TPIZ 5FX5A 3ELAH 4Y6DA 1F5RA 2ZDVH 3BIUH 1W7GH 3F9EA 2PSXA 1AWHB 1QQ4A 2V3OH 2ZFPH 4U30A 1MBQA 1SQTA 1FDPA 2QF3A 4I31A 3VPKA 1P2MA 1CU1A 2Z3DA 1C5XB 1G3CA 3RU4D 3A7ZA 2J2UA 5A8YA 2FOBA 1TBZH 2B8OH 2VIDA 1CHOG 4CR5A 4NIWA 3U69H 3A8BA 4WMFA 5FXLA 1SQAA 3NXPA 3TH3H 1T4VH 3MTYA 1V2JT 1TGTA 1BRCE 2CGAA 2Z9IA 3K6ZA 2BB4A 1O3IA 3FFGA 1AVGH 4HZHA 1E36B 2WPLS 3K65B 2J9NA 2RCEA 2XCFA 1QL8A 4JYVH 1GGDC 5F8ZA 3RXCA 4AG1A 1DS2E 5FPSA 4K8BA 1XX9A 2W3KA 1MKXH 4D9QA 1DDJA 1JOUB 1BOQA 1LKAA 2UUJB 3TLOA 2F9UA 4BNRA 3PLPA 2P3UB 3RXSA 3SUGA 1CA0C 1SGDE 1CHOF 3ZZCA 5HM2A 8LPRA 2Y7ZA 4AG2A 2A2QH 2QF0A 2OC1A 3UUZA 2ZCLP 4GHTA 4UFGH 4NGAH 3ATIA 2BM2A 1BIOA 4O9VA 1O2HA 3RXMA 1QB6A 2FM2A 4QT8C 4R0IA 4B75A 3VFEA 2ILNA 4BAMB 1FLEE 1O2XA 3MNXA 2FIRH 1TOCB 1C1WH 1ETSH 4YO9A 4DGJA 4FUGA 1S0QA 2H1UA 2HNTE 1HLTH 4NG9H 2G52A 1EJMA 2BMGB 3H5CB 3STIA 2FYRA 1C5UA 1U6QA 3KIDU 1DSUA 1ZPCA 2CMYA 2PKSC 2VU8E 6ESTA 1O5DH 1QFKH 4H4FA 2IJOB 3TH2H 5TJXA 4K1SA 1P04A 1P2OA 3MO9A 1FAXA 3GDVA 2FMJA 1ELDE 1W14U 4GLYA 3NK8A 2BVSH 1V2VT 2O8WA 1BUIA 1THPB 4YESB 2QXIA 2VIQA 1O2IA 2VWNA 1EPTC 4CH8B 1YPHC 4WH8A 1SG8B 1WTHD 3ZVFA 4B2CA 4ISOA 4KTCA 3DHKH 4UFEH 1O3HA 2BD2A 5EG4A 1J16A 2AEIH 2QC2A 3MU0A 3ATWA 4ESTE 4THNH 1TPPA 2GKVE 3NCLA 1TX6A 1L4DA 2ZDNA 3HKIB 3C27B 3O8RA 1NFUA 1V2OT 1YPJH 3TJVA 1ZTJA 3M3SA 5C5NA 1WUNH 1EZUC 1UTJA 2GZ9A 2NU0E 3D62A 2VVUA 4X2XA 3KQCA 2B5TB 3KGPA 5LH8A 5F03A 1H9IE 2PGBB 1RIWB 2ZDLA 3PMAB 3PYHA 2BX4A 1JRSA 1MUEB 1GJ9B 4IC5A 1S0RA 1CGIE 1OXGA 2JH0D 4ZROA 3QUMP 1ETRH 1A46H 1C2LA 3ZZ5A 3RDZA 1LKBA 1GJ5H 8ESTE 3OU0A 1ZMLA 3Q3YA 1DXWA 2G55A 2I6SA 5C1XA 2Z3CA 2AYWA 2BD4A 1K1PA 2Y5GA 4MLFB 1NRRH 2A1DB 4INHA 1TNJA 2J34A 1IHTH 1SGCA 4U2WA 2ZU4A 1FZZA 3A7XA 4HFPB 3BG8A 3RXEA 3DT0H 3SQHE 4Y7BA 3UWJH 2BY9X 2SNWA 2ESTE 1A3BH 2XXLA 3P17H 1BMMH 1FNIA 4XSKU 2Y82A 4ABGA 2Q1JA 4OS4A 1GJBB 5ESTE 1QRXA 1UTPA 4A5TS 5CE1A 1K22H 1W13U 2XC0A 2IOTA 3A8AA 2IPHA 4MPVA 1K1IA 5HYOA 5FCRA 4OS2A 2JETC 2WINI 1K2I1 3U98H 1HAHH 2ZDMA 5GCHF 1BT7A 1GHBG 3P8GA 3BEFB 1NFYA 4OS5A 4A92A 1T7CA 1E38B 1ZMNA 3GCNA 3KN2A 5A09A 5A0CA 2OTVA 1KYNA 1TA6A 3T27A 3TJOA 4DURA 1FN8A 5EQSA 1GVZA 1YPHE 5ETXA 1H1BA 2OC8A 3SZNA 1P05A 3A86A 4NIXA 2FO9A 5IYTA 1A5IA 1ZHPA 1C5YB 1KLIH 1NY22 5CHAC 1O2WA 5L6NH 3V0XA 1PYTC 2B9LA 3A7WA 4NFFA 4U32A 2A4RA 3ZZDA 1SGNE 1FMGA 1O2UA 2ZNKH 2GX4A 5AF9H 4DIIH 1CT4E 3LC3A 4BOHA 1SVPA 1GHBF 3E0NB 2FX4A 1C1PA 1SL3A 1DSTA 1W7XH 2ZU1A 1FJSA 2EC9H 3LDXH 3SU1A 1QJ6B 2FTLE 2PUXB 1P11E 2QYIA 3E90B 4I8HA 4PROA 3HATH 1IHSH 4JCNA 4B1TA 3QZQA 2Z6BD 1P9UA 5J4QA 2ZPRA 1A4WH 1VGCC 5DGJA 2V0BA 1MTNC 1OWDA 1KXDA 1HRTH 4Y8YA 4ABHA 1GVLA 3RXGA 2GCTB 1O5BB 3QO6A 1UHBA 1G3EA 2PSYA 1AUJA 1C5LH 1Y5UT 2GZ7A 2G4TA 1C5WB 3UNSA 2ANMH 3RC4A 1O2NA 3LT3A 1QB9A 3SN8A 3LH3A 2BD8A 2ZQ2A 1AVXA 4D7GA 1GBKA 1SC8U 5JYIA 3PTNA 2BD9A 3OSYA 1A7SA 1GI7B 1GHVH 3EE0B 1K1MA 2AFQB 3A83A 4OGXA 1EATA 1JRTA 3A8CA 3O8DA 1TRYA 4DY7B 4X8SH 1IQEA 1FPCH 1ZJKA 3DFLA 1ETTH 2ZO3H 1BA8B 2A7HA 1DWDH 3TIUA 2ZHQH 2R3UA 1G2MA 3FAOA 2PUQH 1P0SH 2GT8A 3MU5A 3T5FH 1P2NA 1ZRBA 2BXTH 1PQ5A 4AYYB 1ZPBA 2SGAA 5HGGA 1AFQB 1SPJA 1BTHH 1DOJA 3NWUA 3I78A 1UTQA 3SJ9A 3RM0H 3U1JB 2O9QA 3TITA 2VJ1A 2UUKB 1TGNA 1VITH 1O3FA 3GCOA 5F8TA 2NU3E 5HXFA 1C1UH 2BDGA 2R2WU 4BAKB 1FQ3A 1MAYA 3U8TH 4H6SB 4ABBA 1OWEA 1OWKA 4AFZA 5EPNA 5I25A 1V2ST 1FY4A 3TK9A 4E06H 1DLKB 2A2XH 1YCPK 2ZTXA 5E2OA 4GCHG 3ZZ3A 1F7ZA 1GCTC 1W12U 2FYQA 4X2WA 5BRRE 1KSNA 4YT7H 2FXRA 1JMOH 4I8GA 5DP7A 5EXNA 1P8VC 1NFWA 1T8LA 4GAWA 1VZQH 4MPXA 3M3VA 1PPFE 2F3CE 1HAIH 1GDUA 1ELBA 2A32A 1GHYH 1CGJE 3VB6A 4NFEA 2ZG0H 2SGDE 1ELFA 1C5MD 4NA7A 4BXSA 1GMDF 4CBNA 3EDXB 1SQOA 1ELGA 4TWYA 2F9OA 2XTTB 2SFAA 1ANDA 3RXOA 1L1NA 1L1JA 1Y3XA 2Y81A 3OY5U 3G01A 1HAZB 3SU2A 3SV6A 5B6OA 3KL6A 1VR1H 2EEKA 3ZVAA 2V35A 1ELTA 5E8EH 4K1TA 1M9UA 3B8JA 3DA9B 3M37A 2GTBA 1D3PB 2W7SA 2DE8A 2CV3A 2HPPH 4WWYA 4X6OA 1A5GH 3RXLA 1Y5BT 2AGGX 1HUTH 1Y59T 1K1LA 4AFQA 1JBUH 5C3NA 3RLYH 2ZFRH 3KQEA 4NCYA 4Q7XA 1YC0A 1XKBC 4FUIA 4ABDA 2BDAA 1AQ7A 3VXEH 1BRBE 1GBMA 1ID5H 4I32A 1E37B 3SNAA 1F0RA 4ZXXH 4R8TB 2ZQ1A 4MPUA 1L0ZA 2ZU2A 1GDNA 3VB4A 4NIYA 5DJ7A 1CE5A 1GBLA 2G81E 1THRH 3LGWA 1W11U 5JDUB 4I7YH 1S85A 1HDTH 1FY3A 3SU0A 1V3XA 2FDAA 1MTSA 1WQSA 3AVZA 3QLPH 1UCYE 2VIOA 2QN5T 3SOSA 1DWEH 3JZ2B 4AORA 1ZSKA 1LVYA 3VEQB 4B74A 1GG6C 2VNTA 2OLGA 3GISB 2WUBA 3KCGH 3ODFA 2J95A 3E1XB 1ELCA 4X8TH 3DD2H 1TA2A 3JZ1B 3BF6H 1RGQA 2CHAB 1FONA 3RXRA 4VGCB 4CRGA 1ZZZA 1SGIB 4YT6H 2BLWA 3T28A 1KTTB 4DIHH 3P92A 1LMWB 1DY8A 1DUEA 1Z6EA 2TBSA 3U9AH 4D7FA 2VB0A 3BTWE 4B76A 2BQ6B 1OYTH 1ACBE 1GBJA 1EAIA 1O3DA 2ANYA 3UOUA 1GBIA 2AERH 4MVNA 3T2NA 2TGAA 2AIQA 1LHGH 2CF9H 3CENA 4GSOA 3U1IB 1G2LA 3PB1E 1PPZA 1A3EH 3MU4A 4A6LA 4ZMAH 1PPBH 5DK1A 1ZR0A 2CF8H 2C8XB 1SGPE 3MFJA 1WYKA 1NM6A 2VIWA 4D76A 3PWBA 1CHGA 1YP9A 1SR5C 1AZ8A 1A0HB 1YPMH 2BY6X 2FI5E 3VXFH 2SGPE 3SJOA 3TNSA 1HXFH 4HI3A 3BTQE 1SI5H 3QGJA 1CT0E 1C1MA 1O2OA 1Y3VA 1EP5A 3RXJA 3OTJE 1GJCB 1EKBB 4FUJA 4TY7A 1AMHA 1GJ8B 2FX6A 4IN2A 1C2IA 1O2RA 2Y7XA 1HBTH 1TAWA 2ZHEH 2XBWA 2BD7A 2P94A 1SFQB 3T26A 4XBDA 3EYDA 2R0LA 4JYUH 1MAXA 1N6YA 4YM9A 2ZGJA 1OPHB 2O8LA 2VGCC 1E35B 5LPFA 4YZUA 5HM9A 3ZZ9A 2AGEX 5A8XA 4AX9H 1G9IE 1HJAC 2PLXA 3B9FH 4I8JA 2BOHB 3SNDA 3D65E 2BY8X 3QDZB 5GDSH 3HK3B 3QZRA 1PQAA 4D8NA 3ZZBA 3V7TA 1EAWA 1TNKA 3BTHE 4B73A 1O3MA 1DM4B 1JIRA 3MH4A 4FU8A 1J15A 1N1LA 1SLWB 1MTWA 5DP5A 2XCNA 2ZHWH 1AGJA 1PQ7A 4JZEH 2BLQA 3MNBA 4HTCH 1P12E 3BG4B 3E3TA 1BHXB 3A88A 3S9CA 4XFQA 1DE7H 4NWKA 1GHWH 1MKWK 2QXHA 1O3JA 1MTVA 1HB0B 1ESBA 5GJ4B 2WPKS 2ZU5A 3GCTF 1GBEA 1A0JA 1ZYOA 2G00A 1C5VA 2GMTC 1IQNA 1NU9A 2BDHA 5EODA 3RXAA 2ZA5A 1K21H 1Y3YA 5SGAE 2FOMB 4AOQA 4U01A 3P95A 1C1SA 4JK5A 2FODA 2F9VA 1P2QA 4KTSA 1IQHA 1YCPH 4K60A 1SLVB 1SGYE 1DLEA 1HGTH 1EPTB 4AYVB 3Q3XA 1G36A 4CHAB 1O2PA 3M36A 1O3PB 4DVAU 3PMHB 1IQLA 1P02A 1QRWA 1HNEE 1Y8TA 3UQVA 3GY2A 2ZTYA 1UTKA 1KXBA 3RC5A 3KQDA 2YNBA 4E7NA 1BDAA 1W0YH 2R9PA 1FPHH 1BTZA 5DP4A 3W94A 3TPIZ 1EOJA 1DVAH 3KHVA 3M7QA 2ZPQA 4FXGH 1K1JA 1DT2A 2YOLA 3MH5A 1Z8IB 6CHAB 1TALA 1YPKH 1C4V2 1TMTH 2A31A 2OXSA 1NC6A 4JYTA 4X0WU 1T8MA 1AWFH 2XBXA 4Y0YE 1O5CB 1DPOA 3BTFE 2HVXA 4JZ1A 2UUYA 1C2HA 2VVCA 2EI7A 1YLCA 5AHGH 1D9IA 3AAUA 2SGEE 1UJ1A 3Q76A 3W95A 1V6DA 5JBTA 2XBVA 3RXDA 1P06A 1EAXA 1UCYH 3SI3H 3RC6A 5LGOA 4X1SU 1BRAA 1KDQB 3URCA 1KXFA 6GCHG 2ZFTA 1HAGE 1YCPM 1HAYB 4MNVA 2G4UA 4WF8A 4UFFH 1K9OE 3CS7A 3SJKA 5JBAS 1O2YA 5A0BA 2EI8A 3QGNB 3P8OA 1CA8B 1KXEA 1ABIH 2XRCA 2CN0H 2Z3EA 2OBOA 1DUAA 1S84A 4IN1A 3PROA 4WH6A 3SO3A 3TU7H 1B5GH 1WTGH 5DKMA 1GBAA 1S82A 3ZVGA 5AFZH 3O8CA 3RLWH 4Y8ZA 5K7RA 1BMLA 1LVOA 2B7DH 1QY6A 2SGFE 1EZQA 1QCPA 4NZQA 7ESTE 1NRQH 3SGBE 3FVFB 1VITG 1N8OB 4RKJB 2ALPA 2VIPA 1C1RA 1YBWA 1O2KA 5C1UA 5T3HA 2W5EA 1HAVB 1C4Y2 5EXMA 4NWLA 2VIVA 4MQAA 1BBRK 1DICA 2A7JA 1O3CA 2OQUA 1AD8H 1C2JA 5JB9S 3DUXH 5FPTA 1J9CH 4ISLA 4CR9A 3UIRA 1G32B 1BQYA 1GI2A 5T6GA 2FZZA 1AIXH 1AB9B 4BTIB 1C9TA 1GMHG 1XKAC 1SOZA 1J14A 1UVSH 1W0ZU 1B0EA 1TPAE 3O8BA 1UTLM 2WYJA 3SNEA 1KDQA 3H7OA 1UTOA 1NU7B 1SGTA 2LPRA 3RXPA 3TVJB 5DO4H 1GL1A 3BTEE 1RIWC 4RN6A 2ODQA 3A89A 1NTPA 1F92A 3SUEA 5EQRA 1CBWB 5TCCA 4B2BA 1P2KA 4YOGA 3GDUA 5FBIA 4B71A 1ZLRA 2AH4X 3NZIA 2H5CA 4Y79A 3ESTA 2Y80A 1V2PT 2VH6A 2UWPA 5JPMH 2TIOA 3K9XB 1NESE 1GMHF 3E91A 2FESH 1O2TA 4IGDA 2VWLA 4J2YB 2ZIQH 2ZFFH 2ZGCA 1UK3A 2FS8A 1HAXB 2AGIX 4FUBA 5DG6A 1C2DA 1HYLA 2Y6TA 3L6PA 4X1RU 3LIWA 3N7OA 4Y11E 2FOGA 4OS6A 1TGBA 2P3FH 2XBYA 4K8YA 1EJAA 2H5DA 3PMJA 2BVRH 3V3MA 1YGCH 2KAIB 4BTTB 4INKA 4X8VH 3T25A 1PQ8A 3TJNA 1RD3B 1PJPA 1AI8H 1O34A 1YF4A 1Z7KA 2C93B 2DE9A 3NPSA 4NSYA 4X6PA 4XE4A 4BAQB 1T4UH 1SLXB 3F1SB 1DANH