3T28A

Tmao-grown trypsin (bovine)-previously unreported tetragonal crystal form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title The use of trimethylamine N-oxide as a primary precipitating agent and related methylamine osmolytes as cryoprotective agents for macromolecular crystallography.
pubmed doi rcsb
molecule tags Hydrolase
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t28A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t28A02
3W94A 1THSH 3PROA 1FPHH 2GCTB 4FVDA 3RU4E 4YT7H 2STBE 3T25A 1O3CA 2J2UA 5E8EH 1FJSA 4Y7BA 3H7OA 4OS1A 1BRCE 2OP9A 1T8LA 1TNLA 1ANBA 1V2TT 3TLOA 5FPSA 1F0SA 2G4UA 3MFJA 3MNSA 4FUDA 1VJAU 3JZ2B 4BAKB 3A81A 4BAOB 2C3SA 1H9IE 3KIDU 3QGJA 1HJAB 2W3KA 5C1XA 2BTCE 1CT2E 2Y7XA 1C5QA 2VWLA 3A82A 1GVLA 4FUIA 4D9QA 3QWCH 3BN9A 1UTLM 5LGOA 2B0FA 1PQ7A 4DURA 2SGAA 2Z3CA 1DICA 1UTJA 4Y76A 2ODYB 2Y5FA 3SI4H 1QB1A 3RUOA 3PLKA 2P93A 3PB1E 6ESTA 1RIWB 1IQJA 1V2KT 2EC9H 5GWZA 1GHZA 1L1NA 3KF2A 3SU3A 3UPEA 1DY8A 2A2XH 2FTMA 2GZ9A 3E6PH 1CHOG 1SQTA 1TOMH 3QGNB 4XOJA 4I8LA 2UUKB 4OS4A 5BRRE 4XE4A 1SMFE 3P70B 1SC8U 2AGIX 1GJCB 3DFJA 1A0HB 2GMTB 1AE8H 2KAIB 1QHRB 2F9OA 7GCHG 1LPZB 4Y8XA 1SLWB 3ZYEA 3ZVBA 4X2XA 2ZTZA 1Y3XA 3QK1A 3BIVH 3VB4A 1J9CH 1GMCF 1Z6EA 4ZKNU 1FIZA 1HNEE 4HGCA 1VITG 5DP9A 3LH1A 1K1NA 2ZGXH 2B7DH 4ABIA 1TGCA 1O3GA 4D7GA 2WYGA 4ZAEA 5EW1H 4ABFA 2TBSA 1QA0A 1GHYH 4IN1A 1GBBA 4AG1A 2BQWB 1FNIA 2ZO3H 3S0NA 3QTVH 3SOSA 3UOUA 4H4FA 1GMHF 2HVXA 2XBYA 3RXVA 1B0EA 1QFKH 2ZCHP 3MH5A 1GBAA 4ABBA 1NFWA 1C1SA 4TPYA 2H9TH 3ELAH 2BD2A 3NWUA 4A1XA 2GV6A 5A0AE 1YPKH 1BJUA 2BVRH 2QIQA 3NCLA 1PYTD 5JB8S 4BOHA 1GJ7B 2O9QA 3BEFB 2NU0E 5EQSA 2C8WB 1QL7A 2PKAB 3RC4A 1ETSH 3SGAE 3H5CB 4Z6AH 5I46H 2A5AA 1DUAA 4Q7YA 5GDSH 2AGGX 1TPSA 2A2QH 4F49A 8LPRA 3GY4A 1BTUA 1O32A 3RXOA 1CA0C 2B9LA 3RXJA 3ZVAA 1ELTA 4X2VA 2P94A 3C1KA 4HI3A 1XX9A 1AGJA 1AQ7A 3UY9A 3A83A 1F5KU 2BDYA 1OOKB 5C3NA 3EE0B 1ZMLA 1KLTA 2ZCKP 1O3FA 2CJIA 1ZSJA 1BBRH 1GBDA 2ZU4A 2FO9A 1QBOA 2LPRA 4ZHAA 1PPZA 2A32A 3LOXA 4CBNA 3RXFA 2QAAA 1EAIA 1W13U 5AFZH 2Y80A 1NT1A 1AFQB 1S6HA 3SU6A 1O5EH 1NFYA 2EI8A 2OQ5A 2A5IA 1YM0A 3PMAB 1QGFA 3LONA 4D9RA 5HXFA 3A84A 3U1IB 3HGPA 2ZA5A 2R0LA 1GBMA 1F5LA 3A86A 4ZHMU 1NRNH 2XCNA 2QYIA 1DANH 1Y5AT 3MH7A 1MTVA 3Q76A 1FI8A 5E2OA 8KME2 1FUJA 1GI5A 5FX5A 1P04A 1B0FA 4Q7ZA 3ATLA 3E0PB 5A8XA 3RLWH 1O2YA 4IS5A 4WH8A 1SFIA 1C9TA 1TE0A 3UWIA 4AB8A 4UE7H 1DPOA 3Q3XA 3P8OA 1WTHD 4UFEH 1KXFA 1FY4A 1C5RA 2H2ZA 5GPIB 2I6SA 2XC4A 5FXLA 2ZDLA 4MPWA 1GBFA 1BB0B 3RMLH 1TMUH 3O8CA 2ANKH 2QGRA 4A1TA 3ZVEA 6GCHF 1W0YH 3OYPA 2ZG0H 4YM9A 2PKSB 2ZI2H 1W3CA 1SL3A 1NO9H 1O34A 2B8OH 2P3UB 1KYNA 4CHAC 1T8MA 1RTLA 1TNKA 1AHTH 1ZPCA 4X8UH 1ANEA 1SFQB 1FONA 2B5TB 1NESE 2PGBB 3HK6B 4TPIZ 2OD3B 4K1EA 4MG3A 1BTPA 2H5CA 1TX6A 2ZEBA 2OC8A 5LPRA 4CR5A 2FM2A 3ZZCA 5L6NH 2NU1E 1MKXH 2OUAA 1VGCB 2A5KA 1OP2A 2BD5A 4U32A 1C5YB 1JIRA 3LU9B 4MNYA 4RKJB 2ZPSA 2FS9A 1MCTA 2BD9A 1SPJA 1C5UA 4AZ2B 5AHGH 3GY2A 1ZSLA 1TBQH 3GCOA 2WPKS 1KIGH 1THPB 4X1NU 1CU1A 3K6YA 1AB9B 2BM2A 1QB6A 1EJAA 1AY6H 2QN5T 5T3HA 4OGXA 1TQ7B 1TA6A 1C2DA 2ZGHA 3GY7A 5EOKA 5DKMA 4NGAH 3IITA 1PPCE 1TPOA 3NK8A 1TONA 4BANB 1ZSKA 2WPLS 1HAOH 1C1OA 2D2DA 1OWHA 4MDSA 1GJBB 4NIVA 2FOHA 2VVCA 3MU8A 4UFFH 3ODDA 1GVZA 1A0LA 1O3OA 4X1PU 3RXTA 2W5EA 1P2JA 3GISB 3MO9A 2F9NA 1KLIH 1SGEE 2Y82A 2CMYA 4XBCA 3U8TH 1HJ8A 5T6DA 2HLCA 3PMBB 1C2HA 1GL1A 4ISNA 3KEEA 1F0RA 1FQ3A 3GYMA 1LQEA 1ACBE 1V2RT 2WYJA 3E3TA 3BTGE 1BITA 1WQSA 4BAQB 4GHQA 1HXFH 1JRTA 1AIXH 1O0DH 1C2KA 2NU4E 1CBWC 1L1GA 1WBGB 3FFGA 5ESBA 3D23A 1MCVA 1ARCA 1P02A 1LO6A 5EODA 2DE8A 2A7HA 2D8WA 1G30B 1SLXB 3UNSA 4JYTA 1GI9B 3EDXB 2Y81A 2Z9IA 4Y7AA 3UFAA 2KAIA 3I77A 4LZ1H 1O3KA 1ARBA 4JZEH 3CENA 1C5LH 1K1PA 3UNRA 8ESTE 2CV3A 1EB1H 1BJVA 1C2IA 2VIDA 3UR9A 1U6QA 1C4V2 1QRZA 1LMWB 2W7SA 4ABHA 1E36B 3GDSA 1P8VC 1CVWH 4Q2KA 5F03A 1PPFE 5TCAA 5HM9A 1SGIB 1IQEA 3KQCA 1UO6A 5DP7A 1W12U 4B73A 1DDJA 1PPGE 1P9SA 1VCQA 2OC7A 2ZHDA 1YYY1 1ELBA 1W8BH 3RXMA 1FZZA 1LHEH 2C90B 3BG4B 4AYVB 1DOJA 1P03A 1ID5H 1OWEA 2ZQ1A 1ZYOA 1ZHRA 1HBTH 4MLFB 2HGTH 3DFLA 3TNTA 3KQEA 1ELAA 1FN8A 1T8OA 5DK1A 1ZTLA 1LDTT 2FDAA 2XBXA 1GHBF 1S5SA 1DE7H 7LPRA 3MU0A 8GCHG 1IAUA 3ZZ8A 1D4PB 4ABEA 2Y5HA 1T7CA 1OWKA 1HLTH 2XNIA 1TPPA 4Y0YE 3SNCA 2PKAA 1O2TA 1P3EA 2OINA 4XBBA 4MNWA 2FYRA 4GLYA 3TK9A 3RXDA 4R8TB 4WXVA 1O5FH 3A7YA 4FUHA 2HPQH 1S0RA 1HFDA 1GJ9B 3HPTB 1HAYB 1ZMNA 1KY9A 2IOTA 5JBCS 4UONA 2ALVA 2RA3A 1ETTH 1LTOA 2QF0A 3FP7E 5G4BA 3T5FH 1EXFA 4IW4E 3RMNH 4I7YH 1BZXE 1P10A 1UTNA 3M3TA 3M61U 1GJDB 5DP4A 1UK2A 3M7QA 2P59A 4JK6A 4KTUA 1GL0E 3SI3H 1FY3A 2C93B 1GDNA 1NM6A 9ESTA 1JRSA 2FTLE 1BRUP 2XWBI 1SI5H 3RLYH 3RXAA 3TGIE 1O2KA 1DS2E 4AYYB 4INHA 4K3JA 4PROA 1W0ZU 4E06H 3M5OA 5EGMA 1FXYA 1XUKA 1UVSH 1OS8A 2J38A 3F9GA 2A31A 5HGGA 1A1RA 1DWBH 1JIMA 3R0FA 1TBRH 3PM3A 1F2SE 1P0SH 4I31A 1EPTC 5FPYA 2UUFB 2XYAA 3SUGA 5B6OA 2HPPH 3LDXH 4XBDA 4JZFH 1CHOF 1WV7H 1SGFA 1GMDF 3ESTA 3RP2A 4B74A 1ANCA 2P3FH 4O9VA 1H1BA 3V13A 1PQAA 4JZ1A 3SW2B 1O3DA 5E2PA 1SGDE 1GPZA 1NZQH 1O2JA 2OQUA 2EEKA 3BTDE 3LGWA 7GCHF 5FPTA 1HRTH 1A3EH 2VB0A 1BMNH 1KSNA 1EOLA 2G00A 4DCDA 1UTMA 4JMYA 5DP5A 1Z7KA 1NRQH 1AZ8A 3TK5A 1ELFA 1HAPH 1NRPH 4JYUH 2A7JA 3RXHA 2V3OH 1VITF 3P95A 2ZTYA 3KGPA 1DSTA 1AD8H 1SGTA 4X1QU 4CRFA 4J2YB 3E0NB 3UNQA 4NIXA 1MU8B 1XUFA 1RTKA 2W26A 1RRKA 2P8OC 3S7KB 2YOLA 2G52A 2BD8A 4UEHH 1TNGA 3STIA 1PYTC 3RDZA 1O31A 1B5GH 1A7SA 1O5DH 3MTYA 2FOCA 3ZZ3A 2V35A 5L2ZH 4MTBA 2STAE 2VIOA 4NZLA 1BDAA 1C2GA 6LPRA 1P2KA 1F5RA 1RTFB 2O8WA 4KP0A 1FN6A 4CRDA 2AMDA 2AMQA 4Z0KA 1SOTA 4BTUB 3QO6A 4ZHLU 1Z8IB 2PR3A 2JKHA 3RMMH 1B7XB 1MTSA 1MTUA 2OBOA 4VGCB 1Y8TA 3ATWA 1G36A 3K6ZA 4LZ4B 3K9XB 1HJAC 1O3NA 3O8DA 3M5MA 1G3EA 1IOEA 2Y6TA 3BTME 1ELCA 1FAXA 1O5AB 2CF9H 4I8HA 4Y10E 1Z1JA 4ABAA 1CHGA 2R3YA 2SGFE 1O5BB 2A0QB 5FBEA 1GCDA 4THNH 1OYQA 2ZGJA 1OX1A 4NFFA 2G51A 2GZ8A 1S6FA 2VGCC 1KTTB 1XMNB 1NRSH 3M5LA 1RIWC 1ZOMA 1BCUH 1RGQA 1EJNA 1MU6B 4X6PA 2JH6D 3PYHA 2JETB 2Z3DA 1GCTB 1F0TA 1XUJA 2A4GA 1SR5C 2GTBA 1GVKB 2IN2A 1ELEE 2WPIS 1D3DB 4WMDA 1DM4B 1TQ0B 1UTPA 1O3MA 4GSOA 2GMTC 3M5NA 2CHAC 2ZPQA 2H1UA 1GMDG 3ENSB 1OSSA 1SQAA 4TY6A 5JYIA 1O3EA 2XC5A 1T4UH 2F9PA 3CS7A 4K69A 1ZPBA 4ZKOU 1ZMJA 4B2AA 1V2JT 4MPXA 1O2QA 3U8OH 1DLKB 2PSYA 1OXGA 4RKOB 1BRBE 2AS9A 3BTKE 1BRAA 1TGTA 1UCYK 1PPEE 1BTYA 3HKJB 1N6XA 3AASA 5IDKA 1HYLA 1Q31A 1EZQA 3ODFA 3BTWE 3GDUA 2DUCA 5JDUB 3NPSA 1HUTH 3LT3A 2BDAA 4FUBA 2GDDA 3S9AA 2F9UA 2BX4A 1QL8A 1NU9A 2G5NA 3SU4A 1DY9A 1OWDA 4DIIH 1VITH 2XRCA 5HM2A 3NKKA 1TBZH 1BTXA 2A4OA 2ZWLH 3A8CA 2I6QA 1CQQA 1RD3B 2BDIA 4X8TH 2F3CE 3HGNA 3OX7U 4WMEA 4ISIH 3V3MA 2AGEX 4CH8B 4YO9A 3TJUA 2FMJA 1GG6B 5EU8A 5A09A 1G2MA 1XXDA 2V0BA 1WTGH 4FUFA 4YTAA 1J14A 2H9EH 3GCHC 2BD3A 4TYDA 5IYTA 5K7RA 1O2RA 2BB4A 1IQIA 2NWNA 1JBUH 5GIBA 1VZQH 5EPNA 3P8FA 1N8OB 1YPLH 2FXRA 3T29A 1YBWA 3TH3H 1BBRE 3RM2H 1F0UA 2Z9JA 2UUJB 2BY8X 3E8LA 4U01A 4WJG2 3RXSA 4WMFA 2YNAA 1LVYA 1KDQB 2Q1JA 4IBLH 4H6SB 1TAWA 3AVZA 3NXPA 2A4QA 3HK3B 2QC2A 5EXMA 1TFXA 1AFQC 1C1QA 4MNVA 1O38A 2PUQH 4MPVA 3ZVDA 1GI8B 3PMJA 4D8NA 3RXEA 3UQOA 3FAOA 1PPHE 3B9FH 3SV2H 4U30A 2BDBA 3RMOH 2ZFQH 1VCPA 3LJOA 3SBKA 3M7TA 5CHAB 3EA9A 5AVDA 4B2CA 1HIAA 1GBCA 3F68H 1O2MA 1ZPZA 4JCNA 4D7FA 1L0ZA 1KTSB 4AGJA 1GHAG 1UVUH 3AAUA 3S7HB 1EJMA 1C5OH 2THFB 2VWOA 3F9EA 3LKWA 3SV9A 4MNXA 4BNRA 1JMOH 1ZTKA 4BXWA 1HAVB 4CH2B 1CA8B 2ZC9H 5EXNA 2FOBA 1PPBH 3LJJA 1DSUA 1BIOA 5TCCA 1NRRH 2P3TB 5PTPA 1GBTA 3O8BA 2VJ1A 1A0JA 3FANA 5DGJA 3R3GB 2QY0B 2VWNA 1CO7E 3PO1B 1O2XA 5C5OA 1S85A 1DWEH 2GCHG 2ZDNA 1YCPK 1TNIA 2WUCA 3E91A 2BOHB 3LGVA 2PKSC 1EP6A 5L2YH 3SUEA 1MZDA 2AERH 2GZ7A 3F6UH 5E0HA 1C1NA 1K1OA 2VIQA 1GI1A 5FCRA 4WY3A 1BTHH 1EPTA 1ESTA 4GVUA 2HNTF 1DXWA 1LKAA 1W7XH 1MTWA 1V2ST 3SJKA 1IQMA 2ANYA 2BY6X 1A5HA 2A1DB 2VH6A 1WUNH 1AUTC 4AORA 1ZJDA 1E35B 1EX3A 1GBLA 4IC5A 1O2PA 1UMAH 2PV9B 1V2LT 4IC6A 1UTKA 3OU0A 1TRYA 2XBVA 3LGTA 5DPAA 1YC0A 2SGPE 3A7TA 2XW9A 1SHYA 4Y79A 1DITH 4AFUA 2QXIA 4B2BA 1SVPA 4ISOA 1CE5A 1S0QA 1AB9C 4I8GA 5LPEA 4YOIA 1KLJH 3U8RH 4ZKSU 3MO3A 2F91A 6CHAB 1AKSB 4ZXXH 3E1XB 1G3BA 1ZZZA 4FU8A 1P57B 2BY5X 5T6FA 1P2NA 3M37A 3Q3YA 1T32A 3VGCB 1T4VH 1D9IA 1DUEA 4CREA 8GCHF 2G8TA 3QLPH 1C1TA 1A3BH 1A46H 1HV7A 4FUGA 1KXAA 4WF8A 4U2WA 1GBEA 1V2WT 1AI8H 1UTOA 3NUMA 3UQVA 1GJ8B 2XTTB 3LGIA 1SGRE 1EQ9A 4K2YA 1IQNA 1ZJKA 1EZSC 3QDZB 5A0CA 4FUEA 3W95A 2IJOB 2P16A 1IQHA 3ITIA 4AGKA 1CGHA 3EA8A 3A7VA 2QV1A 1QNJA 3SUDA 3B8JA 4O03A 2OBQA 4DJZB 1PJPA 1QBNA 1YPGH 1V2NT 1GDQA 1BMLA 1J8AA 3P6ZB 2VINA 2QXGA 1O3HA 4X8VH 5ABWA 2FOGA 2D26C 5DP3A 3GY6A 2F9BH 1INCA 1GJ5H 1W10U 2XC0A 1EAUA 2Z94A 2FIRH 3A7ZA 4IMZA 3M36A 4O3TA 2XCFA 1P2MA 1EUFA 3SNEA 4A7IB 1BMAA 1RFNA 1TRMA 5C5NA 2ZFSA 3HKIB 1SQOA 2Z7FE 5JBAS 5ETXA 1SGNE 1O2ZA 4Y0ZE 1CT4E 3FZZA 5T6GA 1V2OT 4FUJA 2UUYA 2BQ7B 3QN7A 4ABGA 2FZZA 4KGAA 3TPIZ 1O5GH 2ZKSA 1O2GH 2J95A 4AFZA 3SU2A 1CBWB 1V6DA 1K28D 2HALA 1C1UH 3T26A 3IWMA 3UWJH 1TIOA 5JBTA 3BTEE 2RA0A 2TGAA 4CRGA 3RC5A 1V2VT 1AU8A 2CXVA 4K1SA 5C20A 5A8ZA 4E05H 3AW1A 1MBMA 3ZVCA 3L6PA 1P06A 3A85A 2FI3E 2JH0D 4TWWA 3VXEH 5HYOA 3DT0H 1DWDH 1GJAB 1O2UA 4X6MA 4Y8ZA 4UFDH 3SNDA 1W7GH 3PTNA 3LGYA 2Q6GA 1C5TA 3MHWU 2FOEA 2AYWA 3GCTG 1VJ9U 1O3AA 1HPGA 3SV6A 2C8XB 5HMAA 1HAIH 2ZQ2A 1AUJA 3BSQA 1GGDB 1MZAA 1K22H 2W7UA 1K1IA 2R0KA 5A2MH 3SO3A 2UWLA 3DHKH 3E16B 3D49H 1AVWA 4H6TA 1K9OE 1LQDB 2FESH 3OY5U 1MUEB 1ZTJA 4IGDA 1RXPA 1L2EA 1LVMA 3RXKA 1YF4A 3GCNA 3PWCA 1GI7B 1O2IA 4I32A 4MVNA 2R9PA 2C8ZB 4E7NA 4O3UA 2ZNKH 3ATIA 4NG9H 1IQGA 2AMPA 4NSVA 1OKXA 1TALA 2ZDKA 1TX8A 1XKAC 2G5VA 2ZHEH 1K1MA 1QRXA 2A7CA 3MWIU 1UHBB 4ZXYH 3LH3A 4AN7A 1UTQA 2ZHQH 4B71A 4MQAA 1AVXA 4LXBH 1YGCH 3RXBA 4DY7B 1V2UT 1D3TB 2OXSA 5C67A 1RS0A 4RN6A 3K2UA 1LPKB 1S83A 1IQFA 1WU1A 1LHDH 1G9IE 1MAYA 1QQUA 2ZDMA 3ZV8A 1DXPA 1EATA 4NFEA 3S69A 3MNBA 4YLUA 1Y5UT 1GI4A 1HAVA 3GY5A 4CRCA 1TNJA 2GT7A 1AWFH 1TA2A 1E34B 5CE1A 5EQQA 3SJ9A 4WH6A 2BDGA 2O8TA 2LNCA 3KN2A 1BHXB 5F6MA 1GI6A 3A87A 4BAMB 3ZZ7A 2FX4A 1FDPA 1MD7A 3MO6A 1N1LA 1JOUB 4JZIA 4YOJA 3PTBA 3LPRA 5L30H 2GGVB 5A8YA 2ZCLP 2QCYA 1SSXA 2Z9LA 4DG4A 1A61H 3Q77A 1DWCH 1MTNB 1Y59T 2H5DA 1FAKH 1BHXF 5E0JA 1Z1IA 3ZZBA 3SZNA 1XUGA 3RM0H 2Y7ZA 1H9HE 3DD2H 2W3IA 1YLDA 4KTCA 3U9AH 5GXPA 2J34A 2ZDVH 4HFPB 3DUXH 1FY5A 2GV7A 4NA9H 1O3IA 1QQ4A 1H8IH 4X2YA 2ZHWH 3NZIA 4CRBA 1G3DA 1O2HA 1O33A 3TH2H 3MNCA 2GP9B 5C1UA 1TABE 2ESTE 1QJ7B 4Y6DA 3MH4A 2BOKA 1K1JA 3RXLA 2AEIH 2ZFTA 1C1MA 1ZHMA 2GCTC 4YZUA 1XUHA 4NCYA 1H8DH 1FPCH 3T2NA 1TGBA 1UVOA 4K8YA 4NSYA 3IG6B 1UVPA 4VGCC 1LHCH 1CGIE 2ZGCA 1ZHPA 5LH8A 2VIPA 2CN0H 1AFEH 2ZP0H 1O2OA 1C1VH 3BG8A 1O3PB 1UCYH 1O2WA 2P95A 3UREA 3SGBE 4AG2A 4IN2A 4DT7B 2NU2E 2ODQA 1AE5A 3RU4D 1C9PA 1OPHB 1LVOA 2XBWA 1MQ5A 1GWAA 1ZGVA 3H7TA 1OYTH 2AFQB 2JETC 1GCTC 3EQ0H 3VB6A 1EZUC 2JH5D 2FODA 2ZU2A 1IHSH 1GJ4H 1M9UA 5A0BA 2G81E 1ESBA 1QA7A 4A92A 5F8XA 1AO5A 4GHTA 1S81A 2J94A 4YESB 2OCVB 4ZROA 1P11E 1Z6JH 3Q3KA 4ISLA 2HRVA 1H9LB 2FEQH 2VVVA 4X1RU 2F9VA 4GCHG 5J4SA 2SGQE 1NU7B 3VEQB 4YLQH 2NU3E 4Y11E 3AW0A 3EYDA 1TPAE 1GHAF 2VIWA 2UWOA 4IMQA 1ZRKA 2VGCB 2V3HH 4XSKU 1UK3A 4SGAE 2J92A 1XXFA 4K8BA 1HAXB 3BEUA 1SGCA 3EAJA 3SV7A 3T62A 3S9CA 4X2WA 3RXUA 2XXLA 4LK4A 3MYWA 3QX5H 1MKWK 4FXGH 1NFUA 1A2CH 3BTFE 2Y5GA 5DJ7A 1A5IA 1EAXA 3BEIB 1ANDA 3TGJE 5BPEA 1C5PA 3MU1A 1OP8A 1G2LA 1S82A 1WAYB 3RXGA 4NZQA 2BLOA 2WINI 2ZF0H 4XDEA 1ABJH 1L1JA 1HAGE 1SLUB 2CHAB 2ZU3A 1O2NA 2GCHF 2R2MB 2ZZUH 3QZQA 1JWTA 1QL9A 3RXRA 4J1YA 1O2VA 3TJOA 2V6NA 2PTCE 2RG3A 1O39A 1Z8JB 4NIWA 3SU5A 4K60A 1GG6C 3F9HA 1GI2A 2ILNA 2FI4E 2GT8A 2OC1A 2PWXA 3ATMA 1SGQE 3CP7A 4AOQA 4OGYA 2BLVA 1YPMH 1GHVH 1AWHB 2ZTXA 1C5XB 2ANMH 1YPEH 1XVMA 3BTHE 3RU4T 4GUXA 4X6OA 4Y71A 2ZU1A 5E0GA 1IQKA 1N8OC 1D6RA 1BUIA 2TGDA 1BTWA 1YCPM 1S84A 3T27A 1ELVA 2ZU5A 3QTOH 1NN6A 2ZIQH 2WPHS 3EA7A 1D6WA 3OTJE 2OLGA 2H9HA 1Y3VA 3STJA 3BF6H 1TB6H 1YCPH 5F8ZA 1G37A 3DA9B 1T31A 2SNVA 1C2FA 1LCYA 4MPUA 5FAHA 5JPMH 1Y3UA 4CR9A 2FS8A 3SV8A 1FV9A 1TMBH 1QRWA 1SB1H 2D1JA 2ODPA 3M3VA 2PTNA 3P8NA 4ASHA 1SHHB 3URDA 3BTTE 1QR3E 2EA3A 2M5TA 1O3BA 5F8TA 1O36A 4QT8C 3GCHB 5CHAC 1J17T 1SBWA 3V7TA 1ETRH 3FP6E 2EI6A 1KXDA 1TLDA 4LOYH 1J16A 4A5TS 1NPMA 1D3PB 4DOQA 1C5VA 5DP6A 3PLBA 4CRAA 4XFQA 3UIRA 1HJ9A 4NA7A 1V2MT 1A5GH 1AZZA 3SHCH 3F1SB 1CA0B 4Q7XA 1HCGA 1BTZA 1EASA 2RCEA 4UD9H 2Z9KA 3EGKH 2Z3EA 3MOCA 3ZZ9A 1UHBA 1FY8E 1HAZB 4BAHB 2WUBA 3T28A 2PFEA 1AN1E 3U98H 4OS5A 3KHVA 1DFPA 1TYNA 1UK4A 2GKVE 3K65B 1Z8RA 2BXUH 1YLCA 1QY6A 1WYKA 4TWYA 2BYAX 1O30A 1P9UA 3PO1C 1P2IA 1THRH 4OS2A 1C2MA 1TGSZ 4X8SH 2HNTC 2O8LA 4KKDA 3TITA 5FX6A 4I8JA 2FOMB 2FPZA 1P09A 4GPGA 4DGJA 4Y8YA 3ZZAA 3U69H 1J15A 2H6MA 1XVOA 3M7UA 1GMCG 1IHTH 1D3QB 2GD4B 1YPJH 4RSPA 1N6YA 1VCWA 1ZGIA 4R0IA 3A8AA 2C4FH 1E0FD 3U1JB 3GICB 1LHFH 1CT0E 3AAVA 1XM1A 1G3CA 1FMGA 1C2JA 1DX5M 3ZZ5A 3MU4A 5JBBS 3ATKA 1QJ1B 1ORFA 2GX4A 5H4IB 4I8KA 4JZDH 1O3LA 3A89A 4YT6H 1V3XA 2PSXA 3TIUA 2ANWA 4BTIB 1EOJA 1VR1H 3SJ8A 5TJXA 2VNTA 4B75A 2QXHA 1GMHG 2OC0A 4JK5A 3BIUH 1FIWA 2TIOA 1PFXC 1H4WA 4WWYA 2BDHA 1A4WH 3SU0A 3V12A 1BBRK 1LKBA 1ZRBA 2PHBA 3TVJB 1C1PA 1C2EA 1NY22 1VGCC 2BY7X 3RXPA 1YPHC 1BMMH 3QUMP 5C2ZA 3BV9B 1IQLA 1SGYE 6CHAC 1DT2A 1ABIH 5SGAE 1TRNA 5ESTE 4K1TA 2CF8H 3E90B 3ZZ6A 2VH0A 2BMGB 2BY9X 4AFQA 4NIYA 2WV4A 4CHAB 3LGUA 3VGCC 4O97A 2PGQB 1HDTH 3SNAA 1P12E 1C4U2 4KTSA 4D76A 3ZYDA 1CSOE 3P92A 2R3UA 4X0WU 1RJXB 3GYLB 1QB9A 4OS6A 3Q00A 1NROH 2EI7A 1X7AC 3D62A 3G01A 3UOPA 5FCKA 3GCTF 3M35A 1FY1A 3URCA 3UTUH 1WCZA 5GCHF 4H42U 3UR6A 2YNBA 3KQDA 2FLBH 2VVUA 1F7ZA 4DW2U 2FLRH 3D65E 4I33A 1GHWH 1W14U 1GHXH 3VXFH 4A6LA 2BD7A 1ESAA 2SFAA 1C5SA 1L4ZA 2ZHFH 2Q6FA 3VFEA 2TRMA 2VU8E 3RXCA 3MI4A 3P8GA 3TK6A 2BZ6H 1FLEE 1P05A 1LHGH 4NWKA 9LPRA 1C1WH 3ZVGA 4UFGH 5I25A 5CMXH 2C8YB 3TGKE 2AH4X 2FOFA 2TPIZ 3A80A 2GDEH 2QXJA 1TOCB 1YKTA 4FU9A 4OS7A 1K2I1 4WXIA 1C2LA 2AIQA 3I29A 3SHAH 7KMEH 2BD4A 3RXQA 2FI5E 2DE9A 1BQYA 1E38B 1HGTH 2BLQA 1TGNA 4HZHA 3WY8A 2HNTE 3SUFA 2HOBA 2IPHA 3FVFB 1Z71A 2QF3A 1WQVH 2WV5A 3FP8E 1QIXB 2VWMA 1EP5A 1C5WB 3PWBA 4NWLA 2WPJS 3ZV9A 2A4RA 1GJ6A 1OWIA 1HB0B 1LVBA 1K21H 3GDVA 2A45B 2GVFA 4BTTB 2K1QA 1NS3A 1C1RA 6GCHG 2O8UA 3KQBA 5DO4H 3VB5A 1XUIA 1MKXK 4B1TA 1SGFG 3GOVB 3MH6A 4GAWA 3BG4C 1ZLRA 4ESTE 2J4IA 4DIHH 3P17H 4AFSA 1P01A 2FP7B 1GI0A 1QURH 3MMGA 2G4TA 1MD8A 2FX6A 2ULLA 4AX9H 1K1LA 2RDLA 2SNWA 1WSSH 5EG4A 2ZFPH 1MBQA 1O3JA 2TGPZ 3HATH 3SQHE 4X1SU 1GGDC 1EZXC 3CS0A 3KNXA 1V2PT 4ZH8A 1E37B 1YPHE 2G55A 5GCHG 3SJIA 1C5NH 1QBVH 1UJ1A 3V0XA 1KXBA 1ELGA 1DVAH 1SG8B 1TMTH 3FZDA 3GY8A 5AFYH 1GBHA 5DG6A 5EXLA 1EB2A 1PQ5A 2Z6BD 3MNXA 1AVGH 1MAXA 3QZRA 5AF9H 3SU1A 2FWWA 3SQEE 1NFXA 1P3CA 1Y3YA 4INLA 4UDWH 2WPMS 2VIVA 1KDQA 3N7OA 1GDUA 3SORA 3PLPA 3RXIA 1WOFA 5C1YA 3PMHB 1QCPA 1YP9A 1HXEH 3UUZA 3VB3A 3SJOA 3PV4A 3LC5A 2SGEE 3TJVA 2ZFFH 1QTFA 3MU5A 2BHGA 1SLVB 2BVSH 1Q3XA 7ESTE 4SGBE 1L4DA 3TH4H 3TNSA 1BOQA 1G32B 2PW8H 2HWLB 4WVPE 3I78A 3A7WA 1MQ6A 1P2QA 3RC6A 3ZVFA 3ZZ4A 1AMHA 3JZ1B 2ASUB 1MH0A 1HIAB 1UVTH 5JB9S 4FUCA 5FHTA 4KELA 1O35A 5LPFA 1CGJE 1EAWA 2XWAA 2FYQA 1W11U 3LIWA 2BX3A 5J4QA 1V2QT 1DLEA 5EPYA 1Q2WA 1F92A 3B23B 4ISHH 3O8RA 5EQRA 1Y5BT 4E7RG 4ABDA 5EW2H 3C27B 3GY3A 2BLWA 3SN8A 1GBJA 1O5CB 2ZECA 3A8BA 3SGQE 4ABJA 1C4Y2 1ELDE 4DVAU 1C5MD 3VPKA 2BXTH 4GCHF 1BT7A 4YOGA 1KXEA 1MTNC 5K0HA 4ZUHA 3BTQE 1SGPE 4ZMAH 1HAHH 2TGTA 3F9FA 1T8NA 3ZZDA 3KL6A 1GI3A 4JYVH 2BQ6B 2Z9GA 3OSYA 5FBIA 2CGAA 1O2LA 1TNHA 4AB9A 4F4OC 4B76A 1PQ8A 1NC6A 4M7GA 1LPGB 2ZDAH 2Q6DA 3M3SA 2ZPRA 2AIPA 1OP0A 5DP8A 4FVBA 3TU7H 2ZGBH 1C5ZB 1XKBC 3A88A 1W2KH 1EPTB 3SNBA 4BXSA 4HTCH 1O37A 1Y3WA 3KCGH 3VB7A 1EKBB 1Z8GA 3S9BA 2BDCA 1MMJN 2ALPA 4K5ZA 2PUXB 4CBOA 3OY6U 2J9NA 1SOZA 1O2SA 3TJNA 4FU7A 2O8MA 1NTPA 1QJ6B 1UCYE 2BZAA 4ZKRU 1GBIA 3LC3A 3A8DA 1GHBG 2QA9E 1P2OA 1TX7A 3L33A 1JXPA 2PLXA 4Q80A 1MKWH 2ZFRH 4INKA 2F83A 3A7XA 1GBKA 2BVXH 2FOAA 1ZR0A 2UWPA 2SGDE 4NA8A 1TWXB 2P8OB 1AKSA 4A1VA 1OWJA 5GJ4B 4X6NA 3L3TA 1KXCA 2R2WU 4TY7A 1BA8B 2OTVA
chains in the Genus database with same CATH superfamily
3W94A 1THSH 3PROA 1FPHH 2GCTB 4FVDA 3RU4E 4YT7H 2STBE 3T25A 1O3CA 2J2UA 5E8EH 1FJSA 4Y7BA 3H7OA 4OS1A 1BRCE 2OP9A 1T8LA 1TNLA 1ANBA 1V2TT 3TLOA 5FPSA 1F0SA 2G4UA 3MFJA 3NRLA 3MNSA 4FUDA 1VJAU 3JZ2B 4BAKB 3A81A 3PV5A 4BAOB 3EE7A 2C3SA 1H9IE 3KIDU 2WV9A 3QGJA 1HJAB 2W3KA 5C1XA 2BTCE 2KFWA 1CT2E 2Y7XA 1C5QA 2VWLA 3A82A 1GVLA 4FUIA 4D9QA 3QWCH 3BN9A 1UTLM 5LGOA 2B0FA 1PQ7A 4DURA 2SGAA 2Z3CA 2YMSB 1DICA 1UTJA 4Y76A 2ODYB 2Y5FA 3SI4H 1QB1A 3RUOA 3PLKA 2L74A 2P93A 3PB1E 6ESTA 1RIWB 1IQJA 1V2KT 2EC9H 5GWZA 1GHZA 1L1NA 3KF2A 3SU3A 3SZEA 3UPEA 4F55A 1DY8A 2HLDD 2A2XH 2FTMA 2GZ9A 3E6PH 3FO8D 1CHOG 1SQTA 1TOMH 3QGNB 4XOJA 4I8LA 2UUKB 4OS4A 5BRRE 4XE4A 1E1RD 1SMFE 3P70B 1SC8U 2AGIX 1GJCB 3DFJA 1A0HB 2GMTB 1AE8H 2KAIB 1QHRB 2F9OA 7GCHG 1LPZB 4Y8XA 1SLWB 3ZYEA 3ZVBA 4X2XA 2ZTZA 1Y3XA 3QK1A 3BIVH 3VB4A 1J9CH 1GMCF 1Z6EA 4ZKNU 1FIZA 1HNEE 4HGCA 1VITG 5DP9A 3LH1A 1K1NA 2ZGXH 2B7DH 2XOKD 4ABIA 1TGCA 1O3GA 4D7GA 2WYGA 4ZAEA 5EW1H 4ABFA 5B6LA 2TBSA 1QA0A 1GHYH 4IN1A 1GBBA 4AG1A 2BQWB 1FNIA 2ZO3H 2K0QA 3S0NA 3QTVH 3SOSA 3UOUA 4H4FA 1GMHF 2HVXA 2XBYA 3RXVA 1B0EA 1QFKH 2ZCHP 3MH5A 1GBAA 4ABBA 1NFWA 1C1SA 4TPYA 4XRNA 2H9TH 3ELAH 1QZ8A 2BD2A 3NWUA 4A1XA 2GV6A 2F43B 5A0AE 1YPKH 1BJUA 2BVRH 2QIQA 3NCLA 1PYTD 5JB8S 4BOHA 1GJ7B 2O9QA 3BEFB 2NU0E 5EQSA 2C8WB 1QL7A 2PKAB 3RC4A 1ETSH 3SGAE 3H5CB 4Z6AH 5I46H 2A5AA 1DUAA 4Q7YA 5GDSH 2AGGX 1TPSA 2A2QH 4F49A 8LPRA 3GY4A 1BTUA 1O32A 3RXOA 1CA0C 2B9LA 3RXJA 3ZVAA 1ELTA 4X2VA 2P94A 3C1KA 4HI3A 1XX9A 1AGJA 1AQ7A 3UY9A 3A83A 1F5KU 2BDYA 1OOKB 5C3NA 3EE0B 1ZMLA 1KLTA 2ZCKP 1O3FA 2CJIA 2EQNA 1ZSJA 1BBRH 1GBDA 2ZU4A 2FO9A 1QBOA 2LPRA 4ZHAA 1PPZA 2A32A 3LOXA 4CBNA 3RXFA 2QAAA 1EAIA 1W13U 2YMSD 5AFZH 2Y80A 1NT1A 1AFQB 1S6HA 1WXRA 3SU6A 1O5EH 1NFYA 2EI8A 2OQ5A 2A5IA 1YM0A 3PMAB 5C0TA 1QGFA 3LONA 4D9RA 5HXFA 3A84A 3U1IB 3HGPA 2ZA5A 2R0LA 1GBMA 3N99A 1F5LA 3A86A 4ZHMU 1NRNH 2XCNA 2QYIA 1DANH 1Y5AT 3MH7A 1MTVA 2XNDD 3Q76A 1FI8A 5E2OA 8KME2 1FUJA 1GI5A 4ZCNA 5FX5A 1P04A 2RFKC 1B0FA 4Q7ZA 3ATLA 3E0PB 5A8XA 3RLWH 1O2YA 4IS5A 4WH8A 2WZQA 1SFIA 1C9TA 1TE0A 3UWIA 4AB8A 4UE7H 1DPOA 3Q3XA 3P8OA 1WTHD 4UFEH 1KXFA 1FY4A 1C5RA 2H2ZA 5GPIB 2I6SA 2XC4A 5FXLA 3F2GA 2ZDLA 4MPWA 1GBFA 1BB0B 3RMLH 1TMUH 3O8CA 2ANKH 2QGRA 4A1TA 3ZVEA 6GCHF 1W0YH 3OYPA 2ZG0H 4YM9A 2PKSB 2ZI2H 1W3CA 1SL3A 1NO9H 1O34A 2B8OH 2P3UB 3CNRA 1KYNA 4CHAC 1T8MA 1RTLA 1TNKA 1AHTH 1ZPCA 4X8UH 1ANEA 1SFQB 1FONA 2B5TB 1NESE 2PGBB 3HK6B 5EIYA 4TPIZ 2OD3B 4K1EA 1NBME 4MG3A 1BTPA 2H5CA 1TX6A 2ZEBA 2OC8A 5LPRA 4CR5A 3PRBA 2FM2A 3ZZCA 5L6NH 2NU1E 1MKXH 2OUAA 1VGCB 2A5KA 1OP2A 2BD5A 4U32A 1C5YB 1JIRA 3LU9B 4MNYA 4RKJB 2ZPSA 2FS9A 1MCTA 2BD9A 1SPJA 1K0HA 1C5UA 4AZ2B 5AHGH 3GY2A 1ZSLA 1TBQH 3GCOA 2WPKS 1KIGH 1THPB 4X1NU 1CU1A 3K6YA 1AB9B 2BM2A 3W1EA 1QB6A 1EJAA 1AY6H 2QN5T 5T3HA 4OGXA 1TQ7B 1TA6A 1C2DA 2ZGHA 3GY7A 5EOKA 5DKMA 4NGAH 3IITA 1PPCE 1TPOA 3NK8A 1TONA 2QF4A 1ZSKA 2WPLS 4BANB 1C1OA 1HAOH 4P02A 2D2DA 1OWHA 4MDSA 1GJBB 4NIVA 2FOHA 2VVCA 3MU8A 4UFFH 3ODDA 1GVZA 1A0LA 1O3OA 4X1PU 3RXTA 2W5EA 1P2JA 3GISB 3MO9A 2F9NA 1MABB 1KLIH 1SGEE 2Y82A 2CMYA 4XBCA 3U8TH 1HJ8A 5T6DA 2HLCA 3PMBB 1C2HA 1GL1A 4ISNA 3KEEA 1F0RA 1FQ3A 3GYMA 1LQEA 1ACBE 1V2RT 2WYJA 3F3BA 3E3TA 3BTGE 1BITA 1WQSA 2K8IA 4BAQB 1H8HD 4GHQA 3FOAA 1HXFH 1JRTA 1AIXH 1O0DH 1C2KA 2NU4E 1CBWC 3FN8A 1L1GA 1WBGB 3FFGA 1E79D 5ESBA 3D23A 1MCVA 3GS9A 1ARCA 1P02A 1LO6A 5EODA 2DE8A 2A7HA 2D8WA 1G30B 1SLXB 3UNSA 4JYTA 1GI9B 3EDXB 2Y81A 2Z9IA 4Y7AA 3UFAA 2KAIA 3I77A 4LZ1H 1O3KA 1ARBA 4JZEH 3CENA 1C5LH 1K1PA 3UNRA 8ESTE 2CV3A 1EB1H 1BJVA 1C2IA 2VIDA 3UR9A 1U6QA 1C4V2 1QRZA 1LMWB 2W7SA 4ABHA 1E36B 3GDSA 1P8VC 1CVWH 4Q2KA 2LELA 5F03A 1PPFE 5TCAA 5HM9A 1SGIB 1IQEA 3KQCA 1UO6A 5DP7A 1W12U 4B73A 1DDJA 1PPGE 1P9SA 1VCQA 2OC7A 2ZHDA 1YYY1 1ELBA 1W8BH 3RXMA 1FZZA 1LHEH 2C90B 3BG4B 4AYVB 1DOJA 1P03A 1ID5H 1OWEA 2ZQ1A 2V3MA 1ZYOA 4HG6A 1ZHRA 1HBTH 4MLFB 2HGTH 3DFLA 3TNTA 3KQEA 4FETA 1ELAA 1FN8A 1T8OA 5DK1A 1ZTLA 1LDTT 2FDAA 2XBXA 1GHBF 1S5SA 1DE7H 2V7QD 3FKSD 3MU0A 1IAUA 7LPRA 8GCHG 3ZZ8A 1D4PB 4ABEA 2Y5HA 1T7CA 1OWKA 1HLTH 2XNIA 1TPPA 4Y0YE 3SNCA 2PKAA 1VKYA 2L6OA 1O2TA 1P3EA 2OINA 4XBBA 4MNWA 2FYRA 4GLYA 3TK9A 3RXDA 4R8TB 4WXVA 1O5FH 3A7YA 4FUHA 2HPQH 2CK3D 1S0RA 1HFDA 1GJ9B 3HPTB 1HAYB 1ZMNA 1KY9A 2IOTA 5JBCS 4UONA 2ALVA 2RA3A 1ETTH 1LTOA 2QF0A 3FP7E 5G4BA 3T5FH 1EXFA 4IW4E 3RMNH 4I7YH 1BZXE 1P10A 1UTNA 3M3TA 3M61U 1GJDB 5DP4A 1UK2A 3M7QA 5EJLA 2P59A 4JK6A 4KTUA 1GL0E 3SI3H 1FY3A 2C93B 1GDNA 1NM6A 9ESTA 1JRSA 2FTLE 1BRUP 2XWBI 1SI5H 3RLYH 3RXAA 3TGIE 1O2KA 1DS2E 4AYYB 4INHA 4K3JA 4PROA 1W0ZU 4E06H 3M5OA 5EGMA 1FXYA 5EJZA 1XUKA 1UVSH 1OS8A 2J38A 3F9GA 2A31A 5HGGA 1A1RA 1DWBH 1JIMA 3R0FA 1TBRH 3PM3A 1F2SE 1P0SH 4I31A 1EPTC 5FPYA 2UUFB 2WPDD 2XYAA 3SUGA 5B6OA 2HPPH 3LDXH 4XBDA 4JZFH 1CHOF 1WV7H 1SGFA 1GMDF 3ESTA 3RP2A 2J5UA 4B74A 1ANCA 2P3FH 4O9VA 1H1BA 3V13A 1PQAA 4JZ1A 3SW2B 1O3DA 5E2PA 1SGDE 1GPZA 1NZQH 1O2JA 2OQUA 2EEKA 3BTDE 3LGWA 7GCHF 5FPTA 3DSPA 1HRTH 1A3EH 2VB0A 1BMNH 1KSNA 1EOLA 2G00A 4DCDA 1UTMA 4JMYA 5DP5A 1Z7KA 1NRQH 1AZ8A 3TK5A 1ELFA 1HAPH 1NRPH 4JYUH 2A7JA 3RXHA 2V3OH 1VITF 1SQRA 3P95A 2ZTYA 3KGPA 1DSTA 1AD8H 1SGTA 4X1QU 4CRFA 4J2YB 3E0NB 1S6LA 3UNQA 4NIXA 1MU8B 1XUFA 1RTKA 2W26A 1RRKA 2P8OC 3S7KB 2YOLA 2G52A 2BD8A 4UEHH 1TNGA 3STIA 1PYTC 3RDZA 3WW7A 1O31A 1B5GH 4F48B 1A7SA 1O5DH 3MTYA 2FOCA 3ZZ3A 2V35A 3DSOA 5L2ZH 4MTBA 2STAE 2VIOA 4NZLA 1BDAA 1C2GA 6LPRA 3PRDA 1P2KA 1E1QD 1F5RA 1RTFB 2O8WA 4KP0A 1FN6A 4CRDA 2AMDA 2AMQA 4Z0KA 1SOTA 4BTUB 3QO6A 4ZHLU 1Z8IB 2PR3A 2JKHA 5GNDA 3RMMH 1B7XB 1MTSA 1MTUA 2OBOA 4VGCB 1Y8TA 3ATWA 1G36A 3K6ZA 4LZ4B 3K9XB 1HJAC 1O3NA 3O8DA 3M5MA 1W0KD 1G3EA 1IOEA 2Y6TA 3BTME 1ELCA 1FAXA 1O5AB 2CF9H 4I8HA 4Y10E 1Z1JA 4ABAA 1CHGA 2R3YA 2SGFE 1O5BB 2A0QB 2YMSC 5FBEA 1GCDA 4THNH 1OYQA 2ZGJA 1OX1A 4NFFA 2KCPA 2G51A 2GZ8A 1S6FA 2VGCC 1KTTB 1XMNB 1NRSH 3M5LA 5EJ1A 1RIWC 1ZOMA 1BCUH 1RGQA 1EJNA 1MU6B 4X6PA 2JH6D 3PYHA 2JETB 2Z3DA 1GCTB 1F0TA 1XUJA 2A4GA 1SR5C 2GTBA 1GVKB 2IN2A 1ELEE 2WPIS 1D3DB 4WMDA 1DM4B 2JIZD 5C0UA 1TQ0B 1UTPA 3KYFA 1O3MA 4GSOA 2GMTC 3M5NA 2CHAC 2ZPQA 2H1UA 1GMDG 3ENSB 1OSSA 1SQAA 4TY6A 5JYIA 1O3EA 2XC5A 1T4UH 2F9PA 3CS7A 4K69A 1ZPBA 4ZKOU 1ZMJA 4B2AA 1V2JT 4MPXA 1O2QA 3U8OH 1DLKB 2PSYA 1OXGA 4RKOB 1BRBE 2AS9A 3BTKE 1BRAA 1TGTA 1UCYK 1PPEE 1BTYA 3HKJB 1N6XA 3AASA 5IDKA 1HYLA 1Q31A 1EZQA 3ODFA 3BTWE 3MQKC 3GDUA 2DUCA 5JDUB 3NPSA 1HUTH 3LT3A 2BDAA 4FUBA 2GDDA 3S9AA 2F9UA 2BX4A 1QL8A 2J98B 1NU9A 2G5NA 3SU4A 1DY9A 1OWDA 4DIIH 1VITH 2XRCA 5HM2A 3NKKA 1TBZH 1BTXA 2A4OA 2KCAA 2ZWLH 3A8CA 2PP6A 2I6QA 4M9FA 1CQQA 1RD3B 2BDIA 4X8TH 2F3CE 3HGNA 3OEHD 3OX7U 4WMEA 4ISIH 3V3MA 2AGEX 4CH8B 4YO9A 3TJUA 2FMJA 1GG6B 5EU8A 5A09A 1G2MA 1XXDA 2V0BA 1WTGH 4FUFA 4YTAA 1J14A 2H9EH 3GCHC 2BD3A 2J97A 4TYDA 5IYTA 5K7RA 1O2RA 2BB4A 1IQIA 2NWNA 1JBUH 5GIBA 1VZQH 5EPNA 3P8FA 1N8OB 1YPLH 2FXRA 3T29A 1YBWA 3TH3H 1BBRE 3RM2H 1F0UA 2Z9JA 2UUJB 2BY8X 3E8LA 4U01A 4WJG2 3RXSA 4WMFA 2YNAA 4I86A 1LVYA 1KDQB 2Q1JA 4IBLH 4H6SB 1TAWA 3AVZA 3NXPA 2A4QA 3HK3B 2QC2A 5EXMA 1TFXA 1AFQC 1C1QA 4MNVA 1O38A 2PUQH 4MPVA 3ZVDA 1GI8B 3PMJA 4D8NA 3RXEA 3UQOA 3FAOA 1PPHE 3B9FH 3SV2H 4U30A 2BDBA 3RMOH 2ZFQH 1VCPA 3LJOA 3SBKA 3M7TA 5CHAB 3EA9A 5AVDA 4B2CA 1HIAA 1GBCA 3F68H 1O2MA 1ZPZA 4JCNA 4D7FA 1L0ZA 1KTSB 4AGJA 1GHAG 1UVUH 3AAUA 3S7HB 1EJMA 1C5OH 4XD7D 2IJD1 2THFB 2VWOA 3F9EA 3LKWA 4RT0A 4MNXA 3SV9A 4BNRA 1JMOH 1ZTKA 4BXWA 1HAVB 4CH2B 1CA8B 2ZC9H 5EXNA 2FOBA 1BMFD 1PPBH 3LJJA 1DSUA 1BIOA 5TCCA 1NRRH 2P3TB 5PTPA 1GBTA 3O8BA 2VJ1A 1A0JA 3FANA 5DGJA 3R3GB 2QY0B 2VWNA 1CO7E 3PO1B 1O2XA 5C5OA 1S85A 1DWEH 2GCHG 2ZDNA 1YCPK 1TNIA 2WUCA 3E91A 2BOHB 3LGVA 4FOUC 2PKSC 1EP6A 5L2YH 3SUEA 1MZDA 2AERH 2GZ7A 3F6UH 5E0HA 1C1NA 1K1OA 2VIQA 1GI1A 5FCRA 4WY3A 1BTHH 3UB0A 1EFRD 1EPTA 1ESTA 4GVUA 2HNTF 1DXWA 1LKAA 1W7XH 1MTWA 1V2ST 3SJKA 1IQMA 2ANYA 2BY6X 1A5HA 2A1DB 2VH6A 1WUNH 1AUTC 3F2FA 1SKYE 4AORA 1ZJDA 1E35B 1EX3A 1GBLA 4IC5A 1O2PA 1UMAH 2PV9B 1V2LT 4IC6A 1UTKA 3OU0A 1TRYA 2XBVA 3LGTA 5DPAA 1YC0A 2SGPE 3A7TA 2XW9A 3OTPA 1SHYA 4Y79A 1DITH 2F4LA 4AFUA 2QXIA 4B2BA 1SVPA 4ISOA 2OK5A 1CE5A 1S0QA 1AB9C 4I8GA 5LPEA 4YOIA 1KLJH 1W0JD 3U8RH 4ZKSU 3MO3A 2F91A 6CHAB 1AKSB 4ZXXH 3E1XB 1G3BA 1ZZZA 1OHHD 1P57B 4FU8A 2BY5X 5T6FA 1P2NA 3M37A 3Q3YA 1T32A 3VGCB 1T4VH 1D9IA 1DUEA 4CREA 8GCHF 2G8TA 3QLPH 1C1TA 1A3BH 1A46H 5FL7D 3OEED 1HV7A 4FUGA 2M2AA 4B6EA 1KXAA 4WF8A 4U2WA 1GBEA 1V2WT 1AI8H 1UTOA 3NUMA 3UQVA 2KR7A 1GJ8B 2XTTB 3LGIA 1SGRE 1EQ9A 4K2YA 1IQNA 1ZJKA 1EZSC 3QDZB 5A0CA 4FUEA 3W95A 2IJOB 2P16A 1IQHA 3ITIA 4AGKA 3KQ5A 1CGHA 3EA8A 3A7VA 2QV1A 1QNJA 3SUDA 3B8JA 4O03A 2OBQA 4DJZB 3UAIC 1PJPA 1QBNA 1YPGH 1V2NT 1GDQA 1BMLA 1J8AA 3P6ZB 2VINA 2QF5A 1O3HA 2QXGA 4X8VH 5ABWA 2FOGA 2D26C 5DP3A 3GY6A 2F9BH 1INCA 1GJ5H 1W10U 2XC0A 1EAUA 2Z94A 3VG8A 2FIRH 3A7ZA 4IMZA 3M36A 2GJGA 4O3TA 2XCFA 1P2MA 1EUFA 3SNEA 4A7IB 1BMAA 1RFNA 1TRMA 5C5NA 2ZFSA 3HKIB 1SQOA 2Z7FE 5JBAS 5ETXA 1SGNE 1O2ZA 4Q63A 4Y0ZE 1CT4E 3FZZA 5T6GA 1V2OT 4FUJA 2UUYA 2BQ7B 3QN7A 4ABGA 2FZZA 4KGAA 3TPIZ 1O5GH 2ZKSA 1O2GH 2J95A 4AFZA 3SU2A 1CBWB 1V6DA 1K28D 2HALA 1C1UH 3T26A 3IWMA 3UWJH 1TIOA 5JBTA 3BTEE 2RA0A 2TGAA 4CRGA 3RC5A 1V2VT 1AU8A 2CXVA 4K1SA 5C20A 2J98A 5A8ZA 4E05H 3AW1A 1MBMA 3ZVCA 3L6PA 1P06A 3A85A 2FI3E 2JH0D 4TWWA 3VXEH 5HYOA 3DT0H 1DWDH 1GJAB 1O2UA 4X6MA 4Y8ZA 4UFDH 3SNDA 1W7GH 3PTNA 5C94A 3LGYA 2Q6GA 1C5TA 3MHWU 2FOEA 2AYWA 3GCTG 1VJ9U 1O3AA 1HPGA 3SV6A 2C8XB 5HMAA 1HAIH 2ZQ2A 1AUJA 3BSQA 1GGDB 1MZAA 1K22H 2WHXA 2W7UA 1K1IA 2R0KA 5A2MH 3F0OA 3SO3A 2UWLA 4RI0A 3DHKH 3E16B 3D49H 1AVWA 4H6TA 1K9OE 1LQDB 2FESH 3OY5U 1MUEB 1ZTJA 4IGDA 1RXPA 1L2EA 1LVMA 3RXKA 1YF4A 3GCNA 3PWCA 1GI7B 1O2IA 4I32A 4MVNA 2R9PA 2C8ZB 4E7NA 4O3UA 2ZNKH 3ATIA 1COWD 4NG9H 1IQGA 2AMPA 2W6ID 4NSVA 1OKXA 1TALA 2ZDKA 1TX8A 1XKAC 2G5VA 2ZHEH 1K1MA 1QRXA 2A7CA 3MWIU 1UHBB 4ZXYH 3LH3A 4AN7A 1UTQA 2ZHQH 4B71A 4MQAA 1AVXA 4LXBH 1YGCH 3RXBA 4DY7B 1V2UT 1D3TB 2OXSA 5C67A 1RS0A 4RN6A 3K2UA 1LPKB 1S83A 1IQFA 1WU1A 1LHDH 1G9IE 1MAYA 1QQUA 2ZDMA 3ZV8A 1DXPA 1EATA 4NFEA 3S69A 3MNBA 4YLUA 1Y5UT 1GI4A 1HAVA 3GY5A 4CRCA 1TNJA 2GT7A 1AWFH 1TA2A 1E34B 5CE1A 5EQQA 3SJ9A 4WH6A 2BDGA 2O8TA 2LNCA 3KN2A 1BHXB 5F6MA 1GI6A 3A87A 4BAMB 3ZZ7A 2FX4A 1FDPA 1MD7A 3MO6A 1N1LA 1JOUB 4JZIA 4YOJA 3PTBA 3LPRA 5L30H 5HKKD 2GGVB 5A8YA 2ZCLP 2QCYA 3SYJA 1SSXA 2Z9LA 4DG4A 1A61H 3Q77A 1DWCH 1MTNB 1Y59T 2H5DA 1FAKH 1BHXF 5E0JA 1Z1IA 3ZZBA 3SZNA 1XUGA 3RM0H 2Y7ZA 1H9HE 3DD2H 2W3IA 1YLDA 4KTCA 3U9AH 5GXPA 2J34A 2ZDVH 4HFPB 3DUXH 1FY5A 2GV7A 4NA9H 1O3IA 1QQ4A 1H8IH 4X2YA 2ZHWH 3NZIA 4CRBA 1G3DA 1O2HA 1O33A 3TH2H 3MNCA 2GP9B 1WDIA 5C1UA 1TABE 2ESTE 1QJ7B 4Q4LA 4Y6DA 3MH4A 2BOKA 1K1JA 5HIYA 2AEIH 3RXLA 2ZFTA 1C1MA 1ZHMA 2GCTC 4YZUA 1XUHA 4NCYA 1H8DH 1FPCH 3T2NA 1TGBA 1UVOA 4K8YA 4NSYA 3IG6B 1UVPA 4VGCC 5T1VA 1LHCH 1CGIE 2ZGCA 1ZHPA 3F0PA 5LH8A 4ACBA 2VIPA 2CN0H 1AFEH 5HIZA 2ZP0H 3OE7D 1O2OA 1C1VH 3BG8A 1O3PB 1UCYH 1O2WA 2P95A 3UREA 3SGBE 4AG2A 4IN2A 4DT7B 2KZ4A 2NU2E 3PV2A 2ODQA 1AE5A 3RU4D 1C9PA 1OPHB 1LVOA 2XBWA 1YWUA 1MQ5A 1GWAA 1ZGVA 3H7TA 1OYTH 2AFQB 2JETC 1GCTC 3EQ0H 3VB6A 1EZUC 2JH5D 2FODA 2ZU2A 1IHSH 1GJ4H 1M9UA 5A0BA 2G81E 1ESBA 1QA7A 4A92A 5F8XA 1AO5A 4GHTA 1S81A 2J94A 4YESB 2OCVB 4ZROA 1P11E 1Z6JH 3Q3KA 4ISLA 2HRVA 1H9LB 2FEQH 2VVVA 3KYGA 4X1RU 1FX0B 2F9VA 4GCHG 5J4SA 2SGQE 1NU7B 3VEQB 4YLQH 2NU3E 4Y11E 3AW0A 3EYDA 1TPAE 1GHAF 2VIWA 2UWOA 4IMQA 1ZRKA 2VGCB 2V3HH 4XSKU 1UK3A 1YLNA 4SGAE 2J92A 1XXFA 4K8BA 1HAXB 3BEUA 1SGCA 3EAJA 3SV7A 3T62A 3S9CA 4X2WA 3RXUA 2KX4A 2XXLA 4LK4A 3MYWA 3QX5H 1MKWK 4FXGH 1NFUA 1A2CH 3BTFE 2Y5GA 5DJ7A 1A5IA 5DSFA 3WWBA 1EAXA 3BEIB 1ANDA 3TGJE 5BPEA 1C5PA 3MU1A 1OP8A 1G2LA 1S82A 1WAYB 3RXGA 4NZQA 2BLOA 3H09A 2WINI 2ZF0H 4XDEA 1ABJH 1L1JA 1HAGE 1SLUB 2CHAB 2ZU3A 1O2NA 2GCHF 2R2MB 2ZZUH 5KGOA 3QZQA 1JWTA 1QL9A 3RXRA 4J1YA 1O2VA 3TJOA 2V6NA 2PTCE 2RG3A 1O39A 1Z8JB 4NIWA 3SU5A 4K60A 1GG6C 3F9HA 1GI2A 2ILNA 2FI4E 2GT8A 2OC1A 2PWXA 4P00A 3ATMA 1SGQE 3CP7A 4AOQA 4OGYA 2BLVA 1YPMH 1GHVH 2JJ2D 1AWHB 2RDEA 2ZTXA 1C5XB 2ANMH 1YPEH 1XVMA 3BTHE 3RU4T 4GUXA 4X6OA 4Y71A 2ZU1A 5E0GA 1IQKA 1N8OC 1D6RA 1BUIA 2TGDA 1BTWA 1YCPM 1S84A 2JJ1D 2JDID 1ELVA 2ZU5A 3QTOH 1NN6A 2ZIQH 3T27A 2WPHS 3EA7A 1D6WA 3OTJE 2OLGA 2H9HA 1Y3VA 3STJA 3BF6H 1TB6H 1YCPH 5F8ZA 1G37A 3DA9B 1T31A 2SNVA 1C2FA 1LCYA 4MPUA 5FAHA 5JPMH 1Y3UA 4CR9A 2FS8A 3SV8A 1FV9A 1TMBH 1QRWA 1SB1H 2D1JA 2ODPA 3M3VA 2PTNA 3P8NA 4ASHA 1SHHB 3URDA 3BTTE 1QR3E 2EA3A 2M5TA 1O3BA 5F8TA 1O36A 4QT8C 3GCHB 5CHAC 1J17T 1SBWA 3V7TA 1ETRH 3FP6E 2EI6A 1KXDA 1TLDA 4LOYH 5F53A 1J16A 4A5TS 1NPMA 1D3PB 4DOQA 1C5VA 5DP6A 3PLBA 4CRAA 4XFQA 3UIRA 1HJ9A 4NA7A 1V2MT 1A5GH 1AZZA 3SHCH 2KCOA 3F1SB 1CA0B 4Q7XA 1HCGA 1BTZA 1EASA 3N7EA 2RCEA 4UD9H 2Z9KA 3EGKH 2Z3EA 3MOCA 3ZZ9A 1UHBA 3DSGA 1FY8E 1HAZB 4BAHB 2WUBA 3T28A 2PFEA 1AN1E 3U98H 2KCYA 4OS5A 3KHVA 1DFPA 1TYNA 1UW7A 1UK4A 2GKVE 3K65B 1Z8RA 2BXUH 1YLCA 1QY6A 1WYKA 4TWYA 2BYAX 1O30A 1P9UA 3PO1C 1P2IA 1THRH 4OS2A 1C2MA 1TGSZ 4X8SH 2HNTC 2O8LA 4KKDA 3TITA 5FX6A 4I8JA 2FOMB 2FPZA 1P09A 2IPQX 4GPGA 4DGJA 4Y8YA 3ZZAA 3U69H 1J15A 2H6MA 3OAAD 1XVOA 3M7UA 1GMCG 1IHTH 1D3QB 2GD4B 1YPJH 4RSPA 1N6YA 3OFND 1VCWA 1ZGIA 4R0IA 3A8AA 2C4FH 1E0FD 3U1JB 3GICB 1LHFH 1CT0E 3AAVA 1XM1A 1G3CA 1FMGA 1C2JA 1DX5M 3ZZ5A 3MU4A 5JBBS 3ATKA 1QJ1B 1ORFA 2GX4A 5H4IB 4I8KA 4JZDH 1O3LA 4ASUD 3A89A 4YT6H 1V3XA 2PSXA 3TIUA 2ANWA 4BTIB 1EOJA 1VR1H 3SJ8A 4OM9A 5TJXA 2VNTA 4B75A 2QXHA 1GMHG 2OC0A 4JK5A 3BIUH 1FIWA 2TIOA 1PFXC 1H4WA 4WWYA 2BDHA 1A4WH 3SU0A 3V12A 1BBRK 1LKBA 1ZRBA 2PHBA 3TVJB 1C1PA 1C2EA 1NY22 1VGCC 2BY7X 3RXPA 4TSFD 1YPHC 3N7DA 1BMMH 3QUMP 5C2ZA 5IK2D 3BV9B 1IQLA 1SGYE 6CHAC 1DT2A 1ABIH 5SGAE 1TRNA 5ESTE 4K1TA 2CF8H 3E90B 3ZZ6A 2VH0A 2BMGB 2BY9X 4AFQA 4NIYA 2WV4A 4CHAB 3LGUA 3VGCC 4O97A 2PGQB 1HDTH 3SNAA 1NBMD 1P12E 1C4U2 4KTSA 4D76A 3ZYDA 1CSOE 3P92A 2R3UA 4X0WU 1RJXB 3GYLB 1QB9A 4OS6A 3Q00A 1NROH 2EI7A 1X7AC 3D62A 3G01A 3UOPA 5FCKA 3GCTF 3M35A 1FY1A 3URCA 3UTUH 1WCZA 5GCHF 4H42U 3UR6A 4AC9A 2YNBA 3KQDA 2W6JD 2FLBH 5DN6D 1KMHB 4Z1MD 2VVUA 1F7ZA 4DW2U 2FLRH 3D65E 2AHME 2EY4C 4I33A 1GHWH 1W14U 1GHXH 3VXFH 2WSSD 4A6LA 2BD7A 1ESAA 2SFAA 1C5SA 1L4ZA 2ZHFH 2Q6FA 3VFEA 2TRMA 2VU8E 3RXCA 3MI4A 3P8GA 3TK6A 2BZ6H 1FLEE 1H8ED 1P05A 1LHGH 4NWKA 9LPRA 1C1WH 3ZVGA 4UFGH 5KECA 3AK5A 5I25A 5CMXH 2C8YB 3TGKE 2AH4X 2FOFA 2TPIZ 3A80A 2GDEH 2QXJA 1TOCB 1YKTA 4FU9A 4OS7A 1K2I1 4TT3D 4WXIA 1C2LA 2AIQA 3I29A 5CHBA 3SHAH 7KMEH 2BD4A 3RXQA 2FI5E 2DE9A 1BQYA 1E38B 1HGTH 2BLQA 1TGNA 4HZHA 3WY8A 2HNTE 3SUFA 2HOBA 2IPHA 3FVFB 5C17A 1Z71A 2QF3A 1WQVH 2WV5A 3FP8E 1QIXB 2VWMA 1EP5A 1C5WB 3PWBA 4NWLA 2WPJS 3ZV9A 2A4RA 1GJ6A 1OWIA 1HB0B 1LVBA 1K21H 3GDVA 4ACAA 2A45B 2GVFA 4BTTB 4YXWD 2K1QA 1NS3A 1C1RA 6GCHG 2O8UA 3KQBA 5DO4H 3VB5A 1XUIA 1MKXK 4B1TA 1SGFG 3GOVB 4DT4A 3MH6A 4GAWA 3BG4C 1ZLRA 4ESTE 2J4IA 4DIHH 3P17H 4AFSA 1P01A 2FP7B 1GI0A 1QURH 3MMGA 2G4TA 1MD8A 2FX6A 2ULLA 4AX9H 1K1LA 2RDLA 2SNWA 1WSSH 5EG4A 2ZFPH 2QE7D 1MBQA 1O3JA 2TGPZ 3HATH 3SQHE 4X1SU 1GGDC 1EZXC 3CS0A 3KNXA 1V2PT 4ZH8A 1E37B 1YPHE 2G55A 5GCHG 3SJIA 1C5NH 1QBVH 1UJ1A 3V0XA 1KXBA 1ELGA 1DVAH 1SG8B 1TMTH 3FZDA 3GY8A 5AFYH 1GBHA 5DG6A 5EXLA 1EB2A 1PQ5A 2Z6BD 3MNXA 1AVGH 1MAXA 3QZRA 5AF9H 3SU1A 5KEDA 2FWWA 3SQEE 1NFXA 1P3CA 1Y3YA 4INLA 4UDWH 2WPMS 2VIVA 1KDQA 3N7OA 1GDUA 3SORA 3PLPA 2HVYB 3RXIA 1WOFA 5C1YA 3PMHB 1QCPA 1YP9A 4RT1A 1HXEH 3UUZA 3VB3A 3SJOA 3PV4A 3LC5A 3U28C 2SGEE 3TJVA 2ZFFH 1QTFA 3MU5A 2BHGA 1SLVB 2BVSH 1Q3XA 7ESTE 4SGBE 1L4DA 3TH4H 3TNSA 1BOQA 1G32B 2PW8H 2HWLB 3F2HA 4WVPE 3I78A 3A7WA 1MQ6A 1P2QA 3RC6A 3ZVFA 3ZZ4A 1AMHA 3JZ1B 2ASUB 1MH0A 1HIAB 1UVTH 5JB9S 4FUCA 5FHTA 4KELA 1O35A 5LPFA 1CGJE 1EAWA 2XWAA 2FYQA 1W11U 3LIWA 2BX3A 5J4QA 1V2QT 1DLEA 2VBCA 5EPYA 1Q2WA 1F92A 3B23B 4ISHH 3O8RA 5EQRA 1Y5BT 4E7RG 4ABDA 4B6FA 5EW2H 3C27B 3GY3A 2BLWA 3SN8A 1GBJA 1O5CB 2ZECA 3A8BA 3SGQE 4ABJA 1C4Y2 1ELDE 4DVAU 1C5MD 3VPKA 2BXTH 4GCHF 1BT7A 4YOGA 1KXEA 1MTNC 5K0HA 4ZUHA 3BTQE 1SGPE 4ZMAH 1HAHH 2TGTA 3F9FA 1T8NA 3ZZDA 3KL6A 1GI3A 4JYVH 2BQ6B 2Z9GA 3OSYA 3WWFA 5FBIA 2CGAA 1O2LA 1TNHA 4AB9A 4F4OC 4B76A 1PQ8A 1NC6A 4M7GA 1LPGB 2ZDAH 1YY3A 2Q6DA 3M3SA 2ZPRA 2AIPA 1OP0A 5DP8A 4FVBA 3TU7H 2ZGBH 5CDFE 1C5ZB 1XKBC 3A88A 1W2KH 1EPTB 3SNBA 4BXSA 4HTCH 1O37A 1Y3WA 3KCGH 3VB7A 1EKBB 1Z8GA 3S9BA 2BDCA 1MMJN 2ALPA 4K5ZA 2PUXB 4CBOA 3OY6U 2J9NA 1SOZA 3ZIAD 1O2SA 3TJNA 4FU7A 2O8MA 1NTPA 2KM0A 1QJ6B 1UCYE 2BZAA 4ZKRU 1GBIA 3LC3A 3A8DA 1GHBG 2QA9E 1P2OA 1TX7A 3L33A 3DCLA 1JXPA 2PLXA 4Q80A 1MKWH 2ZFRH 4INKA 2F83A 3A7XA 1GBKA 2BVXH 2FOAA 1ZR0A 2UWPA 2LP6A 2SGDE 4NA8A 1TWXB 2P8OB 1AKSA 4A1VA 1OWJA 5GJ4B 4X6NA 3L3TA 1KXCA 2R2WU 4TY7A 1BA8B 2OTVA
chains in the Genus database with same CATH topology
3W94A 1THSH 3PROA 1FPHH 2GCTB 4FVDA 3RU4E 4YT7H 2STBE 3T25A 1O3CA 2J2UA 5E8EH 1FJSA 4Y7BA 3H7OA 4OS1A 1BRCE 2OP9A 1T8LA 1TNLA 1ANBA 1V2TT 3TLOA 5FPSA 1F0SA 2G4UA 3MFJA 3MNSA 4FUDA 1VJAU 3JZ2B 4BAKB 3A81A 4BAOB 2C3SA 1H9IE 3KIDU 3QGJA 1HJAB 2W3KA 5C1XA 2BTCE 1CT2E 2Y7XA 1C5QA 2VWLA 3A82A 1GVLA 4FUIA 4D9QA 3QWCH 3BN9A 1UTLM 5LGOA 2B0FA 1PQ7A 4DURA 2SGAA 2Z3CA 1DICA 1UTJA 4Y76A 2ODYB 2Y5FA 3SI4H 1QB1A 3RUOA 3PLKA 2P93A 3PB1E 6ESTA 1RIWB 1IQJA 1V2KT 2EC9H 5GWZA 1GHZA 1L1NA 3KF2A 3SU3A 3UPEA 1DY8A 2A2XH 2FTMA 2GZ9A 3E6PH 1CHOG 1SQTA 1TOMH 3QGNB 4XOJA 4I8LA 2UUKB 4OS4A 5BRRE 4XE4A 1SMFE 3P70B 1SC8U 2AGIX 1GJCB 3DFJA 1A0HB 2GMTB 1AE8H 2KAIB 1QHRB 2F9OA 7GCHG 1LPZB 4Y8XA 1SLWB 3ZYEA 3ZVBA 4X2XA 2ZTZA 1Y3XA 3QK1A 3BIVH 3VB4A 1J9CH 1GMCF 1Z6EA 4ZKNU 1FIZA 1HNEE 4HGCA 1VITG 5DP9A 3LH1A 1K1NA 2ZGXH 2B7DH 4ABIA 1TGCA 1O3GA 4D7GA 2WYGA 4ZAEA 5EW1H 4ABFA 2TBSA 1QA0A 1GHYH 4IN1A 1GBBA 4AG1A 2BQWB 1FNIA 2ZO3H 3S0NA 3QTVH 3SOSA 3UOUA 4H4FA 1GMHF 2HVXA 2XBYA 3RXVA 1B0EA 1QFKH 2ZCHP 3MH5A 1GBAA 4ABBA 1NFWA 1C1SA 4TPYA 2H9TH 3ELAH 2BD2A 3NWUA 4A1XA 2GV6A 5A0AE 1YPKH 1BJUA 2BVRH 2QIQA 3NCLA 1PYTD 5JB8S 4BOHA 1GJ7B 2O9QA 3BEFB 2NU0E 5EQSA 2C8WB 1QL7A 2PKAB 3RC4A 1ETSH 3SGAE 3H5CB 4Z6AH 5I46H 2A5AA 1DUAA 4Q7YA 5GDSH 2AGGX 1TPSA 2A2QH 4F49A 8LPRA 3GY4A 1BTUA 1O32A 3RXOA 1CA0C 2B9LA 3RXJA 3ZVAA 1ELTA 4X2VA 2P94A 3C1KA 4HI3A 1XX9A 1AGJA 1AQ7A 3UY9A 3A83A 1F5KU 2BDYA 1OOKB 5C3NA 3EE0B 1ZMLA 1KLTA 2ZCKP 1O3FA 2CJIA 1ZSJA 1BBRH 1GBDA 2ZU4A 2FO9A 1QBOA 2LPRA 4ZHAA 1PPZA 2A32A 3LOXA 4CBNA 3RXFA 2QAAA 1EAIA 1W13U 5AFZH 2Y80A 1NT1A 1AFQB 1S6HA 3SU6A 1O5EH 1NFYA 2EI8A 2OQ5A 2A5IA 1YM0A 3PMAB 1QGFA 3LONA 4D9RA 5HXFA 3A84A 3U1IB 3HGPA 2ZA5A 2R0LA 1GBMA 1F5LA 3A86A 4ZHMU 1NRNH 2XCNA 2QYIA 1DANH 1Y5AT 3MH7A 1MTVA 3Q76A 1FI8A 5E2OA 8KME2 1FUJA 1GI5A 5FX5A 1P04A 1B0FA 4Q7ZA 3ATLA 3E0PB 5A8XA 3RLWH 1O2YA 4IS5A 4WH8A 1SFIA 1C9TA 1TE0A 3UWIA 4AB8A 4UE7H 1DPOA 3Q3XA 3P8OA 1WTHD 4UFEH 1KXFA 1FY4A 1C5RA 2H2ZA 5GPIB 2I6SA 2XC4A 5FXLA 2ZDLA 4MPWA 1GBFA 1BB0B 3RMLH 1TMUH 3O8CA 2ANKH 2QGRA 4A1TA 3ZVEA 6GCHF 1W0YH 3OYPA 2ZG0H 4YM9A 2PKSB 2ZI2H 1W3CA 1SL3A 1NO9H 1O34A 2B8OH 2P3UB 1KYNA 4CHAC 1T8MA 1RTLA 1TNKA 1AHTH 1ZPCA 4X8UH 1ANEA 1SFQB 1FONA 2B5TB 1NESE 2PGBB 3HK6B 4TPIZ 2OD3B 4K1EA 4MG3A 1BTPA 2H5CA 1TX6A 2ZEBA 2OC8A 5LPRA 4CR5A 2FM2A 3ZZCA 5L6NH 2NU1E 1MKXH 2OUAA 1VGCB 2A5KA 1OP2A 2BD5A 4U32A 1C5YB 1JIRA 3LU9B 4MNYA 4RKJB 2ZPSA 2FS9A 1MCTA 2BD9A 1SPJA 1C5UA 4AZ2B 5AHGH 3GY2A 1ZSLA 1TBQH 3GCOA 2WPKS 1KIGH 1THPB 4X1NU 1CU1A 3K6YA 1AB9B 2BM2A 1QB6A 1EJAA 1AY6H 2QN5T 5T3HA 4OGXA 1TQ7B 1TA6A 1C2DA 2ZGHA 3GY7A 5EOKA 5DKMA 4NGAH 3IITA 1PPCE 1TPOA 3NK8A 1TONA 4BANB 1ZSKA 2WPLS 1HAOH 1C1OA 2D2DA 1OWHA 4MDSA 1GJBB 4NIVA 2FOHA 2VVCA 3MU8A 4UFFH 3ODDA 1GVZA 1A0LA 1O3OA 4X1PU 3RXTA 2W5EA 1P2JA 3GISB 3MO9A 2F9NA 1KLIH 1SGEE 2Y82A 2CMYA 4XBCA 3U8TH 1HJ8A 5T6DA 2HLCA 3PMBB 1C2HA 1GL1A 4ISNA 3KEEA 1F0RA 1FQ3A 3GYMA 1LQEA 1ACBE 1V2RT 2WYJA 3E3TA 3BTGE 1BITA 1WQSA 4BAQB 4GHQA 1HXFH 1JRTA 1AIXH 1O0DH 1C2KA 2NU4E 1CBWC 1L1GA 1WBGB 3FFGA 5ESBA 3D23A 1MCVA 1ARCA 1P02A 1LO6A 5EODA 2DE8A 2A7HA 2D8WA 1G30B 1SLXB 3UNSA 4JYTA 1GI9B 3EDXB 2Y81A 2Z9IA 4Y7AA 3UFAA 2KAIA 3I77A 4LZ1H 1O3KA 1ARBA 4JZEH 3CENA 1C5LH 1K1PA 3UNRA 8ESTE 2CV3A 1EB1H 1BJVA 1C2IA 2VIDA 3UR9A 1U6QA 1C4V2 1QRZA 1LMWB 2W7SA 4ABHA 1E36B 3GDSA 1P8VC 1CVWH 4Q2KA 5F03A 1PPFE 5TCAA 5HM9A 1SGIB 1IQEA 3KQCA 1UO6A 5DP7A 1W12U 4B73A 1DDJA 1PPGE 1P9SA 1VCQA 2OC7A 2ZHDA 1YYY1 1ELBA 1W8BH 3RXMA 1FZZA 1LHEH 2C90B 3BG4B 4AYVB 1DOJA 1P03A 1ID5H 1OWEA 2ZQ1A 1ZYOA 1ZHRA 1HBTH 4MLFB 2HGTH 3DFLA 3TNTA 3KQEA 1ELAA 1FN8A 1T8OA 5DK1A 1ZTLA 1LDTT 2FDAA 2XBXA 1GHBF 1S5SA 1DE7H 7LPRA 3MU0A 8GCHG 1IAUA 3ZZ8A 1D4PB 4ABEA 2Y5HA 1T7CA 1OWKA 1HLTH 2XNIA 1TPPA 4Y0YE 3SNCA 2PKAA 1O2TA 1P3EA 2OINA 4XBBA 4MNWA 2FYRA 4GLYA 3TK9A 3RXDA 4R8TB 4WXVA 1O5FH 3A7YA 4FUHA 2HPQH 1S0RA 1HFDA 1GJ9B 3HPTB 1HAYB 1ZMNA 1KY9A 2IOTA 5JBCS 4UONA 2ALVA 2RA3A 1ETTH 1LTOA 2QF0A 3FP7E 5G4BA 3T5FH 1EXFA 4IW4E 3RMNH 4I7YH 1BZXE 1P10A 1UTNA 3M3TA 3M61U 1GJDB 5DP4A 1UK2A 3M7QA 2P59A 4JK6A 4KTUA 1GL0E 3SI3H 1FY3A 2C93B 1GDNA 1NM6A 9ESTA 1JRSA 2FTLE 1BRUP 2XWBI 1SI5H 3RLYH 3RXAA 3TGIE 1O2KA 1DS2E 4AYYB 4INHA 4K3JA 4PROA 1W0ZU 4E06H 3M5OA 5EGMA 1FXYA 1XUKA 1UVSH 1OS8A 2J38A 3F9GA 2A31A 5HGGA 1A1RA 1DWBH 1JIMA 3R0FA 1TBRH 3PM3A 1F2SE 1P0SH 4I31A 1EPTC 5FPYA 2UUFB 2XYAA 3SUGA 5B6OA 2HPPH 3LDXH 4XBDA 4JZFH 1CHOF 1WV7H 1SGFA 1GMDF 3ESTA 3RP2A 4B74A 1ANCA 2P3FH 4O9VA 1H1BA 3V13A 1PQAA 4JZ1A 3SW2B 1O3DA 5E2PA 1SGDE 1GPZA 1NZQH 1O2JA 2OQUA 2EEKA 3BTDE 3LGWA 7GCHF 5FPTA 1HRTH 1A3EH 2VB0A 1BMNH 1KSNA 1EOLA 2G00A 4DCDA 1UTMA 4JMYA 5DP5A 1Z7KA 1NRQH 1AZ8A 3TK5A 1ELFA 1HAPH 1NRPH 4JYUH 2A7JA 3RXHA 2V3OH 1VITF 3P95A 2ZTYA 3KGPA 1DSTA 1AD8H 1SGTA 4X1QU 4CRFA 4J2YB 3E0NB 3UNQA 4NIXA 1MU8B 1XUFA 1RTKA 2W26A 1RRKA 2P8OC 3S7KB 2YOLA 2G52A 2BD8A 4UEHH 1TNGA 3STIA 1PYTC 3RDZA 1O31A 1B5GH 1A7SA 1O5DH 3MTYA 2FOCA 3ZZ3A 2V35A 5L2ZH 4MTBA 2STAE 2VIOA 4NZLA 1BDAA 1C2GA 6LPRA 1P2KA 1F5RA 1RTFB 2O8WA 4KP0A 1FN6A 4CRDA 2AMDA 2AMQA 4Z0KA 1SOTA 4BTUB 3QO6A 4ZHLU 1Z8IB 2PR3A 2JKHA 3RMMH 1B7XB 1MTSA 1MTUA 2OBOA 4VGCB 1Y8TA 3ATWA 1G36A 3K6ZA 4LZ4B 3K9XB 1HJAC 1O3NA 3O8DA 3M5MA 1G3EA 1IOEA 2Y6TA 3BTME 1ELCA 1FAXA 1O5AB 2CF9H 4I8HA 4Y10E 1Z1JA 4ABAA 1CHGA 2R3YA 2SGFE 1O5BB 2A0QB 5FBEA 1GCDA 4THNH 1OYQA 2ZGJA 1OX1A 4NFFA 2G51A 2GZ8A 1S6FA 2VGCC 1KTTB 1XMNB 1NRSH 3M5LA 1RIWC 1ZOMA 1BCUH 1RGQA 1EJNA 1MU6B 4X6PA 2JH6D 3PYHA 2JETB 2Z3DA 1GCTB 1F0TA 1XUJA 2A4GA 1SR5C 2GTBA 1GVKB 2IN2A 1ELEE 2WPIS 1D3DB 4WMDA 1DM4B 1TQ0B 1UTPA 1O3MA 4GSOA 2GMTC 3M5NA 2CHAC 2ZPQA 2H1UA 1GMDG 3ENSB 1OSSA 1SQAA 4TY6A 5JYIA 1O3EA 2XC5A 1T4UH 2F9PA 3CS7A 4K69A 1ZPBA 4ZKOU 1ZMJA 4B2AA 1V2JT 4MPXA 1O2QA 3U8OH 1DLKB 2PSYA 1OXGA 4RKOB 1BRBE 2AS9A 3BTKE 1BRAA 1TGTA 1UCYK 1PPEE 1BTYA 3HKJB 1N6XA 3AASA 5IDKA 1HYLA 1Q31A 1EZQA 3ODFA 3BTWE 3GDUA 2DUCA 5JDUB 3NPSA 1HUTH 3LT3A 2BDAA 4FUBA 2GDDA 3S9AA 2F9UA 2BX4A 1QL8A 1NU9A 2G5NA 3SU4A 1DY9A 1OWDA 4DIIH 1VITH 2XRCA 5HM2A 3NKKA 1TBZH 1BTXA 2A4OA 2ZWLH 3A8CA 2I6QA 1CQQA 1RD3B 2BDIA 4X8TH 2F3CE 3HGNA 3OX7U 4WMEA 4ISIH 3V3MA 2AGEX 4CH8B 4YO9A 3TJUA 2FMJA 1GG6B 5EU8A 5A09A 1G2MA 1XXDA 2V0BA 1WTGH 4FUFA 4YTAA 1J14A 2H9EH 3GCHC 2BD3A 4TYDA 5IYTA 5K7RA 1O2RA 2BB4A 1IQIA 2NWNA 1JBUH 5GIBA 1VZQH 5EPNA 3P8FA 1N8OB 1YPLH 2FXRA 3T29A 1YBWA 3TH3H 1BBRE 3RM2H 1F0UA 2Z9JA 2UUJB 2BY8X 3E8LA 4U01A 4WJG2 3RXSA 4WMFA 2YNAA 1LVYA 1KDQB 2Q1JA 4IBLH 4H6SB 1TAWA 3AVZA 3NXPA 2A4QA 3HK3B 2QC2A 5EXMA 1TFXA 1AFQC 1C1QA 4MNVA 1O38A 2PUQH 4MPVA 3ZVDA 1GI8B 3PMJA 4D8NA 3RXEA 3UQOA 3FAOA 1PPHE 3B9FH 3SV2H 4U30A 2BDBA 3RMOH 2ZFQH 1VCPA 3LJOA 3SBKA 3M7TA 5CHAB 3EA9A 5AVDA 4B2CA 1HIAA 1GBCA 3F68H 1O2MA 1ZPZA 4JCNA 4D7FA 1L0ZA 1KTSB 4AGJA 1GHAG 1UVUH 3AAUA 3S7HB 1EJMA 1C5OH 2THFB 2VWOA 3F9EA 3LKWA 3SV9A 4MNXA 4BNRA 1JMOH 1ZTKA 4BXWA 1HAVB 4CH2B 1CA8B 2ZC9H 5EXNA 2FOBA 1PPBH 3LJJA 1DSUA 1BIOA 5TCCA 1NRRH 2P3TB 5PTPA 1GBTA 3O8BA 2VJ1A 1A0JA 3FANA 5DGJA 3R3GB 2QY0B 2VWNA 1CO7E 3PO1B 1O2XA 5C5OA 1S85A 1DWEH 2GCHG 2ZDNA 1YCPK 1TNIA 2WUCA 3E91A 2BOHB 3LGVA 2PKSC 1EP6A 5L2YH 3SUEA 1MZDA 2AERH 2GZ7A 3F6UH 5E0HA 1C1NA 1K1OA 2VIQA 1GI1A 5FCRA 4WY3A 1BTHH 1EPTA 1ESTA 4GVUA 2HNTF 1DXWA 1LKAA 1W7XH 1MTWA 1V2ST 3SJKA 1IQMA 2ANYA 2BY6X 1A5HA 2A1DB 2VH6A 1WUNH 1AUTC 4AORA 1ZJDA 1E35B 1EX3A 1GBLA 4IC5A 1O2PA 1UMAH 2PV9B 1V2LT 4IC6A 1UTKA 3OU0A 1TRYA 2XBVA 3LGTA 5DPAA 1YC0A 2SGPE 3A7TA 2XW9A 1SHYA 4Y79A 1DITH 4AFUA 2QXIA 4B2BA 1SVPA 4ISOA 1CE5A 1S0QA 1AB9C 4I8GA 5LPEA 4YOIA 1KLJH 3U8RH 4ZKSU 3MO3A 2F91A 6CHAB 1AKSB 4ZXXH 3E1XB 1G3BA 1ZZZA 4FU8A 1P57B 2BY5X 5T6FA 1P2NA 3M37A 3Q3YA 1T32A 3VGCB 1T4VH 1D9IA 1DUEA 4CREA 8GCHF 2G8TA 3QLPH 1C1TA 1A3BH 1A46H 1HV7A 4FUGA 1KXAA 4WF8A 4U2WA 1GBEA 1V2WT 1AI8H 1UTOA 3NUMA 3UQVA 1GJ8B 2XTTB 3LGIA 1SGRE 1EQ9A 4K2YA 1IQNA 1ZJKA 1EZSC 3QDZB 5A0CA 4FUEA 3W95A 2IJOB 2P16A 1IQHA