3T38A

Corynebacterium glutamicum thioredoxin-dependent arsenate reductase cg_arsc1'
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
204
structure length
199
Chain Sequence
LHTNILNRIANELALTYQGVFSAETINRYIFESYVSLARTAKIHTHLPILAEGFAKDRLHALAVAEGKVASPVPQVLFICVHNAGRSQIASALLSHYAGSSVEVRSAGSLPASEIHPLVLEILSERGVNISDAFPKPLTDDVIRASDYVITMGCGDVCPMYPGKHYLDWELEGEDKIQEIIEEIDGRIRELWKSIQLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arsenate Reductase
publication title Corynebacterium glutamicum survives arsenic stress with arsenate reductases coupled to two distinct redox mechanisms.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Oxidoreductase
total genus 69
structure length 199
sequence length 204
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1060 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3t38A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3t38A02
4D6XA 5KQMA 1YK1A 3RVLA 1ZGGA 5DLEA 3T95A 1R8JA 3TX6A 3QLVC 5I4CA 2NUBA 3GA5A 4PYRA 4YP9A 3HUTA 4RSMA 4YLEA 4MQFA 3T6KA 3T38A 3ILHA 3OLZA 1WETA 2IPLA 4WZZA 1L5YA 4MS4B 2FMHA 4Z99A 3TO5A 3RVOA 5FBKA 1EAYA 2H3HA 3SY8A 2XDYA 1XWWA 1RZRA 3QX9A 5FWXB 4KVFA 3GV0A 3GRCA 3N0RA 2LIVA 4MS3B 1LJLA 2GX6A 4MGEA 5TQJA 3LUKA 1EWTA 5F64A 2P4UA 2AYXA 4YO7A 3GBPA 4LE0A 4WXMA 3Q7RA 1Z13A 2WWVD 3DLBA 1ZY2A 2WRZA 4MLCA 4MR8A 2NZUG 1ISSA 4YGXB 1JWLA 3N0WA 5KC8A 4NV3A 3KYIB 1BDHA 3O1IC 1A04A 3C97A 4MR7B 1RZRD 2NZVG 4D6YA 2E4UA 2PLNA 3KHTA 1TM2A 5TQ2B 2W42A 1NATA 5D2CA 4MR9A 1NXVA 1VPWA 1A0OA 1XHFA 2FQXA 2R48A 2JVKA 3IP7A 4JP1A 5E3JA 5IEBA 2E4ZA 3N6VA 5EWJA 1JH9A 4WWHA 4XLTA 4Y9TA 1JBEA 4OTZA 4UHKA 3LUAA 4ZYLA 1SXIA 3EAFA 2FKAA 3GWGA 3QELB 4JA2A 1ZAYA 1KRWA 3MF4A 4KV7A 1M2EA 2H0AA 3I5AA 1E6KA 4MAAA 2MSWA 4OBBA 2Q5CA 4RDCA 5IULC 4KREA 4TN5A 1C4WA 2E4YA 2GKGA 5TQ0A 5CNJA 5TPWA 1U04A 1JFTA 2L19A 2QSJA 2QV0A 1HEYA 1YIOA 4M88A 3EQ2A 4NICA 3R0JA 4JB0A 4MQFB 3H5IA 4PEVA 4RY0A 4O1HA 4IMJB 3URMA 4FE7A 3HVRA 2YHAA 1PHRA 1CYEA 3QLUA 4RXUA 2O20A 3FFTA 3O75A 2PUDA 4LDAA 1GUBA 3G1WA 1BDJA 3C3MA 5ED4A 3H75A 1VKRA 3NNSA 1VRVA 1JDNA 1FQWA 3I42A 5BQ3A 5IBQA 5C5CA 4NCAA 1JF8A 4OLBA 4RS3A 3T8YA 4MR8B 4YR7A 4ML3A 1PNTA 4H3KB 3JY6A 2PKXA 2A9QA 2KYRA 3ILYA 1BDIA 2CHEA 3SQNA 1NXSA 5DTEA 3RH0A 4HYEA 3LUDA 1DP4A 3NHZA 2E4WA 4YRZA 4L85A 1W25A 4QPJC 1DBQA 3H1FA 2CD7A 3HJFA 2FMKA 5BR1A 3RVSA 1ABEA 4EY3A 1RXEA 3HZHA 2FVYA 1DZ3A 3IP5A 3O1HB 4PICA 5IX8A 1QO0A 5B3JC 4ZPJA 4O1IA 3C3WA 4G0QA 3EULA 4Z0NA 2WMYA 3E61A 3GT7A 3HCWA 3OLWA 5JS2A 4LDZA 3SG0A 1QQAA 1QNLA 4LZLA 4P98A 2HJ9A 3Q9SA 1DC7A 4MPTA 4QICA 5TQ2A 1GCGA 1UDRA 1AB6A 1ZESA 1YMVA 3QX8A 2WY2D 5KC9A 5TQ0B 3A0UA 4NCBA 1C0EA 5TPWB 4N03A 1M5TA 4Z9AA 1LBIA 3SNKA 3LUJA 2M1ZA 3EDCA 1SRRA 2F8SA 1YTUA 1YVUA 3TD9A 3QELA 1Z2DA 3BRSA 1CHNA 4QYWA 2MYPA 3QEKA 1D5WA 2LPMA 2OQRA 1DRKA 1M5UA 4W5OA 1FSPA 5EWMA 1ABFA 1D4ZA 1FFWA 3Q15C 2QVGA 4F06A 1ZVVA 4TLMB 2JVJA 3O74A 3BBLA 3KTOA 4XXHA 2ID9A 2FMFA 3B2NA 3MIZA 3N75A 2PUEA 3IDOA 2V0NA 5IUKC 2HQRA 5DCLA 1TJYA 4HNRA 1Z15A 5KQLA 2ID7A 2NT3A 1U0SY 2RJOA 4JAVC 5KWSA 2JB9A 1GUDA 1Y1LA 1Z16A 1RPJA 3CNBA 4JASB 1W9HA 3HV2A 1DBPA 2B1JA 4Z9BA 2X7XA 3RVNA 1APBA 4KZKA 3SAJA 1LK0A 1K66A 3LUHA 3QLVA 3RVMA 1USIA 4IMIB 4YS6A 3HK2A 1I3CA 3RVQA 3ROFA 3IP6A 4KK4A 2OENG 3LTEA 1SXGA 2PAFA 3QLTA 2LUOA 4ZJPA 1NXXA 4E7OA 5HKOA 2QXYA 4RY9A 4KQ9A 4RXTA 4RK1A 4JOQA 3MA0A 1XHEA 5T3YA 4TLLB 3O21A 4Q6WA 4KNYA 4MS1B 5BRAA 3CS3A 3DGFC 4RY8A 2DRIA 1DBWA 2E4XA 2FLWA 1DCMA 5FBHA 3CHYA 2FLKA 2ZWMA 4N0QA 4MLDA 4RK5A 4W5RA 2PMCA 3G85A 3HO1A 2VUIB 5EWMB 2JVIA 2VK2A 2VYCA 2WB4A 3DZDA 3OM1A 1QQBA 2B4AA 1E6MA 4Z4CA 1QMPA 1PEYA 6ABPA 5GOTA 3BILA 3O2SB 4F3TA 2GBPA 1Z26A 5JNWA 2HQOA 2PL1A 1ZDMA 4IRXA 2N9UA 3RVJA 3TMYA 1IIBA 2A9PA 2JCGA 1FFSA 4RV5A 2R47A 1ZH4A 2PL9A 1VLZA 2FMIA 4WUTA 3UKJA 3HDGA 5CHYA 2M98A 1NTRA 5JNVA 3HSYA 3NBMA 2CHFA 1ZITA 3UK0A 3LUGA 4LE2A 3FGZA 1B00A 4TMYA 5EWLB 1BVHA 1MB0A 5JNRA 4KPYA 3LKBA 1F51E 3H1EA 3F6CA 3GL9A 1MIHA 3JVDA 3BREA 3H6HA 3LUCA 1URPA 1Z25A 4EYQA 4MRMB 2IOYA 3KYJB 2MYNA 3F6PA 4RKQA 4F12A 2LBPA 1ZN2A 1RNLA 4Z4IA 1D1PA 3OM0A 3IP9A 4G0ZA 3LOPA 4OLAA 1LJUA 3D8UA 1ZHHA 4DADA 2JBAA 1YK0A 4Q6BA 3CFYA 4KQCA 3HUUA 4YCSA 4ETIA 3CLKA 1U8TA 1ZH2A 5IUNC 5KQPA 1EFAA 1GLGA 2FSPA 5JS1A 5DKFA 2PUBA 3MYYA 2QVCA 3IPCA 3NNNA 3TB6A 1D2AA 3C6QA 2A9RA 3KLOA 1NXPA 1GCAA 4MS1A 5BRJA 2AYZA 4EUKA 1DJMA 5HQJA 1E2BA 4DN6A 3C3KA 1QO0D 3DGEC 5TPZA 2MSLA 1MB3A 4YWHA 4RK0A 1NXWA 1JX6A 3H5TA 8ABPA 4KFCA 2BGGA 4EVSA 4G0PA 3Q7SA 5B3JA 1MAVA 5C5EA 1DCFA 4XARA 5ABPA 5CNMA 3O2QB 4Z4FA 2MYTA 9ABPA 2R25B 1JYFA 3MMNA 1JFVA 3OO0A 3K4HA 3H1GA 3RVPA 4EVRA 2IDMA 4F8JA 2PUGA 3CU5A 1NXTA 2FQWA 4G0OA 4WT7A 4HNSA 3HM9A 5KQGA 4RXMA 2F8TA 3ROTA 5TE9A 4XFKA 1RXIA 3H5LA 4OG2A 5FWYA 1P6UA 4EGSA 2L18A 1BAPA 2FN9A 2FN8A 3LFTA 3O2JA 3M9XA 4OATA 1PEAA 2IPAB 4YV7A 3KSMA 2QW1A 3CRNA 4N76A 1FFGA 3CKMA 2I6FA 3H6GA 3CG0A 4ZMRA 4UHJA 1K68A 4RK7A 1QKKA 5EWLA 4LRQA 3CG4A 4RZSA 3OO1A 3FFXA 4WXEA 2P9HA 1OXBB 3LKVA 3LMKA 4FB4A 4Z4GA 3K9CA 4XAQA 2GWRA 1TVMA 2JBAB 2TMYA 4MRMA 4N0PA 3E3MA 4QYMA 3Q7TA 3LUFA 1M2FA 3NHMA 4G0XA 4S04A 3D02A 4H60A 2HSGA 3KS9A 1DCKA 4PZ0A 5CNKA 5KI6A 3I09A 2RGYA 1JDPA 5CNIA 3F73A 1JHZA 4P1ZA 3N0XA 4W5NA 4F11A 1P2FA 1A2OA 4DQDA 3O1JC 3OMWA 4G86A 2FXIA 1KGSA 1S8NA 1LBHA 4RWEA 1U2QA 3W9SA 4N47A 4HNQA 5HM6A 4LX8A 4FE4A 3HS3A 1DG9A 2WJWA 3FFWA 1USGA 3HEBA 3OLXA 3CZCA 2LP4Y 4E7PA 2GI4A 1QP0A 3F7NA 4Q7EA 1CEYA 3EQZA 3H5VA 2QU7A 2HQBA 3P9YA 3EGCA 1JFSA 3H5OA 2IKSA 4G0YA 4NQRA 3H5WA 4RK6A 4GNRA 3L49A 5IC5A 5HSGA 2R4QA 4EYOA 3RVRA 1EWKA 1Z17A 2PUFA 3GYBA 1NXOA 2E4VA 1YS7A 3QLUC 4O5AA 5FWYB 2NT4A 1E6LA 2MYUA 4IGAA 1QP7A 4IILA 3FDFA 2FQYA 5JNSA 3A3KA 4MQEA 1PNRA 2A9OA 3KCNA 4RKRA 4EYKA 3FMVA 5GQSA 1NY5A 2FEKA 2VUHB 3EJWA 3I45A 2L2QA 5T7BA 4W5QA 3S99A 4KRFA 3N8IA 4GPAA 4KK3A 1L5ZA 4PE5B 1H9CA 1F4VA 1Z18A 3QK7A 3OLYA 3OLVA 1QPZA 2PJUA 4G97A 2QR3A 2FW0A 6CHYA 5JNTA 4D74A 1SD5A 3HXMA 2L17A 5DGCA 2PUAA 4N41A 1JL3A 3QEMA 1QP4A 4L4UA 2IYNA 3OQOA 2MSKA 3KKEA 3MQ4A 1DC8A 4RK4A 1AB5A 3MM4A 3JVIA 3OMXA 1PUXA 3JPWA 1JYEA 3BRQA 1EWVA 2RJNA 1P6QA 2FTKE 2IPNA 1KMIY 4ETNA 3DLHA 1BA2A 3KLNA 4MS4A 4IF4A 2HPHA 3L6UA 4CBVA 2JRLA 3A0RB 4EVQA 4LE1A 1YS6A 4RU1A 3UUGA 1ZGZA 1ISRA 1U2PA 4ZMSA 5FWXA 4MS3A 4MYRA 3HDVA 5JNUA 3RVKA 2PUCA 4MR9B 1Z2EA 7ABPA 3GBVA 3IPAA 3OQNA 3CZ5A 1YMUA 5EWJB 5PNTA 3DBIA 3VNAA 3EODA 2J48A 4XASA 4EYGA 3JTEA 2CWDA 3KJXA 1MVOA 4G0MA 4MR7A 3A10A 2JK1A 4Z4EA 1USKA 3SM9A 1DRJA 4MQEB 1SXHA 4H3HB 1KRXA 1EHCA 3CTPA 1T34A 3RQIA 5IEJA 4JB2A 3NNDA 2PE5A 1J56A 1P8AA 3N53A 2WJAA 1JLKA 5TPZD 2ZAYA 2FEWB 4ETMA 1TMYA 2YHBA 3M9WA 1OXKB 1Z12A 3JPYA 2QZJA 4B09A 2IPMA 3M6MD 3VNBA 3Q41A 1TLFA 2FEPA 4W5TA 2RDMA 1D1QA 4S05A 3KG2A 4KMRA 4Z4HA 5IUJC 3JS5A 3OQMA 3QEMB
chains in the Genus database with same CATH superfamily
5DULA 2NXEA 5DOVA 2RAUA 3HUTA 5L7YA 2P9BA 4E03A 3WHLA 3W77A 4G85A 5BQ5A 3OPNA 1WXWA 3GMDA 4BO0A 1X1SA 4Q4JA 4KVFA 3ISVA 5JAPA 4XDZA 9GPBA 3NRJA 1IMOA 2Z4SA 5M2QA 2JWSA 3ANLA 1AQNA 4HSEA 2ZP1A 3GP3A 5CXXA 4HNVA 1JHPA 3KNZA 2AMYA 5HJ2A 3V1TC 2IYPA 4MAAA 2Y4OA 5K0SA 4DCPA 4I1YA 4P8RA 1LVUA 1UT5A 4KAFA 2COEA 1ULSA 1DAOA 3FZQA 4X94A 1A9XA 4JB8A 3IBGA 4OHPA 4GKVA 4Y1GA 1MCZA 2CSUA 2J5QA 3E8XA 3IXMA 4IGFA 5DTEA 4HYEA 4L9SA 3SAVA 2XVZA 4IOMA 1CEXA 5IX8A 3LT1A 3BE6A 3P5SA 1TAGA 3D7KA 4D4HA 2NSJA 2ZANA 2MYPA 4DCVA 4KE8A 4RIHA 2C61A 2X1LA 1PDOA 1G2QA 2PDAA 2V1CA 2QW0X 2Z3VA 1CIJA 4LECA 3ANSA 1AXEA 2G7ZA 2PHZA 4I4NA 2AZTA 3MLEA 3PL5A 1Z4KA 2C8KA 4Q6WA 4CTMA 1I13A 3AUFA 3AK4A 1G38A 4FX2A 5HF9A 1XR3A 4X8HA 2OV4A 3FE2A 3RUAA 3AF1A 5JO0A 3K4PA 3QIVA 2AG5A 2PL1A 4AJKA 3BBPA 5LZ2A 3DE2X 1XZAA 2Y0TA 2G72A 1C1XA 3TTTA 4KH1A 4GSLA 2YNMA 3TOCA 1GA6A 1I0IA 3BHMA 2NACA 3VR4H 4MA0A 2PX4A 2H92A 3OM0A 1AIPC 1P18A 1HR0M 2E7ZA 2VATA 3O3MB 2XBMA 1A4UA 4E4YA 2GPBA 5C2JB 2G8LA 1DIRA 1KIMA 4B08A 4QFMA 2XE4A 4P7KA 2P3OA 3WMEA 2Q1TA 5EE0A 1AS0A 1KAOA 1TVEA 3G9XA 4RABA 4MROA 4AJOA 4DDVA 5BR4A 3TSCA 4BN4A 1S3FA 3O2QB 3F2VA 3L4KA 5AJWA 2VK8A 1ZIYA 2EP5A 1DJQA 2PGLA 3NHAA 3M9XA 3ZBQA 3OZCA 4LC1A 4LA4A 1JHOA 1QKKA 4K2AA 3CURA 2A1IA 2HXGA 4ZD6A 5K3CA 4YJ2A 1XT6A 1YR3A 4AMYA 1GQSA 2NO0A 2OBBA 3N0XA 3KHKA 3DEJA 4F11A 3K6RA 4P4TA 3H1TA 4KYVA 2BFAA 1DG9A 4Q3OA 3A6DA 1PUJA 1NNEA 2AXPA 1COWA 1GQQA 1MH9A 1D2MA 3IDQA 3U81A 3JYHA 2JIDA 1U6IA 4AMBA 2AX4A 2HA6A 5L40A 5KOJB 4MYDA 2AEMA 4OUKX 5HQ3A 3SMSA 4RD2A 1SRQA 3MTGA 5EXXA 1M8FA 3IDSA 1IULA 2DQ4A 3CO5A 6CHYA 1ZC4A 2DHCA 3FOCA 2JIRA 4MB0A 4LRSA 3QIAA 3B85A 5FR2A 3KP1E 1AQ6A 4CLEA 5J4LA 4D3SA 3UCXA 2J45A 3VFDA 3BAZA 5CVTA 2BGLA 4GWLA 4X85A 2W70A 1O03A 3KYBA 5CJ2A 5P8WA 5AKYA 1ZSYA 3A1WA 1DAHA 3EVAA 2XGSA 5ILOA 1GNPA 4FINA 2AVNA 2NUTA 1PFKA 1FYFA 2OOAA 3NG1A 5JQGF 3P8ZA 3RVLA 2IXTA 3TX6A 2Y77A 1C1KA 3NEJA 1KP3A 2Y76A 3D8RA 1QU3A 3REFA 1VBNA 4JXZA 1J2YA 1WXHA 2Q5FA 3GRCA 2WAOA 4DV4B 2HHCA 4FWBA 4D45A 4D43A 1VHWA 5HBGA 2B78A 3AIIA 3GQ4A 5AJXA 5TQ2B 2PX3A 1KJJA 5DWVA 4UE3S 4YROA 3GZ4A 1GFSA 1I5RA 1JH9A 1AU9A 3DZGA 1DHTA 3EWAA 4ZHQF 1RQ2A 3OY2A 2Q5CA 2PPLA 1IEVA 5L51A 2G9UA 1W2GA 2J7NA 4JBYA 3SEFA 2C84A 4RY0A 4R0NA 3TPFA 2J4DA 2XEPA 2PUDA 3BGSA 3BL5A 3S1SA 3C3MA 2M2IA 4OMFG 1B1AA 2O1WA 2C83A 3DFMA 4YJ3B 2UUBM 3CXRA 2QS9A 2I4OA 3FNGA 4JYAB 1J8DA 3TB4A 4CHGA 1JEJA 3MMZA 4O2AA 2W7TA 2DWLA 2P6RA 3SQNA 5CBPB 4QHSA 2YINC 1I7DA 1UWLA 2NTEA 4K9MA 3ZHXA 4ARAA 4EIWA 2BONA 4HX2A 3T5MA 4R9VA 2IYFA 4K3VA 1ADJA 3HU2A 2QDKA 5A4MS 4U8GA 3GLGB 4HDMB 1E98A 2WYIA 3OD1A 1O89A 2X13A 3ZHBA 3V8NA 4ZJZA 2Z6UA 1WV1A 1Q19A 2JFXA 3LVFO 4UEJA 2QNIA 3TRIA 4CKCA 2OVFA 2JG3A 1FYXA 3ZQKA 4U5XA 4J7CA 1N36B 2OENG 4C04A 4KDFA 3V3KA 2OK7A 1NXXA 3BEDA 4NMHA 5KTTA 3TD2A 5E6UB 4DCCA 3UK6A 5KNCD 1XOIA 4QTYA 2D5BA 4NU0A 2B4AA 1F8GA 1LI7A 2BM1A 4BOYA 3KOWE 4LNUB 5JNWA 4FJ1A 1FQKA 3TE6A 1XG5A 1ZITA 2X1HA 4PLYA 1F0NA 1UMCB 4M8NE 3WBJA 3Q1LA 1TF0B 4NEQA 5K8CA 4GL4A 1UXKA 2ZIEA 4I4IA 5GOZA 1QOQB 1GCIA 3R7LA 5FSWA 4P38A 1E4OA 2O23A 3CLKA 4X0EA 3MJFA 3AOEC 3KALA 2EGHA 1UBRS 1DGHB 2ZAGA 3OEHA 5CX1A 4F1IA 1E59A 1NF2A 1F1JA 1UJ2A 1XFDA 4Q48A 2AN5A 3OSUA 4X8OA 4LXIA 4MKXA 4KIFA 3JQ7A 4NARA 4E2WA 2FFAA 1SUWA 4A10A 2H2IA 4R8LA 4ZRDA 3DDZX 4ZAXA 3HVHA 2WKSA 4G86A 1HO3A 3AKEA 3CZCA 4MKHA 2GN1A 2WSEF 1LPBB 3EGCA 2GM5A 4JMPA 4WN9A 2A0WA 3BMXA 4QXPA 4UW9A 1RM0A 1PZGA 1E7SA 3HNPA 2RB4A 4RPGA 4XGKA 4F4JA 4D42A 4G4RA 1L5FA 4PRLA 4UEKA 3T7DA 1VE9A 3LO8A 3AG5A 5ALRA 1JAYA 1AQLA 2GUGA 1XJ0A 4S1OA 4YV2A 4TUYF 5HUHA 2II6A 1ISIA 3CGWA 4BMYA 1RE1A 4CT5A 1FDVA 2G08A 1OFVA 2F4VM 1Q7EA 4NATA 4FMDB 1I33A 1J2JA 1E1CA 3HHYA 3KS4A 3GBVA 2VYFA 1VHJA 1WDWB 2QMOA 4LF4M 3N53A 3WBKA 1NLZA 2BGNA 4GVPA 1U0FA 3GFQA 1H3NA 2XI4A 1UQUA 3ONEA 3FYUA 3ZIAD 3CTMA 4TYPA 1DG3A 1FQJA 5F12A 2JIPA 3KW6A 1IB0A 3E18A 1DKOA 4ZVOA 3MD9A 1G3UA 1NMSA 3U4QB 3AJ8A 3T61A 5BURA 3HI4A 2IGBA 2YJ6A 5JYBA 4JI2B 2NZVG 3AR4A 4HXFB 3E0XA 3C98A 5EE3A 2J3JA 4WBXC 4DNQA 2R48A 1R00A 4ENUA 5ENDA 5K0JA 4UHKA 4GRIA 3NTRA 3SX2A 2XCRB 5HKBA 1COWD 3VZBA 2H16A 2OXTA 2Z6VA 2GDZA 1PHRA 3OF2A 2XUQA 3UAYA 2ZYVX 2XE7A 1FQWA 3CLHA 3D7LA 4CF7A 3RRMA 5J3JA 5JWHA 3EH1A 3J7AC 3T1HB 5H70A 1WOMA 5AD1A 1KVUA 1ITZA 1EVYA 3DR3A 4KBGA 5LLDA 2N0SA 2AH5A 1AUVA 2A0FA 4K0KB 2W2LA 3HDQA 1GTL1 2ZZMA 4X24A 1L4NA 5JJKA 1SRRA 3AL2A 2P0AA 1ZVVA 2AQ8A 1UBUS 2Z95A 2A14A 4YALA 1KK1A 4F72A 1IL0A 4IKPA 4G9GA 1JDTA 1E1YA 3MAGA 5L95A 3NOOA 1NAHA 5KU7A 2A4KA 3T5CA 3G5MA 3KTAA 1YRHA 1NMEA 5JYDA 3L2OB 5DHPA 3RVMA 1SCJA 4E08A 2EJCA 1Z82A 1EVIA 3CXUA 1Y7HA 3GLFE 5CX4A 4PZCA 1PS0A 3L1IA 2VP6A 3RK1A 1PLJA 1NUHA 3O4VA 1QCCA 4A0FA 4MM3B 4FWTA 3NIBA 4L78A 1EFVB 3BDVA 5AVUA 3D3NA 1WHTB 1GJRA 3R74A 3HYLA 3QA9A 1OI7A 2B7BA 4LFBB 1SG6A 4JP2A 4B3IA 4YJHA 5JARA 3NT4A 4WKNA 3GFOA 4NEHB 2FDXA 1J5EB 5FIUA 2MSCB 3LT5A 3GRYA 5FT9A 3L6OO 1TF5A 3IURA 2W6NA 1BX0A 3PNVA 1GLGA 3VVMA 3ULKA 2UZ3A 1V47A 1E2BA 2JJMA 4KWCA 1YA8A 5B1HA 4EGCB 1IXSB 3MMNA 2O1EA 1N25A 3GQBA 2HU2A 2AIRA 4G5QA 4EGSA 3LC2O 3ZE2B 1E92A 3GFVA 1VOTA 3V46A 3L7DA 3K9CA 1DX4A 4IGKA 2YHSA 3P32A 3VPXA 4FFOA 4JQCA 4BWVA 4GF5A 1WAMA 2AFIE 1NQAO 3AI1A 1PX2A 3KSUA 1ML4A 2JDIA 2UUOA 2OP1A 2YY6A 1N2HA 4EKGA 2QVBA 4JJ8A 4I0WB 1YQGA 4C0WA 3CZPA 5BPFA 3BFXA 1UPAA 5KQSA 1N33M 3AF5A 3DVQX 5DBFA 1EGVB 4JVSB 4OK6A 1ZZEA 4JOCA 3LBAA 121PA 5IAAA 2JFGA 2EJTA 5CH8A 4KUGA 1M7BA 4L3WA 4RKYA 2ZRNA 3CC8A 4BQOA 3ZI4A 4BPBA 2OAQ1 1BJTA 5JZSA 1NVTA 2C2GA 3HO8A 2VH1A 4X6XA 2FRVA 4J0CA 1C3LA 1YA6A 2CNLA 3VNAA 4FN4A 3PEUA 3DWFA 4KO4S 2HGSA 3RS3A 1VBMA 1EHCA 4FVMA 4BFVA 2ADOA 1T3ZA 3GX1A 5JDIC 3A1FA 4QE3A 3IOBA 3W34A 2D54A 1OIWA 3WB2A 2BSAA 4JVNA 3HJSA 3PKJA 3UMFA 2R7AA 1YKFA 1CB7A 4OH7A 5HS4A 3STVA 1N7GA 4UDXX 1PHPA 1XAJA 3G88A 3CEHA 3OX3A 2OHFA 2GZ2A 3JZIA 5EFZA 3KEFA 1FP1D 4N3GA 2R8PA 5JRDS 3QPUA 4W5HA 3WS7A 3L82B 3EZLA 5ALGA 3AB8A 4PF1A 4CN8A 2KNVA 2IOHA 1XNQM 3R6DA 1K3TA 4UVGA 1R4MB 4FMBB 3R0JA 4FN5A 3N2LA 1R0RE 5KTRA 4KQWA 4MW7A 2VPQA 3WLIA 3R6GA 4QJ3A 4AQ7A 1CQIA 1Q92A 5HMMA 2NSDA 1HRKA 3NHZA 5IJWA 3HJFA 2VQFM 5BR1A 3HWSA 2PV7A 4QNMA 3NLLA 4YJ3F 1DZ3A 3FZNA 4CCYA 2BH9A 5ULLA 5H3CA 2P2LA 3DYVA 2KRUA 1CE8B 3THOA 4DLSA 1UP4A 4JOBA 3WI7A 1QV9A 1R8XA 3U6PA 5F23A 1WY7A 2BFEA 3DOHA 1MB9A 3VBEA 4XXHA 4EUEA 3RS2A 1ID1A 3UFBA 5BV7A 1AQUA 3PITA 2V7VA 5AQEA 2CVZA 3SHTA 4DV1M 4K6HA 1RPJA 4Y6QA 3T3MB 3HV2A 3W8NA 1ZW6A 3W7AA 3IP6A 3OUTA 5L3QB 4BHTA 4ZVPA 3WSWA 3D7NA 4KXNA 3BN3A 5E9QA 2EDCA 2MOKA 3DYIA 2XLJA 4YT2A 4RF4A 3NHFA 3KJGA 4I66A 3LUBA 4YAIA 1RCFA 3CUTA 4CUKA 2QYHA 4BGDA 2VZEA 1VCIA 4LYHA 1DXHA 1NJ6A 2OILA 5KINB 4TTQA 4HN2A 3PC8C 3R9IA 1DC4A 4P7FA 4BB0A 3QM1A 3RYFA 4Y9SA 4DEVA 1URPA 3KYJB 4OHXA 2HMVA 3VAAA 3DS8A 4K9OA 4AK9A 1VM6A 4MYUA 4MHOA 1EUCB 4YACA 3DVAA 1O54A 4HLQA 1SZPA 3AJ9A 1EM8A 2PUBA 4I19A 1WQ4A 2ALJA 3S1AA 4X92A 2F3RA 3D3KA 2EFDB 1TRKA 2IKQA 5DWQA 1K8RA 5KTPA 4CCAA 3Q88A 3L05A 1DCFA 2LTAA 5HYVA 2ZVPX 4XJSA 1W9MA 3UMRA 3T4PA 1OMOA 3G5AA 4F2LA 5IPFA 3ZZ0A 3IMEA 4Z0TA 4A3SA 3OCZA 1IOWA 5CYFA 1OFGA 3ZY6A 4XCQA 5H9WA 4GI7A 4DR6M 3Q2KA 3I34X 2F3TA 4RWEA 4LX8A 4ZICA 3UUFA 3A27A 4YPFA 4BMDA 1YL6A 2H52A 3MFQA 4U00A 1SCBA 2C8VA 3GRKA 2EU8A 2IY7A 1PR9A 3S99A 1KDYA 3ICPA 5HCNA 1SNYA 4GMDA 4TZTA 1WO8A 3IR7A 1BJKA 3CKYA 4AWAA 3CR3C 3PFFA 2AJLI 3WKCA 3U6DA 1I9GA 5E2BA 2VWQA 3KK0A 5CXUA 3UTCA 2H17A 1RQ7A 2HEIA 3WLTA 2OLKA 3HB1A 3QVUA 1TIBA 4AZ3A 1KK3A 2ZBDA 3S28A 2EZUA 1NU6A 3FGNA 4FMDF 1EHIA 3WG9A 1FJGM 1V4VA 2JIBA 3K3PA 4Y67A 1QHYA 4XVHA 5BOVA 3RBVA 4L8LA 4R9NA 3KDPA 4KPUB 1XZJA 1ZJYA 5AW8A 3E23A 4TYYA 3A9CA 2RE8A 5DEOA 5FTJA 4J9UE 3UWOA 1O4VA 5IKMA 5JXWA 1EK6A 2XCIA 1IY1A 3ZW8A 3VPFA 4RL4A 4GKKB 1OXTA 3SX0A 3HB4X 3U61A 5LP6C 3G2JA 3KKKA 5G0UA 2GS9A 1BXGA 2JVKA 4QOSA 2SNIE 5LB4A 3ES9A 1BSVA 4OTZA 2IUTA 1RYNA 3C24A 3QF4A 1XMOB 1R6AA 4U9IS 1KI6B 3NKFA 4YMWA 3THYA 3SHVA 5DGDA 5KMGB 3IKTA 4QXOA 3HDHA 3K8ZA 2OXRA 2Z9BA 3KIPA 4HZUB 1VRVA 2O7VA 4RMNA 1PV4A 2PUTA 5KNBD 2J32A 3I5UA 2C7GA 4HEQA 2DQSA 2ZRFA 5CT4A 2EFYA 1Y7LA 1RPNA 4P6VF 1ZIXA 4BVKA 2VJNA 2D1QA 3HZHA 3ABOB 4DQUA 2E3JA 1NA5A 3CX6A 4DCSA 4OX9M 2Q27A 4P98A 4L95C 4HVAA 4Q00A 4FXPA 1SVNA 4C7OA 1Q6ZA 3LUJA 4N18A 1XZQA 2ZYIA 5D87A 4M9QA 2BJVA 1J25A 3QNUA 4QLBA 3ZLUA 2GD6A 4IICA 1A7AA 4ZANA 3LHKA 5HF5A 4ON9A 4AO7A 1SUDA 3G2PA 5DFAA 1QYIA 5JAIA 3N58A 4LJ8A 2O0MA 4ZOBA 3GH3A 4I4CA 2LUOA 4JI4M 2P4QA 3KL2A 4W6ZA 1DCMA 1HDXA 4LDPA 3E9MA 3IO5A 3ZBPA 4D4LA 4ISCA 1Q6YA 1ZDMA 4HDSB 2QHOB 1W5EA 2J67A 4IS2A 1WCYA 1V43A 2BEVB 3V7YA 1DAGA 4ACBA 3NBFA 5H68A 4TMYA 3DXYA 4Q9HA 4XM2A 1DMRA 2VNKA 4Y9UA 1WMAA 2EWMA 2NM0A 1M2JA 1CRWG 4IHQA 1KMHB 3HYNA 1SMKA 1PVVA 1FNDA 3MCTA 5AM4A 2ZSBA 3N28A 1O5TA 4R7GA 4WW0A 3C7DB 2LKCA 1CRLA 3L41A 1QRRA 4P16A 3GA0A 2WM9B 2XD4A 3GDFA 5IJ0B 5JECA 3CONA 4EJSC 3GJRA 4ZCQA 4AXBA 3BA6A 5ICGA 5KQGA 2OV6A 3S8YA 4YJDA 1SVUA 1MT3A 3U48A 1WVMA 1OX4A 3FMGA 3SZGA 3B2QA 2O3SA 2G0NA 3D9QX 2XNHA 1QSGA 3WGYA 4N01A 4RJJA 3IDFA 2D1RA 1U99A 2WIJA 3F46A 1Z8FA 4Y2XA 1NY6A 4UUNA 5T4HA 5J9FA 1U11A 3HS3A 4EF5A 5AM2A 3NDRA 2QTZA 4X3CA 1W6RA 3MWDA 3W7BA 4XB1A 1CY7A 1A71A 1DJOA 3RVRA 3O6VA 1M6WA 4NAHA 3GFTA 5CTAA 3BRWD 4A2PA 1GZ4A 4B7FA 3NBZC 4B3TB 4OU7A 4Y2GA 4UUAA 3ZN2A 5E7JA 1T2UA 4W7IA 3A37A 3C8UA 3MINA 3ZE6A 4F3RA 4FYJA 2VZ8A 2HPAA 2RK4A 4M76B 1JLMA 2H11A 4KXUA 4L8RC 5IT4A 3EH2A 2FG6C 1NW9B 5AI9A 1OC4A 2UUPA 3QI7A 3AGPA 2ZSUA 3JTEA 4TWJA 1HDZA 4XD2A 4RYDA 1V2HE 1KYQA 3HN7A 2Y0QA 1CTQA 1A97A 2HCRA 1MR3F 4PNEA 5L6MB 4WY2A 4HBGA 4JYCA 3TTWA 2NVUA 3I1JA 5DP2A 3LKZA 2HHLA 3LT0A 2YWRA 1EFPA 1PYOA 4MQFA 5JHHB 2HHHM 1NLUA 4JX9A 5E3IA 1DO8A 2OO5A 4C6RA 1VG9B 1U8XX 1JBKA 2OUIA 4CKWA 1W4AA 1JQEA 3PUYA 2BEKA 1Z36A 3L7NA 4TQAA 3OCUA 5C0OE 1QANA 4OQMA 1L5HA 2O8FA 3UWDA 2PLNA 1M34B 1MEEA 3OE1A 4KMSA 5EN4A 1SKQA 4F9GA 4LV8B 1C4WA 1IIRA 5C34B 1RYDA 1J2TA 3P1JA 1RXYA 4PEVA 3TZKA 4MQUA 2NIPA 4UAUA 3AHHA 1SXJE 3ZJTA 2OOBA 1CR0A 2PBFA 4G37A 3RJMA 3INGA 3VYSB 3EZGA 3UTDA 2C2MA 3WRXA 3TGLA 3KZNA 3JR7A 4QPJC 3TEFA 1BYUA 3GZJA 3E9SA 2GZHA 5IK2A 1TOAA 4P3NA 3NATA 3V8MA 3EEFA 4LSZA 4ZJYA 3SG0A 2X58A 1KEKA 1Z3CA 2CCKA 2FPPB 4GUDA 5B6JA 3QEKA 1QHIA 1W0JD 1Q77A 3ZV6A 4HXGA 5G2OA 5CG1A 1Z5VA 1L1ZA 1CQXA 4HH1A 2K2QB 1A4XA 1O97C 5DT2A 2XA2A 5HCUA 3FCYA 1A98A 4B17A 4JI3B 4DV0B 2FP3A 1KEZA 4TTVA 2KRKA 4Z86A 4Q12A 3I5YA 3UV3A 4B3DA 1A9RA 2L4EA 4NX2A 1YR2A 1VPLA 3VYTB 4RY9A 1N0IA 4JVOA 1DIBA 3WYFA 3DFZA 3O0DA 3PTAA 2QAJA 3O2SB 3WIUA 2W2PA 1E60A 1D0KA 1XDGA 2JGLA 4CR7A 3FJ1A 5EGSA 3NHWA 4QPCA 1QTIA 3VSCA 2H54A 1GARA 3DA1A 1MO6A 1T8RA 1ZI9A 3H2SA 4MUAA 4KH0A 5E6SB 5CYOA 5TGDA 4CLOB 1GPMA 2DR3A 1N5RA 3ETCA 4KXMA 2QUIA 4R2JA 3PVSA 3ZOKA 3OCWA 1ZOSA 4Z7QB 1E3QA 1B8UA 4EOGA 2NP7A 3IESA 2JF0A 4MDEA 4EYEA 2MU1A 3VTAA 5CM2Z 5H7XA 3VSDA 1UEXC 1T3TA 3ZV4A 1Z28A 3H2ZA 1TF7A 4A4DA 1BYIA 4EHNA 2OHJA 2WV7A 1XX6A 1YE9A 3THWB 3QVKA 1RC1A 2C54A 3D6JA 1ID8A 2Z6AA 4F3NA 4W5NA 1DUSA 3U6SA 3PENA 4L4RA 4TL8A 3R7WB 3GD7A 3WAGA 3KE8A 4HWSA 3AONB 1X77A 4DG8A 5A3SA 3OLXA 2QZSA 4ZYXA 1G21B 4ESHA 2ESRA 2DPHA 3RYTC 1SXJC 5EUMA 4AJHA 2BFWA 2REBA 4P4SA 2O3TA 3CGGA 4UE2A 2VA9A 5BOSA 1PWHA 4ID9A 4Q1AA 2V7BA 4TV8A 1U3UA 1J8FA 3AI7A 1L1EA 5D84A 5AW0A 2QYTA 2RMKA 3LL4A 2I9KA 3V1LA 5JY1A 2ZYAA 4EVQA 1LZKA 3GNQA 2J85A 4WCFC 1L5RA 4NJOA 1RQPA 3RIXA 3ECSA 4MR7A 4EKYA 3K31A 1GRNA 2ZJ5A 3KRTA 4JUCA 1XRMA 5G4KB 4UJ5A 1JLKA 2DERA 4H16A 3NGXA 4H59A 2FEPA 4G8BA 1HWYA 1BIFA 4NCXA 1CXZA 1KDPA 5CJJA 5DLEA 1V7PC 2JGAA 1Z88A 2BY4A 2X4DA 4O3FA 4FD2A 2FZEA 1JS1X 1W581 5IYZB 2LWIA 3EYWA 1GO2A 2UXBB 2KHZA 2H3HA 3WKAA 1RZRA 3K8YA 1VLMA 1KQ3A 3CF0A 2IZ6A 2OBXA 2R44A 1Z13A 3HR8A 2BMDA 1ORVA 4IQ8A 1KOJA 3ZDQA 2WJPA 4DLTA 4JJKA 2UXDB 2XCTB 5B7QA 2MJ5B 3ZWKA 1QHSA 4RFVA 2ODPA 4LYAA 3W5CA 1CK4A 1JIUA 1TVKA 2QR2A 3EQ2A 4P0QB 4BQSA 3BGIA 2P1ZA 2DUWA 1J24A 4BZPA 5F77A 3SR4A 5ED4A 2J3EA 4PRZA 2XDQA 4L5JA 3HKPA 3J2PB 4ZU6X 5A6SB 2BFPA 2GM9A 1RWBA 2A88A 4LOJA 3ILYA 1NXSA 1SU8A 3IE1A 1RC8A 1AOXA 1UK7A 3BDIA 4IHJA 1NG9A 1F8UA 3NPAA 5CDFA 4JELA 1AZWA 1LBEA 3E9NA 1QHNA 3W67A 2CHVA 1KP9A 1FSPA 4ZTBA 4KJXA 3KTDA 3KYCB 2I7DA 4ZZ3A 2IHBA 4AZVA 2B34A 1U3VA 4CF4A 4MQ4A 1V1RB 3M6WA 4C29A 5DV9A 4F71A 1SOUA 1DKPA 1P1JA 3BMCA 1ZBQA 1ZH6A 5JSYA 2DQZA 4MIOA 3A2KA 2IU0A 3PNQA 4DBLE 4L07A 3QLTA 4D7AA 1CJSA 5JIBA 3FTPA 2DI0A 2QXYA 1H2YA 2CLLB 5JMTA 3TWKA 4LRWA 4Y2SA 1KKMA 1ZVQA 1PRBA 4CQMB 2WYUA 5GJVC 3IQXA 1PGYA 1B3RA 1UH5A 1XKQA 4KGVA 4MV0A 4G56A 2PRSA 1BU8A 1GG9A 3UMMA 4KX5A 1ZUNB 2C8LA 4ZJUA 5FTWA 4BU0A 3NXKA 4I14A 1AURA 3B3AA 2RHCA 5ED0A 4YJGB 3IIJA 3WVNA 5ITXE 3R0XA 3RNLA 4LQ4A 5CJPA 2DXIA 1ZU5A 1U8UA 3EFHA 1HLDA 1VLQA 2HV9A 4QWMA 2HA4A 5IK2D 621PA 4UJ3A 4Z7OB 4J3NA 3F3MA 2FPSA 1M8PA 1XO1A 2Q3LA 5CA0B 2HOQA 4EJ2A 1V6AA 2HMYB 1SPXA 1TTQB 3DYBA 4UMFA 3I52A 5JMWA 5CCDA 4MVJE 1VSTA 1VJCA 4FR5A 2G1PA 1FFGA 5EUQB 5A7FA 1OFHA 3L1KA 1D1SA 3IB3A 5JVDB 2YWHA 2WNSA 3V48A 4C0BA 4MVJM 1YULA 4UNPA 3OMWA 3WLQA 3LHSA 1RYYA 2Z2KA 1ND5A 2XHZA 4JI7B 3NKVA 2VQSA 2B25A 3J81A 1EFRA 2IHNA 4PW0A 1YS7A 3TLGA 1WDKA 1SU6A 3IRUA 5HVNA 2HU5A 1ELOA 5EIHA 1XWIA 1VA5A 4JHXA 4AJLA 2EF0A 2W8ZA 4UASA 4Q1FA 1P5HA 3HY6A 3VSAA 2UUCB 5M04A 1RCTE 1SY7A 1F20A 3AJIB 4PFJA 1DBVO 4D9FA 1OC2A 2VPXA 2W6CX 4IV0A 4IJVA 1KMIY 2CW5A 3PQ2A 3NAGA 1HETA 4Z51A 1U0BB 1VB5A 4CLRB 1HSZA 3DQZA 2GPJA 2G77B 1E1NA 2Q28A 2CCGA 4PDIA 1JKMA 2A58A 3HUFA 3RRJA 4Y9RA 3G8AA 2WP0A 3MERA 4L6AA 1T43A 4PSKA 2PYIA 5COQA 4DWWA 4DBLC 4ALMA 1X7YA 4HRAA 4O0LA 2DZLA 4OAPA 3LWDA 4BFXA 5BV8A 1U2SA 1XNRM 4A0SA 1II9A 1TGUA 1S3IA 2I29A 5CB8A 5DTRA 2G17A 3OECA 1PO7A 1FMTA 5ERGB 2O8EA 3OQVA 1WQ3A 3PNMA 4Y9TA 4R1OA 1ZUIA 3SXPA 1ZAYA 4IIJA 5IULC 5LM3A 4TWIA 1Z4MA 2UVPA 3A4YA 4MV7A 4BVAA 3VOSA 4C4AA 4GOMD 2X0JA 2GCOB 3E2IA 4GR5A 1YMQA 4M46A 9LDBA 3F6EX 5DNEA 2I4MA 2QSYA 1TH2A 4RSRA 1XXLA 2IDJA 1EFTA 2A9QA 3ETJA 1GNTA 3JYLA 4PD2A 1XCGB 2IE8A 5ALIA 2WKWA 2FX5A 1NI3A 5C7OO 4PC2A 4CMGA 1V1JA 3X1WA 4C3OB 3ND6A 3QX8A 2WY2D 3ENZA 4Z9AA 5NULA 3KJIA 5FTNA 1LDMA 2AOUB 1D5WA 2XNJA 2PX6A 5IMBA 2HWXA 3UATA 2CGEA 2ZRPA 5DLYA 1Q5PA 2IS2A 3I5MA 4KAXA 1LZLA 3A6LA 2C9MA 4I55B 2RJOA 1I2BA 1YWGO 4LUCA 2QLLA 2NVOA 2ENUA 3GELA 2F9MA 4YFVA 1RXUA 2BLNA 9ATCA 4ZI7B 3C4VA 4JOQA 3S2FA 5BYJA 5FQNA 3ZHTA 4N49A 4RY8A 4C1NA 4L5IA 4AXXA 2KZSA 2VDNB 3F90A 4BX8A 2NQTA 1AC5A 3HCCA 3DV2A 4G8CA 2ACEA 3QBEA 2FJUA 5EHXA 3ZLVA 4QRHA 4UBMA 5THKA 3HYTA 2X8BA 3HDGA 3Q3CA 1DDOA 4CEJA 1F9AA 4D02A 3JZDA 3DL4A 3TE7A 2A4MA 3RABA 3L8YA 3UYKA 3NHSA 1T2AA 5BQXA 4E31A 3P2IA 2UZ0A 2X4IA 2DBYA 1ZBDA 3IPCA 3MFYA 1NF8A 4UFPA 1XTBA 2C7BA 3RE1A 4TQGA 2JY8A 2WTEA 3GCXA 1BHO1 3K0SA 4RKEA 1NQUA 4LPSA 3AESB 4G0OA 1QK5A 3KJHA 2XBUA 1V9CA 2FH5B 4C9BA 3DPSA 4CMIA 5HFNA 2V1XA 5IREB 1R2QA 1JGTA 3RBZA 3HP4A 1HEIA 4FOTA 4MULA 3OPYI 4AF7A 1ZW1A 2DPLA 1W94A 2QK4A 1E6UA 4AIIA 3WQSB 4B31A 1O0BA 4M9ZA 3CEAA 5J2TB 1CIPA 3ZWWA 2AI1A 2WIAA 2HT1A 1T9DA 4YP7A 2APJA 4OMCA 2Z7JA 1Q0HA 2P6PA 1GZUA 2REOA 4BEBA 1F7VA 3IHKA 1GPLA 4WZAE 4RQUA 3FLMA 1GV1A 1V39A 3E82A 3NHUA 4EQ6A 4XDYA 1ONBA 3OZUA 1MZPA 4QYXA 4BWGA 2NVWA 1JL3A 2BE9A 2DWMA 4G01B 1EK1A 2X2EA 1VXOA 2EHJA 1CJVC 2XUAA 3REQB 1NUTA 3EIHA 1GWNA 2OBYA 1OXXK 2Q4EA 3ZLBA 1Q50A 3KVWA 4JS0A 3R6WA 1Q0UA 2P4HX 2P9CA 3AIKA 2Q9BA 4BV9A 4GD3Q 1PGOA 2NO1A 5E95A 4A23A 5G3ZA 3RYCA 4MCIA 4M0PA 3AUKA 4MJXA 1OHHA 721PA 5DJ5A 1E2HA 1SOMA 4OPMA 2Z5GA 4QYSA 2ZDQA 3T6KA 1XL1A 3ILHA 4NJMB 4HF7A 1XNJA 4LF6M 1REQA 1P5FA 4D9EA 3PIDA 1GTRA 3AYXB 2X9NA 1NVUQ 4W5WA 5IXSA 5IYZF 1AS3A 1C4OA 2OOSA 4OQQA 4KXFB 2W42A 2O5VA 2AN9A 1NSYA 2BGTA 5JSUA 1UXIA 1QIMA 4RPLA 4KT0F 3LUAA 5LR6A 3O8BA 3U26A 1YVEI 4ND8B 3HXOA 1G3RA 2E4YA 4EZEA 2CXHA 4FLEA 1EFRD 4C0AC 5TMPA 3AOGA 2JLQA 3TLMA 4HH3C 4ZKEA 2YOGA 3ER8A 1R5LA 2OD9A 4BLTA 3BMNA 4UM9B 4NZZA 5MN4A 3WJAA 2NU8B 4WOBA 1OLSA 1Y8QB 1ZK2A 4MVXA 1DBQA 4YMUA 1T8YA 1HL3A 3BWXA 1T6BY 3WNVA 1A77A 3TL6A 2HPZA 3T9BA 2DWUA 1N6KA 1YVUA 3FXAA 5BSRA 5HP4A 2WQZA 3IUJA 2Q3MA 4HVLA 1UMBB 2ZTUA 3TSYA 5FFNA 3OU2A 3O8QA 4JI8M 1M1YE 4EI9A 4GKJM 3LQQA 3IQDB 3U13A 1W88A 3R5SA 4YUXA 1ZGAA 3C3BA 1SKUA 2OORC 4HYYA 1JDVA 1TGVA 3WLOA 4RMGA 1WKBA 1FMJA 5A5EA 2C1ZA 4G1VA 5JW6A 4D57A 4QUKA 4EG7A 3G85A 3OOEA 3UPTA 4HPWA 1MJNA 4PCAA 3ZDRA 1HNXB 3A9VA 2HX1A 2V4MA 5KYXB 3DXFA 4BMOB 3K9NA 3ZNOA 4LY6A 2GRJA 1H85A 4H35A 1TECE 1E1DA 1MIHA 2H2WA 1UBSB 4B3JA 1NBMA 4GZMA 1RM5A 2JCSA 5KO3A 2ZM6B 4TPKA 2F1RA 1BH2A 1THZA 4B44A 2YNMD 3ZCUA 3N7AA 1C0KA 4KMOA 5EJ2A 4GOXA 3HB0A 3H16A 3H3XA 4PG5A 2OWEA 3H7AA 4OHFA 3F4BA 3A05A 2QXTA 4TROA 4MTCA 4KUEA 3ZD6A 4EVSA 1N9GB 4BNHA 2KE5A 2TMGA 1UAYA 2HCJB 1D6JA 2G5TA 4ZVUA 4UC0A 5CA0F 4HGPA 3S8EA 5L7TA 3LLVA 1OOEA 3JQQA 2C1EA 4Q24A 5CAEB 3RHFA 2ZBQA 1XLTC 1YBHA 4G23A 5ALJA 3BS4A 2GYWA 5EY5B 5KJFA 1JB1A 3LG2A 2FSSA 4ERXA 1ACJA 4LF9B 3FI9A 3VJLA 4F3KA 1ND6A 2WZQA 2IIQA 1QCZA 4NBSA 1AZTA 1EUDA 4PC6A 5JVDF 4U2KA 3UBTA 3PT5A 4LHVA 1O57A 2BN4A 2B37A 4DIBA 3FOWA 3OQIB 3W5VA 2EX1A 5F7JA 1GQ2A 4WZBB 1QPZA 1E2MA 3KP1A 2OSVA 5BUCA 1UBTS 1DAIA 1LSUA 4R1TA 4M1KA 5TJHA 2CBXA 4QGAA 5HZKA 2O59A 1UADA 4CG3A 3KQLA 4F5WA 4NU8X 4UCFA 2GZMA 3LE8A 5C4MA 2N1MA 3C5WP 1RS0A 1LPOA 1WXGA 1PG0A 4DCTA 5IEJA 1UM9A 2XCUA 2FXVA 1EX9A 4TZ6A 1THMA 4MGYE 2ZRLA 5IJ9B 2QRKA 2PANA 4O4JB 4QAQA 1SKYB 1L8QA 1F06A 2Q2WA 5J4HA 5F5XA 1QYCA 2VNHA 2XXJA 2XDYA 5TQJA 1LJLA 3LC7O 4QOJA 5IBRA 4WLOA 3HADA 2JD1A 2QLJA 1N2XA 1LD3A 1KMQA 3OAAA 1DJLA 3OY7A 3DKVA 4G4NA 1HMYA 5E0KB 4KSCA 4A8JA 3U5TA 4OBBA 3WADA 1A9PA 3IB6A 1YJ8A 4HDKA 2YDYA 3MRXA 1J09A 2YZNA 3EXIA 4JB0A 4G1BA 4R7ZA 3R3UA 4M9RA 3HU5A 4D9MA 5BSEA 2HA3A 2Q4TA 3TX2A 2IBTA 3TGWA 1CEQA 4GEKA 4GXRA 4B9AA 1JHVA 3QKSB 3NM6B 1J5PA 3UW1A 5U9CA 5BXYA 2E4WA 4L85A 5EIEA 3WHPA 3P9PA 3ZV5A 3OE4A 3RAEC 2FS1A 4KVGA 4R68A 1UEIA 1PJIA 3SCZA 4RF1A 3UCEA 1C0EA 1VKZA 3FPLA 3I01M 1AHNA 5EZQA 1WY5A 4F38A 5E7QA 3B6MA 2R1VB 1DB3A 3FKQA 3ZTWA 5JPCA 5EC8A 1QS0B 3D4PA 2J0UB 1MOSA 2GD0A 4JIMA 4PHCA 2C97A 2BUBA 4M0WA 5AQ1A 1H0RA 1NM5C 4QTUB 4I55F 4C05A 3SQXA 5HKOA 4WP2A 4BYGA 5AHWA 5KDLA 2Q5OA 4DCMA 2PD3A 4YCDA 2FETA 2QRHA 4EP1A 3KOWA 3ZY5A 4ZI7F 5JAMA 3O31A 5JUWA 2IYRA 1JQ3A 1DGFA 3KBOA 2N46A 3FCOA 4DANA 3GL9A 2F1JA 1VEKA 1MO5A 1XZDA 3M6XA 1MX1A 5A7GA 1JV2B 4WNIA 1D1PA 2SKCA 1DX6A 5K2MA 2JC3A 3TSZA 1HC7A 3K16A 1TEZA 1M10A 1QBGA 4JT9A 3OKFA 3D7RA 4ESEA 2QSFX 4QZVA 1G8SA 4CI9A 2QRVA 4NXNM 2AKAB 1GVNB 1GL3A 2P4SA 3EBPA 2GMWA 2FR1A 3C3YA 4LXXA 5KYWA 1Z4IA 3P0IA 1JDZA 1F8XA 3OBIA 2ACWA 2VJCA 3MJ4A 3JAWB 2V58A 2RCNA 3OLCX 3OEHD 1JT2A 4IBBA 2QX4A 2ZREA 3CKMA 4KCGA 3C16C 4MQ6A 4YP0A 3C48A 1KRHA 2FPGA 2IVFA 4AO6A 2ECPA 3K2QA 3DOCA 5J2UB 1LCIA 4IGEA 1NW8A 2IYYA 3NW9A 3F74A 1JB9A 1W36D 5IN4A 4PNHA 5LC1A 2QN3A 2X9LA 5LIPA 2UYGA 5E1DA 4INJA 4ARZA 1VGRA 5FPPA 5J2TF 1NXOA 3KSBC 1N0HA 2QY9A 3AEKA 2FEKA 3ZWVA 3OETA 3VO9A 4GLLA 2O7SA 5KKNB 4ZVSA 4HEOA 1IUNA 2XZDA 4Q3BA 3N2GA 3D0KA 2P5SA 3IIMA 4YDQA 2O0LA 1Q21A 4KO3S 3TJRA 2Q4OA 5FBZA 4H31A 3K5IA 2HW8A 4ZQGA 5THXA 2P2SA 4AY4A 1DI0A 1QRTA 2LCIA 2AE1A 1JMKC 2ASVA 3LVBA 4UXHA 3WLMA 4YBZA 1X1BA 2DY0A 4GKAA 3OOJA 4D8VA 1ATIA 2HF8A 1UK6A 1JR3E 3V6LA 1RWVA 1VECA 4PX9A 3ILSA 1NR7A 3HHEA 4X6LA 3KSDO 3EIXA 4ZEOA 2C9DA 4YCBA 2MINB 2X0FA 2RGWA 3VK7A 4TTAA 4C7JA 2XHEA 4DY4A 3FI0A 1HDOA 1M6YA 2C2ZA 5F51A 2W83A 3MF4A 5CNJA 3HGIA 1L2CA 3CLTD 4XOIA 2QAGB 4DMFA 1O9GA 2VKTA 2BRUC 2NPIA 1NPDA 1XZ8A 2CLIB 3E4RA 1C8KA 5I45A 2PGOA 2ZTLA 1T4GA 3GLHE 3F9IA 2ZI5A 3CM0A 5AM1A 3UT5A 4IIVA 2YIJA 4C0QC 3EGOA 4BP8A 1ZP6A 5FPHA 4JLVA 4ZO4A 3HCWA 1TK2A 3PC6A 5E6JA 1DC7A 2ZBVA 3E46A 1UDRA 2QQEA 3U44A 1T5TA 5F3WA 1SHJA 2J4FA 4PN7A 1DOAA 2F3PA 2XYQA 2W2LD 4D0LB 4MVJI 1J1ZA 3M81A 2PJRA 1GLNA 3KVVA 3EGEA 2GLUA 3HSSA 3KFLA 4LXHA 5JDIA 5BSTA 1T2NA 1TEVA 4MKFA 3SLKA 3MLAA 1N2CB 4AJ1A 5IF3A 3KV3O 1ZK3A 1RRMA 4PIMA 2AG0A 2E5LM 2O8BA 1PCXA 1J39A 3IAFA 4JR0A 2P30A 2B69A 4NZ9A 1EA5A 2PUWA 1V5FA 5LMUB 3LYUA 3EUAA 3TQOA 2FMIA 4XIJA 3KQYA 3PUXA 2UUAM 1GEEA 4O4IB 1Y9DA 2X7JA 1G8FA 3PQ3A 4P31A 3MD0A 3KVRA 5KCZA 3C70A 3WNQA 5DFLA 1O6GA 3DMTC 2GJSA 1RR6A 4B35A 3RKSA 2CVPA 4LHZA 3U4IA 1XQ9A 2ZXFA 1Q0ZA 1MPXA 2ZIAA 3GP5A 2VI5A 5CRIA 3MBIA 3VU1A 2G63A 4TVOA 5DRTA 3WIBA 3DE4X 3S4YA 3RHZA 3IUSA 2ATCA 1D8AA 1CZNA 2KB0A 1U7TA 3LX5A 1U9CA 3DDNA 5JS8A 1DKUA 3GCWA 2L4FA 3RTEA 3PQ8A 2QTVA 4DVGA 2JW5A 2OPFA 3AV0A 3GK3A 1FDUA 3DAHA 1MG5A 3N2NA 4MUBA 2I99A 2W00A 2JRCA 4TXNA 3LGSA 4BQPA 4EFLA 4OAQA 2G07A 2JDID 1FY2A 3GYBA 4IBOA 3EARA 1SHZA 4CEIB 4EYKA 1YDFA 5HK9A 4PE5B 2JH9A 1XN1A 3BL8A 2C04A 2PKCA 3MCAA 1NQWA 1VPDA 1IM5A 3E2MA 3RU3A 2UDPA 2REQB 3RK4A 2X5OA 4F7DA 1ZI8A 1LPAB 3TTVA 3A8TA 5FUMA 1JDUA 2JJ8A 3AR2A 2WIBA 1QRAA 1QJCA 5F35A 3ZDCA 1WXEA 2ZQ5A 3LTNC 3NYWA 3OTQA 8LDHA 2GK6A 5DM1A 1DNPA 2Y20A 1PZXA 1CZKA 2ZE5A 3OD5A 3PFKA 5LZ9A 2H00A 5CB4A 5E0OA 3KX2A 4IV5A 4PGGA 2FJ0A 5IS2A 3LV8A 4NYIQ 2G80A 4PX2A 2NNLD 4MS4B 3OJLA 3TQSA 5EMKA 4E33A 1I6LA 4O4JF 4OKSA 4BO7A 2GTIA 2FMUA 2J5RA 3UGQA 4TTIA 4OP3A 3P96A 4QXMA 1NF9A 1V3TA 4DR7B 5IU6A 2QP9X 1M2VB 3THGA 2WOJA 2R6FA 2RARA 4KR2A 8ADHA 1KEEA 3EGWA 4Q7QA 2J6IA 1N5KA 2QTBA 4UDYX 2I22A 4Q7JA 4ZDIA 3VC2A 4BN0A 1AKWA 4AMGA 1CY0A 1R4ZA 3M7IA 4AECA 2JI7A 5FCDA 5LUAA 1NE7A 3RGWS 2IZ7A 3GUCA 2AEEA 4XQCA 3DB1A 1JXAA 4LZPA 4W4TA 1BDIA 3AX6A 3QVMA 2B35A 2OO9A 3UQYS 3VR1A 3LSYA 521PA 3PDHA 1FLDA 3B5IA 1TA0A 1MRZA 2MH8A 5TQ0B 1JIIA 1M2OA 1OIXA 1QGAA 4DMMA 2BFBA 3VKGA 1KO4A 4DR4M 1BFKA 1Y5RA 3EPRA 1PJRA 1G19A 2X1VA 4BBJA 1J33A 2PWYA 3QE0A 4H7HA 4LZOA 5ITWA 4CGYB 3KQVA 4DR1B 5FBLB 1GPBA 2YZ7A 4GYYA 4JLOA 3SJ7A 2KBFA 3GHHA 4R3NA 3AU9A 2P8SA 4YUYA 1MIOB 2EV9A 3AVQA 2CUNA 2CMFA 1KAGA 4JZKA 1CB0A 4H0NA 4J29A 3IT0A 4Y0VA 2VHZA 1T10A 4Q4HA 2GA8A 2R1ZA 3IT2A 4ZXFA 1KI8A 3BYZA 1XEFA 1O95C 5K45A 5LP6A 1Q0LA 3TZLA 1JIKA 2VT7A 4Y0NA 4ZOEA 3ROXA 2VK1A 2BCEA 5L3SA 2DVWB 3U5ZB 3I76A 3AB7A 4WA8A 2BYTA 4KLAA 2QRJA 1DOHA 1ISMA 4FC6A 1NUUA 4BXOA 3K0FA 3FVVA 1JKIA 4K40A 3B60A 5DX8A 1C9JA 3IOMA 3QG5A 3FDXA 4HLUC 4A9AA 2DKLA 5AWFC 2W4MA 2OGWA 2KZUA 1D2AA 2JKVA 3KLOA 1P5ZB 4XD7A 4HUQA 1QRUA 1RJEA 1D4FA 1J9ZA 4WGFA 1MQ8B 1GZ6A 2F5OA 1KHHA 3G49A 1NBIA 1O8BA 2D2EA 2VF2A 4A92A 4UBNA 4BKRA 5K6RA 4H1HA 3OESA 3IQWA 4EATA 4MHSA 3CRNA 2UYQA 2GEFA 1D2GA 4M37A 3Q7TA 5BWMA 4E3WA 3VZQA 3EZ2A 4WNYA 2WJGA 4J1SA 1UAGA 5C7IO 1QHHA 3T94A 2GOYA 2ZPAA 3K1ZA 5DZSA 5EERA 1BMFA 2A5DA 3GDHA 3C3JA 2ZRDA 1BFUA 2KLHA 3SF0A 1XHLA 5FA6A 4RTMA 2VTVA 5J2UF 1PJQA 2A1TR 5IC5A 3ZZMA 3ZD7A 1DBIA 3MPUA 1E7QA 3LS2A 5DHAA 1GAWA 4S2EA 4Y1RA 3MRVA 4MI1A 1OFIA 3F8SA 5JEEA 5EMNA 1C41A 3HE3A 1N6IA 4A2QA 3QWLA 1NVDA 3LZCA 1YCFA 2MR5A 4ZDKA 3DTVA 3U6QA 1XPJA 2QPTA 4LKOA 5H82A 3UKOA 4WECA 2MIIA 1MOZA 4XRRA 3CSSA 5IVPA 3GZNA 1BX1A 1WPGA 4IFBA 3C8MA 1R0SA 4P3OA 4HEA6 4NBUA 4DILA 2DT8A 3KD2A 1HOXA 1FTSA 3OCYA 4UTVA 3E9ZA 2I4LA 3ZYZA 4CTJA 1XTRA 1LTKA 3EZ9A 1T8TA 4ZAZA 3C8DA 4RPJA 4JBNA 3ZWXA 1KETA 2ZXEA 5DK6A 4I9FA 1OZ0A 1TC2A 5F7XA 4RH1A 3K9PA 4F56A 2GFQA 5EQFA 5CH5A 1P7CA 4LFAM 1UXOA 4EJSA 2JKZA 3T54A 2MGWA 1TKCA 2J0VA 4CG1A 5KOHB 4FQ7A 4NRWA 4JC8A 2Q29A 1IOZA 5F2EA 5EP1A 1M73E 3LX6A 3HVIA 1PJTA 5LZ5A 2QJTA 1UBCA 2GX6A 2AXEA 1BVYF 4MR8A 2YW9A 2ZU0C 1EDEA 2EO2A 2WB2A 1OAAA 2OCDA 3M1LA 1FA9A 4DLAA 4J94A 2WPNA 4AD8A 3L7OA 1P3DA 4LQCA 2OKGA 3BVPA 4F3CA 1SURA 4G0WA 3FPKA 5HIIA 1BEZA 2FPWA 4OQZA 3BCRA 5HWSA 3LPMA 5HUQA 2HRQA 4IWYA 4IDFA 2EG5A 4MPDA 1N5JA 4FCWA 5DT9A 1KZHA 1VKRA 2VF5X 3Q8XB 4NZNA 4ND7A 2RHHA 5ES4B 3V2UA 4ML3A 1WE2A 5CEJA 5D3KA 1V9SA 4JKYA 4P53A 1QWOA 2HSEA 2PTHA 2VZLA 1C9KA 1TZJA 3FKSA 4EBFA 3QVGA 1U31A 4G5XA 2OLEA 2D6FA 2HF7A 3EC2A 3HRIA 3RS9A 1UBEA 1J2UA 2NW6A 3AUYA 3ER6A 3T4UA 3P27A 2O2DA 1X80B 1ZQ1A 2IHZA 3NKLA 3WIVA 3Q8LA 1E2PA 2AMJA 2Z58A 4US1R 3A70A 1YCHA 5BPVA 5D3MB 3SBJA 2QSZA 1Y1LA 4XYMA 1T5IA 2B1IA 4TTSA 4DSAA 3L25A 4B6GA 3H5NA 1L5KA 4AJ2A 1PK9A 4RK1A 2HSWA 2I71A 4KIGA 4KW7A 2WNHA 4MLDA 2PMCA 5KPTA 1YGPA 1R8YA 1ZHOA 2NYVA 6ABPA 1G20A 1WW3A 4PAWA 3UJDA 1Z6QA 4KR3A 4J0JA 2ZB3A 1VLZA 1WG8A 4BMSA 1SVKA 1H93A 3R3HA 3LCMA 5F5LA 1SHTX 3WK5A 5EOVA 3ZU6A 5BYKA 4Q4AA 1V4BA 3WWPA 1KZ7B 2P0EA 2YL2A 5AVTA 3VR5H 2WM3A 3QYJA 4O4IF 3VZDA 3A4TA 4Y2QA 2L7IA 5IDVA 3ZH9B 5KQDA 3EGVA 2QM8A 3ND9A 2IYTA 3ROPA 5BQFA 2VPTA 2CCJA 4A27A 5BN5B 4PXSA 1WKCA 1CETA 4DHWA 1RQXA 1MJ5A 4BVFA 2XPCA 4RZHA 2O05A 1KZYC 2EKBA 4UN2B 2FQWA 3CQ9A 3ZWCA 3G0HA 1N5DA 1K9VF 2FGKA 1IZ7A 4OM7A 4YHHB 3CB2A 4QT0A 5LU9A 1AV7A 3M4YA 4MI6A 3EDYA 1H1LA 4B2PA 4H7EA 5G1OA 1WMDA 3IP8A 5L3RA 4XAQA 3KQWA 5DB4A 4F5YA 3M82A 3DUFA 4I4TA 1AKQA 4FNMA 5TF0A 1JVNA 4YCJA 4BVBA 2IF2A 3PEWA 2QLMA 1V2GA 1JKJB 3OCJA 1EJ6A 3V34A 3DOAA 1HT3A 4HNQA 4AC9A 3FYHA 3F7NA 5I4KA 2HRDA 5K7SA 2QORA 1M0WA 2FF7A 3QMMA 1SELA 5FWDA 4MWEA 1L5ZA 2OGZA 4MV5A 1N2EA 1Z18A 1GRCA 1JJVA 2CNNA 3ANMA 2VWPA 2YFQA 1M1NB 1AB5A 3P45A 4KRGA 3SM3A 4LC0A 3W9BA 3ELDA 4D79A 1Z4LA 2WD8A 4AKTA 4G5OA 4H3SA 3GPDG 3CZ5A 1Z75A 1S02A 1PT9A 2WSLA 1H0KA 4XD7D 1GCUA 1SXHA 1R64A 2VDBB 1P8AA 4I50B 3UT6A 2ZJOA 4IV8A 3ANXA 1AUAA 3DB2A 3RSQA 4CU5A 2GJAA 1BCRA 2NPFA 4OXYA 4UMDA 4B8WA 2HY7A 1R66A 1WKVA 2DR0A 4MDYA 4WZZA 2IU3A 2VHYA 4PLWA 2DMRA 3LM8A 4OQFA 1U8CB 5CPBA 1NW7A 2QVXX 5JEDA 2FW1A 2WWVD 4ER0A 1AG9A 3MJTA 3JXEA 3AHGA 3L40A 1M5RA 4XZ3A 1U1FA 1OAOC 4PVDA 1OXUA 2C00A 3GFGA 3KEGA 3G8BA 2FHPA 4URUR 4UQLA 2PZMA 3T5TA 4LOHA 4ISBA 3MUFA 3Q2OA 1QX3A 1H2RS 4UM5A 4O4LA 4IIXA 3CSDA 3RRYA 1ZD9A 4OU4A 3FTNA 2B83A 4M21A 1W34A 3VGJA 4Q05A 3V5NA 3LLCA 3VU9A 2NU9A 5H16A 1I1QB 2PMDA 1ESMA 3UJNA 3AUUA 5HIMA 2PA0A 5CURA 2LRHA 3FCXA 3GRPA 1T6OA 4Q5IA 4D9GA 4EMTA 1JQLB 4W5OA 1YE5A 3ZV3A 1OYYA 2EBWA 4P92A 4II2A 2WA2A 3OJFA 1YQEA 3PD0A 2FSFA 1GGKA 1P1BA 4AW4A 2HDHA 3ZWDA 3B6ZA 3JD0A 3SAJA 2E9SA 2F48A 3NORA 3IUQA 1D4OA 3VTKA 3N2KA 2FEMA 4XUCA 2WTMA 2FZ5A 1J49A 4DDTA 4KQ9A 1EDDA 3EA5A 5KWVA 4P58A 1N7IA 4B84A 4CDMA 2VOJA 3B1VA 4HUJA 1HDYA 3W6OA 3COJA 2NO9A 4NFYA 4QRIA 2N9UA 2AFHE 1WCXA 4QGGA 3H2JA 3B3JA 3SGLA 4AZTA 2X19A 3NQ41 2PGDA 4ROTA 2CHFA 2FH0A 2HLHA 1RWWA 1E3WB 4AY3A 4R05A 3QHPA 2K7FA 2OZLA 1NDUA 5JU6A 2H9YA 1X87A 2W2QA 1GTJ1 1AH2A 1UMKA 4UPVA 4OBWA 3ZW9A 5AVZA 2V1UA 2BFCA 3D54D 1VBFA 1I10A 3AHDA 4DQKA 4GMHA 3FKSD 2ZETA 4QQFA 8ABPA 4XJVA 4D1YA 1UANA 5TMEA 4DJDC 1DXYA 1MJGM 2H2DA 3EGDB 4AQYM 2QTWB 4AS3A 4OJQA 1W30A 2AOTB 5EIBC 4DV6M 4KU4A 3AQIA 1L4BA 3O93A 4L5YA 1JLLB 3ZTYA 3TNJA 1GU0A 5KI6A 4WK4B 2NSHA 1QYRA 1RWKA 3SYMA 1ZH8A 3KQQA 3W6UA 1B2LA 4AL4A 3OPMA 3RR2A 1ZA2A 2R4QA 4K8OA 1KAEA 4QOFA 3CBQA 3ACBA 2ZFUA 5F9HA 4KFTA 5FX2A 2JXNA 2L2QA 4L57A 3HKEA 4MJLA 1SCNE 4WOKA 2CVQA 3JVVA 2MCFA 5ITQA 2C2KA 3O38A 3KZOA 3WB0A 1Z83A 3L3BA 1TYCA 3FA2A 4RGQA 1VDMA 1ZLYA 3MTBA 3WK9A 5BN4A 2IV2X 4XI9A 1Y89A 1E9DA 2EL9A 2EIXA 1K6MA 3M6LA 3UOWA 5DI3B 5KKAA 2GCNA 4QOHA 3R8FA 1EU1A 4BTEA 5AIAA 3U7FB 4IBCA 2Y1CA 5B7PA 1ESZA 4K7JA 4LYYA 2E37A 3LGXA 3AVOA 1Y4AE 1AMOA 4X6UA 4YAJA 4Y2PA 3ZGNA 2QR5A 1JAZA 2XMQA 3TIFA 2Q5IA 3P0EA 1RKVA 4K6KA 1MTZA 2W2KB 5IC4A 3CH4B 3OIVA 4F85A 5TLSA 2W6JA 3F3SA 3PPXA 2P5UA 4QYTA 3R0VA 3ZC7B 2C0CA 4AYTA 1RZRD 4YV1A 4PYOA 3BB4A 2HH9A 1BKDR 2QUKA 4YJFA 4IXWA 4EAQA 4Q21A 4H08A 3C3XA 3UH1A 1C7RA 3UMVA 4KV7A 3WYGA 3VMFA 2MSWA 1Z73A 2ZT6A 5TPWA 4TT8A 2V59A 3EOZA 3MHPA 1ZNXA 1ZMRA 2DPXA 3CR7A 2UYCA 2B21A 3R4CA 1XQ6A 3OOYA 5KWJA 3UV6A 5AH0A 3DULA 2I6XA 4I1IA 5JTUA 3PGVA 4TMKA 4MWDA 1MOPA 3L84A 4UPEA 2C9CA 2XMPA 2P2GA 4WJLA 4DT1B 3D2LA 3PUKA 2ZBFA 4K05A 1XXHA 4OF4A 1IU9A 4HDRB 1DLJA 4M87A 2PLRA 2Z8YA 3A3YA 2ZS7A 3AF2A 1A8IA 3ECCA 1GCGA 5LXTB 2YV3A 2HA5A 4N3BA 4NCBA 3I9NA 1Q20A 4ZTZB 2CDBA 1MNAA 3BMQA 4MUEA 2W6QA 3KOOA 4F60A 4KUHA 4UHHA 2FRXA 5EA2A 3BQNB 3B2NA 3ODGA 2FCAA 3VSEA 2H7CA 5JXJA 3I37X 1MH1A 3G0CA 1XQWA 2RHTA 2XUFA 2IIBA 3N2IA 4GOJA 4R8RA 1SAYA 4TL9A 3OZXA 3E35A 3FPEA 3E03A 1ULUA 1VDLA 1WMEA 1UMDB 4WIAA 2UXCM 4QU0A 2I6GA 4PSUA 5CLLA 4O29A 1ZSVA 5LA6B 1C9EA 5ITZA 3VH1A 2X8JB 1FU7A 2PVSA 3VNRA 3ZGVA 1FJXA 2P2ZA 4ZIRB 5COAA 4IRXA 4DM3A 4JWKA 3SS9X 4HGYA 1EM6A 1YS4A 1FX0A 4LE2A 3NT5A 1QF7A 1U1IA 1YHNA 2C4MA 4GQAA 4JCCA 4ZARA 4FHZA 5MGBA 3EXFB 5EKDA 1F3OA 4QHTA 4MV3A 4DLNA 4ZEXA 4MGIR 5EZYA 1PNOA 4EVIA 4PZUA 3SXUA 4S3MA 4Q02A 4MW6A 2B94A 1QJ4A 1AIPA 3NIDB 5E1OA 2DPGA 3WQBA 4DRXA 1T1EA 4HC4A 2XR1A 4B40A 3B82A 5KYUA 1JVBA 2HCTA 3VAZA 1CLUA 2X15A 3EG9B 4YV7A 5LKRA 3TFOA 1TJ5A 2KPOA 4ZVTA 3VDQA 3COPA 2LE0A 1TX4B 2EJBA 2I7PA 3R6LA 4JU9A 2Q4BA 2R96A 1NURA 4B80A 4DGSA 3QWBA 2RGYA 3EJ6A 2F5NA 2KW5A 3RROA 3F67A 4M7PA 1KJNA 4CW7A 5ISMA 4J2OA 1L2TA 4MVCA 3BXXA 3L0SA 3PCRB 4Y0AA 4PZLA 3PWZA 2D7CA 2QUBA 3DUWA 3PR2B 2QSUA 3I9MA 4AN4A 3U62A 3PB3A 1TTPB 3RANA 2IPXA 4TXLA 4ZDJA 1NZJA 1IN7A 3F5FA 5DGCA 2PUAA 2EZ8A 2QLBA 2LNHC 4KJZA 4DMGA 3ED1A 4UFNA 4IDCA 1HJPA 4XA8A 1P7ZA 4MRRA 1XZMA 2MTBA 2QW8A 4IF4A 4N40A 3RIMA 2BI8A 1SKAA 2AQKA 3IPYA 4N7BA 3G9TA 3NVAA 4NJEB 4EHDA 1JJFA 4R5MA 4B7GA 3W68A 1T34A 4GRAA 2PBRA 1KZGB 5IAKA 1ONPA 1OLUA 4QC2A 3GO4A 3RSFA 1P31A 2FF5A 1GZ5A 3GXOA 4I50F 1CUGA 3CUSA 3T38A 1V16B 3RI3A 1RI2A 3PFHA 4MAFA 1UT6A 4QOEA 4NV0A 1J0XO 1Q7TA 2XF8A 1HT0A 4PIVA 4WDRA 5F64A 2AYXA 1JECA 4RA6B 1FMCA 3FETA 1V1MB 1CERA 1WXFA 4GXTA 3C97A 3A98B 2COKA 4Y6RA 3DQPA 5JYEA 1TM2A 3EFOA 3S2GA 3K9LA 2O8DB 3JR5A 4R83A 2C77A 2C59A 1YC2A 2QRQA 4BFYA 5I7HA 2QU8A 1XKTA 3ZHVA 3PHBE 3AKYA 5BO5A 3EWNA 4E22A 3H9EO 1E89A 5AYVA 2H1SA 2G9ZA 4Q4JB 4KN6A 4MEBA 3DFKA 2CL5A 2FOIC 2ZIXA 1EUZA 2V65A 4DV7B 4MW9A 2SKDA 4OGKA 2O01F 1SEVA 3H1FA 3ND7A 4B5KA 3R44A 2QENA 2E18A 2Q99A 4MDHA 2CE7A 1M7HA 3KHUA 2LV8A 1S1CA 4WKPA 3R5KA 1WM1A 5BMOA 3M4ZA 1ABFA 1WZ2A 3BD9A 1A9XB 2A3NA 5JH7B 2I3BA 2CYAA 1ZD4A 3T4EA 4YC7A 1WZCA 3GOHA 3QW2A 1T2EA 5K0NA 3AUSA 3HRHA 1ZJJA 2X7XA 3RFVA 1KBQA 5DSTA 4KVAA 3FRJA 3L8FA 4IIWA 3VA7A 4RXTA 2W6JD 3RODA 1WR1B 3WHKA 3DMGA 4JUIA 5F78A 4XPIB 2CLKB 4N7RA 4IF6A 3T3GA 1N7JA 1PUIA 1QKIA 3IV9A 2XWBF 3IV6A 3U3MA 2OCKA 3OJ0A 2IIVA 5DVZA 3NBYC 1U90A 1BRMA 2ZWAA 4BMVA 3SZLA 1V92A 4LXGA 3HY3A 3A36A 4CPDA 1ILWA 1SEPA 3GROA 3LY7A 1Z5CA 1JEYA 5EJGA 2C7VA 2XECA 2MYNA 4NI5A 4XYLA 2AW3A 4B71A 3NT2A 4OP2A 3H18A 3L1VA 1TO6A 1N4DA 3L1JA 1VL8A 4LF7M 5CGZA 1VHTA 1IMJA 1X94A 2WF8A 1X42A 5KPRA 4O08A 5AKHA 2IQIA 3O9ZA 1PGQA 4BN5A 4G0PA 3B1KA 3OICA 3T7RA 3AOEA 2HK8A 1V37A 4JBLA 3W05A 2FPIA 3LCJA 5L8RF 2HV8A 4FZJA 3AFMA 1X7GA 3ELUA 4X1IA 2BDUA 4BKQA 2OYRA 3ILVA 4DUZM 3VU0A 1O87A 2VNIA 1BQ4A 1I30A 3E3MA 4L8WB 2CLOB 3F5QA 3DXZA 2HSGA 3LVVA 4QYIA 1HNZB 2HSZA 4MWTA 5EIFA 3H84A 3ZGXA 6NULA 1G3IA 1ULHA 4KDEA 4YH1A 5JAQA 3H2GA 2YYAA 2OORA 1EK0A 1SUPA 1JI0A 3S70A 3GGOA 4KITB 3IJRA 5B37A 4B9EA 2Z57A 3OOSA 4B3HA 5T5QA 2PR2A 4MQEA 1SHKA 2VT6A 2CDCA 3LX8A 4W5QA 4EQZA 4KK3A 3VR6H 2J3MA 4JLPA 3L6DA 4YJ2B 3WLHA 3VJKA 2YOFA 1XKLA 4QPDA 3KKEA 4J3FA 4GXNA 5T8KC 1M74A 4DAOA 2RHWA 5FPTA 3VOTA 4K9PA 5IH3A 4X54A 5A2GA 4ZEMA 3RKUA 3L0OA 5CHEA 1LV8A 3PQ7A 1GZSA 5HF6A 3OQNA 1T8WA 4A5SA 4X8MA 4AUEA 1Z2PX 4O59O 1SCQA 2WE7A 4UFOA 1HNNA 3DD1A 1SM4A 5HQ3B 3ZK9A 3L7LA 2Q1UA 5F2NA 4PGHA 2WG0A 4HLNA 1JBQA 4LRSB 4DCNA 2ZIVB 4H15A 4L8GA 3CEPB 1OHHD 1GTVA 3HL4A 4JLAA 3G0BA 2QUZA 3WLLA 5WRFA 3QEAZ 1Z4PX 4W8OA 5C7LO 4KBFA 4GVLA 3KO8A 4NDNE 1XLTA 3CUKA 3X2EA 3I9FA 3NBXX 3TSOA 2I87A 3D3QA 2NUTB 5CDTA 3M5PA 3BJIC 4PG4A 4R1QA 1U8FO 3P9IA 3E3OA 3EPLA 1RDFA 3IVCA 1ADYA 2VKQA 2QSJA 4CN9A 4JYZA 3O90A 3ZE0B 3SQDA 1XAHA 3VTZA 1CYEA 1C7JA 4LDAA 3FYDA 3NNSA 1L9XA 2PS1A 2H5EA 4Y18A 1BKYA 3WAKA 1LS6A 4LNAA 1XUOA 2XGOA 4ZDWA 3KU1A 5B3LA 3ELBA 5BN3B 4RAOA 1GNLA 1OKSA 4JBXA 2ZR0A 5KTYA 5AW5A 4G4JA 3P4YA 5BN1A 3U4MA 3QELA 1SCUA 1Z07A 3EIUA 4TLMB 1FZQA 5LXTF 2Z09A 3HR4A 4M9XA 3RJ5A 3QX3A 3TBFA 1NN0A 1K7CA 4A73A 4O2AB 4LXQA 2WF7A 4J76A 1MPTA 4OAOA 3V32A 2XNDA 5A7HA 3RVQA 3HEAA 4G89A 3LDAA 4FYHA 4F4IA 4S24A 2IXDA 1R5BA 1B6SA 1S4MA 3JTMA 4NFHA 4R6WA 3E22A 2VUIB 2XUHA 4M86A 3JWGA 3DNMA 2BDEA 2C2HA 5KO2A 1PEYA 4HATA 2OY0A 4J6EA 1JEDA 3FCSB 3U31A 5LA6F 1P3QQ 4HWOA 1PJAA 1VKHA 3GG9A 3GARA 3SN6A 3DE5X 4L7VA 2J5KA 1HE5A 4TXMA 1QVWA 3FPJA 5ITUA 5HTKA 3BORA 3L02A 3USZA 2XUOA 2A30A 3NH6A 1PD0A 2VZ0A 2ONKA 1JWBB 1Y9EA 4PLPA 3OIGA 3IP9A 1Z0AA 4ZMBA 1G0OA 2QTMA 2H8KA 1Q7CA 2C5FA 1DTSA 1E6WA 1NBMD 2NPOA 1E9FA 2P9TA 2ZRAA 4RHXA 3QU2A 1NLMA 3FNBA 1HFKA 2C03A 3R0IA 1EWYA 4HRYA 4PBSA 4LY3A 5AW7A 1WB6A 4TLEA 2C7RA 1MO3A 1WUJS 4OYRA 1G2IA 3U3DA 4B4OA 4NE9A 1XCJA 1GFZA 1XRLA 1KH2A 3J81k 3QKRA 2FN9A 4V03A 3QE3A 2QAIA 3KSMA 1FNBA 2BTEA 4CMEC 3OC6A 3LUFA 4BEJA 1QFSA 1H1DA 1Z4QA 4QLOA 4X1KB 3LYHA 3DEAA 2WWXA 3JQ6A 5CX1B 1XJCA 3PUVA 3PC7A 2ORIA 3L7MA 4BNLA 3K9FC 3MN1A 4CLXA 3PD7A 4L9WA 3E21A 4EI2A 1Q0TA 3IMFA 1UL1X 1IK4A 4BVJA 3G8CA 2Y6UA 3OFVA 5KAMA 4X44A 2ZK7A 3JQ7B 2APLA 2VUHB 2Q9CA 2NQ8C 1UXHA 3UOAB 4TOIA 3P9NA 2D3WA 3EDRA 1CJCA 3R6TA 4EG5A 4C20A 4AP5A 2IPNA 4D9HA 5KAPA 1E0DA 4LK2A 1RHQA 4K1LA 4ZMSA 2GEUA 4MUXA 4YHBA 1WW8A 2EC5A 4WN9B 4Q3EA 1IFYA 5CB6A 2H1LA 2HDWA 3WYBA 3M49A 1Y8AA 1PRYA 3TNLA 2R3SA 2PSFA 3ZXXA 3V1UA 4B09A 3M6MD 1A7KA 1D1QA 4CMKA 2QX6A 5D5PA 4C1BA 2HL6A 1PR0A 3OQBA 1LW7A 1KMMA 4H7JA 4DUPA 5EAIA 4ZOAA 3OLZA 3NV9A 3AR3A 1SWVA 4AF6A 2J1LA 4LFCB 1XAIA 3K32A 3DKPA 1E1CB 2WWWA 1H05A 4LMPA 3EEQA 1TW3A 1QIDA 4TMVA 2ZZKA 3GLFA 3LA8A 1ISSA 1CY2A 1C3VA 4US2R 1BMDA 3FWNA 2J4CA 3DCJA 4BY9E 2BVNA 1AQJA 4QBGB 3AY6A 2JGNA 5JWRA 2AK2A 1E2FA 1R9MA 3FVWA 1HT1E 4Q66C 3M3DA 3UJ3X 3OAAD 3JQEA 2G5GX 1KS9A 5FUVA 1UFZA 4WCDA 1YFLA 3F92A 1R2ZA 1QOZA 2BFDA 2R0QC 3I42A 2WHPB 3I01A 3PWTA 2WZCA 4B3XA 3FAKA 3I92A 3B89A 4PXYA 5FI5A 2HHAA 4JWTA 3F98A 2GD1O 3BK2A 1IM8A 2IT1A 3MJHA 4ZODA 2RHGB 4RVCA 3Q2IA 1TQDA 3E61A 4Z53A 5KOIA 2G88A 3V97A 3VHXA 3RAGA 4XWWA 4U2EA 3U3OA 1RACA 5AVYA 4M1ZA 1I2ZA 1L2DA 1JSLA 2LPMA 3NOQA 3CE9A 1LK5A 4TS4A 3PNBA 5KJ1A 1XMVA 4BLWA 1E61A 3LIPA 1AKNA 4H7PA 2P2NA 5I4IA 1EX6A 4ZRNA 4R8VA 1Q1AA 5LDHA 1ST3A 4L74A 5JH7F 1TTTA 2RH5A 4C08A 3B7WA 4RF2A 2XE6A 1Q14A 4XB6B 1D5CA 2AFIA 3BWCA 1I0ZA 3UAOA 3DL7A 5DLDA 1WXIA 3F6RA 4YRLA 2FI1A 4FCCA 1O6ZA 3VUEA 2Y0PA 2YMMA 1T9GR 3T7SA 2FFQA 1UEJA 2YIDA 3JRWA 4A5OA 3FJOA 2GZDA 4KE9A 2J6BA 2XOXA 2WT8A 3IL2A 3H4MA 4P35A 3K15A 2XRFA 1NQXA 3UMGA 1E9RA 4FW9A 1ZMXA 1CFJA 5M7EA 4MOWA 3ZVMA 3PC8A 3OBBA 3UXYA 5JFOA 1YC5A 5DKFA 3SNHA 1T9CA 1NXPA 4PZDA 5F33A 4PPYA 2DJIA 3TJZA 3B52X 2VNJA 3H5TA 4HR7A 1T4DA 4C07A 3SQLA 1IN8A 3CLSC 4TM7A 1OXVA 4YNBA 2PWAA 4WXYB 4YJHB 3W2TA 4A6XA 5KU1A 3Q4GA 5FWYA 1T4CA 2E5WA 3LFTA 2QLFA 2ZIUB 1CUAA 3OO1A 2BZSA 2JIOA 1KTVA 4FB4A 1QF6A 1BW9A 1SBQA 5CXQA 1TI7A 4YT4A 3A04A 3S81A 1QBKC 4PWYA 5BR8M 3CX7A 1K89A 5HGJA 4XOUA 4ZAGA 3GGPA 2OZKA 2SCUB 3TBHA 3ZE9A 3FFAA 1ZD5A 2HQBA 3GQBB