3T38A

Corynebacterium glutamicum thioredoxin-dependent arsenate reductase cg_arsc1'
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
204
structure length
199
Chain Sequence
LHTNILNRIANELALTYQGVFSAETINRYIFESYVSLARTAKIHTHLPILAEGFAKDRLHALAVAEGKVASPVPQVLFICVHNAGRSQIASALLSHYAGSSVEVRSAGSLPASEIHPLVLEILSERGVNISDAFPKPLTDDVIRASDYVITMGCGDVCPMYPGKHYLDWELEGEDKIQEIIEEIDGRIRELWKSIQLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Corynebacterium glutamicum survives arsenic stress with arsenate reductases coupled to two distinct redox mechanisms.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Oxidoreductase
molecule keywords Arsenate Reductase
total genus 69
structure length 199
sequence length 204
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1060 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3t38A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3t38A02
4LDZA 1D1PA 2NZUG 1QP0A 1RPJA 1DCKA 1Z13A 3H5LA 3N8IA 2HQOA 3E3MA 2VYCA 2GWRA 1FSPA 2ZAYA 4XFKA 1AB6A 2JRLA 1ZY2A 4RSMA 3KG2A 1DBWA 2FMIA 1E6KA 3HS3A 4YP9A 5EWJB 3HDGA 4RK7A 3GYBA 4RK4A 3H5WA 1BA2A 2MYPA 4O1HA 1JDPA 1Z15A 2E4ZA 1D4ZA 3CG4A 2CD7A 4JA2A 5IX8A 3OQNA 2WJAA 3VNAA 3RVQA 5DTEA 1JBEA 4PZ0A 1ZN2A 2WB4A 2JVKA 4YRZA 5JNUA 2E4UA 4S04A 4ZYLA 4HNSA 4KREA 4S05A 5IBQA 1H9CA 3TD9A 1BAPA 2FVYA 3DZDA 5HM6A 2A9PA 4WUTA 3H6GA 3RH0A 3FGZA 4W5QA 4W5RA 4KVFA 1U04A 2PL1A 3LUCA 1TVMA 3LUGA 1JL3A 4EYKA 3ROFA 3CZ5A 3K9CA 4JB2A 1QKKA 3TMYA 2XDYA 2QVCA 5FWYB 3JTEA 2FSPA 3P9YA 3NNDA 3QEMA 4LRQA 4RDCA 3N6VA 1CYEA 1ZVVA 3JVIA 4Z4FA 1VPWA 3NHMA 3B2NA 1D5WA 5B3JC 3H6HA 1ZAYA 2ID9A 3Q7TA 5DGCA 2FMHA 3HJFA 3LOPA 3BRQA 2YHBA 4YGXB 2PUAA 3EAFA 1JX6A 4IGAA 3N0RA 2O20A 1F51E 4EVQA 4ZMSA 5CNMA 2QW1A 5HKOA 2W42A 1RZRD 3H1FA 1YS6A 2FXIA 3QX8A 4E7PA 3ILYA 1NXPA 1QP7A 1RZRA 3G1WA 3DLHA 3T6KA 1DC8A 3L6UA 1SXGA 3KHTA 4Q6WA 5TPWA 3OLWA 2OQRA 1DCMA 3IP6A 1K68A 1IIBA 2QSJA 4W5TA 4CBVA 3IPCA 4O5AA 1JDNA 5EWJA 2QZJA 1JLKA 1VKRA 3NNNA 4KQ9A 2F8SA 4O1IA 2FQXA 2PUFA 1GUDA 4MGEA 3C3WA 1BDHA 3Q9SA 1L5YA 1KGSA 4PEVA 2PUCA 2NUBA 3BILA 3Q7SA 4RY9A 4YCSA 2JBAA 5FWYA 5KQMA 1W25A 2LP4Y 4JAVC 4KK3A 4KFCA 1B00A 4RY0A 3LUAA 3CS3A 3T8YA 5CNKA 3URMA 1DCFA 5HSGA 4RK6A 4MRMB 4F06A 4Z4IA 1BDJA 1U0SY 2WRZA 4HNQA 1JYEA 1F4VA 2A9OA 2X7XA 4MS1B 2MYUA 2FLKA 5T7BA 2PKXA 5DKFA 1YMUA 2FMKA 3GBVA 3M9XA 1I3CA 1Z26A 2JVJA 4D6YA 2FQWA 4OATA 4RKRA 5FBKA 7ABPA 3LUDA 2LBPA 5JS1A 4Q7EA 1E6MA 3BRSA 1Z2EA 3N75A 4N0QA 5EWLA 5BRJA 1YTUA 4KZKA 3SM9A 3HXMA 1ZESA 5HQJA 4KRFA 3QLVC 3RVJA 5FWXB 5BR1A 3N53A 1P6QA 2P9HA 3H5VA 3O1IC 3RQIA 3JPYA 3LKVA 4XXHA 3BREA 2DRIA 4XASA 3Q7RA 1ZDMA 1VRVA 3OO1A 4RU1A 5C5EA 2FMFA 4LZLA 3C97A 2NZVG 5KC8A 1Y1LA 2LUOA 3O1HB 1C4WA 1USGA 1FQWA 3I09A 1XWWA 2AYZA 2N9UA 3OLYA 3JS5A 4PICA 4RK1A 1NATA 3FFWA 4LDAA 3F6CA 1NXOA 5JS2A 4MR9A 4FB4A 3A10A 4N41A 3EGCA 3K4HA 1QP4A 2HQRA 3UUGA 1FFGA 1E6LA 1EAYA 1BDIA 3Q41A 1PHRA 3GWGA 4Q6BA 4OTZA 3RVNA 1DRKA 3H5OA 5IUKC 3EQ2A 2NT4A 2CHEA 3EQZA 1K66A 4Y9TA 3M9WA 5EWMA 1ISRA 3H1GA 3RVMA 2IPAB 4Z4EA 4KK4A 4LE2A 1ABFA 1NXWA 4HYEA 5KWSA 3KCNA 4LE1A 1ZGGA 3TO5A 3IP9A 3FDFA 4EUKA 4EVSA 2B4AA 4N76A 4NICA 2PUEA 4G0ZA 4RZSA 1M5UA 1DC7A 1ZHHA 2GX6A 1ZH4A 1RNLA 5D2CA 2BGGA 1MB3A 5JNTA 3LUHA 3RVSA 3GT7A 1A04A 4JOQA 3E61A 5TQJA 1NTRA 1EWTA 3MM4A 4M88A 5FWXA 2WMYA 4F12A 2QU7A 1P6UA 4IMJB 1RXIA 1Z18A 3IP5A 4IRXA 3OLVA 1JYFA 1M5TA 5EWMB 1JFSA 1EWVA 3FFTA 1M2EA 3M6MD 3JPWA 1YK0A 1NXVA 1GUBA 4G0MA 4LE0A 3LUKA 5C5CA 3H75A 1XHFA 5IUNC 8ABPA 3QX9A 2MSWA 3Q15C 5JNRA 2L18A 3KLNA 2L19A 2PL9A 3QLTA 3O74A 5CNIA 1Z16A 4L4UA 5CNJA 4ZPJA 5IEJA 2PE5A 4MQEB 4P1ZA 1Z17A 3O2SB 2E4VA 2PAFA 3CLKA 5PNTA 3DBIA 5TQ2B 9ABPA 4MS1A 2WJWA 1YIOA 2E4YA 1ZITA 3F73A 3A0RB 2I6FA 4PYRA 4RK0A 4EY3A 3D02A 4NCAA 1P2FA 2ZWMA 4MS4B 3SQNA 3OO0A 1URPA 3TX6A 1RXEA 4YR7A 1J56A 2IOYA 4ZMRA 4MS3A 4DADA 4Z4GA 4JB0A 4Z99A 5TPZD 1LJLA 3HEBA 3OM0A 5TE9A 3SAJA 2PJUA 4GPAA 1GLGA 4QYWA 5TPZA 3H5IA 5DCLA 5F64A 1YMVA 3GRCA 2KYRA 5TQ0B 4MQFB 3CKMA 1GCAA 2PUGA 2H3HA 2FLWA 1Z12A 3MA0A 4MAAA 1OXKB 2F8TA 5KQLA 1DBQA 2FN9A 5TQ0A 3DGFC 1LBIA 3QEKA 2JK1A 3FFXA 2PUBA 2LIVA 1QO0A 4PE5B 3TB6A 1XHEA 2FKAA 1CHNA 1QNLA 3MF4A 4F8JA 1R8JA 4OG2A 4RXMA 4D6XA 2L17A 1EWKA 3S99A 2RGYA 1MIHA 1USKA 2IPLA 5GOTA 3SG0A 3FMVA 1ZGZA 2GKGA 2VUHB 1DJMA 3I45A 5BRAA 1L5ZA 1U2PA 2ID7A 1MVOA 1KRWA 1LK0A 4MLDA 3O21A 1NXSA 2AYXA 1SXIA 3W9SA 5BQ3A 4EYGA 5ED4A 2GI4A 4EGSA 3MMNA 2JVIA 3HDVA 3QEMB 4YLEA 3HCWA 1DBPA 3MYYA 4MQEA 1ABEA 1D1QA 1HEYA 2OENG 3EJWA 4G0PA 3VNBA 1C0EA 3NBMA 5I4CA 5JNVA 2MSLA 3KYIB 3OMWA 4F11A 3C3KA 3QK7A 3C3MA 4JASB 2J48A 1Z2DA 2QV0A 2P4UA 4MPTA 5B3JA 4D74A 5IULC 3LFTA 1PNTA 4DN6A 2LPMA 3OQOA 3NHZA 3C6QA 4RWEA 1T34A 1YVUA 1FFSA 2QXYA 2WY2D 4ETMA 4G0XA 1U8TA 3OM1A 1ZH2A 4P98A 3QELA 5IEBA 3KKEA 1TM2A 3QELB 3R0JA 2V0NA 4W5OA 3MQ4A 6ABPA 2A9QA 2FEPA 4MS4A 3A0UA 3F6PA 3QLUC 2E4XA 4DQDA 3HM9A 2GBPA 3OMXA 2FEKA 4WXMA 3QLUA 4G0YA 2CHFA 2R25B 1YS7A 1NXTA 1A2OA 1ISSA 3HVRA 4MYRA 2HSGA 4QICA 1EFAA 5KQPA 2JB9A 1VLZA 4GNRA 4RK5A 4WT7A 4UHKA 4YV7A 4XARA 4OBBA 2WWVD 4LX8A 3A3KA 4MQFA 2TMYA 2FQYA 5JNWA 1DZ3A 3LTEA 4G97A 1DRJA 3CU5A 4MS3B 1JF8A 1QPZA 4L85A 1SRRA 2R48A 4YS6A 3OQMA 3RVOA 4N47A 2FW0A 1S8NA 1BVHA 3LMKA 2IPMA 4ETNA 3EDCA 4MR9B 4QPJC 2QR3A 3T38A 3HUUA 1SD5A 1NXXA 4ML3A 4UHJA 4OLBA 4TMYA 3I42A 1JHZA 1QMPA 4EVRA 1NY5A 3LKBA 1LJUA 2MYTA 4E7OA 5FBHA 3RVKA 3L49A 4RY8A 1A0OA 4HNRA 4G0OA 4KPYA 4KQCA 3QLVA 3GV0A 3KSMA 3KS9A 1QQBA 4TLMB 2HPHA 2JCGA 3KYJB 1QQAA 3HSYA 3BBLA 4MLCA 1JWLA 1KMIY 4YO7A 4B09A 5KC9A 2PUDA 1AB5A 4FE7A 1MB0A 3HZHA 2HJ9A 4NCBA 3ROTA 2R4QA 3DGEC 6CHYA 1YK1A 3OLXA 3N0XA 4YWHA 3HK2A 4N03A 1Z25A 2MSKA 1JH9A 1CEYA 4ZJPA 4NV3A 2NT3A 3O75A 4RKQA 1MAVA 2R47A 3H5TA 4WZZA 1W9HA 3CTPA 3SNKA 3RVRA 4EYOA 4Z4HA 1UDRA 4H60A 4WXEA 5DLEA 1TJYA 3MIZA 1TMYA 2YHAA 4JP1A 2PMCA 1DP4A 4KMRA 5ABPA 3LUJA 3NNSA 3DLBA 4OLAA 5IUJC 3EODA 1JFTA 2CWDA 4W5NA 2FTKE 2L2QA 3RVPA 4KNYA 3JVDA 3CFYA 3KLOA 4TLLB 2IDMA 3JY6A 4F3TA 3EULA 1SXHA 5T3YA 4MR7B 4MR7A 3CNBA 3G85A 5KQGA 1DG9A 1EHCA 1PUXA 2RJNA 4QYMA 4RXUA 5JNSA 5IC5A 5TQ2A 2FEWB 1QO0D 5GQSA 3O2QB 5KI6A 4Z0NA 3CRNA 3GBPA 2Q5CA 3O1JC 1WETA 4XAQA 2M98A 1D2AA 1TLFA 4MR8B 3HUTA 5TPWB 1LBHA 4G0QA 4MR8A 4EYQA 4G86A 4XLTA 2E4WA 3KJXA 3N0WA 3CG0A 3KTOA 3OLZA 4Z9AA 3T95A 4TN5A 2VK2A 1GCGA 3UKJA 2M1ZA 1JFVA 3LUFA 2FN8A 4IMIB 4NQRA 4RS3A 3IPAA 4N0PA 1E2BA 1FFWA 2PLNA 1USIA 1M2FA 2VUIB 2H0AA 4ETIA 4IILA 2RDMA 2MYNA 3IP7A 2HQBA 5CHYA 2JBAB 2IYNA 3RVLA 4WWHA 4FE4A 3H1EA 1OXBB 3O2JA 5EWLB 3GL9A 3SY8A 4Z4CA 1PNRA 1PEYA 3CHYA 2IPNA 4IF4A 4RXTA 1U2QA 1APBA 3HV2A 3IDOA 1PEAA 4Z9BA 1P8AA 3ILHA 3CZCA 4H3KB 2B1JA 3I5AA 3HO1A 3D8UA 4KV7A 4MRMA 3UK0A 2A9RA 2QVGA 2RJOA 3GA5A 5E3JA 4RV5A 1KRXA 2IKSA 3F7NA 4H3HB
chains in the Genus database with same CATH superfamily
2ECOA 1YI0A 1QIFA 2X42A 3E3LA 1M73E 1LBTA 2OCBA 1XO1A 1GNSA 3NVDA 4LDJA 3ZXIA 4JL5A 4OY3A 2VWPA 4HADA 3I8OA 2EP5A 1HLDA 2G9NA 2GGSA 1TKCA 4PQYA 1HK7A 4B4VA 4EQ6B 1G98A 1XX6A 1JDPA 2ZI4A 4ZJUA 2PVCA 4QGGA 4EGJA 4LJ5A 3CR7A 2WJAA 5ECGC 5C1DA 3TM5A 4GGOA 3VKHA 4ERNA 2BN4A 2NU7B 3CKKA 5JD6A 4DYDA 1RMQA 3P71T 4YT8A 3VZCA 5FI1B 5EL0A 4ZO6A 2WB4A 1XQYA 2JVKA 3D4LA 4KLAA 1PT7A 3GO4A 3JQ7A 1F8GA 4JKIA 2IHTA 4CM4A 2BBTA 4GBMA 4ZO7A 1L8LA 3EVBA 5TEWA 4C6SA 2ATEA 4E12A 1ZOIA 4W5RA 2XBLA 2IUUA 3WKEA 2PZMA 4ZN6A 4MVYA 5CDFE 1JL3A 1N4DA 3GJTA 4PZYA 2OHFA 3LNCA 1JJIA 1YRLA 3Q98A 4RPGA 4MGZR 3TX2A 2XDYA 5HF5A 2XLCA 2FSPA 3CRZA 3IEXA 2AW5A 3FWNA 4G8CA 4B79A 1VJ5A 4ND6A 4YP5A 3REQA 1QXSA 2IZ6A 1NAIA 4FSXA 4AY2A 4NH0A 2QIPA 4HDAA 4MV0A 4X84A 1X1SA 4KIWA 2XCTB 5DX8A 5ALUA 2FPOA 2JFFA 3BWXA 5K3BA 2DUUA 3GGSA 1YVRA 1YSYA 5DGCA 1KZHA 1FC0A 3BRQA 4WRRA 4ZOCA 1IB6A 3DLPX 3FPAA 4J49A 1X7ZA 4MWZA 4IGAA 3THWB 4MW7A 1CEYA 3ABRB 5CA1A 1F2TB 2C4KA 4QGSA 4CDRA 1SOMA 4ZMSA 4DV3B 3OHSX 1QGOA 1A27A 4HNUA 3ESQA 1N2CE 2JFZA 2JI7A 1YUNA 3L0OA 1RZRD 1CR0A 1Z9BA 3A1CA 1IWPB 4OXRA 3M6FA 2OV4A 3DAHA 3MOGA 2GDJA 3VJMA 1PZMA 4TX1A 3FE2A 4N40A 2Q1YA 4YCDA 3CM0A 1O95D 5G3ZA 2WAOA 4O4JA 2V6FA 4KQXA 3FUTA 2QSJA 4O4HA 3QFSA 1A8QA 3FOZA 1FUEA 2QRUA 2EWVA 5DTMA 2UUCB 1C9NA 2DKFA 4WNAB 5JVDB 1TO2E 2QZJA 3VU9B 3WKDA 4F1WA 4BO3A 4KQ9A 4J2TA 3ZK8A 2H1LA 3W5SA 4AJHA 4A2PA 1OH7A 5C3MA 4I8OA 4WI1A 1ACJA 2H2GA 3U1VA 5BVGB 2ZBQA 4OHZA 3VO2A 4CGYA 5HDBB 1W25A 4U2BA 4FGSA 1E4VA 3D6FA 2GZHA 5AWFC 4KK3A 4PDGA 4D0RA 2WZDA 2BGJA 3HKCA 3NLLA 4AECA 3GELA 1QUEA 4IWNA 4W1QA 4OHYA 1KQOA 2Z2KA 4HWTA 2JLBA 2ATXA 4ERXA 1AZWA 4IR7A 1XCLA 3FZEA 3EIEA 1JHOA 4HH1A 4K03A 2QBYA 3N9IA 3NKVA 4IJUA 5BSFA 4PDIA 2R6AA 5F51A 4WW0A 3IE0A 2EA0A 3FYTA 3QPBA 1IULA 1R8SA 2I0FA 4HNHA 2AR9A 4JELA 5DBEX 2BI7A 4B2YA 5BUCA 2ZB7A 4BQPA 3O4HA 4KN5A 5I7OA 2FW9A 3KEMA 3HHPA 3NHAA 1XNRM 1XZDA 4IIXA 4TT8A 4XUGB 2BR3A 4FGZA 2HCRA 4CF5A 1PJIA 3FTCA 4O3FA 3U6CA 1EVJA 5CDSA 4TKLA 4YK7A 5GP1A 5ITYA 1OREA 3H5VA 2WJGA 3HGQA 2R45A 2WYUA 1ITZA 1R0SA 2DRIA 1ZWKA 3V8NA 2JAHA 4UREA 1FCJA 4R2LA 3OF3A 2G70A 1V43A 5LQMA 1P4AA 3C7AA 2LUOA 3FZQA 2ANCA 4RGBA 5DBFA 4F4HA 1M1YE 8GPBA 2GRJA 3DOIA 4EARA 1XRMA 3A58B 4KQJA 2PZKA 3HFGA 2ZJ2A 2BR5A 1W96A 2H65A 1JPNA 2J4DA 2J5XA 2IIBA 5KU7A 1HDXA 1M6VB 1OKKD 5JS2A 2Q3HA 5H59A 4DJJA 1D6NA 1D0SA 4NXMB 2C8VA 1C1DA 1ZU5A 2CGEA 2NOAA 1EAYA 4TM7A 1R10A 2YHSA 1AKWA 1T0BA 3K09A 1PCXA 4M60A 1W19A 3Q41A 2QRVA 3DW1X 3UAWA 4OTZA 3VC1A 3W3AD 2WKQA 4HB4A 2XIQA 1E5DA 4DXHA 3HRKA 4Y9TA 3QUAA 2C0PA 2DY0A 2WF9A 1EP2B 3OBBA 4FS8A 2ZJYA 3X1JA 5IZ4A 3NDBB 2Z30A 5K8CA 1EP3B 4IBBA 1I94B 2DFVA 2XB2A 1JZQA 1DAGA 3E7WA 2OXTA 3OTOB 3E2IA 2B9EA 1M66A 4PG7A 2I3DA 2Q5JA 3H05A 4Q0MA 3CB2A 5D2CA 3CVXA 1EWYA 2HEGA 4KUGA 4DTCA 3IBSA 2UZ3A 1X13A 2PH5A 2CLLB 3V6LA 1LDYA 1C9EA 4NZNA 3UATA 2EAUA 3V48A 2V5AA 3WGKA 1H3EA 4M88A 4N5IX 1VA4A 4GMFA 4LRTB 3GLIA 4P32A 4EMBA 1G19A 1W9MA 3B7GA 3GJ3A 3PNQA 2PYDA 5EMHA 4Z4QA 3WRXC 2MROB 3LP8A 3BE8A 3ROQA 2F48A 2HK7A 3CF6R 2Y76A 3QFCA 4YIKA 1R64A 4GKJB 1KKLA 1P2TA 1U2GC 5B7PA 1S4QA 1G5RA 2W2LA 3K5HA 3LLCA 3EOAI 4S1WA 5ILQA 3U6PA 4I8DA 5K2MA 3WYDA 2O25A 1OJ7A 4B2LA 2AW3A 421PA 2OHVA 3LIPA 1REQB 2IL1A 3L1HA 1SQSA 3PC8A 4QDZA 2F9LA 4QASA 1FZQA 5JNRA 3FUVA 2ZIXA 1BE6A 4URFA 3VR3A 1NW7A 5IEJA 4OHBA 4UUMA 1T9BA 2ZR9A 1C9JA 5FHRA 5I45A 4KXQA 4A8TA 4E31A 1EUDA 2GILA 2H1SA 3LE8A 3CH4B 5BW5A 2GPTA 2JFYA 1U3TA 3N8HA 4FS3A 5MN5A 1S02A 4EPXA 1B6GA 5SY9A 4F3NA 1OLXB 3GHYA 2YWFA 5JI2E 2L42A 1YDFA 3SWWA 2R5WA 2XRZA 4HFRA 2FXVA 4W63A 2J3HA 1PI3A 1I2AA 4B31A 1L5FA 5HVNA 4AUNA 3RC8A 1RI2A 2AG5A 3VDRA 2WHPB 4IEEA 5KOJB 2CMDA 2IOYA 4K9DA 2A59A 2VAVA 3KFUG 1L5OA 4LC1A 4ZJZA 3R5XA 2QTBA 3LT0A 1H5NA 2C5LA 3AIOA 1NLUA 2X4GA 3MGAA 3RYIB 1BW9B 2ZDHA 3INTA 1ZFNA 2XKBA 3GIWA 3F71A 4QYWA 1J24A 4V39A 5A4IS 4F9GA 6NULA 4ER3A 2XE6A 1JIIA 1RIIA 4OYLA 2OQ2A 5GINE 2QRQA 1PLJA 2HXGA 1AIPC 3HCNA 4KDEA 1AHIA 4JB8A 5BWNA 3H4MA 2OHXA 3E9DA 4O29A 4FFVA 5CU7A 5CEFA 3M34A 4JR1A 2HLDD 3FYHA 1MC1A 1NNI1 1IVYA 2FN9A 3RFTA 1PQPA 2GAAA 1QO0A 3IX7A 2BTOA 4DSTA 1Z5OA 4RC9A 5KKAA 3M89A 3EA5A 1FA9A 3D81A 3L27A 4P36A 2JIOA 5FUBA 4BKQA 2GPJA 1AXEA 1N1EA 5FWDA 3JYOA 3JVVA 1GTG1 4KZPA 3DMNA 2L6OA 4PLHA 3SG0A 3WHIA 2PA3A 1RRFA 1YHYA 4JJAA 1J9GA 3LXMA 4BAGA 1NJSA 3VA7A 3HU5A 4PS0A 3G1TA 1K97A 3WLNA 2BZGA 4O3MA 1KRWA 3PWZA 5CM9C 1AKMA 2XGGA 1FMFA 3N28A 2X15A 1YE5A 1NXSA 3GJ0A 2C7BA 3UHFA 1IQPA 4N0EA 1E5VA 1XRNA 4OQFA 5TF0A 4PHCA 2O7RA 3O31A 4RGVA 4EG4A 2B1GA 4OUKX 4L9WA 1OBCA 3R8FA 2CLEB 4XTRA 1O0CA 1IB0A 1PR5A 1W93A 3W2FA 1C0EA 2B98A 2QPAA 1AF4A 4FLFA 2IOQA 2I4TA 4TM8A 2P9TA 3SE7A 4R83A 3HL0A 1SVLA 4R31A 3F4BA 4KJXA 1YZNA 1H4TA 1YWGO 2WFAA 1P4RA 3C8ZA 3QWIA 4C43A 1EIWA 4YXWA 1M2HA 3UG6A 2NVWA 4OFBA 3OJOA 5J59A 1Y7PA 3ZHVA 4LYFA 3QVVA 1YOVA 4MINA 4MHSA 1JU3A 4U6NA 4IXTA 2FPXA 3T1OA 3G23A 3I2GA 3AZQA 4LGYA 5E95A 2OO9A 1NWHA 1ZH2A 2CNWA 2Q45A 1GT91 1ZK3A 1KZGB 2ZIFA 4FLEA 5CJJA 2ZJ0A 5IEBA 2GVZC 4TTTS 3AKDA 2LHCA 4XBOA 2NTJA 5FQOA 3YASA 3U5ZA 4RA9B 3LI2A 3L7KA 4PFKA 1I7NA 3A0UA 3PYLA 2DR0A 4BJ6A 2X86A 4URZR 4NBUA 2ZRQA 1KYXA 3VDUA 2B21A 4YMVA 3AUKA 4Y6QA 5GJVC 4ALNA 3FOFC 3PDUA 2JJ1A 4KDFA 2R2GA 5EPEA 3LFUA 2DAPA 2YHUA 3FRIA 1G60A 4YV7A 1T9KA 2R87A 2VHVA 4OBBA 3A3KA 4HGOA 4IIBA 3PXXA 4GOKA 3S6JA 2WZQA 4RE6A 5KPRA 4LBYA 4JI1B 1NUTA 1UBEA 5IKPA 5JQGB 4DV2B 1HNWB 3SM3A 2DKNA 4PR3A 4UOZA 4KI0A 4QFDA 2HA2A 4QT4A 2LDBA 3ZN2A 1OX4B 2NU9A 2BELA 2PN1A 1PUIA 4D8XA 1ZGJA 3LCMA 1CQIB 3B9PA 2GN4A 2QN2A 1OH8A 1BVHA 1YDHA 3JATB 1SC9A 4BNUA 4HB3A 4AG5A 4DR2B 1YGPA 1OI7A 1X8JA 3C8HA 3Q40A 5JXHA 1TAUA 4RE5A 4CIDA 1RXSA 3ZD6A 2BP7A 1BOFA 4JP3A 5KYKA 2YCLA 1KMNA 1LLDA 1TUIA 1FTWA 2IZ5A 3FA2A 3NATA 4QOHA 2JD2A 4UD2A 4UM7A 4E7OA 3JAKA 4RY8A 2OL4A 3VU0A 2AQKA 1PS0A 2OBBA 4ZCLA 3OHMA 2AQIA 3UM9A 2GNPA 2HPHA 1PT6A 4UU0A 3AVXA 1ZCAA 2E1RA 1TNDA 3JAMS 4MLCA 1KMIY 1YB1A 2EZUA 4ZZ3A 1LQUA 3E5NA 3B36A 3BOSA 1RE0A 3VYUB 1K08A 1ZVQA 2Z95A 4H1HA 4Y2GA 1EGQA 1FVOA 3G82C 3HHEA 4KH0A 1CY4A 4K8OA 3NRCA 3HJSA 5JR3A 1QC5B 4D43A 1VYHA 4CIVA 5AYVA 1EK2A 4CLDA 2GFIA 4MO9A 1EDOA 4OHMA 5DBHX 4JBNA 3AUUA 2YZKA 4MUGA 2Y6VA 4CV3A 1BQEA 4NMHA 4NDNE 1E2GA 1YZHA 3OTWA 4Z7JA 2FE8A 1QB8A 1XEFA 3BWMA 3SASA 5AIBA 3FWYA 4WXEA 3PEYA 1U65A 2MJ5B 2WTBA 3NXKA 2BI8A 2W22A 4N39A 1W4LA 4WZAB 1DO2A 1CR4A 1BEEA 3K9OA 1MC5A 2HA3A 1Z47A 3NNSA 3CUUA 2BF4A 4Y30A 1JAZA 3U7QA 2NQ8C 2L2QA 3TBFA 3V7YA 1GKIA 1WCIA 3NGXA 1L8XA 5HFAA 4DLTA 3W6OA 4HWKA 2NTVA 3LECA 1VYVA 3EULA 6REQA 1W87A 1V9SA 1Y3HA 5I6DA 4LZZA 4PNZA 3WYGA 2CUNA 1JDUA 1U1EA 1XA0A 5C1IA 4CTMA 1R5LA 1M8FA 2FG7C 3GRFA 4CM9A 1R3UA 3T41A 2H7YA 4B40A 1IN6A 1U9IA 2EWWA 3DL0A 3GZNB 4GR5A 2NLOA 5J58A 3BMQB 4C14A 5INTA 1D2AA 1GU0A 3KP1A 3OJCA 3JR7A 2W58A 1W5SA 1E2JA 1VIDA 1KR5A 2H11A 5C4GB 2XY4A 4HTFA 4BYGA 3RJ9A 5CXUA 5KTKA 4DRXB 1ZV1A 2H4JA 3OX1A 3RS3A 4H59A 2NU8A 4OK6A 4RGQA 4Z2AA 1XDDA 2P78A 3ETLA 1V9CA 1SCUB 2CXOA 4I1YA 4X66B 4LHEA 3FNHA 2CZQA 2XFTA 1CDEA 1FFWA 2D0OB 4FM9A 2PLNA 2IDZA 1N2OA 4D96A 3GUHA 2WT4A 1LTKA 1RI5A 3S5UA 4C0JA 2CC2A 1VSBA 4CG3A 4HUJA 5KKCA 1DC5A 2QD3A 1TH3A 5T67A 3E21A 1Z45A 3I1YA 2IYNA 2BM0A 3HBNA 1DBSA 4J4BA 4HS4A 4B34A 4NQZA 1PT5A 1CUAA 2PXXA 1KAHA 4HMPA 3KWMA 2VDMB 5IPFA 5ELXA 5TIIA 3KR9A 3O83A 3PNSA 3WLKX 4XKJA 4FJ0A 5T57A 1XPUA 1OKSA 3HLKA 1Q2XA 3TGPA 4KXXA 3FHTA 1P29A 4WLNA 4DCSA 3GEGA 2OO7A 1I7SB 2ZYRA 2EYUA 4PM4A 3I5AA 4E5VA 4LK3A 4OQYA 1G0NA 3NHYA 5U4XA 1DB3A 5CDFA 3SAVA 1NW9B 5MHTA 4C6TB 1MFZA 4V0ME 4ZEOA 4K0KB 1A97A 4MPDA 2BDEA 3COWA 5AM3A 1GTL1 3L7BA 2XT0A 4RLSA 1KRXA 3E2MA 3UW3A 2JAXA 4OHVA 1KJJA 2BSQA 4C22A 4GW3A 2O8DB 1NBEA 2P6OA 4CTNA 3TK1A 3SBJA 2W8BA 4ZJYA 1P5RA 1BVUA 3WWPA 4DKXA 3NBAA 1UK6A 4ITRC 3KPYA 4YEDA 3Q7PA 5EJAA 5DXAA 1SR8A 2JRLA 4JUDX 4P7KA 5CCBA 3HS3A 1TVCA 2DX7A 3QIVA 5J5VA 3UJ3X 3H5WA 3KJQA 1U0LA 5TXGA 3TINA 3NEAA 3NBYC 4R5HA 1R8XA 1JQKA 3CH6A 4ZZ2A 4B8YA 3D6AA 1D4ZA 3CG4A 3NU1A 3IVGA 4WBXC 5EPOA 4EABA 4JBWA 1EH5A 1XLVA 1QTNA 1SM4A 4G24A 1L5QA 2YFYA 3A3PA 2P41A 3KVVA 4HH4A 4LJ8A 2C1EA 5A2GA 2DAGA 2GCOA 4P83A 1KYYA 3CLUD 5BMOA 5ECDA 2KZSA 2IP2A 5I5GA 1US8A 1Q0LA 1G8FA 1TB4A 3MCTA 5HM6A 4UUAA 3ACBA 2J0SA 1CUEA 4PNPA 1IUNA 1IHOA 3FGZA 3R0XA 4X8OA 4BVHA 3WGNA 1QLJA 2JLYA 1D03A 3G89A 5LNK1 4WNYA 4XQEA 2ZTHA 5E38A 3R75A 2WFZA 3V8QA 4ALIA 3FKQA 3EEYA 5FPSA 4CFYA 2JL1A 3PJRA 1EQUA 1RP7A 2QVCA 2D7GA 3KALA 5EVJA 4OV6B 4Z6YA 1ZH8A 4IX1A 3TXXA 2IWRA 1II9A 1R9JA 5I7FA 4BWVA 4CR7A 5CRIA 1BVRA 5B3LA 2VYND 3JVIA 2EUCA 3D3WB 3GLHB 1TF7A 3DO5A 4MRAA 5FLXA 1PT8A 1Y9ZA 1ODKA 2PUHA 3AESB 3CRMA 3FPGA 5IWCA 1VE7A 4NNPA 1GG8A 1XAJA 4OSOA 4YGXB 3TUZC 1NW3A 1OTRA 1AKQA 3VYSB 5DISB 3PNVA 4PYMA 2F8MA 2Y8EA 4IZHA 5CLHA 1C0LA 3PF9A 2RBEA 1VCNA 3MCZA 2PX2A 2PZFA 3T4XA 2YMPA 4HUQB 1WCYA 1KDTA 4B4OA 2W42A 4CEHA 1L4LA 1TO1E 1QK4A 2DMRA 2VYVA 2J9FA 1PIWA 2IXGA 3RSCA 1TK2A 3T7RA 1JEQA 1RRPA 4X1YA 3U3KA 3G1WA 4CIXA 1IZYA 1S9DA 3PKZA 4KQ6A 1S2LA 4YRJA 4UFNA 1MX1A 1KE1A 3M8KA 5HIJA 3UQZA 5JJCA 2OQRA 2EG9A 4TLCA 5AW5A 5TVGA 1MN3A 5EQFA 4YUAA 2AE1A 4XSVA 1IEVA 2IUYA 1Y8QA 1YA4A 2X5KO 3JQAA 4NXNB 2V65A 3KWJA 3JQPA 4HH3C 5ITSA 2NQ2C 1U31A 1PJBA 2XMRA 3WHKA 2OILA 3IAFA 2I87A 4U3JA 2QGZA 2COEA 3DDOA 3NB0A 1P1KA 1XZJA 4HRXA 1J4AA 1V26A 4PYOA 4FNMA 1AQUA 1SURA 4EGCB 5SY6A 2YN2A 1T2UA 1YQ9A 1Z4QA 4TXJA 1DKPA 1A98A 2QL5A 1B00A 3FVQA 1XTPA 4AUKA 1XMJA 5HSGA 3ROEA 4OHUA 1D07A 4N7RA 4LW8A 4RK6A 4QA9A 1BDJA 1XCPA 4I14A 4TWJA 5AOCA 3MUFA 1F4VA 4MS1B 1RWPA 1SVUA 4GMHA 2XTZA 1CK4A 5EKUA 2IODA 2GZSA 1VDDA 1HDOA 2DFKB 2QNRA 3FR7A 1YO6A 5ARDA 4EI8A 5TLSA 4PQGA 1FLAA 3VSEA 1M2JA 1M5RA 1XNRB 3A6HA 5FOWA 1FUYB 1DGBA 4JSRA 2ZETA 4N0QA 3OQJA 3RBAA 3K9NA 2ENUA 4XDGA 3VTFA 5I8WA 3BMXA 1N78A 4D9BA 3EXIA 3ZBQA 3IC5A 3UV6A 1TQ4A 3TWLA 2CVHA 1XKQA 3ILSA 3NANA 1J0XO 2J9RA 4JP2A 3WXBA 5AFSA 5JIBA 1MGPA 3PEFA 5FCDA 1GTSA 3VNVA 5EIBD 3VPHA 1SMKA 2ZKLA 1CNMA 4XASA 3VTKA 3DBRA 5DH9A 4A3VB 2BFAA 3BGVA 4GKJM 1TAQA 3UMFA 1Z39A 3T3EA 1RRCA 1DIAA 1CEQA 1GNPA 2GK4A 2RH9B 4FOSA 5JANA 1GL3A 5LQCA 4QBTA 4MP8A 4PAOA 4EZBA 3IILA 3FAZA 1A71A 1GA4A 1B2RA 2NXJA 1NMXA 4YT5A 2I22A 2D62A 3O3CA 4KR9A 4DV0B 3N2ZB 4LDAA 1B26A 4ZVUA 3RAPR 4GM0A 4UHDA 3RJTA 2PCLA 4ZOQI 2IXEA 1U9ZA 4HDQB 3K4HA 4B84A 4XVCA 3Q9LA 1SUCA 4JX8A 4V0SA 2K2QB 5MN6A 3ABOB 4DABA 2RI0A 3ONWA 3RVNA 5IM4F 4L2IA 3UB4A 2V1XA 3MWKA 2I65A 4IW3B 4RQAA 4Q1FA 1KSJA 1J06A 2VJYA 5HKLA 4G41A 1QG0A 4ZIRB 2AG6A 2J59A 3LYAA 1UC4B 1EK1A 3KZNA 1VJ0A 4KK4A 4KLRA 4CQLB 4IQ0A 5JISA 5L40A 1SZJG 2P7HA 3QXGA 5KWSA 2R4UA 3N05A 3VPGA 5CT5A 2AHOA 5CCDA 2VDBB 5D3QA 4EM6A 5LMUB 2PUEA 1S7CA 1N8TA 1BZYA 1UXOA 3C9PA 2IY8A 3NWPA 2OQIA 1W85B 1N34M 1A04A 4X7BA 2VTKA 5TQJA 2X4DA 2WOJA 3VSAA 2OV6A 4M8IA 2HUPA 3A4YA 3GYGA 3K15A 2PKYX 1V1MB 1TCBA 1P6UA 5JYBA 2ZJ7A 3VPCA 1ZCZA 1TDJA 5FORA 1W73A 1SBIA 1KI7A 3BSFA 3GLGB 1IK4A 2C97A 3NDPA 1BGVA 3LF1A 3OCWA 2XOKD 4IRXA 3ZUGA 1J2RA 4CR8A 4DFDA 2D8AA 2O7VA 3KL2A 1HZZA 1WJ7A 2ACEA 5JSZA 1XCMA 5KSOA 1O9HA 2C2OA 3VKGA 1OH5A 2P9YA 4C06A 1B8VA 4MA0A 2R62A 4LE0A 2PUJA 4RL4A 3T5PA 1H0SA 2OGSA 4NZYA 3UHOA 1YD7A 1DBIA 1TI7A 2WPNA 4WKPA 5KTRA 3EDOA 2V45A 3WLAA 1QQ6A 3N2IA 1E92A 4YJ3A 1A8UA 1KI9A 1PNVA 1F5NA 1N9KA 2G7MC 3FDJA 3HM2A 3PX2A 4OMDA 4V0NA 4ZPJA 3TFQA 5JO9A 3ZWVA 3V4SA 3IURA 3ZBPA 4LZAA 5JY6A 3EMVA 5PNTA 3CTWB 2NSDA 2VZ0A 3SHFA 3EMKA 1FSSA 3WDKA 1E1DA 4MUJA 1Y89A 1R4MB 2ONKA 5CA0A 4M76B 2VCEA 2WIDA 3W5DA 4K05A 1NR7A 2LBCA 3ICCA 5JYEA 4GZLA 4YBZA 2PX5A 3D02A 1JVBA 1Y98A 1KSHA 4R8LA 4UVHA 1Y3DE 1RCTE 1VHLA 5A05A 2MGWA 4FFPA 4FOTA 4URVR 2R0QC 1A5BB 3RRMA 1I1NA 2YY7A 2B94A 4KNWA 4BMNA 5ITUA 4JJEA 5IT5A 1H2EA 2H5EA 4JN6B 5AKGA 3HBFA 2XT9A 3T6PA 2NQTA 4EY8A 2AD1A 2HHJA 5JFOA 3GRCA 2NTYC 2LVPC 1MN6A 1CVIA 3H0EA 4HN2A 1FY2A 3I2JA 2JXNA 1QF9A 1GABA 4OKSA 3MLEA 4RENA 2FLWA 2O57A 3KVWA 5F3WB 3LHFA 3JARA 1GQ2A 5GV8A 3LQ1A 1RLJA 1PFYA 3HKCB 4U5XA 3DXZA 2C84A 1LBIA 4NZZA 4TMZA 3OX3A 2J8ZA 1MB2A 5CHEA 4D4JA 4MAMA 1RXWA 1DO0A 1TT7A 1KBOA 1QNLA 2FF5A 4Q3KA 5EN4A 1KORA 1ZO8A 3RRJA 5THKA 4BNWA 3SSAA 5CX1A 1MIHA 1DKNA 4BVBA 2WUWE 1M2KA 3EZ7A 4QOJA 2H5JA 4PZEA 2GDZA 3GRUA 1L5ZA 3O8NA 4R05A 1RRKA 1PGQA 6AT1A 1ZA1A 5EUMA 4DA0A 1E1NA 2TECE 3W4KA 4ZQFA 1YRAA 1PP4A 2EATA 3IOMA 2I3GA 5BN3B 5I9LA 4E5PA 2W2LD 4UUPA 4Q7JA 1UFKA 3IXMA 4BQEA 2G5PA 1ZHOA 4GX0A 2RMKA 1K89A 1KZ7B 3EJWA 4FFRA 4Q3DA 3H4JA 1WXIA 3QTBA 4X0EA 1ZONA 5F12A 3ZIUA 1KVQA 4V1CI 1DG3A 4RS4A 1CJBA 3GVCA 2G88A 5KU1A 5E9WA 1VLVA 5CW1A 4I50B 1XXLA 3LBIA 1TO6A 3AY6A 3NONA 5CLFA 4JNKA 4RD3A 5ANRB 4F93B 3O5AA 1ZUIA 2ESRA 3AR9A 4TL7A 3I9MA 4N8DA 2IE0A 5D7NA 5A9RA 1DT3A 1J23A 1ZD5A 2FEAA 4ZEMA 3IO3A 2OO5A 1TM2A 1P2VA 1JQ3A 4IIDA 5DASA 1AXRA 4AZ0B 2O9JA 1E3WA 1V2GA 1Z73A 4DR3M 3BJIC 5FTNA 3CE9A 1ZGAA 3OPYI 5DTQA 6ABPA 3JZIA 2LNDA 1JA1A 1Y9AA 1PD1A 1BROA 2YIMA 1WGNA 2QRHA 1A9PA 3GVIA 3WB2A 3QSYA 3AEZA 3HHYA 1I36A 3GG2A 2GZRA 2GZ3A 2ZVJA 1YS7A 2ODTX 5G2OA 4J1NA 3VR0A 5KNDH 4EENA 3ZHBA 1CUDA 1CX9B 5K7SA 3ACDA 2WNHA 4M0CA 3PE6A 2D00A 3PZBA 1RAAA 2I33A 2QZZA 2WSLA 3GJQA 5GONA 5J2TF 2HJGA 5FAXA 5J43A 3S40A 2NNWB 3DC2A 1PNOA 1QHNA 5JNWA 3ZDRA 2V7EA 4QHYA 5DCUA 4YMLA 4B3TM 4TMFA 4HYTA 4ZI5A 4J0GA 3RDPA 4H9GA 4GR9A 3TEFA 1I7DA 5EJ6A 3IR5A 2C00A 3RV4A 4N9QA 1W0JD 1C1DB 2I4NA 3NXSA 3OQMA 1TJ5A 1VM6A 3ZX4A 3ZQJA 5KX5B 2X7HA 4S1OA 1YCHA 4QPJC 1GO5A 1WPRA 3WNVA 1XXHB 2O7NA 3Q2IA 3BZBA 5LB4A 1LQ2A 3N07A 1TF2A 3GEHA 3FSEA 3PVSA 2R6GA 3BJMA 3HY3A 4FOLA 5CLGA 3ILKA 3LCUA 2ZI6A 5EG5A 5CX1B 3LGXA 5CLQA 3SSMA 3TLXA 1GR1A 4Q24A 5JZVA 2D59A 4G5XA 2RCYA 2TS1A 3E48A 3JALA 4R8KA 4BO1A 2J87A 3MJ4A 4E09A 2HOQA 2HV8A 4A82A 1BHQ1 4HV4A 4BTVA 4DDUA 2JCVA 1JAYA 1XNGA 5EJIA 1XNQB 3VM6A 3FZNA 1P1IA 3HZHA 3MIIA 4G5OA 3P0RA 2WKRA 3EEBA 1ORVA 3ZV5A 1ICIA 4OGFA 2YR0A 1FYFA 1ZJYA 2CNBA 3N0XA 3GNSA 4GSKA 4NF2A 5LMNB 1WBDA 2IU6A 4J7AA 2ZP1A 4Q9IA 2YJGA 1YZQA 4GHAA 1LPSA 4NV3A 4Y2QA 1XTBA 2QRPA 4I55F 1UC8A 1ONPA 4MW0A 1I9GA 4DRXA 5LDDC 4MAFA 1O4WA 4YAJA 2QYSA 1THGA 3KXEC 3TQQA 1EIZA 1XJCA 1RQRA 2IYRA 4B6PA 3FNIA 4LJ9A 3CBQA 3Q5EA 6PFKA 1LSSA 2LVOC 1N1GA 2RAVA 4NOOB 2XUQA 3ENKA 4UCXA 3MIZA 1GZ6A 3EHDA 4GPIB 3BXOA 4B6OA 1EHIA 5J2UB 2JF0A 4D4MA 2XYGA 1LPBB 1ZGHA 1PGOA 3BJEA 3LVBA 4DB2A 5HJ2A 4S1PA 1OUMA 2YXLA 4BATA 4ZYZA 4DR6B 4C30A 3QHQA 4W1PA 1NQOA 1PQYA 1E1KA 2GARA 1JSCA 2CFTA 3KPUA 1EXNA 1GGJA 4TQUS 1WKVA 2HF2A 4LJSA 2D4AA 4B0PA 5L51A 4AULA 2GEKA 2NV2B 4R0VA 1ID8A 4JBHA 3OFVA 2FEWB 3U9TA 3QUBA 3L1JA 3AHCA 3BKXA 2OUIA 4HATA 1B43A 4Y2RA 1ISHA 3GMDA 4KW7A 4LG2A 3PGLA 2YOHA 4OK5A 1E6EA 1U8AA 3GRKA 4JENA 1XMIA 4N54A 3EC2A 2R6DA 3GJ8A 2D1QA 1EFHA 1PRYA 2GEUA 4KPGA 1TEVA 4FGKA 1S3SA 2HTFA 2ZCUA 2JHGA 4N3GA 3B52X 1ONNA 4UNIA 4CE6A 4YC7A 2PMBA 3K0SA 4FD2A 2DXIA 1NW5A 2OXEA 4GRDA 1C8VB 5AXAA 3CZ9A 2JASA 2VS1A 4ZXFA 3Q3HA 3RNOA 1L1FA 1RS0A 1OJLA 1D2HA 4TSFA 2QP4A 2BHTA 4K46A 1PG2A 1P45A 1F1BA 4ARZA 1P7VA 4WACA 1I8TA 4JBIA 1ZR4A 4IX9A 1W88A 3KOXA 4KJZA 3PXGA 4MW6A 2LVBA 2GZMA 2RDMA 2VRCA 3E27A 3OECA 4IILA 3LL4A 3C7TA 3BF7A 5IK2D 4ISBA 1C7RA 1VJ1A 3DYBA 5I9SA 4CIYA 1JR2A 2JIMA 2XB6A 5LZ7A 5BXYA 4XE5A 4IBKA 3GCWA 1HDZA 1Z4NA 4W1SA 4OBWA 5EIWA 1JILA 3EXFB 4X60A 3H16A 3WB9A 1UMDB 2W90A 4JQYA 1HE1C 3EH2A 4FSDA 1WABA 3PC7A 3VOBA 5LWQA 2BGTA 4I50F 4EUSA 4H6PA 4P4LA 5J9FA 2AN5A 4B7ZA 1PV4A 4Y2HA 2CLOB 4G36A 5CH8A 1ZN8A 1L4FA 4FCVA 4ZU3A 2J3KA 3WGGA 3EXAA 1JR3E 1UBHS 1OT3A 3MTAA 5FO0A 5FTJA 4H3KB 4BJHB 5JUWA 1QH8B 1T5OA 2Q1TA 3VBCA 4XYLA 5A5VA 4LFBB 2QUHA 2F62A 4RA6B 4BAZA 3ZD7A 3B74A 3COPA 3TCKA 2NXCA 2CVFA 3SKXA 4OH7A 1KY4A 2WZCA 2PT6A 4NRVA 4PCAA 5CPBA 3TZKA 4DMLA 1OLOA 4TS1A 5LYYA 3RHSA 2NO0A 2COKA 3F7NA 3MWDA 4YRMA 2R44A 4PYLA 4AK9A 1TCUA 1DQZA 3D43A 5BNZA 1DIBA 2RKOA 2GJ4A 2HQOA 2WYHA 4MKGA 2FPSA 2I3ZA 4PSDA 2F3TA 1L9KA 4QODA 3DBRB 4XX1A 3S29A 5LR6A 4POOA 3AY3A 3DXXA 2I3BA 4NE2A 1U8XX 3VPXA 4FMBB 2EOAA 3F96A 3PTAA 4GC5A 4DJDC 3QKIA 1EUYA 3EVGA 2FFJA 3IAM1 4F5WA 2E4ZA 2KDLA 1R27A 1JJFA 2CD7A 1Z8NA 4L0QA 4OLJA 2OQVA 3KT6A 4RTMA 2A5DA 2ZBRA 1YUMA 3L01A 3MWJA 3LT1A 1FPQA 1STOA 3PUZA 4DSUA 1DIGA 4KWIA 3T5MA 5JAZA 4X62B 2CLMB 1T6YA 4WXYB 5FUWA 1H42A 2Q9AA 2ZTLA 4U7PB 3MJ5A 1QV9A 2F1RA 3LKZA 4CCAA 2G5TA 3VHXB 4YXWD 1SQ5A 3OPXA 2IDJA 3VSDA 4F9EA 1CY6A 2B20A 4KIUA 4WNIA 2GBIA 5K6RA 3LUGA 3SF8A 1X94A 4QO7A 3ZU2A 3L6BA 1E9AA 3ZY2A 1H2WA 2YHIB 1P1JA 4NDAA 3JTEA 1GPJA 4RHCA 1LBSA 1SVIA 2C7VA 1NVKA 4JGBA 4C4ZA 1H4QA 4YRQA 3HN2A 1BC5A 2D2VA 3FMPB 3VBEA 3CT6A 3P2EA 1KQFA 3KSZO 1SKQA 3NS7A 1GGNA 1P2DA 3WLSA 3R9KA 1MH1A 4RTSA 1I4TD 2PMWB 5AXDA 1M0SA 4H15A 1D9XA 1DBRA 1LLUA 3KD3A 1JECA 4HDKB 4DR1B 2ZYIA 4J9VA 4N5LA 1YULA 2RGNC 1A4IA 2PTHA 3THGA 1MUUA 3NGMA 4H7EA 5JWOA 1V3QE 1UAAA 2BKUA 2FZ4A 5BOVA 1SIBE 1D04A 1QORA 2XQJA 2Q7DA 2X5NA 3WWDA 3ZJTA 3A45A 1GLVA 2PTGA 1P4JA 5K09A 4GWKA 2ZJ1A 3L46A 3D2LA 1AGRA 4N6OA 1CUFA 4R2JA 4RPHA 3BH7A 1U81A 5IM4A 1AV6A 3RF7A 3ILXA 3M83A 4PG5A 4QXPA 3MJSA 3D2AA 2ON6A 3BCSA 3P1JA 5JPIA 3B1VA 1UOQA 2AFVA 4NZOA 4G8BA 4BNJA 1H6DA 1D09A 1UXHA 3LDAA 1KSGA 2VP6A 3AEXA 4E51A 5EWJA 3U2QA 3H11A 1WTAA 1K6IA 2QSUA 3NNNA 2AJBA 5SZKB 2FQXA 2DHDA 2P0EA 1OC4A 4LQLA 5K01A 5BQPA 4XYGA 1C0KA 1DOHA 3MJVA 3LBYA 3T7TA 3AI7A 3TLJA 1J1UA 2F5SA 3Q7SA 5HP4A 2WG0A 3QX7A 4OKIA 3HJCA 2UYHA 4HBGA 2NTEA 4NH4A 4O25A 2QUZA 1QTQA 2P3SA 3LWZA 4FWDA 2OZLA 5C7OO 5K9ZA 1KVRA 1T15A 1DCFA 3SX2A 1CHDA 1WR8A 4KODA 4RA6A 4X91A 4F06A 1DIRA 1HM5A 1FJGM 2D0IA 4IDOA 3G2HA 2PWAA 3BMCA 1TT5A 2ZPTX 2C8LA 4PRYA 4B32A 4F1JA 1R6VA 2EF1A 2EFJA 3OICA 4MXDA 4PQEA 3TD2A 1BWQA 5EJ7A 1V47A 3GBVA 4IHJA 2NUTB 1DMRA 5ILGA 4GI7A 1XYVA 1I6LA 4O8CA 4UTXA 2PDAA 1E6MA 4XGQA 1KKMA 4IIUA 2H5XA 4HGYA 2J46A 3C6YA 1RQ7A 4A2CA 3G2KA 1IDOA 4D5GA 1JHQA 1SUEA 3QLVC 3U62A 4K28A 4ZWNA 1Z0JA 2IUTA 5C5IA 5L8VA 4CISA 3I39X 1ISIA 2PRKA 3IVCA 4U6QA 4AU1A 2PLFA 4D3FA 2JIZA 1J6UA 1WNTA 4MCIA 1UBMS 1CUYA 1QHGA 1J8VA 2EV9A 1JXAA 3D59A 1PJZA 4UQPA 4WLVA 1MLDA 2OGWA 2PT7A 3ZHYA 2OHGA 5C81A 3CISA 2JBWA 1KOFA 3NHUA 4D97A 3TFOA 3LVVA 1VCOA 2HC9A 4OHWA 4ID9A 2H1RA 2AS0A 1XNJA 1RMTA 1J8FA 4TWIA 5FXMA 4Q15A 2XRMA 2HWJA 1E3JA 1Z62A 2P9ZA 1J8YF 1R0BA 1U28C 3UKDA 4D44A 1YRYE 2BWEA 1T3TA 1W4CA 3D4IA 4KR6A 1E6LA 2H07A 4HVLA 3AUJB 2YL2A 5ECYA 3EQ2A 1ZMBA 4MKIA 1NN0A 3EQZA 3TR0A 1II0A 2IA5A 1LLFA 3B20A 3WNCA 3ZLBA 3FDZA 4WOJA 4C0HA 2IPAB 3AKZA 3D6MA 5AIAA 3RS7A 4PZLA 2Y1CA 4C4AA 2QRVB 5C80A 4WXHA 1G3UA 1SEPA 2FI1A 2H2DA 5CFRA 2O0JA 3PEUA 3Q3JB 4X9XA 4DIFA 1V9LA 1N2HA 2CXRA 2EFGA 2EQ5A 3ZW7A 4EUKA 3I1IA 4HMQA 4L8FA 1NNUC 3VR5H 5IM5A 5JU6A 1WXEA 2Q3FA 1O96B 4D99A 1NSFA 5JNTA 1OZHA 1A88A 3WMRA 3RAGA 1DC4A 5K8UA 2UDPA 1F17A 1G4HA 4GIBA 3GFPA 1C1XA 4MOWA 1AK1A 1GJRA 2I6QA 4QDXA 4ZPXA 4K6HA 5E0OA 5AI9A 1H2XA 2I1QA 1AUAA 3FE3A 3PEVA 2GPYA 2PX8A 3PUHA 2QZ9A 3SDZA 1GNRA 4UBOA 4C2BA 2I6XA 2LH0A 4G6ZA 4HQLA 4IG9A 1BXRA 1ZM9A 1OIWA 2GD6A 1GUBA 3FPEA 4G0MA 3E0QA 3MWYW 4G0WA 1I0IA 1QOQB 2OXFA 4RKYA 5KBYA 1R5JA 2HN9A 3W4JA 3RJZA 3BMQA 4J16C 2CLFB 3OTOM 1MABB 2X5OA 4A7PA 2PL9A 3PXCX 3HJRA 3NGLA 4JA0A 5CNJA 3VH3A 4EGQA 3O4JA 1S1MA 4NOLA 4P1ZA 4RUKA 5DEOA 1HFJA 5FOXA 1VSQA 2EO2A 1CZKA 1SKYB 4LHWA 4UU8A 4IQ8A 3TIFA 3NCHA 1NKVA 1YIOA 4QHTA 4PCUA 4TTIA 3V3TA 5FI3A 4KIJA 2PX3A 2OESA 1NQXA 2EW8A 2K5UA 3SXPA 1J97A 4N5DA 1VOTA 5IDXA 1P2FA 1PEDA 3TVYA 1PVDA 3ADOA 4M0KA 2IWHA 3V4FA 2BLLA 1N3BA 2XWQA 2GYWA 2OCXA 1XMXA 3TSOA 3WGIA 2XVAA 4RM2A 5AKXA 3PR2B 3PUYA 2XMCA 4Z4GA 3B1XA 3R7LA 1RD4A 2WBLC 3CR3C 4IMRA 4IOKA 5J2UF 1UFZA 4P16A 2BKLA 1T8UA 4WNAA 4IBJA 3KE9A 3PNLA 4KR0A 1VTKA 1YGYA 5BNWA 3U6MA 4QUEA 1U2EA 2QRGA 1YRHA 5ALTA 4QEDA 3VR6H 3P96A 4DLBA 4ESHA 3OFJA 2HFKA 3T1YM 4B3XA 3WK4A 1J07A 1J70A 3ETNA 1XPRA 2AZTA 4E2WA 5E3HA 1OXKB 3GGJA 4XLZA 3WL7A 3R4CA 3FRHA 4J43A 2O23A 2Z43A 4QDKA 3V2IA 5KQLA 4UCQA 1QHFA 2NO6A 2CB9A 1F1JA 1M6WA 5GJCA 5TQ0A 5DHUA 3EA4A 3TR6A 1K4KA 1MV8A 2OBXA 1NVXQ 1UPBA 5IBRA 3A9WA 3KYDB 4QRIA 1TIBA 4IY1A 4RXMA 5D00A 2GXUA 2J5QA 2RGYA 4R8RA 4BNFA 4FX2A 2C83A 3LDUA 2GKGA 3EY4A 2Y3IA 4JV5B 1H6UA 1WG8A 3H9GA 2XEPA 3OY2A 3KXPA 4FYMA 4LV5B 1Y6FA 4J1SA 1T6BY 2O1XA 3CVUA 1GYRA 3ORQA 4MLDA 4DIDA 3G5LA 4GBGA 1T0HB 4GX5A 1R2QA 2P9QA 4G1FA 4HDNB 1C7ZA 1F6WA 1DT5A 3LQ2A 4Q1AA 4BGEA 3TRDA 1AF7A 1U4OA 1P0IA 1VZ3A 1W76A 1EP9A 3I0NA 5F23A 1NOKA 2R84A 3T5CA 1OA1A 1DEKA 1XP8A 3VH1A 4AX4A 2UVPB 1XVUA 5LXTF 4YAUA 3D7KA 3HC7A 4C7KA 4BL5A 2I1LA 4AQ7A 4LXQA 1QH0A 3R41A 1C30A 1NMZA 4FYWA 2P5SA 4UQLA 5JC8A 5E4TA 1UBLS 2AE2A 2REOA 3OJEA 3P2IA 4DDWA 4YRNA 3AVVA 4RWZA 4QSHA 3PD0A 2N35A 3L05A 4J1TA 4PCZA 2Q9CA 1D2NA 1M74A 4W82A 3H7AA 1MTOA 4JLKA 1FP4B 2PGNA 2WSIA 3PKJA 3UMGA 5NULA 4YHHB 2GZ2A 2CNNA 2HU7A 2Q50A 1KE2A 3B7ZA 4IOLA 3GEBA 1JHXA 3C87A 1FFHA 3GROA 5TT1A 2PZEA 4P98A 4DNXA 2VZ9A 3ZH9B 4PIPA 5IK2A 1KEPA 2G1JA 3UO8B 4PAWA 1XBTA 1GQYA 2BR4A 3E9QA 3TGLA 2AJTA 4LAFA 1IAVA 2XTMA 4ODIA 1TU3A 4OI4A 4D45A 2UUCM 2Q7OE 2K7FA 1HX7A 4IJ5A 3W3AH 4FWTA 4AN1A 3D7LA 4RAQA 1OT5A 2B82A 3BAFA 5LU8A 4ZAFA 4GNKA 1DLIA 2VZEA 3ZDAA 1YZVA 1XI2A 3PC8C 3KSAC 2B78A 3KFXA 4F45A 3V2GA 5I5EA 2B4TO 2EBUA 3VYWA 4ZVNA 1TA0A 4XDYA 2OA0A 1MA0A 2Q27A 4HPXB 4YECA 3ZDYB 4A91A 1KQGA 1M34E 2J67A 3VV3A 3B8HA 5AUQA 2FPUA 3ZZNA 4X64M 1U28A 3W5JA 1YBAA 2J7PA 3SAWA 1MOQA 1JF8A 4MS3B 3LBHA 4ZAVA 3ZTTA 1ZKMA 4DARA 1YTLA 2RIPA 1RM5A 2MSCB 1Y34E 2Q0QA 3K6KA 3L8FA 4J91A 4W5HA 4BRSA 4C08A 2IPMA 5AI0A 5A02A 2I2DA 1E3QA 4RESA 2VA8A 4HF7A 1A7AA 2W6CX 1K7XB 2P5YA 2QR3A 3EGOA 3JYPA 4UHJA 1YDEA 5AQEA 2E5WA 5EGNA 2DAEA 2VJMA 4RHXA 4EJ0A 3AEQB 1XPJA 3Q2OA 3VKFA 3GDOA 5F7XA 4MARA 2O50A 3KZXA 2VOJA 4G1VA 3FWPA 3ZXUB 1ZOOA 2G07A 3G13A 3RVKA 5CA0F 1V33A 2Y0BA 1Z7BA 1GL6A 3MS4A 4G1UC 1BTOA 4JLPA 4ZT7A 4ZDKA 5M2QA 3EPHA 4CCYA 4MB7A 1GKYA 2VP0A 2WEKA 4RYLA 4E94A 5HKKA 3O4FA 4C29A 4OMCA 1QJCA 1E61A 1F4PA 3KVYA 4KAAA 5FBZA 3WL3A 1W2HA 2Z2JA 4AYWA 3C43A 3E58A 4BNDA 4QBIA 1IN7A 2RHWA 2VDLB 4UTZA 5B53A 4IV5A 2CRUA 1N2JA 3ZEIA 5DFAA 1Z25A 5CFMA 5T5QA 2IEDA 3BQMB 4JI3B 3T1QA 2I7VA 3CR8A 1JIXA 1O97D 1CS0A 2EKBA 5C0OE 1K75A 2RK6A 2G09A 1QTRA 3DEAA 1UJ6A 2IEGA 5AM2A 4PVCA 4B3HA 1SC4A 4JMPA 1VPEA 1Z06A 3UT5B 2ZB2A 4BN4A 1Q95A 4RTPA 3S68A 4FYIA 3J81S 2LR0A 1GARA 2IQ5A 3GR6A 4J8PA 2PMCA 3RSHA 4XR4A 3V34A 1SQ0A 2E89A 1RAGA 2B30A 1KZ6A 3A9TA 3V8BA 4DJFC 3OCXA 5JAHA 2Q5EA 4KNYA 2IYZA 2XJ4A 3ZCSA 4NFSA 1QR6A 1W4ZA 4QJ3A 4CM7A 4KR3A 1BD3A 3BJRA 2XFSA 3M5DA 3SGLA 2VK4A 4HL6A 5I7HA 4F3TA 2H7XA 3B9BA 4YAEA 3AVUA 2JFVA 1GDTA 4TKMA 1AT1A 3O8QA 4ARSA 2DZOB 2DHCA 4DDTA 2YWDA 1T4CA 1YS9A 3KKMA 3O8LA 5KI6A 4D25A 1FDVA 4HVCA 2OK8A 3RIEA 2GF2A 2PK3A 5DHRA 2HLPA 1IJFA 2IU0A 5CXSA 3ZNQA 3SHGB 1XL0A 1ZNYA 1BN6A 3RTAA 4AJKA 2J6HA 1DXQA 4C21A 5DNAA 1LDBA 1XC8A 1XWFA 2R66A 3ANNA 1RWNA 2PR7A 3A25A 1BYUA 3LJKA 4Z9AA 5SZIA 1BS9A 1D1TA 3ENZA 3VR4A 3LLSA 4QEZA 4GOJA 3EBLA 3PGA1 3UKJA 3ZWQA 4AURA 2B1QA 3KU1A 1PKEA 2XUFA 1TMGE 4QGFA 2BYTA 1WHSB 2GTIA 5ELLA 3HP7A 1XMPA 3EVAA 3O3NB 1OASA 1AN0A 3IQDB 3TGWA 2P9BA 2PL3A 2PSSA 3LDFA 4ETIA 1ZSYA 2VLBA 2IBSA 4TT3D 1GFZA 3FWZA 4E22A 3WB0A 1GRCA 1QMGA 4MYUA 3IG5A 2QM3A 5JS8A 4OK3A 3ZU3A 2HTEA 3EBPA 3I2IA 3HKEB 3EZLA 1ZRSA 2XV1A 1PJTA 3KKZA 3O03A 3O2JA 1YQXA 2CJWA 2V6IA 1WXHA 8AT1A 1ECJA 1KF0A 3JASA 1CC1S 1G21A 1H85A 1UKYA 3AFMA 3S2GA 1PR2A 1CUXA 5JHHB 5LQRA 3NPMA 3C1UA 3PDWA 3ILHA 2A1IA 1N1DA 4TKVB 5DHTA 2BAGA 4QXRA 4BNDB 2E0IA 5BUZA 2CNOA 4R4JA 1RLMA 4YB8A 3N7UA 3A7DA 3R0ZA 2PX4A 2QTLA 4CMEC 2HCBA 2Z2YA 2AMJA 3I3SR 1R0RE 4HH0A 4AP9A 2A86A 3WDLA 5SYNA 4ND1A 4EY4A 4LFCM 3K94A 5LQAA 1WMDA 3DOFA 5LC1A 1WA5A 2FX3A 2GEFA 3UQYS 1RPJA 4E1AA 4OEHA 3H5LA 4KMOA 3CWZA 3BULA 1UOPA 3PI6A 4IOJA 1XSEA 4WLUA 3EEOA 3AJ8A 4IIHA 1ZXXA 3DAOA 1CQXA 2NO4A 3NIBA 2FPGA 3OEHD 1JPJA 3TZCA 2VHZA 1L7PA 3C4JA 1PR6A 5JG7A 5JLAA 1DKUA 4O1HA 2N75A 2PU7A 3UUFA 4CL0A 4DWWA 4J76A 2M6KA 4CVNA 4M9ZA 3HX3A 4AO8A 2MJLA 3PL5A 4B7FA 1YFKA 4JLVA 1Q7EA 1X2EA 2IU3A 4FKZA 2OBMA 1MZVA 3B9QA 1NNEA 4M8LA 5JNUA 3IJ5A 1WP4A 2WJYA 2DHQA 4XVRA 2DLCX 3P4XA 3I5UA 2L2DA 3DZDA 1T8TA 4C0SA 3CX7A 3SX4A 2DBRA 2OHOA 2VYVD 2H2HA 2BJHA 2PGLA 1JSLA 4A1FA 3K9CA 5E6UB 1H3FA 4BBAA 4X7PA 2GNOA 3DZBA 1XMOM 1ISFA 4X6XA 4NCJA 2EWMA 4Z5XA 4C2TA 4Q7LA 2AVDA 2B61A 2AD5A 2EIXA 2D13A 4M87A 1W1IA 5H3HA 1KEZA 2UXCM 5IC6A 2X0FA 1N5JA 4YQEA 1MO2A 2F9MA 1FRZA 3ZY5A 3B2NA 4YV0A 4YNBA 2ZK7A 2ID9A 4M86A 4L6IA 1Q0RA 3A1NA 2W83A 1AGPA 3NHKA 3HJFA 1BMFD 1E2QA 1ZLXA 3BWVA 1GN9A 2PUAA 3RS5A 2EARA 1GCIA 4TTVA 4CF4A 1X3LA 5TGTA 4MJLA 1UPUA 2O20A 2W2XA 4JI7M 2XVMA 3FPBA 4FIZA 1HJPA 3LNTA 1ATIA 2FZGA 3WY9A 1B0PA 4NS4A 5AVSA 3L8CA 4GQBA 2P4SA 1OI2A 2BUAA 2C5FA 2ZIXB 3CWCA 1RZRA 2AUTA 4AF8A 5AESA 2R6R1 1BGWA 2V6MA 5HOQA 3QVMA 1JB1A 4LIPD 1ISJA 2QS9A 3ZWKA 4AMGA 1EJ6A 1TJ4A 2V7TA 3P2OA 4X66M 3GJRA 4G8DA 1JIQA 4EO9A 3ERCA 1UK9A 1NC1A 3JQCA 3MPOA 3BWCA 1U7WA 3EFBA 3D0RA 4Y6RA 3TRJA 3UCXA 1FLNA 2XRFA 7ADHA 3D9QX 4Q7KA 4GPTA 4FP9A 2IEZA 3C58A 4JIGA 4NPAA 4XYEA 3SHOA 3TJZA 5C8XA 4EMUA 1SO8A 3JQDA 1DFGA 4FHEA 3U4CA 2HPZA 1QRUA 4KACA 3AI1A 3B2EA 3HZRA 4QJ4A 2O2YA 4YCSA 5HG0A 3FUWA 4CLRB 4M1KA 2PX6A 2ICAA 3Q11A 3W1VA 1QAOA 4Y67A 3KWLA 2CK3D 3U48A 3SQWA 3B5IA 4RY0A 4X63A 1DX6A 1ST3A 4XB1A 4KOEC 2WUEA 4XGNA 5ALSA 4XJTA 1DJNA 1D2EA 3AUSA 1HUQA 3HCCA 3OZRA 4F0JA 3LPCA 2V74B 5JPDA 5FI0B 1SUPA 1EBUA 3FIJA 4CM1A 3BXPA 3WL5A 3SR4A 3C6BA 5T4HA 1UT5A 2J5RA 4YHHM 5FBKA 3SC2B 2YW2A 2BWBA 3I9V6 5K05A 3GJSA 3M1YA 3H2SA 1MD9A 3I92A 1OAOA 4MW5A 5IN5A 2XJ9A 1ZESA 1Z7WA 2ID4A 2ZJ8A 1DX4A 2OMEA 1LNQA 1MG0A 1EFRD 3CLVA 3JRWA 3ZDFA 4D4HA 1VHTA 1V7ZA 3J80A 4DBZA 5LXTB 2P9HA 4ZV9A 4DVJA 3WLPA 1F2DA 4JGGA 4I6GA 4WL0A 3SZMA 3L26A 1DEXA 1KFKB 4GS5A 5FPKA 5JYDA 2QNBA 5AW0A 5E9AA 1JJBA 4U2CA 1IBKM 2ZS9A 3ULKA 1XQWA 3I09A 3IMKA 1G59A 1DGHA 5FJJA 4E11A 1UXJA 1E4EB 1S9HA 3SFTA 3E5RA 1PW7A 4KGZA 1KEEB 3FPCA 5AO9A 1H6BA 3U7RA 4KR7A 2G76A 1OKKA 4LSWA 5F1OA 1Y3AA 3VO1A 4BE7B 2VJLA 1X80B 2DUJA 4IQ4A 4DQUA 3STXA 4LJ7A 1XMQB 4G9EA 1MW8X 3LG2A 3P5SA 4MR9A 1VE1A 5BQ5A 5J2UA 2OCLA 4CQMD 1W0KA 3QBVA 1MPTA 1AHNA 3W5CA 1EX9A 4N41A 2NVUA 3M4ZA 3UUGA 1NJGA 4KQKA 4QPCA 4CEJB 3A4TA 5A6SA 4C6HA 2R6FA 3GO8A 3K6JA 4IYJA 1BDIA 5A6SB 1G3QA 4P2GA 4NU8X 2ZBKB 9ATCA 4BGVA 4Q4LA 4GP9A 2Z4RA 1GZ7A 1TYDE 2WA2A 1YB7A 2YDXA 4HAVA 3ZV7A 2HBQA 1FYEA 2P9EA 3M9WA 4PSCA 1J00A 4ZRDA 5E9JA 4D8VA 3U6BA 4LE2A 4OBXA 4R41A 3L7IA 2JHCA 4KE7A 1Y9JA 1FXWA 1CUGA 1NP7A 1FVFA 2HA4A 5D5HA 1V5GA 1YQEA 2OCIA 3SBDA 5EXSA 4HSEA 1HLPA 4EFKA 3RGPA 4QD3A 2Y77A 3VZBA 5CYPA 1Q2UA 2CV2A 1GZHB 2VPTA 1QIJA 4CRWB 3THYB 1RWOA 1V6AA 1VKZA 2ZSKA 5G4KB 3AB7A 2J6CA 1USWA 4JOQA 3B13B 4J0CA 3RLFA 3JQRA 4WZAA 2PIDA 5LA6A 3EFEA 1UBFA 4BQSA 3G8YA 1R2YA 2OFWA 1DWQA 1YB6A 2WU8A 2YOFA 1ZD2P 4F12A 2FRDC 3E9EA 4CV1A 5EUCA 4IUDS 2DJ5A 5I47A 3I51A 1R4ZA 3KAPA 2IF0A 3L92A 1KDYA 3WS7A 4WFKA 3OLVA 1IHDA 1JYFA 1NX9A 3MGBA 1J5EM 2ZZMA 1SNYA 3R3XA 4FYYA 3W05A 1Z82A 3HJHA 1QC5A 2AZ4A 1UPTA 3VPAA 1XJQA 1WTCA 1X1BA 2F5OA 2G9ZA 2QA5A 1Z2CA 2OAP1 4NOMA 4DEYA 3GH1A 4X1IB 2RHHA 4YT4A 3U6LA 1UPFA 5GGXA 5K8IA 4WSOA 4HGNA 4QYIB 3KQVA 3FSGD 2WK1A 3TXAA 3UA3A 4XQGA 2PE5A 5GONB 1NE7A 1M6NA 4QGHA 2DUMA 1A4RA 1IY0A 2P2NA 2R11A 3ZDDA 1Z37A 4BJ3A 3O6VA 4XIJA 4XM0A 4MB6A 1QZZA 2AEFA 4MWGA 1JZSA 5D3ZA 4ZCIA 4D56A 2MH8A 4NOKA 4KQGA 2GBCA 3BL6A 1VEKA 2H7CA 2I6FA 1VKNA 1WZEA 3QE0A 1QIKA 5IKOA 1ZMOA 4E4TA 5E7IA 2RD2A 3OZGA 3JZFA 4H4EA 1YJXA 5G0TA 1M83A 1ZCFA 3JQFA 4R3WA 3ZBUA 4RVUA 4MI9A 3ZGLA 5KB3A 4WFJA 3TX6A 4E4RA 2PVPA 3BCHA 3M3DA 1L8QA 1EBBA 1K5HA 4RZHA 5EMKA 3WIOA 4NYIR 4G4NA 2GUGA 2OORA 4KNVA 4M1MA 5MFPA 3R44A 4FD3A 1TRHA 4I50A 5TQ0B 2PZLA 3QENA 1PJAA 5AUPB 4JJGA 2B5VA 2VNSA 3AU9A 2QPTA 4GKKM 3MG9A 5F1PA 3HY4A 5HOEA 3ZU6A 1QRTA 4TSFD 2YY5A 2H92A 2DAMA 4UNNA 2FWAA 3MWLA 1EBFA 4AIRA 1RXYA 2WD9A 2YFHA 2F8TA 2O2GA 2XAUA 2Y1XA 3L6RA 2JEZA 4MGYR 1WS6A 2QJWA 2GXSA 5CVVA 5FLKA 4MYDA 1JLLB 4TPKA 3WXMA 4RF5A 3RAFC 5GKNA 4ZMBA 4ZOBA 2K4MA 1DJMA 1DEHA 4HQFA 1A8SA 3I45A 5L9AA 2YIVX 1MHTA 4MIEA 3QJYA 1ZKDA 4DEXA 1QJ4A 2GM9A 2WAAA 1J7KA 3L6CA 4IHKA 2WNIA 1V6SA 3FAKA 4UVDA 3LYLA 2W6IA 3G0IA 5AVKA 5JCZA 3B6ZA 1AQIA 3RS9A 1DAPA 1U7TA 3IJEB 1QX4A 1VSVA 1Y5LA 3RV3A 1VHQA 2ZB4A 4UTVA 2YXNA 1OXSC 1OX6A 3QEMB 1GTZA 4X3OA 1MJNA 2IYAA 4J0FA 4D9CA 1DIHA 2YNMD 2PGIA 4IDFA 2OENG 4WOCA 5F1YA 2HK6A 4E70A 3FM9A 3L0DA 1E66A 4M9XA 3DJFA 4ZOLB 5ICEA 3P0IA 2YRXA 3LBNA 1Y7IA 3RYCA 1CULC 1MPXA 3RSSA 1M7BA 1AY0A 1YBFA 4ILEA 5REQA 1W29A 2C4MA 4OM7A 3DBLA 3STYA 1M33A 1HT0A 4I55B 4P5DA 2FUCA 5CDYA 4LY9A 3QE4A 1RI4A 4PTYA 2NW6A 4TMWA 5DCWA 2C8KA 2EJTA 5ITQA 1AKYA 1ONBA 4RQBA 2ZCJA 1GA6A 4NG5A 4F85A 5KOHB 1Q3BA 3B1ZA 1Z5BA 1Y1PA 1I4EB 1UDBA 1ZBQA 2CDRA 2DQKA 1QHXA 5FLEX 4FMDF 2WY2D 1FX1A 1Q0SA 3OM1A 3V97A 4YCNA 3VI4B 5B30A 2CFSA 3RW9A 3OM8A 5GZ6A 4L5JA 3CUTA 4UEQA 5EHQA 2I2XB 4RJKA 4C03A 3ZHQA 2OFXA 2MIIA 3AFIA 4MS4A 2Y1LA 1ZJ5A 4H0CA 5CVTA 4YN3A 1E62A 2UUAB 1AS3A 4M4SA 4RSGA 1N77A 1CE8A 1XAHA 4WXMA 1HZZC 3QLUA 3BDAA 2CHFA 3VNSA 1Z38A 1KVUA 5BSRA 1SXJC 2R6ZA 3ORHA 1GAJA 3HVRA 3PIRA 4DR4M 2QPOA 3MK6A 1FMCA 2YX1A 3EXEA 3P94A 3DFFA 3G0BA 4MYRA 3SN6A 4E1VA 1M3SA 2CJXA 5BN4B 1RWVA 5ALFA 3QEBZ 1RTTA 1K6JA 2N1MA 1KS2A 2A5GA 2GSDA 2YVUA 3GI1A 1QLHA 3K9HA 3NDJA 1KYVA 4IO1A 4TXLA 5AXBA 4G1CA 3K1AA 3L0SA 1ZOSA 3UZUA 3LRXA 2GBFA 3O9VA 4KQ1A 3UB2A 3IHPA 2M32A 3DP9A 5FPTA 4P7FA 4BLSA 1SBTA 5EZ6B 2QI9C 3BE6A 1UDCA 5F5XA 3KEQA 1VGRA 2WUDA 4F3KA 5JSZB 2QD5A 2UUOA 3T38A 4ZEXA 4NK4A 1MG5A 3L7AA 2OOSA 4ZVOA 1INLA 3HG7A 2K9DA 3FMIA 1I2CA 4RIEA 3ZK9A 3IR7A 4C3UA 1A77A 5A3JA 4LPKA 2X1HA 3KSJA 5EJCA 1ZH6A 2MYTA 1UPCA 3M5WA 4KDRA 5FBHA 4BUCA 1WDKA 1MZPA 1KA9H 4G0OA 1S2NA 4RBNA 4KQCA 3KV1A 4CQNA 3KS9A 1ZK0A 3W1WA 2JCGA 3JX9A 2J30A 3G2PA 4LGCA 2C82A 1G5FA 1L4MA 1IPHA 2G40A 2HKJA 3LQQA 4A10A 7YASA 3JRXA 3HJGA 4R1QA 1AB5A 3BD7A 5LZ8A 1PD0A 5DNYB 4H1UA 3VX4A 5B58T 5EYPB 4DUYM 3ML1A 3ESBA 5EESA 3ZOZA 5JOQA 5FTKA 4N82A 4PRZA 4ZJPA 5CXXA 3SD7A 4LBWA 4LA4A 2ZCVA 1LRJA 3LQYA 3QX3A 4KO1S 1S7GA 5H1YA 5H83A 1XD8A 4CDGA 1WXXA 3HHWA 5F2KA 2VTVA 4Z4HA 4XEUA 2PG3A 2B8WA 1IQUA 1VE3A 2F90A 3AHFA 1J5EB 3SX0A 1NYRA 1T6XA 1WV0A 5CDHA 2VC2B 1E8NA 1NLMA 4BNTA 3TIIA 2X3YA 1YV9A 1JFTA 3ADKA 4P3PA 4W5NA 1YQGA 3GN2A 4PX5A 1D2GA 2ATVA 3AQIA 4E0BA 1Y0BA 5ERXA 5KAMA 4MULA 3DQZA 3VRHA 2CNDA 5I01A 2VQFM 2HSWA 3A4MA 3G85A 3N74A 3QYAA 5TS2A 3ZCXA 2FP4B 2BE7A 5B3AA 3WC4A 1ZI6A 1E0SA 3G9ZA 1VJGA 1HY3A 1N36M 2KW0A 1ZI8A 2BUBA 5K0JA 2J4CA 2W4QA 2Q5CA 3J7BA 4IF6A 2IV7A 4EG6A 1IQRA 1AGNA 4JFAA 3LVWA 2AJ8A 2PWBA 4G0QA 3FVRA 3L93A 3OFNA 4MVJP 5EE3A 1Z28A 3T1TA 1HNZB 3B3QA 3D5TA 4UZFA 3BM5A 1ZSVA 3KQNA 4IVQA 4YRBA 2HRBA 1OGJA 1GCGA 3CQ9A 4V03A 1JFVA 1IDN1 1Y8RB 4M99A 1WX1A 1G2IA 1XROA 1JR6A 1SG9A 5AVXA 1TF0B 1PDWA 1NJ1A 3DW3X 3ZE7A 1JG7A 2WHYA 5ALDA 3DFKA 3RQSA 1QYIA 3ZCVA 4TGLA 1R50A 2I9KA 1PK9A 3PYMA 1YOBA 3RGWS 2GLUA 3OQPA 3OT4A 3T61A 1CFZA 2EKKA 4IQFA 3NRJA 5AOAA 2PD4A 3IMFA 3V5NA 2JFUA 2Q4TA 4W9MC 4DG9A 4J0QA 3DA8A 2Z83A 4I4TB 2BMFA 2W9XA 2VTBA 4IAOA 1KJIA 3W06A 1ID1A 5HMMA 3HN6A 2F43B 3ZNOA 3J81A 5JZMA 1JDZA 1KHHA 1EA7A 3I1FA 4L4YA 4GXTA 3AV0A 4PLZA 3SVLA 2VBIA 4JI1M 3QMWA 1U2QA 2YMLA 2ZBDA 2FW7A 4OVKA 4UHCA 1AZSC 3MWFA 4L16A 1P8AA 4HNGA 4ON9A 4FMDB 5FUXA 3LIIA 3R8CA 3RFXA 2G06A 2JFHA 2VDWB 2X5XA 5D85A 3WLFA 2YNMA 5KOIA 3HBJA 3FMOB 3PPIA 4TVBA 3PRYA 4REMA 4ZAGA 3Q8XB 2VRNA 4U7HA 2P6UA 2PZAA 3RYTC 4DLNA 1Q7TA 2HL7A 1YB4A 4HYQA 4EEKA 1H94A 5LSAA 5ETJA 2UU9M 1TM3E 2B0JA 2VATA 1UZLA 3W8FA 1QK5A 1RBZA 3PNBA 3VH4A 1Z13A 3B89A 5AI5A 5KVCA 2HY7A 1ND5A 4PIVA 2AL7A 2DWOA 2ZAYA 2FPLA 1CNEA 4MWDA 4C0KA 5GADl 4XWGA 1NVUQ 3NUQA 4U9UA 1YMQA 2FMIA 2Z7JA 2RGWA 4LRYA 3FSJX 4G3OA 2E2WA 1XK7A 3B6KA 1V3TA 4G5HA 2B2XA 2J3DA 5AM5A 3Q3VA 4KLCA 1VI6A 3RFUA 3PFHA 2HHLA 2BBWA 5EHGA 1OB5A 4NMWA 2ZDQA 4YREA 2Y68A 3DZKA 5CTAA 1C30B 1OMOA 3QWHA 1B7GO 1C9YA 1P7PA 2P2ZA 2P2CA 4OX9Y 1GUZA 3WLIA 4KFRA 5FL3A 1X87A 3DOEA 4RD4A 3OQVA 3PX3A 2CV0A 2RHMA 4ZVRA 4D9NA 3TD9A 4DMRA 5L7TA 4Q3LA 5CG1A 5K8TA 3I37X 4CKBA 4Y0NA 1EX6A 2WPDA 3KDSE 4NI5A 4JSTA 3F3KA 3ZWDA 3E46A 3GNLA 4B7GA 2MMCA 5AXCA 2VHYA 3CZ5A 1JJAA 1RWMA 5JDIA 3ZJVA 2GCOB 4P6VF 5IG2A 2VNAA 1UCFA 3HY6A 1UIRA 3R3WA 4D9EA 2AWNA 3UH1A 3AP3A 5A2QS 3DV0A 2AEMA 1WIWA 1M1YB 2WSYB 2L7HA 1MBZA 1Q92A 4F5EA 1QFMA 1JR4A 4UZSA 4IRMA 1V2HE 4Z4FA 3NHMA 3MGCA 3KYDA 1FUUA 3OFSA 3HN7A 2HDHA 4HDSB 5ITXE 2C54A 2FMHA 2WICA 4A8JA 1QHIA 5DBGA 1E2LA 1M2OB 3OX4A 4W7SA 3V4RA 2JLZA 1DUIA 3ZS9A 4C5CA 5BSVA 1YIDA 3KQMA 1CF2O 3VO9A 2DFPA 2UYOA 3W8NA 2YFQA 5HKOA 2D5CA 4YPFA 5BSWA 4HZUA 1A9ZA 5MFZA 2FXIA 3HPRA 2E85A 3F4LA 5DLQC 3T6KA 1R6BX 2PH7A 3EZ9A 4GAEA 2FZWA 1M8JA 1M1XB 2DY1A 2XEXA 4R1NA 5U4QA 4ND8B 3ETHA 3TOZA 4INPA 1ZPDA 3WISA 1DCMA 1ZN7A 3IP6A 5K4GA 4GKKB 1IIBA 3VDXA 1U90A 1SUBA 4B5LA 5DOZA 2QAGC 4EI2A 2OCKA 1VKRA 2ZRHA 2ZSBA 5LZ4A 4KQHA 2NACA 3HLYA 3T54A 1ZK1A 3SI7A 4CMCA 3C3WA 3OEHA 1QIEA 2FAXA 1JEEA 3TLYA 1L5YA 2LKCA 4UBMA 1WY7A 2VP3A 2YINC 3BILA 5LA6B 3D1JA 3SIXA 2IS1A 3H2YA 1EEHA 4JAVC 4NCNA 5LZ5A 2WI8A 2BL4A 1ULTA 1RXCA 3Q8XA 4PC6A 3W04A 4QAQA 5G3YA 3JAMA 1U0SY 4RMJA 4QDOA 1QPGA 4OGGA 5A06A 1EFVA 3OOYA 4Q3OA 1A5SB 2I1WA 2M6SA 3U7GA 2FMKA 1XB2A 3A9CA 1T0UA 3AV0B 2JVJA 3OA2A 4IDBA 3AR4A 2HSEA 4V38A 3RREA 1GSIA 2GHIA 1GPAA 1M7GA 3QKSB 4MSUA 1OHHA 3Q0EA 3V7FA 2YYYA 3HXKA 1VI5A 1C3LA 3FYDA 1U2GA 2WVGA 3AYXB 3IGFA 2LV8A 4JGIA 2NU6A 3E0XA 3I6MA 5I51A 2AK2A 4YCLA 1LPPA 2VKQA 3O1IC 4AC9A 4DOMA 3DMTA 1QHSA 3N0TA 3GNTA 4B8ZA 4EITA 3RUDA 1IOWA 3DHNA 4LMRA 5BP7A 2ZYSA 1SEVA 4FDVA 5K0FA 5JAOA 2BTQA 3W9BA 3BKWA 1ZINA 3ED5A 1JDTA 3IUQA 1DGHB 3BMNB 5KVVA 3UBTA 3NEYA 2N9UA 4WKGA 4R6WA 1WMEA 1LZLA 3AEUB 1XZEA 3N8DA 2EZTA 2YVQA 2I7TA 2IHJA 3LSTA 1YFLA 4FZRA 2Y9PB 3DTVD 2BE9A 2ODBA 5ALPA 1UBKS 4D2IA 3UMMA 1JFFA 2OGUA 1GZDA 1U8EA 3I0ZA 5AI6A 5DN6A 1YZFA 4B17A 2BV3A 1RHKA 2J9XB 2HLNA 4AYTA 1CIVA 3BGOS 2CV1A 2ZE8A 2V7WA 2XWSA 5G1OA 1KK2A 4CL8A 1K63A 1L7RA 2J32A 2Q3MA 3PIDA 1NF9A 3O73A 4QJIA 4YRPA 1LSJA 1BWPA 3BRWD 2EJUA 3H1GA 1Z8DA 4CTKA 1N57A 1JTEA 1YS4A 4CF3A 5DSXA 5B64A 5CYFA 3T5DA 4A92A 2E5LB 1ETUA 4EHAA 3UWSA 4BXOA 1SQFA 1YFZA 1XLTA 1DKRA 1Z56C 2OZPA 4ZC8A 4DL9A 1Q0HA 3H9UA 4CIAA 2AC4A 3K0AA 4G0ZA 4NJMA 4RZSA 2H1IA 3RC7A 3OAAD 1WBJB 3H9CA 3IV7A 1OYYA 3IT3A 2NX2A 4FGUA 2OXIA 3SHTA 4YAOA 2JY5A 1J0CA 1R66A 2XNSA 4RYDA 1Z6AA 5AK3A 4BMPB 1HA3A 5KEIA 1DHRA 2ZWAA 3JAKB 3AUXA 1NTRA 4FLMA 3AEKA 4MROA 1S2IA 1WZIA 4ID3A 3MK31 1QWSA 4N7BA 2HDWA 2H0QA 3OIDA 4NABA 5J4YA 4RULA 1MXHA 5K8VA 4QLAA 1WMBA 3OY7A 4C01A 5CIWA 3M6UA 4AMBA 5KNDA 2XBMA 2RONA 1L2CA 4GZ3A 4JT9