3T38A

Corynebacterium glutamicum thioredoxin-dependent arsenate reductase cg_arsc1'
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
204
structure length
199
Chain Sequence
LHTNILNRIANELALTYQGVFSAETINRYIFESYVSLARTAKIHTHLPILAEGFAKDRLHALAVAEGKVASPVPQVLFICVHNAGRSQIASALLSHYAGSSVEVRSAGSLPASEIHPLVLEILSERGVNISDAFPKPLTDDVIRASDYVITMGCGDVCPMYPGKHYLDWELEGEDKIQEIIEEIDGRIRELWKSIQLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Corynebacterium glutamicum survives arsenic stress with arsenate reductases coupled to two distinct redox mechanisms.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Oxidoreductase
molecule keywords Arsenate Reductase
total genus 69
structure length 199
sequence length 204
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1060 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3t38A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3t38A02
4ETIA 2FMIA 3TB6A 4W5OA 3HXMA 4G97A 4MR7A 3LUFA 2CHFA 3UKJA 1DJMA 2M1ZA 4E7PA 5ABPA 2PUGA 4Q7EA 4RXMA 1ZAYA 3C3MA 3TD9A 3OMWA 4S04A 3OO1A 3SQNA 5IULC 3CKMA 2MYPA 4YS6A 4RK6A 1F4VA 1JYEA 1ZGZA 3C6QA 5PNTA 3E3MA 2WWVD 4NCBA 1CYEA 5IX8A 4RK7A 2E4UA 2PAFA 5JNSA 5TPWB 1W25A 2Q5CA 2IKSA 3M9XA 4ZJPA 2NT4A 5I4CA 2PUBA 1KRXA 1DCMA 4YO7A 2B4AA 1URPA 3SM9A 3GA5A 5IC5A 3LUDA 4LE2A 3M6MD 3N0XA 3EGCA 3RVNA 3DGEC 2IPMA 4JB2A 4W5QA 1NXTA 4XLTA 4PICA 3MIZA 2MSLA 2QXYA 3QEMB 4MS4B 1MAVA 1PEYA 4RDCA 4Z0NA 3BBLA 1ZHHA 3FFWA 1APBA 3N75A 3LUAA 4Z4EA 2CWDA 3QELA 1GUBA 3QELB 1L5YA 4KNYA 4LZLA 3KCNA 1GCGA 4RKRA 2PL9A 1FFSA 4XFKA 3O2SB 1RXIA 2R4QA 1M2FA 5CNKA 2PUAA 2E4YA 4WT7A 1L5ZA 4WXMA 5T7BA 4HYEA 1BVHA 1GCAA 1MB3A 1ZITA 2QVGA 1U0SY 3EAFA 1USKA 3HCWA 2FEPA 4L4UA 3JPWA 5C5CA 1WETA 4D6YA 4YP9A 1SXGA 1C4WA 4MRMB 3Q7SA 1DBPA 1JLKA 2PE5A 2TMYA 5TQJA 2KYRA 1EHCA 2NUBA 1Z2DA 2M98A 3NHMA 3OO0A 3O2JA 3CS3A 3F73A 3RVKA 1EWVA 5TQ0B 4YV7A 5KWSA 2OQRA 2IDMA 1ZH2A 4RY9A 1XWWA 3Q15C 2E4XA 2PUCA 4N41A 4KVFA 4QPJC 1JFSA 2FMHA 5EWLB 4OLAA 2ID9A 2LP4Y 4RK0A 1USGA 3QEKA 3KSMA 5KC8A 4OLBA 4WWHA 4YR7A 5JNTA 4Q6BA 1JL3A 3CLKA 1P6UA 3RVSA 1RZRD 1OXKB 3OQMA 3HK2A 1TLFA 3O2QB 3Q41A 1FQWA 1U04A 3Q7RA 4G0MA 3N53A 4O5AA 2LBPA 3RH0A 3H6GA 3FFXA 3B2NA 4FE4A 1SXIA 1VLZA 4Z4FA 1P8AA 4RSMA 3T38A 1PUXA 4MS1A 5EWJB 3OM1A 1JDPA 3C97A 1EAYA 4OG2A 1ZGGA 1DG9A 4KPYA 1JHZA 2E4WA 4KK4A 5DLEA 2GWRA 1B00A 4LDZA 1P2FA 4P1ZA 2FMKA 2E4VA 3G1WA 5CNIA 4MGEA 3H6HA 3HSYA 2HQBA 4N0QA 3I5AA 4F3TA 5HQJA 4G0XA 3MA0A 2FMFA 3CHYA 3MYYA 4YWHA 3W9SA 7ABPA 2JCGA 2VUIB 2F8TA 3OLXA 1D1QA 2MYTA 4O1IA 2A9QA 3M9WA 1VRVA 4XAQA 3KG2A 4LE0A 4ML3A 1M5UA 2MYUA 2R25B 4KRFA 4JASB 3MF4A 1GUDA 1DCFA 4MS3B 1NXSA 2A9OA 3A0UA 2FN9A 3CZCA 3SY8A 2QVCA 3K4HA 5EWMA 5IUNC 4WXEA 2FQXA 1YMUA 2PLNA 2WJAA 1Y1LA 4D74A 3TMYA 3IPCA 2PUDA 2FQWA 4KREA 3F6PA 4MYRA 4QYMA 1RNLA 3O75A 2IOYA 3QK7A 4G0PA 1Z25A 4PZ0A 4RV5A 4TLLB 3O1IC 3NNNA 4EY3A 1NY5A 5FWXA 1CHNA 2GBPA 4QYWA 4Z9AA 1USIA 3T95A 3GBVA 4W5RA 1E6MA 2HQRA 1I3CA 3HO1A 1SXHA 4HNQA 3LUCA 4ZMRA 5JS2A 4OATA 3HDGA 1VPWA 4JAVC 1BDIA 2AYZA 3EODA 3O74A 1RZRA 2MYNA 5BQ3A 3OLZA 1Z18A 2E4ZA 3E61A 4Z99A 1M5TA 5D2CA 3CNBA 3RVOA 3RVPA 2JB9A 3MMNA 3QLUC 3I42A 3QLVC 4RKQA 1R8JA 5JNUA 4KFCA 4H3HB 2PUFA 2BGGA 4F06A 4NQRA 3KLOA 1Z16A 3OQOA 3OLVA 1LBHA 2FLWA 2GX6A 4CBVA 5TQ2A 5TQ2B 3I45A 2FN8A 4UHKA 2WRZA 1K66A 1NXWA 5KC9A 3GWGA 5KQGA 4S05A 3HM9A 2FVYA 1LJUA 1DRKA 3LUKA 4G86A 5GOTA 3NNSA 5GQSA 3IP6A 4IGAA 5E3JA 3DBIA 2JVJA 5F64A 2FSPA 3EQ2A 3T6KA 1BDHA 4NICA 4MS1B 2LUOA 1T34A 1OXBB 3KJXA 2N9UA 2PKXA 1YIOA 2P4UA 4Z4GA 1BAPA 3CTPA 3SNKA 4ETMA 4W5TA 1EFAA 2NT3A 3O1JC 3GRCA 1ZDMA 3OMXA 2X7XA 3I09A 5EWJA 4DQDA 3GL9A 6ABPA 1Z17A 1Z26A 1YK0A 4MR7B 3R0JA 1TMYA 1NXPA 2NZVG 3N8IA 3L6UA 2I6FA 3LFTA 4OBBA 4MLCA 1BA2A 4RK1A 4RY8A 1RXEA 1E6LA 4W5NA 2YHAA 5FWXB 4RZSA 2AYXA 3GT7A 4IMIB 2HJ9A 2P9HA 3IP9A 1F51E 3OLYA 3H5TA 4E7OA 4WZZA 4IF4A 1FFWA 1QMPA 4MR8A 1DC8A 1XHEA 2HPHA 4YGXB 3H5VA 1UDRA 4MR8B 4XXHA 3UUGA 1QPZA 4F11A 1SD5A 3QLTA 3RVJA 5TQ0A 4EUKA 3MQ4A 5IEJA 4G0QA 1E6KA 1ZESA 3H5LA 1QQBA 1GLGA 1K68A 4MQFB 3K9CA 2ID7A 3UK0A 4EYOA 3LUJA 1LJLA 5FBKA 2XDYA 5CNMA 8ABPA 1S8NA 2QSJA 1A04A 1MVOA 3TO5A 4MR9A 5CNJA 5HM6A 3QLUA 1JFVA 3IPAA 3QLVA 3H1GA 3IP7A 3SAJA 2FKAA 5JS1A 4IILA 5ED4A 3BRSA 4H60A 1PHRA 4EYGA 1J56A 1DC7A 1PNTA 3KHTA 4G0ZA 4RU1A 5BR1A 3HUUA 4G0OA 4H3KB 5DCLA 4LX8A 3LUGA 3N0WA 4MLDA 4ZMSA 2JBAB 5TPZD 5JNWA 2DRIA 3F7NA 2O20A 4ZPJA 3BREA 3EDCA 1DZ3A 2WJWA 3VNBA 4JB0A 2MSWA 2PL1A 3H5WA 3VNAA 1H9CA 1Z12A 1EWTA 4MPTA 5FWYA 2QV0A 4PE5B 4TN5A 2OENG 3OQNA 3DZDA 5IUJC 1YK1A 3D8UA 4EVQA 1ABEA 4KQ9A 1YS7A 2ZWMA 3HV2A 2A9PA 1QO0A 3F6CA 1DCKA 3JTEA 3N0RA 3RQIA 3A0RB 1AB5A 4ZYLA 2RJOA 1U8TA 1AB6A 2R48A 4JOQA 5FBHA 4HNSA 3OM0A 1A0OA 1ABFA 1ZVVA 3HUTA 4MRMA 4YCSA 1ISSA 1NXXA 2FXIA 3GV0A 1YVUA 2A9RA 4MS3A 1DP4A 1YTUA 3FMVA 3KYJB 3QX8A 4Z4CA 1KGSA 3QEMA 4MS4A 1JWLA 2YHBA 2QZJA 3LMKA 1MB0A 3IP5A 5EWMB 1DBWA 5KQPA 2L2QA 2IYNA 1EWKA 3EULA 4N0PA 4YLEA 3FFTA 1VKRA 4UHJA 1QP0A 2WMYA 3HJFA 3EJWA 4Z9BA 2W42A 3H1EA 3D02A 5CHYA 3RVRA 2MSKA 3FDFA 1KRWA 1TJYA 1RPJA 2HQOA 3LKVA 4GNRA 5B3JA 3S99A 4N76A 4PEVA 3ROFA 2RDMA 3CU5A 3P9YA 4IRXA 1NATA 4KV7A 4YRZA 4KK3A 4EVSA 4EVRA 5JNRA 2NZUG 2JVIA 2RGYA 1FSPA 4G0YA 4MAAA 5T3YA 3H5OA 4Q6WA 5HSGA 4LRQA 2J48A 4DN6A 2IPNA 1LBIA 5KI6A 1BDJA 1JDNA 1FFGA 4ETNA 1ZY2A 3MM4A 2JBAA 5HKOA 2FTKE 3O21A 3KLNA 2V0NA 3C3KA 1A2OA 3HZHA 3ILHA 3JS5A 1W9HA 2PJUA 5DGCA 3HVRA 2FEWB 2JVKA 3BRQA 2JK1A 3URMA 3LKBA 3JPYA 4RWEA 3CG4A 3H5IA 4RY0A 4Y9TA 4NCAA 1M2EA 4RK5A 1Z13A 2JRLA 5TE9A 4N47A 5JNVA 3ROTA 3KKEA 1NXVA 4MQFA 3JVDA 5C5EA 1XHFA 3H1FA 5BRJA 3O1HB 3KS9A 2LIVA 1IIBA 3NNDA 3HDVA 5EWLA 1DRJA 1Z15A 3A10A 3CZ5A 3GYBA 3LTEA 9ABPA 1TM2A 1QP7A 4Z4HA 1E2BA 1LK0A 3CRNA 4F12A 4RK4A 5TPWA 4B09A 3Q7TA 1U2PA 1QQAA 1YS6A 1U2QA 3FGZA 3H75A 4MQEA 3BILA 4MQEB 3RVQA 3T8YA 2CHEA 2IPLA 1D1PA 3HEBA 1HEYA 1NTRA 3EQZA 1JBEA 2FLKA 5DTEA 2PUEA 2L19A 2F8SA 1KMIY 4EGSA 3HS3A 1D4ZA 3JY6A 4NV3A 2LPMA 3DLBA 5DKFA 2ZAYA 4OTZA 2WY2D 1JYFA 3CFYA 3G85A 1D5WA 5B3JC 4XARA 1PNRA 1QKKA 2RJNA 3CG0A 1YMVA 1Z2EA 5KQLA 1NXOA 1D2AA 3IDOA 1ZH4A 1JX6A 3L49A 3GBPA 3KTOA 2L18A 3OLWA 4KQCA 3A3KA 2FW0A 4RXUA 4LE1A 6CHYA 1ISRA 4RXTA 1CEYA 4D6XA 5KQMA 3N6VA 3C3WA 4KMRA 4QICA 5TPZA 4XASA 1PEAA 1JH9A 4EYKA 3KYIB 1QO0D 4GPAA 3SG0A 2WB4A 2VUHB 4JA2A 4EYQA 4FE7A 3QX9A 1DBQA 4P98A 2QW1A 3ILYA 4MR9B 5IBQA 4JP1A 4F8JA 4L85A 1JFTA 5IUKC 4KZKA 1P6QA 2FQYA 4M88A 4PYRA 2HSGA 3TX6A 4N03A 4IMJB 3LOPA 3LUHA 2L17A 3RVLA 3RVMA 2FEKA 4LDAA 2QR3A 3NBMA 1QNLA 1JF8A 5IEBA 4TMYA 2H0AA 4DADA 2CD7A 4FB4A 1SRRA 2GKGA 4RS3A 2QU7A 3Q9SA 4WUTA 1MIHA 2GI4A 5BRAA 3DGFC 3NHZA 1QP4A 2IPAB 2B1JA 2R47A 4TLMB 4O1HA 5FWYB 2VYCA 1ZN2A 1C0EA 1TVMA 3JVIA 4Z4IA 2VK2A 2PMCA 4HNRA 3DLHA 2H3HA
chains in the Genus database with same CATH superfamily
2AN5A 1IL0A 2C3MA 2HSEA 4IFTA 4NLLA 5EJ4A 1IZ7A 2P0YA 1N36B 4ZJZA 4LISA 3H97A 2DJ5A 1XI2A 3B7PA 1J22A 3U3ZA 1RAEA 3FFAA 5T6MA 4IHAA 2X0DA 2FSFA 2ZBGA 4EUSA 4FE3A 4LBYA 4CFSA 4OI0A 4YAWA 3OO1A 3BGWA 4H31A 4F92B 1PHPA 3FA2A 2WD9A 3HJTA 4CT4B 2ZDQA 1MO5A 3WICA 3PUIA 4Y6QA 1JEYA 3E9YA 1K7SN 2C2XA 3E3MA 5FTJA 2H0RA 2YNMA 3CRVA 4FN4A 4JL8A 4TSKA 2OYRA 5CA1F 2E4UA 2PZMA 1ULBA 3D6MA 5BOSA 1HE2A 2QAGA 4M1TA 4N7JA 2MSCB 4Q1BA 1LUAA 1M2VB 1OAIA 2HXYA 2QT9A 5IJ0A 3PX7A 1IM8A 5E6JA 1UANA 2Z2YA 4P22A 4YMIA 4U7GA 3L6CA 4GOND 2W48A 2A0FA 3K1TA 4X1YA 3MMPA 1MJ5A 1PSDA 2PXCA 2OHGA 1GL3A 2LDXA 1UOPA 3GJRA 3IBFA 3MIZA 4QBTA 3DOEA 3UJ8A 4BFYA 1UJBA 3GT4A 2R6ZA 3LQ4A 1IN7A 4W9NC 1ECBA 3ROKA 3Q3VA 4X60A 4RJTA 1GUBA 4J1NA 4J7XA 3LC0A 1GCGA 1EFRA 2W83A 1ZD1A 4B48A 5C4GB 4ESEA 1NNLA 4GNKA 4XFKA 5IC4A 3WGUA 4GMQA 1KPHA 1KPIA 3P19A 3SZLA 4MVJG 4DNQA 3HHYA 1NDHA 1Y81A 1DIBA 2E4YA 1CUAA 3VPHA 2OV3A 4LOHA 1AOXA 4UPDA 2Y0BA 3EGXA 3W34A 1FNDA 4HEQA 4AKTA 4ZV4A 4DSNA 3O8NA 1YVRA 2MIIA 2QRQA 1A2KC 2PZLA 3J81A 1T0UA 3A4VA 3F9CA 3R0QA 1OLUA 1QLJA 3ETJA 2HPAA 4MRMB 3DBLB 2XEXA 4DMFA 4DRYA 1DO8A 3REOA 2GERA 2H5JA 2WM9B 1XG5A 2Y6UA 3ONDA 4JBLA 5KVAA 2XRMA 3M1LA 3LVWA 1H6BA 5EIAA 5B2ZA 4DWWA 1OIXA 3CNHA 1EM8A 1WVGA 1EQAA 1GUYA 2FF7A 4KDEA 4IBDA 1KBOA 2Z9DA 4IBCA 1N9KA 1VDLA 2HCBA 5LBUA 1HRDA 4C2TA 4HDCA 4HTAA 4OFBA 4JLAA 2FMHA 1Z59A 5IZ7D 4URVR 1N7IA 3GLHB 4MUAA 4YJ2B 1P5FA 1ZHOA 1NW6A 1IATA 1AUXA 1T3HA 2HJHA 2LP4Y 2X58A 3LUPA 3CRQA 5HK8A 3S68A 3UWDA 1JIIA 5JS8A 2HWKA 2IZZA 2UZAA 3ZY5A 5K20A 3J7BA 4LGCA 4IJ5A 3A1VA 5L3SB 4NOOB 3CNNA 2ZRDA 1I4OA 3DMTC 3AR6A 3FWNA 4FWIB 4JJ7A 4DLZA 1QUSA 1SOMA 2BISA 3IMCA 4XZ3A 5A9RA 3ZJVA 1N78A 4TXMA 1TZJA 1GO2A 3O91A 3B2QA 4EW3A 5B1EA 3EPKA 4INAA 5CJ2A 3NBXX 4WINA 4HQKA 3FE2A 3S2UA 4YT2A 3QVWA 5BNIA 2C2YA 3QKIA 2BRUA 1VP3A 2CDBA 3CVXA 2FN7A 1HV8A 3QE2A 1V8DA 2VPXA 5CDTA 2R7KA 3K5HA 2ZWIA 2FMKA 4ZYYA 3V8EA 3IVCA 4HN2A 3SBOA 4GOJA 3HSYA 3T7IA 1F38A 1XZQA 3INNA 3TUZC 1ODFA 2AD1A 5HQJA 2FMFA 1SO8A 1SZDA 2DGDA 1K6XA 3NOVA 2JCGA 3OWXA 4KBYA 3R75A 1FQJA 3UGKA 3WMWA 1RVDA 2X13A 5DBOA 3EVFA 2ZREA 1D1QA 4S1OA 5ALOA 1IQRA 3NHPA 2Q5JA 4O4IB 4NMWA 2YVAA 1M5UA 4PQRA 1V8BA 2D1RA 3U5ZB 3F3MA 5LOVF 4LBWA 2H9IA 4X1KB 4B81A 1T1GA 2I33A 2PSJA 5J2TA 3WLQA 2BH2A 2VQEM 3X1WA 5J2TB 5CCXA 1Q3BA 1N7GA 3WBJA 3DVQX 2QTLA 4K9DA 3OQBA 2FFJA 4PANA 3DT6A 1W5AA 4LUCA 1FFXA 1NJ5A 4N5HX 5KX5A 3ZDZB 4M89A 3F3SA 1YL5A 1RKBA 3R41A 1IHOA 1G8KA 2FQWA 3Q3GE 4IEIA 1Y8ZA 4ZEOA 5H1YA 4F4CA 2ZRFA 4JI3B 3GP1A 4BOYA 4M0MA 1N5JA 1OXMA 1YQDA 3S2GA 3KEFA 4I08A 3E8MA 4PYOA 1VE9A 3RE8A 3LBYA 4HG2A 1U7TA 4P2GA 4TLLB 1DQSA 1THGA 3QVSA 5K9ZA 3L43A 1CHNA 4GUAA 5I9TA 1IK6A 1KETA 1M1NA 1OTYA 1OLXA 1RWXA 1TK9A 4AMUA 4A92A 2FV8A 2IS2A 3KBOA 5FA8A 4ZI7F 4IF6A 2LCQA 3AUKA 5A3VA 1B23P 3TTSA 5HIIA 3KAKA 4N5LA 1W4LA 3ASZA 3GHYA 4UQPA 1NQUA 1R5BA 5LB2A 1L5QA 5BWLA 1HEUA 1JE1A 1DJOA 1FDSA 3P4UA 4S24A 5CVVA 4E07A 3ZDDA 3QKRA 5JZSA 1TO6A 1NI5A 2GGSA 2D5CA 3OD1A 1N5KA 2NV0A 4L7VA 2VAMA 4MYSA 4O4JA 3ZZMA 3OQMA 3CNBA 4JLUA 1NNSA 1CS4C 3NIGB 4G1CA 3T7JA 1M7BA 1F0PA 4CTJA 1Z16A 4ER7A 4JLDA 1E2JA 4U0KA 5ITZB 1B3BA 1KEZA 1FS5A 4ED9A 4Q9JA 3RU3A 4DV4B 2A5LA 3BX1A 4JVOA 3HM9A 1RJ9B 3GBSA 2MMGA 1E9EA 1NBIA 1RJ9A 1YJCA 2QY6A 3GJQA 3OH8A 5BSRA 3TQFA 3DLHA 4JI2B 2NVBA 3OICA 5T5QA 4ZZ3A 1CRLA 3GMTA 2VJKA 3KKOA 3JYHA 5A5FA 2IYPA 3HZZA 2JHFA 4MUEA 4BTVA 3X1DA 1RQPA 1KJZA 3TMKA 1RAHA 4JI3M 5IH3A 3A58B 1UK9A 3HHEA 2A3NA 1T3ZA 1GKKA 3FZYA 4MS1B 3H16A 3OZWA 4IHKA 2PKXA 3MD0A 4F8EA 3E9ZA 3FCXA 3WJ2A 3ETGA 3F2VA 3REQA 1RRMA 1GPAA 2R97A 3VHLB 3SNKA 4Q00A 1LX7A 2GESA 3GVIA 3IKVA 4UHHA 3V8NA 4CKWA 2R6DA 3RC3A 5F73A 3AVYA 4WASA 3K72B 4HBZA 1WPRA 5GJVC 4BLUA 4C07A 5A6VA 4V24A 2FZWA 1TW2A 1J8FA 2BEJA 3P9XA 1E3QA 1J9GA 3JQGA 4G4NA 2DFKB 4LFBM 4LXUA 2W4MA 2H2GA 3B1ZA 3F4BA 3TNYA 3WWDA 3DWIA 3VRHA 3HCOA 3VPXA 2Z08A 1ZBDA 5FB3A 3NHSA 5J43A 2O7RA 3DD1A 2BLNA 3ESCA 4MW5A 4WXYB 3ZN2A 3D2LA 4R71A 1EUCB 1UKEA 2XEDA 1SBNE 3B1JA 3HJUA 3EW7A 3LECA 1HYEA 1P61B 2PX4A 4TTTS 2ZJZA 3KV1A 3U7GA 2KNZA 1GQFA 3G5LA 3GLIA 1CS0B 4RVFA 2PUAA 5I7SA 1Y1SA 4L28A 2JFGA 2WTUA 1MDBA 1ADFA 2IEZA 4B3TM 3SOPA 4EUKA 4TPKA 2XH8A 3GPIA 3RT7A 1TJ5A 16PKA 3L0IB 2KWIA 2PU5A 2ONKA 2Q1SA 3MS2A 3QAUA 4DV4M 1GAWA 1H0KA 3R4CA 2LW7A 1BZYA 4JFRA 4N6NA 1QFJA 2OHVA 2CFOA 4NS1A 1NSYA 4KO4S 5BN3B 4JIMA 2XUIA 4FU0A 4PFSA 3P9PA 3QRWA 2NUTA 2DT8A 4Q21A 5GJBA 3PDCA 4NBLA 1I3KA 1EYZA 1NMZA 4QYXA 5GY7A 4NV1A 1RAIA 3LP6A 5J4HA 4QWMA 2K47A 1JFVA 1LPNA 1QB7A 2HXSA 2EFDB 1VDDA 2JP7A 3U26A 1Y6RA 2GNOA 3LPMA 4QU8A 4Q9AA 4H7PA 5JDIC 4QRIA 1FDRA 1T4DA 1AMOA 4FOTA 1G8GA 4IIGA 1M8KA 4TLAA 3HUUA 5GWXA 3FRHA 3AI1A 3KB2A 4LYHA 3LUGA 2JI6A 4BP1A 1OIPA 4R1UA 4OM7A 3DOCA 3UT0A 1LI4A 1GG8A 1WNFA 3BMNA 3ODPA 1KHHA 3CLRD 5C53B 1SUCA 2BM9A 5ULLA 1BJTA 3KE8A 3KXIA 1ZCFA 4LWPA 1HDGO 1T4CB 4OHBA 4ZCQA 4FCTA 2J0EA 1CQIA 3I1FA 1SZCA 2QY9A 3PQCA 3Q6NA 4LV8B 3RS8A 2FX5A 1E18A 3C5EA 4DCTA 2YRWA 3HBFA 5GJCA 1KS2A 1EGQA 2WZDA 1JECA 1TAUA 1W0CA 2WTXA 4KQ9A 4UDYX 4DM3A 2ZR0A 4G09A 4CEJB 2ZYRA 4AL4A 1G66A 4TSFA 4KR2A 1AGYA 4ZYLA 2A9VA 3RYFB 3MJVA 4PZ9A 1EFTA 1N0UA 3DPUA 1KZ6A 2NXCA 1LDYA 3ZU3A 2WMDA 1XQ6A 2L0XA 2ORIA 2X76A 1P3DA 2XNHA 1Y9AA 3Q11A 5ITUA 4BNDB 2EWMA 5TF4A 1N57A 2Y92A 2YHIB 3LD9A 5U4QA 4MWDA 4FDLA 3Q0EA 1YTUA 4JI7M 1MTZA 1FTQA 2OCDA 5FI0B 4AYTA 5ARBA 4JI4M 1XDDA 3U7QA 4EJSA 1VJ0A 1DKMA 3UJ9A 5GTDA 3M6FA 3N70A 3ADCA 1NQWA 1UFRA 2Q6VA 2XNJA 4MJXA 4NZZA 1AGNA 2H2DA 3BMQB 1PR2A 4G26A 4OB6A 3UMFA 4QVIA 1CJMA 3IC5A 4Z9BA 4II3A 3QU7A 3J81S 2W90A 3TXAA 4NBKA 1EDBA 5J47A 4OP3A 3TIVA 3FDFA 4TMXA 3X2FA 1P5ZB 3IAAA 3TLGB 3QWHA 2ZBEA 3IMFA 4F6RA 2BFBA 3AF0A 3R0ZA 4BO5A 2BDEA 3K6SA 1QQ6A 3K4PA 3Q8LA 4DG8A 3TWKA 4IG9A 5D1NA 3UV6A 5B1SA 4LOLA 4B73A 3Q2OA 2R62A 3AERA 3FJ1A 1YAJA 4Y6OA 2Q3CA 5DRTA 1TO2E 2G71A 1RWPA 5KTPA 3G2KA 4G0YA 4DLXA 1E3IA 3JAKB 3Q3EA 4PLGA 2IHNA 3L18A 1C8KA 4F86A 2I8LA 4YP7A 1JH8A 5CAEA 1RYDA 1N9GB 2BUAA 2R86A 1X7WA 1W46A 2ZTMA 3GIWA 4UUNA 5DYYA 3RTAA 3PQ4A 4RVSA 1NG9A 5EC8A 1DTWA 1H2AS 3IMGA 4N40A 4BNYA 1Z5CA 1MOQA 1US8A 1FXWA 1V25A 1ZD9A 3OJCA 2FEWB 4RD4A 1D1TA 3MS7A 1P1RA 4AJIA 5FO1A 2R4UA 5JAHA 1ZOSA 4TTJA 4Y2GA 5M5BA 1SCAA 4NCAA 3ENZA 3AESB 2CGEA 3EEQA 4JL6A 4Y9TA 5TEWA 2IYQA 3GCXA 1GTMA 3SIWA 4RK5A 3UICA 2B9EA 1W36B 1HR0M 3ROTA 5CBPB 1W4ZA 2VJDA 4PCLA 3UOGA 3K2LA 4B3GA 5F2EA 4JI4B 2AMJA 2OQ4A 4MV9A 3ANTA 5JWOA 1C5KA 2R7NA 1ZN7A 4MVJI 1LRJA 1DGHB 5I45A 1HM5A 3L1KA 2LCFA 4RFVA 1XF9A 4WP2A 4IICA 4RYLA 1OFHA 1NUPA 3HU3A 1A9YA 3I4LA 5JZVA 1P77A 3A70A 4PNPA 2X49A 4DY6A 3CWZA 4L8FA 4ZO6A 2HF7A 3PHCA 5EJCA 2R0QC 4EG7A 4TTIA 2VHVA 2CLCX 4Z4QA 3OIUA 3ED5A 4R05A 1GWNA 1MRSA 2VXBA 4DPLA 3U7HB 1YE9A 5I5EA 3THYB 2AUNA 5L8RF 3EVDA 3HEBA 1THMA 4U3JA 4R7GA 3IDSA 4N12A 1CVLA 1P29A 1GXSB 2IUSA 2LWIA 3C3YA 3PE3A 1H1LB 2P8SA 4W4TA 3TOSA 3K70C 2CVZA 1T6NA 4LNAA 1DWUA 4EPXA 1OU4A 2Y1EA 3OY2A 3EGXB 3OOYA 4ITVA 4XQ0A 4CLRB 3JAWB 3WMGA 3FUUA 4KO3S 4NE7A 3OWHA 2EG5A 1M8PA 1Y3AA 3P26A 1U6JA 1ZG3A 3KJFA 4N7MA 1H4SA 3SR0A 2MCFA 1CR1A 4XARA 5DMXA 4KI7A 5TC4A 2PWYA 2X8JB 3ND7A 3EIUA 2PWAA 3IIIA 2UKDA 3IULA 4XE5A 3FOZA 2PGOA 4ZCMA 4Z9YA 3QMWA 5K3EA 3NTQA 1ISRA 4RF4A 4B8ZA 5IABA 1CEYA 2FDRA 4MB7A 3N6VA 5AUNB 2XCRB 1RXWA 4QBFA 2XUPA 4QICA 4Z53A 2XIJA 4BMVA 2X19A 3BRWA 3FAKA 1UKAA 2GWHA 3WNCA 1QHGA 1WQ4A 2BFPA 5CUQA 1BMDA 4EYQA 1XTQA 2P11A 1R00A 3REQB 3VR5D 2EKPA 4RPJA 1DCTA 2MR6A 1U5BA 2I3AA 2PMBA 2FSUA 5FXMA 5C34B 1U9ZA 3S2EA 3WSTA 4QVKA 3TGPA 1EUYA 1SKMA 1UDAA 1ZNYA 1RFGE 2G8LA 2BBOA 2RC5A 1JFTA 8MHTA 4GITA 4HLQB 2HSGA 3AJDA 4ARZB 3HXQA 3GRUA 1XMSA 1N32M 3OKFA 3OWOA 2HA7A 1ZVJA 4RLSA 2L17A 2NN3C 3SFTA 1VL8A 2HX1A 4QM7A 1XJ5A 2P62A 4Y2QA 2W58A 3TCNA 2V6MA 3HRIA 4BLWA 1BHJA 3KKLA 3W8NA 1M6YA 5FYQA 5FI3A 2EUCA 3S27A 3KKKA 2B1JA 3L0OA 1T8WA 4RQTA 5KNCH 2VYCA 1GADO 2R6CA 1G17A 4EK9A 5LQJA 1GG9A 4GUDA 2O0LA 3AILA 4PHTA 2WSFF 1P2GA 4DDHA 1PE0A 4MRSA 1NUTA 1JHAA 2ZKIA 1OMOA 3CA8A 2PZFA 1SUBA 3K6JA 3KZCA 2Z4SA 1NWCA 3LX8A 3R5SA 4RZHA 2B1RA 4NK5A 5A6SB 2FHSA 2J4CA 2ZRCA 1AN9A 3IQZA 3WGOA 5CDFE 4Q7EA 4BYMA 5EJ8A 4ACBA 1HNXB 1F6BA 2YWGA 4JEIA 4MAMA 5K6RA 2P30A 2Z6UA 2LZ0A 4HQ0A 2CJWA 1G8YA 2NZJA 2KZUA 1QCDA 1VHJA 3EVZA 3JD4A 4R0VA 5JZBA 3T94A 3LHFA 1KI6B 2UVPA 1J5XA 2JKZA 3C6QA 2WD8A 5ALTA 1A8QA 2LXEA 2DUMA 4FCCA 4X44A 1YUNA 4IBKA 4PDIA 4IDGA 2NT4A 3P5BA 4CQNA 1PL8A 1K6JA 1U94A 2BEVB 1FBNA 2AMVA 3GA5A 5IC5A 5BURA 1B6SA 3K6KA 4ZARA 2JD2A 1WDTA 2H1LA 4LG1A 4LDPA 3EGCA 1PFQA 2F3UA 2WQ7A 1HNWM 2GBLA 2ZSBA 3FD8A 4K81B 4KDRA 4W9NA 1Y6JA 4XLTA 3M6LA 3AR4A 1X3LA 2IFTA 1EBBA 1K7XB 2AR0A 2MSLA 1QH0A 3CKKA 1BFKA 4PIVA 1DLIA 2I7NA 1APBA 2HRQA 4TUWA 2CW5A 2FGKA 1NR7A 2BFBB 4PLTA 4Z7OB 4HUQB 4HC4A 4YRBA 3RWOA 4Z51A 4GI3A 3TLJA 1FZTA 4M8SA 5KHAA 3RO7A 3LY8A 4M7RA 5FBVB 4ZVUA 1GEEA 4YEDA 4Y2YA 1DAFA 1XZNA 1RZVA 2C03A 4TQUS 2NW6A 2QMHA 1PJSA 2V97A 4B33A 3UC5A 2D0OB 1XEAA 2HL7A 1GUFA 2RHBA 4M9CA 5CDYA 3RVDA 4BJ3A 4D4HA 4QDJA 1X7WB 1U02A 3I6BA 3EAFA 1RKVA 3S2SA 1JMKC 5IZCC 1Z7YA 3UK7A 2F43A 3TQSA 1SXGA 3ZDEA 3UMCA 1PQYA 4I3FA 1PX2A 3HN7A 3MLAA 3G7NA 5AI4A 3UJCA 2YBDA 4CDGA 4FR2A 4NC9A 1Z2DA 2Z98A 4ZOBA 3O2JA 2WF8A 2R6AA 1ENZA 4NZ9A 5HJ2A 2Q2WA 5EL0A 1E2QA 3SSOA 2R1ZA 5CBPA 4JBWA 5JRZA 3SYRA 4BMCA 1XWWA 2RHRA 2E4XA 3V8VA 2O2YA 1T3TA 5FPKA 4L5JA 2VC2B 1H0HA 1ADJA 5AVRA 1NI3A 1R2ZA 1YR3A 2O2JA 1EP9A 2ZB2A 1WXQA 2IV3A 2J3MA 4QSMA 4R16A 1NLZA 1GO5A 4LF8B 2EW8A 1Q3KA 3GFQA 1E7QA 1N5IA 2QA5A 3ER9A 3X3HA 1K9VF 2ZUDA 1VHTA 3B3AA 4Z9XA 2QTTA 1VG9B 4WOKA 3HXPA 1LSOA 2ZROA 1MEEA 5BUZA 5LQAA 2C83A 4XA8A 5DEIA 2JXNA 1A8HA 3RH0A 3UAZA 3ZTYA 3ZDCA 1FTNA 2VP4A 1CUSA 1U90A 2VHZA 4R8KA 5DK6A 1P8AA 3OCCA 1Y7HA 4QKQA 1USWA 1ZNWA 3NBZC 3E9RA 4U9HS 4EA9A 3AR2A 4M86A 3VNRA 1TUIA 1G5IA 2XGGA 4UBIA 3FVRA 3PXDA 4Z6YA 1HFWA 4ZOLA 3ZCPA 3NTXA 3VO2A 3Q85A 2BEKA 4N18A 3G1WA 1U2DC 2O14A 3ESRA 1LRKA 2SCUA 4MGEA 3MJ5A 2FLVA 1JG6A 2FFAA 3O8CA 4J7AA 4IWXA 1R3DA 2X86A 1SKYB 1VQ1A 3OLXA 2C9MA 2OAQ1 4DLWA 2RIRA 1FS6A 1AKUA 1KI1A 1UM9A 1AMUA 1ZMBA 4ML3A 5BOVA 1XV5A 1S6YA 1B0ZA 2MINA 3D59A 3WBKA 1H2XA 2ORVA 3TN7A 4E2YA 5IHXA 4MS3B 3I5XA 3ROGA 2WKSA 3PITA 1ZW1A 1CNMA 3QYPA 4LY3A 4LF8M 5ECYA 3TDMA 4Y0NA 1J5EB 2MMCA 3NMUF 4I2VA 4Y0VA 4R2HA 5DNDA 2CLKB 2D06A 1BJRE 4LJ5A 3UC9A 2VEOA 2ARKA 4D74A 3A46A 2ZYDA 1SGWA 2GA8A 2XFSA 3NGXA 1GAQA 1RNLA 4AD8A 4BNMA 1TCBA 3LIIA 3HCRA 1YQ9A 4IO0A 4U7WA 3RUFA 2F3QA 3O8OA 1MC8A 2P3OA 3I8SA 1G3MA 1DT3A 2D0PB 5IZ4A 4FNOA 1J0DA 2YS7A 4MGIR 3VR6D 1C7IA 3ELDA 2K87A 1R8XA 3WK4A 4B0OA 4C6TA 4TROA 3AOEC 1JN0A 1M2WA 1VCMA 2QUJA 1J8VA 3DFFA 4G01B 4K2AA 4QXRA 4UPEA 1ZRHA 4B7CA 4TXNA 3KHUA 2G1KA 2O6HA 1BG6A 2HUNA 1V8FA 3VK8A 4NXMM 1E2GA 2MH8A 2RHLA 4RELA 1F5SA 5DTQA 4BQNA 4N48A 2XYHA 3E2MA 2PQ2A 4XUDA 3QWFA 4ZMRA 1GG2A 1TTEA 3CE9A 4MZXA 1KJNA 3OOWA 2GEUA 4N3NA 4S1PA 3TNJA 2VNIA 5FI5A 4UTZA 2J08A 3HL4A 3KL4A 4GKJB 3KPUA 3RRJA 1E2IA 3V7FA 2W8BB 4E2ZA 1E77A 3ND9A 4ZK2A 4PC2A 3GD5A 3TSAA 5KOHA 3DNFA 3QSYA 2IXFA 2XTZA 4ZI3A 2NPFA 2I22A 2VJBA 1E2HA 3QLUC 4FOOA 4KQIA 1R8JA 1W29A 1XAHA 1F9AA 5KVSA 3QA9A 1RJFA 2VT3A 2JAQA 1Z5UA 5CXXA 4Q05A 3TGLA 1LBQA 4R8VA 4XJVA 1C0PA 2P9QA 3TW4A 1MZPA 2OXEA 1UFKA 1K89A 3JXEA 1TH3A 5TQ2A 4PS1A 5TQ2B 3ZU2A 4BUZA 2XT9A 3WMFA 4JV5M 4RTKA 4S05A 1NXWA 5KC9A 5C1BA 1KQPA 1KJJA 2FWPA 2NP6A 4O4LB 2I78A 4H4CA 1E3DA 2YR0A 2QQ0A 3Q88A 1OYVA 2LCIA 5JVDB 2VA8A 1JSXA 3PC6A 5AMXA 5GOTA 4ND8B 4CTOA 1Z2CA 4EB8A 4ENQA 2BV3A 5BPHA 3JWIA 2ICAA 2ZCUA 1AQUA 4PWZA 1G8JA 2Q41A 3ITDA 3L77A 4L07A 3FXAA 4NICA 4XGRA 3RU9A 3K70B 1PX0A 1JLHA 2O7NA 1OXBB 2R751 1RTKA 3Q6MA 3HQ4O 1SPBS 4BNXA 1U0BB 4EJ0A 3L28A 2C9ZA 2GRAA 1I1OA 3A4LA 2DAGA 3CTPA 4JYMA 4DV5B 1NN5A 2Q3FA 1X7HA 2VK4A 2GEBA 3HGQA 1RJGA 3MTBA 3PWTA 4KN9S 1ZDMA 4MTLA 1UIRA 2X7XA 3FUCA 4DQDA 5K99A 2E4AA 6ABPA 4NXMB 1Z17A 1FK8A 1HZZA 3DDSA 1KWGA 1N6IA 4GX0A 4TV8F 1W59A 3GRPA 3PCTA 2NTJA 3KJNA 4FT2A 3U81A 5CM2Z 2DM6A 3TLZA 4NAHA 3D6FA 3ZLUA 4DM4A 1UKZA 2ZOSA 3H4MA 4KW7A 4GBGA 2XMCA 2GYUA 2XXJA 3BJZA 2IDZA 3L4SO 3PDIA 3BCUA 3RG2A 3TSYA 5IS2A 1RYEA 3KPVA 1QKJA 4IDCA 3G0GA 1Y5IA 5JCZA 3AKZA 3KXDA 4D9GA 1UC4B 1FNMA 4ZKDA 1PJ8A 1NBEA 3GEIA 3W3AA 3O94A 4DR6M 1IBSA 3YASA 4NYMR 3JQPA 1YBVA 4D0GA 2EL9A 2IYSA 4ALLA 2IODA 4QJ5A 5AXBA 1S7GA 2O8FA 3GGPA 1QZZA 2JY6B 1ZESA 1ZM3A 4F6CA 3NJ8A 2GETA 4BVKA 4QPPA 4N8DA 2PTHA 3FCUB 3PENA 3BWVA 4QYTA 3F6SA 4Q93A 5KEIA 2V59A 4NJOA 1QYXA 3FVVA 2O1SA 5BMVA 3K1YA 1JXQA 1DTEA 3KK0A 4CKEB 1X1SA 3CMMA 4D97A 1T36A 3FYTA 2YW2A 3QUSA 4BU0A 4URXR 2XB2A 1JRLA 3GY0A 2JY5A 4IGKA 3T1NA 4UCFA 3DE6X 3EXFA 2EBWA 1Z0SA 2KXEA 3PC8C 2H2WA 1JS1X 2CLHB 4PAWA 3B13B 3GLHE 1IUKA 2ZTLA 4P3NA 4WV3A 3U6CA 5FFNA 4RF0A 1YKSA 1ZK0A 4I1IA 5FTLA 1G38A 1YSYA 2H17A 3A3OA 1I1QB 1T5BA 4BIIA 3ZY6A 1YBAA 3BULA 4J3JA 4Q3BA 1W52X 3G9UA 3R7NA 1CUHA 1EJBA 1YFKA 2VO1A 4C7VA 5EXTA 4MYUA 3KYCA 3OIFA 4IDDA 1PWZA 2JLCA 2ZKLA 1NUAA 4B4KA 1S1CA 2VF4X 5M34A 1M2HA 5IUJC 1FJGB 4BKRA 4TTQA 1WOYA 1JIKA 2RG1A 3HLYA 3EOAI 2ZBKB 1IEVA 1YS7A 2OCBA 1ECLA 1FP2A 2HD4A 2AK2A 4DR4M 4R1OA 2A9PA 1QO0A 1T6OA 2GN4A 5LA6A 3SJUA 4D99A 2GN9A 3CF6E 1V11B 2WG1A 3ZDAA 2C2GA 4OV6B 1GY8A 3G0CA 2JY7A 2VJLA 4I2NA 4ND6A 5JWHA 5IW8A 2Q4DA 2YQ4A 2XUHA 3PWKA 3HUTA 3QG5A 4MRMA 1RQGA 5IK2D 2O8DA 3WZ2A 1Z34A 2PANA 2FUNB 4A6PA 4LCBA 4Y7DA 2GA9A 4Q9DA 2X0FA 1C8VB 1SWVA 2QZJA 1C7JA 2ZRHA 2Z95A 3VDRA 2GXAA 2NG1A 1OX4A 1VKRA 4M1OA 3AEQA 1UDXA 3EQ8A 3FPCA 3COPA 3E22A 3EJWA 2PV0A 4FLFA 4LWZA 3EVEA 4BWFB 4FYMA 2HNKA 1XRPA 4BNKA 4PN3A 4JXZA 1W0JD 3K9NA 1XMJA 1J90A 3G2QA 1G42A 2A0UA 1CIVA 4ACAA 4D4IA 4EBBA 3GO8A 4LSGA 1EVEA 2VQFM 1KSHA 2PN1A 3PJEA 1ZN9A 2GEJA 1WXWA 1XVIA 1Z22A 2EOAA 4G85A 4JNCA 4MA0A 4C5BA 4GQBA 3ZGLA 3ZUPA 4E5PA 2FK8A 2C5SA 3LW5F 2V3WA 3HMQA 3BDVA 4HZUA 3KR2A 4BFSA 3S81A 4PLCA 3DBLA 2IYLD 2HC9A 1PTKA 3F3YA 1WULS 1P1CA 1VE6A 2H07A 1ZY2A 2PUVA 1RTTA 1EDEA 1E9DA 1BXRA 3PUWA 4RPIA 5LDDC 3DUFA 3COWA 2DFDA 4RZ2A 3L0PA 4GXRA 3T61A 1A2OA 1XVVA 2X22A 3S8MA 4YMLA 2PJUA 4AROA 1IAQA 1U7HA 2H29A 1X9HA 2ZU6A 2ISQA 1S3SA 4X7MA 2XAUA 4PZZA 3BGVA 4I66A 2V1CA 2GTPA 2XWBF 2ZJ2A 3QPBA 5AK3A 3WV5A 2HZBA 4CV0A 1TF5A 2VP9A 1Z7BA 2ZUUA 3A6PC 2Y20A 1JIJA 5J4VA 4QXPA 5JNVA 3ASVA 4JN6B 2JGDA 3EZNA 2EQ5A 2I4MA 2VH1A 3C2QA 3CX7A 3PUZA 4YMSA 2RH9B 4OI4A 1PSZA 2G0TA 2VLBA 1KDVA 2UZIR 5ALGA 3ZU6A 3KD2A 4TMVA 5IN5A 3G0IA 4B3TB 3KS9A 2V5VA 3VPBA 3HJ8A 4CIXA 1IIBA 1RDFA 2XYRA 2Y1DA 4INJA 1I2CA 4O4IA 1K8YB 5HF9A 3A6HA 4JQCA 1YVPA 1R0ZA 4FWHA 5AVWA 3DXYA 4O4HA 3IQIX 1Z4PX 3E9QA 3R7DA 3X0DA 3GXOA 1E2BA 1XZEA 4X3CA 3KQKA 1E0JA 2WM2A 1RYHA 4L1KA 5DEOA 5BMVF 1OTHA 1PGOA 4GRAA 4PYQA 1KQFA 3SQDA 2GD0A 1FTSA 2V6GA 1W5FA 1AQYA 5C32A 1A1VA 3T8YA 2J7PA 2GHTA 2IPLA 1MD9A 3R09A 3R0XA 4EELA 2GHRA 4UUPA 1FMTA 5TDHA 2F48A 2WILA 4AS1A 2ZSKA 1DJPA 2JGNA 3NV9A 4RHEA 1PVVA 4BQIA 1MQAA 1X1BA 3IVXA 3DMFA 3TIFA 3FN4A 3JASB 3RYHA 1FTWA 2V9CA 1VFPA 3B5EA 2EARA 3E8XA 3O73A 2F59A 2WJVA 3C98A 4KVAA 4UEQA 4TKVA 3AOGA 9ABPA 4WD3A 5EVCA 4IGEA 2C2MA 4ME6A 3C4QA 4OHMA 4L51A 1QDEA 1V3UA 3VR2A 1S0UA 1WCIA 4BJ6A 4RVNA 3CC8A 5DLPA 5K3FA 4KHPM 3WYGA 1XTRA 1GV1A 1RWMA 1Y1RA 1ZM9A 2NV6A 3IEKA 3JR3A 3IIMA 4XVQA 4IQFA 1LB1B 4KDCA 4BMXA 1ST2A 1XLWA 3IYLW 3S29A 1XZHA 3IS3A 1GLVA 3GEBA 2A5YB 2OSBA 3MHTA 4FGJA 2PEZA 2I65A 3TM5A 4RZXA 5HMMA 4EJSB 4GPAA 1NJGA 3FNEA 4JNKA 5LQSA 3E5MA 1F14A 1JV2B 4D81A 1UWCA 3STUA 6YASA 1Z5NA 3K5PA 5H16A 1L8OA 1JW9B 1VLQA 4R2WA 4ZVOA 3KS4A 2D2IA 2QN3A 2GPAA 4K6OA 1UIMA 4UHFA 4YX9A 5MHTA 4PYRA 2NUPA 1O6ZA 1GQRA 4Y6SA 3R7FA 5AVKA 5B7QA 5CLIA 2GD2A 4WZ6A 5KPJA 5EHGA 5FFFA 1NN3A 1OH6A 3P9NA 1E2FA 2IW3A 1GTSA 5TY0A 2FF5A 2H3EA 1ZHFA 4C3VA 4DL9A 5KS2A 1VL0A 3DF9A 4JELA 4U6QA 1UWVA 1B8OA 1QP8A 3H9EO 821PA 1BU5A 3NUQA 5SYNA 1UF9A 3NFRA 3KTAA 2FPLA 2DQ4A 3NAZA 3P9QA 3PLNA 3PE4A 4TLMB 5H81A 4M83A 4Z4IA 1D2MA 4PFQA 4DMMA 5FUVA 2ZFUA 4ZRDA 1XR3A 3FOEC 4FMCF 1H6CA 3P9IA 1YNSA 3VHRA 1ZA2A 3U37A 1UC5B 3UATA 4Y9SA 5B58T 3LNCA 2QP4A 4B9EA 3VPDA 1T2UA 1YACA 2QLMA 3I04A 4K26A 1M54A 5JAPA 2EBHX 4ZRMA 2ECOA 3BQNB 4CMEC 2TRSB 1U7PA 4KHPB 1UH5A 4GI1A 5E6RB 3DA8A 1DNPA 1K6EA 3T9CA 5JAMA 4WLUA 1JU4A 4ER5A 3GRZA 3FJOA 1YBHA 2MR9A 4PDGA 1J0CA 4RK6A 3OHSX 4NPCA 4BZWA 2GPSA 5LPNA 1YC5A 3GPDG 4P5EA 5AJZA 1UEIA 3D54D 3ZCRA 1QUFA 2X1HA 3ZWMA 10MHA 4RK7A 3CZRA 2JUJA 1TYCA 5ECDA 1E1NA 3EB9A 2XLBA 4AXXA 2B3DA 3PNMA 4K3VA 5IJAA 5THXA 4I1RA 4KJZA 3JR5A 2YL2A 3GLSA 3BRCA 4HAZA 3RVNA 3ZOKA 1XL1A 1U7DA 2I55A 2X2OA 2AEJA 4PICA 2I1LA 1W30A 2B9VA 1EM6A 4MS4B 3VPFA 4BJ5A 2FOIA 3R5XA 4LECA 4Q9NA 2HJWA 4E5MA 2A7XA 3STYA 4MWZA 1JZTA 1XTSA 3KFUG 3HJBA 4HLUA 4URHA 2CWDA 2GZAA 3QOYA 4K8OA 1JLMA 1QRDA 3TTVA 4R8SA 1YU6A 1AS2A 3KOXE 2AW5A 4HAVA 4OYLA 5SZKB 3WFZA 1PZGA 5IXJA 4YMVA 4F04A 1GGJA 3U3XA 3NTRA 4KXVA 4OKNA 3VQTA 1JBQA 3WGTA 4CKBA 1PR0A 1M7HA 5CNKA 4IQ8A 1RI5A 2OCAA 3NM6B 4RTOA 3R7SA 1V1MB 4F1JA 3V1MA 4C4AA 4CF6A 4AJ4A 3BKWA 4QODA 1GCAA 4KQGA 3RSFA 3Q8XA 2CKMA 3L8CA 1H1TA 4U2GA 4U2DA 1VI5A 2QVGA 5C5CA 1XTTA 3NJ4A 1G21E 2FEPA 1Y9EA 3T5DA 1PP4A 3JR4A 2IYYA 3NM5A 2R00A 3HGIA 4EI8A 4LXGA 1EP3B 5B7PA 1EHCA 1U9IC 2X40A 3EMDA 4X41A 5TQVA 4Q4DA 3CS3A 3N0TA 2V6FA 2WKQA 5ESXA 3CR3C 1GG5A 4XQEA 3VKHA 3I1JA 4PG8A 3QBDA 3TXYA 4RY9A 1OR8A 4Q3CA 5K0NA 4NY1A 3Q15C 4V38A 2ADOA 2D00A 4HSEA 4YDQA 2RH4A 5C7IO 1WMFA 4RMHA 5EWLB 1U2EA 1Y9DA 4P80A 1NR5A 3SP1A 4CKYA 5BT8A 3VNSA 1Y8AA 4G3OA 3IBGA 1PYGA 1UBCA 3IJEB 3PZBA 3N0VA 2WU3A 4BLCA 2IPXA 1C9DB 3KYDA 4YR7A 3CLKA 3CUUA 1LDEA 1J0BA 1J8QA 3RBXA 3HK2A 3WY9A 2Q4TA 2WYWA 4JYZA 2ODNA 1PBTA 1CQIB 2GF0A 2W2QA 3I28A 3G5UA 4AAYA 2JGEA 4MLZA 3UCEA 2PT6A 3TLCA 1K97A 4LW8A 3HZJA 4P5DA 3TAUA 1NRWA 2OFOA 3V6MA 1WW2A 2P68A 4KOAA 3OM1A 1G3UA 3RDPA 1P0CA 4BZZA 4BLRA 5JSQA 2YZGA 5EZYB 4JIGA 4IX9A 1RJDA 4YAEA 1B3RA 1PVDA 1U3VA 4X6LA 5F7OA 4ARIA 5CP8A 3LMMA 1R50A 4AF7A 4RTNA 2C3PA 4P3PA 1DO2A 2QTHA 4ID9A 3DONA 4I4NA 4KGXA 4AVYA 3QJGA 3HX3A 3WHKA 4TN1A 1NQOA 1Y5NA 1WHTB 2IBTA 4G0XA 3MA0A 5I3CA 3DKPA 1G0OA 2XR1A 2X0EA 4BEWA 1KK1A 2VK1A 1HDZA 2WBLC 3AHGA 2QW8A 4CMAA 2YN4A 1GZ7A 1TFUA 2HF9A 3KKZA 5K3FB 1OVMA 2J9YB 4XAQA 3R5FA 1QQWA 4G9EA 3B53X 3R0VA 1MT0A 3BXHA 3CEPB 5DHQA 4CTNA 2I4TA 3MF4A 4NEHB 4MRAA 4D1YA 1JR3A 4HRYA 2C31A 2GD6A 2PUTA 3VKVA 3VR0A 5EJGA 4OCZA 5G3YA 1EGVB 3C6YA 5IZCA 2BMWA 1VPTA 4P33A 4FVTA 4RJKA 2CL7X 2OOKA 4BVBA 6GPBA 4ZO7A 5IUNC 3D8TA 5HTOA 4DDUA 5JQWA 4UHDA 2BHTA 1Y1LA 2VPZA 4LV5B 5CIWA 5EIBD 1P7WA 1MG5A 3F6PA 5EXPA 2XV1A 4QYMA 4Y2PA 2O9JA 2QJFA 2Q3BA 2IEIA 1YVDA 3TRDA 5TLSA 2WLTA 3V1UA 1NLYA 3M6VA 1CUDA 4PYIA 5HF8A 5EJAA 3KSJA 3KZ1E 3S70A 3A7DA 2JEOA 4YRDA 1VMEA 1WE2A 1NY5A 4HRVA 4A8JC 5IAOA 4RMJA 1K0FA 2JC3A 2C61A 3IE0A 3L6EA 4FGKA 3ABRB 3T95A 1XLTC 3VPCA 3AONB 2CFTA 4MV0A 1AD2A 2LDBA 4YCAA 2BGJA 1SVSA 3W5VA 4UMVA 3LUCA 4GMXA 1HYBA 3K9HA 3F49S 3NKLA 4OATA 2A0YA 2K2QB 5C3MA 2GZHA 3OQJA 2DAMA 3OD5A 4BEVA 5BNZA 2C07A 2POCA 2YQ5A 3QXHA 1NVEA 3EWNA 4GDFA 4E3ZA 1IOZA 1TJNA 2WWRA 3E61A 3GYGA 1IG0A 1KBZA 2F4VM 2GJ9A 5CX4A 4H7EA 3WYDA 3K05A 2C97A 1MU0A 3ASYA 1U0OC 1F2TA 2OECA 5TX7A 3V9PA 1V6SA 1HE1C 2CVFA 3NQ41 5G53C 2WKWA 5C7YA 2R6GA 5BQOA 2C7OA 1CUZA 4AP6A 3OQOA 3VKUA 2N42A 4CBVA 2JFVA 5EZ6B 3KXKA 5AJYA 2FN8A 4CMBA 1QYCA 4EHHA 4K2HA 4MPRA 1B2RA 2CY0A 4RUKA 5CHEA 3GO4A 1QU3A 1WW8A 5C7OO 1Z37A 1KSJA 3EVNA 1L5NA 4R41A 2O8DB 3BE5A 1FU7A 1Y1TA 1YAHA 3P52A 3EJ6A 4ZCLA 1ECJA 2LVAA 4DJAA 1K08A 5EESA 1HNZM 1C1DA 3L6RA 4YASA 3G5TA 4NKRA 2R65A 3HR4A 4J1QA 5ALJA 4JI1M 2VWHA 1RC8A 2AA3A 3OP4A 3P96A 4XBOA 1FYXA 3LT1A 3GJSA 3OEHA 1WCV1 1B4DA 2FCRA 1CU1A 3OETA 3JWEA 3RG8A 1KI3A 1DBIA 3AFHA 4JLWA 3ONWA 2V7EA 4JVMA 3ZGZA 4E5UA 5JXIA 3WWYA 3VA7A 3R0JA 1J2YA 4AB1A 1UINA 4RYDA 4B2YA 4J43A 3V1KA 1HORA 4NMXB 5IM4A 1PK9A 3W0LB 1QWOA 4RY8A 5DBIA 1UMBA 2CYCA 1H4TA 4LZOA 2C9CA 1E1LA 1MBZA 1QNFA 3KJGA 5KAPA 4M9UA 3SC2A 4TSFD 4CLRA 5D85A 3ZCUA 1E3SA 1U8UA 2X41A 2EW1A 3R6DA 4R6WA 2C8JA 2HLDD 2JFBA 3HKBB 4RPKA 1W85A 3LNTA 1FFWA 3X44A 1IQPA 2C20A 1DINA 4DR5B 1W4BA 3ZK8A 4DUGD 1BWPA 1SD5A 1XKXA 1Y8RB 1RABA 2HT1A 5ICEA 1Z7WA 4KQHA 4NENA 1SHLA 2JCBA 3OT5A 4M1MA 4NENB 3TVTA 3ZEAA 2V7UA 1X7YB 1A9RA 2AUTA 3DOHA 1BX1A 4N65A 4G0NA 1WB5A 3BXPA 3IP8A 3UK0A 3IHTA 4QTYA 4I1UA 4EYOA 1P2SA 3K71B 1ESNA 1DXQA 2R6JA 4XRGA 3UNXA 1AKMA 2O3TA 1OC2A 1S8NA 3NANA 3FPAA 3WVNA 2NZ2A 1IXZA 2W4QA 4YHHM 4MTCA 3B82A 3IV6A 4MR9A 1EFHA 3HCDA 1DDGA 3ECSA 3OU2A 1M1UA 3EMKA 3DULA 4RKYA 4EPYA 1K27A 3ITKA 1C0IA 2X3UA 4V1CA 1CCWA 4H60A 1G9TA 1GSAA 2IV2X 2GQFA 3N6XA 4OOFA 3CM0A 1EVZA 5DCLA 2DOKA 5HR5A 1LPSA 2R60A 1AXRA 5IMSA 2QRZA 5IAAA 3PP8A 3MEQA 5KPZA 4D43A 1W96A 5EKTA 2WJWA 5KVCA 4IBBA 2EF0A 3CUTA 2DZLA 4TRMA 3UK1A 3UJ3X 3MJHA 1L6RA 1PWXA 5LU9A 3AEUB 2OENG 5BY2A 5AT1A 3DZDA 4E46A 1PKXA 1VPEA 3JQ8A 3AHJA 3RRXA 2V7QA 2VXCA 3KSDO 1ZAKA 4AKIA 2RGWA 1GTL1 4D79A 3WWOA 4DR5M 4OQQA 2B0CA 4PLPA 2QRGA 4AY6A 2FWRA 1FRZA 3R3UA 4G1EB 2NU8A 4KIUA 4BQRA 4I4IA 4CQJA 4MK4A 5JH7B 3L25A 4GKBA 3A1CA 4ENRA 1YDMA 1C7FA 2GD1O 4Y30A 2SKDA 5KNDA 1QGUB 4O3FA 4MWCA 4OBXA 5HZMA 2C99A 2EG9A 5HS6A 3VTKA 1GU1A 3SQXA 1KI6A 2UVPB 5KTMA 3DMDA 1XMPA 5KYYA 3ZNNA 4Z1MA 1BD4A 1CUWA 2XQKA 2JFZA 3KYJB 4F3KA 5KQSA 2Q1TA 2D6FA 1CHDA 1WTCA 3LMKA 1L4FA 2ZZKA 1MPXA 3T3EA 2ONCA 2AEEA 1JSCA 2KHZA 1NFQA 4N0PA 4EMSA 4XIGS 2QB5A 5U9CA 3SF0A 1VEJA 4KGDA 2F9MA 4ATNA 5DMHA 3IP3A 1YJ5A 1X39A 4OAOA 4F0JA 1QRTA 3W6OA 2FW1A 2P27A 3BD8A 3GJ7A 4ZC8A 1DQZA 1KEEB 3BGSA 1DV1A 2HQOA 3A98B 4OXYA 1CUKA 5CA1A 1EX1A 3KP0E 4FBLA 1FQOA 3STXA 4CQLA 3CU5A 4G4GA 1CR6A 4YRZA 4WFQA 4XIFA 5LD2B 2ATXA 1U99A 1Y6GA 4FFVA 1CY7A 3BIFA 1G71A 2QENA 1S2OA 2AX3A 2FSVC 3UYLA 1PQUA 3W4JA 2WF9A 3D0KA 1F4LA 3HTXA 4CFYA 4KXFB 5MFPA 4FGWA 3NRCA 5F1PA 4O2AF 1GTZA 3QITA 2AHRA 1L2DA 2PKCA 5FBZA 3BWCA 4BN5A 2W6NA 1V1JA 4ZO8A 5ALVA 3HZHA 1U0GA 5DGXA 1KAHA 2DBYA 2ZQ5A 1NN0A 1TM5E 2YXEA 3E7WA 3RTGA 4AF6A 4Q4JB 1AZWA 1E4EA 4X8HA 3L2OB 5LP1A 1D7AA 4RD3A 1TTPB 3OHMA 1ZCJA 3C1AA 3EE6A 4RWEA 4RY0A 4CM7A 1SB8A 5KDLA 4FDAA 4XYBA 2BGUA 4F4UA 4RGYA 1ECFA 1VLMA 2D5AA 4LC9A 5I5GA 3ZU5A 3CZ9A 3PF9A 2I2FA 2NZ8A 4BQOA 5T64A 1T2CA 3SVTA 1RYNA 1L4HA 2FOXA 4Q3AA 4FUTA 3H1FA 3L7OA 1B6TA 2E21A 3NGMA 4KGVA 3WGQA 1ZVQA 2CNNA 1L7PA 5KTOA 1A9XB 2YINC 3IA2A 1A9XA 4GKKB 3TIXB 3C4VA 2R11A 3ESZA 3HVJA 3NNDA 4U7FA 4AXBA 3LS2A 3PDWA 1NF2A 2ZPTX 4GBED 4KR3A 2EJCA 2MINB 4OJQA 1T8SA 1P73A 4RVGA 3U6KA 1D1SA 1CIJA 1KI4A 4RK4A 3THGA 1DKPA 2EEZA 1BTOA 1MIOA 1PR9A 3JQAA 3NDJA 3VR5A 1XT6A 3LXMA 4Q48A 3CGGA 4Y2XA 4EKIA 1YS6A 3H75A 3WB0A 2P6RA 4NDNE 3CUKA 1CEXA 1ORYB 1PUJA 2N47A 3RUEA 1TU3A 2CUNA 3ZY4A 2OVFA 5K8LA 4HGNA 2QPTA 5H83A 4KSBA 4KC0A 5DM0A 1FW6A 2B6NA 5CDSA 4U3JB 5FNVF 2QJRA 2Y21A 1KOJA 3NUGA 4BMYA 4LVNA 5I9IA 1KVUA 2RGAA 2L19A 4LQ4A 5ES4B 4KBFA 1KMIY 2B8EA 4HNHA 2OUKA 2I2AA 4JKYA 3RT9A 2ZJ8A 3J2PB 4X00A 2G9NA 3KU1A 1TFRA 2LPMA 4RACA 5DKFA 4FI3C 2Q46A 1KAEA 4ZJYA 3P71T 2PLRA 2QRLA 3D3JA 4UCWA 4XTCS 3BBPA 1TKRA 3UHAA 4CRWB 5ITZA 4M3NA 2HIMA 2BKUA 2DY1A 3G9QA 7MHTA 3UKDA 3HADA 4EGAA 4HSGA 4CTMA 2BMJA 1PD0A 3JD1A 2L18A 3GFBA 3QNWA 3A3KA 3CN7A 3WQSB 1ZUHA 2LVQD 4FHDA 2GPWA 2FUEA 4MV3A 2ANBA 6CHYA 1WG8A 2O59A 2Y0TA 1CY4A 3QOWA 2QRUA 3WDMA 4DREA 5B7GA 2WUVA 4E51A 4H1UA 4HN4B 1L5FA 1Q0UA 2PFKA 4OUDA 5CYPA 3VVLA 5DHFA 1CUGA 2Q99A 2X9GA 3I0ZA 3K0HA 2PD6A 5DN9A 3IR5A 3HBNA 4JA2A 5IJ9A 4NNOA 2G4VA 4TWBA 5KYTA 3CVWA 4JI0M 4HQOA 2FPSA 3LOQA 3RYIA 2JFFA 1OASA 3ILYA 3KT3A 2H31A 3ULKA 4DWJA 1SB9A 4C7OB 1FE8A 4F8JA 3PSAA 3RHZA 5BR8M 2DPMA 2BTOA 4FJ1A 4LMRA 1UXOA 5AUOB 3I6IA 2GJSA 4KZKA 4LGVA 3WLEA 4QTZA 4YPOA 1WO8A 1TUEA 2C5GA 4N03A 3OJ0A 4MRRA 1NYRA 3EIWA 3WNDA 4MJ3A 2HV9A 4PNZA 4DCVA 4DV0B 3KOXA 3PQ5A 5DYIA 2XZDA 2ZRBA 3OEEA 3LC7O 3U2QA 4MKFA 3FF1A 3LCRA 4KSCA 5F2KA 1QMGA 2VQFB 2N1MA 3AEUA 1IB0A 3LBAA 3FGNA 3TX2A 4IV0A 4EGCB 1DKRA 2CB0A 4HNRA 4MQ4A 1KH1A 5A4IS 2R7LA 2BTEA 2J5KA 2BF4A 3TB6A 2QN6A 1ENPA 1FX0A 1N2BA 3E5HA 4YUAA 1FX0B 4DB2A 1R5LA 1E9VA 1XAJA 2W8BA 4P32A 2C5BA 2XZTA 2I4IA 4V0QA 1RC1A 2Y6VA 1RKQA 3L0ZA 5ABPA 2R2AA 4MV6A 1OH8A 1ZIYA 3FB4A 1ZP6A 1DVRA 4Q4AA 3B70A 4Q4AB 4ER6A 3KLBA 3UA3A 1P1FA 1CDEA 1IULA 4LK3A 1JEJA 3LHIA 2YFQA 4QO8A 5HE8A 4OJYA 4L4YA 1W88A 3PF8A 5EMMA 3IX7A 1TH2A 4JJFA 3R3YA 3VI4B 4YV0A 1N2IA 1CYEA 1Z56C 2AV6A 2F17A 4KTTE 1VKJA 1QQAA 4S35A 3SXPA 3F8WA 2IKSA 5CT9A 1IUOA 1XQVA 5ALZA 3VSCA 4A7PA 2M5ZA 1TYBE 2X9QA 4KQKA 1URPA 3I3SR 5F33A 4BX2A 2WNSA 4PVDA 4H7JA 4ER0A 4I14A 3WLIA 5AJWA 3TZBA 1U0HC 3C4JA 3STHA 4B4UA 2DCMA 1QIEA 2CN1A 2R87A 5A2QA 1RAFA 4GLJA 2QRVA 3LG2A 3NP9A 1ZJ5A 1C0LA 1DKUA 1DQNA 4NVRA 4I99A 4E4TA 1QG2A 4OX9B 2ECKA 4UAVA 1X80A 1TGYA 2BGKA 2Y0DA 4PZUA 2J0VA 3A05A 4I4CA 4K9LA 4EHDA 4DJJA 3LL4A 2C1EA 5EINA 1G1MA 3WKBA 3Q12A 3RFVA 1RHKA 4LYFA 4W6QA 4IR7A 1RWKA 2IOFK 2GBIA 3HCCA 3VPGA 5I47A 1DX4A 2V5UA 2O5EA 2PO5A 3DWGA 2RONA 1E9SA 1M2FA 2QMEA 4AJOA 1R5JA 1NKTA 2FE1A 3C7DB 2HZ7A 3N2EA 4OPMA 4DHEA 4RZQA 2NVUB 2E0IA 4MZDA 4OJKA 2XUOA 3RGGA 2O4CA 1USKA 2E6UX 1WETA 1G59A 1G3QA 2CLDX 3IIJA 3S1SA 1AN0A 3A1EA 4LRSB 1TQDA 3F6YA 2PE5A 2TMYA 1YF3A 2VWQA 3ZGYA 1C50A 2PWPA 4DOMA 4B84A 3HJRA 3C6BA 3G9XA 5HILA 2D7HA 1KF0A 4MIYA 1ZD8A 2NO7A 2VL7A 3IP1A 3KB8A 3BMQA 4G81A 1PQ4A 1NPDA 4DCMA 5IJZA 1SVOA 1Z7GA 1USVA 4TQGA 5AHWA 1NMQA 2V7GA 5K0LA 2NUPB 2XF3A 3HO8A 4WCFB 5KMGA 1ADBA 3OQIA 3HUEA 5ANRB 1XXLA 1ZL2A 2APJA 2C2KA 3OPYB 5ADVA 3ABQB 3V1TC 4RPCA 2Z6AA 1M1NB 2AUMA 4YC7A 2VJOA 1Y3BE 3CW2A 1VB5A 3IAXA 4X95A 5B6PA 5FYDA 2O8EB 2ZJ6A 3FNHA 1EFUA 4B3HA 4KPFC 1S01A 2E85A 1F4PA 1RPAA 3KVYA 4RSMA 5ALUA 1TTQB 4RF1A 2AFHE 4YIKA 1YS9A 1EAYA 3AF1A 2XSZD 3BORA 1AHIA 2VDWA 3UFBA 4U8GA 5J5AA 3HZRA 4MW2A 1NL3A 5FOVA 1Q77A 3O4FA 4OHKA 2JZ0A 5A05A 3SZ3A 2G5TA 3R3WA 4GLBA 3EGVA 4WLVA 2PKQP 3BFKA 2CKDA 3FWPA 4FMCB 4AJPA 4JU8A 2EJWA 4GQAA 1T0HB 3DBOB 4N8EA 4Q16A 3I5AA 3BFXA 5H5JA 1F8GA 3DDWA 5JYBA 3HZOA 3PPXA 2F8TA 5JECA 1XFDA 3CZPA 2BSAA 3WRXA 3GD7A 5LIPA 1LRLA 3IB3A 4JYCA 4NL4H 1NDUA 1NI4A 3DHYA 3PL5A 4H59A 4K9KA 4TMTA 1T0JB 4CE6A 3OHPA 5TEVA 1WPQA 2VYVD 1MVNA 1R6TA 1P0MA 1WCWA 2OZVA 1DEAA 3TFWA 3WHPA 3S5JA 4D3XA 4JLVA 1OFUA 3MGGA 2VDOB 1Y8RA 1K7YA 3DZFA 4W1PA 3AKCA 3RSOA 5HF6A 2V74B 4PHHA 3VYUB 4J16C 2Y05A 3AM3A 3GCDA 3Q5DA 4H9GA 4QC2A 3LBIA 1S89A 2BZ1A 1YMUA 2PR2A 2WJAA 2YJ5A 3G1TA 2UVDA 2SKEA 1U81A 2AG1A 2HIGA 2G4CA 4OJMX 4Y6LA 2OFWA 4F9TA 4QM6A 1NOIA 1YZNA 3NBUA 2CDNA 4P8RA 5DSXA 3F7MA 1Z25A 4XCQA 3WP1B 4M8LA 3BYZA 4QXQA 4XKJA 3MWEA 2A4MA 2PR7A 3NYQA 3E18A 2RB4A 2R85A 3PHLA 4D4GA 5I8PA 1HC7A 2Q8NA 1FLVA 1D09A 2J32A 3GEEA 1JQEA 2GBPA 5FWXA 1RHRA 3IVRA 2QAIA 4GZ6A 3X1MA 3ZDBA 3HCFA 2ZRLA 5AKEA 1ZMXA 4CU5A 3E2PA 2QCUA 1XF1A 4EJFA 1RWNA 5JRDS 1SKUA 3R3XA 1H5NA 1W49A 4DQKA 4NEGA 1L1QA 4PSAA 2D8MA 3QFCA 4OGKA 4AZWA 2DJIA 4HQLA 4L3WA 1QAMA 5AM0A 5JARA 2DUWA 2JEYA 3NRJA 5I9BA 1R0KA 2VHUA 1NRIA 1W2WB 1NUUA 1O6FA 2DWUA 3EYAA 1ONOA 3Q3HA 3ETNA 4I5DA 4I19A 4RKFA 5BV1A 3MMSA 1Y80A 3RRZA 3UAWA 4G1UC 5CFZA 3DCNA 1Q22A 5JH7A 4KXLA 2OCPA 4DLUA 1Z3CA 2HSZA 4AQ7A 3AMVA 2CMHA 2FHPA 5TMDA 3P9KA 1SFRA 1E59A 5CH8A 5JYDA 1QOPB 3O84A 4QVGA 1WHTA 1H22A 1Q19A 1V5FA 4LZNA 4Q15A 4WCVA 4ASUD 4TS1A 2F3RA 3Q87B 4FIDA 3ZCQA 5K01A 2I3GA 2ZRQA 3EH1A 3Q9LA 2VUUA 4LG2A 3B89A 3H2IA 1V5WA 2JLZA 4V1CB 5GINE 2WA2A 4BWGA 2DR3A 4ZVRA 1OROA 1GEGA 3BWXA 3W90A 4BNVA 3AL3A 4ABYA 5JQGF 3WZLA 1LV8A 4OA5A 4BNDA 5AICA 1S2DA 2ZRAA 1T9AA 1HG0A 4XLZA 1P81A 4LRUA 4ARVA 1BDHA 3SBJA 5AK6A 4UXJA 2LVNC 1P6XA 4CIWA 2Z8YM 3HEAA 3QUBA 2YUTA 2WZBA 3DOOA 4GP9A 4BLVA 3QE9Y 3ZE1B 1POWA 4ETMA 4MUKA 4IY1A 3UTDA 3ABZA 3VISA 1IPFA 5FHQA 1M33A 2ZZMA 4IG4A 2UXDB 1INLA 1E8MA 3D9QX 1X80B 4JMLA 5GM2A 4CV2A 1FJXA 2WU8A 4MR7B 3HB5X 5DBFA 1KE1A 1KFBB 2ZSJA 2I6FA 2V6IA 5EGNA 3W7AA 4LF7B 1E62A 3H2KA 4MP3A 4MLCA 5D6OA 1Y5RA 3QVVA 4U5QA 1J2RA 2VDBB 5KO3A 1QDTA 2Y0EA 1I7NA 3DSRA 3HJHA 2PBRA 4ZRNA 2HJ9A 4YP1A 4ZXPA 7YASA 3DAFA 3SS9X 5IVHA 2GAOA 1CEQA 2Z6VA 4UTOA 1XHEA 5L40A 4YDHB 2BZSA 4A8JA 3SASA 3WA7A 1XK7A 2ODAA 2GRJA 3IL2A 4X90A 1ZSNA 1Y4DE 1A5TA 5AVOA 3U7EB 2QTRA 1WZUA 4FP9A 3Q8WA 2E18A 2O48X 1SKBA 3OTGA 2QM3A 4WLFA 2J3HA 2AQ8A 3K9CA 2Z5GA 1XX6A 3A3NA 1SVWA 3IECA 2ZT5A 1FMLA 3LUJA 1P0QA 1YFZA 3HCEA 3A6EA 1XMVA 4HXYA 1QGDA 1LPBB 1U80A 4A5SA 1C4XA 1VHDA 2WJ3A 3DAHA 3ESQA 3NBYC 4IGIA 4JITA 1QC5B 2AC2A 4CIBA 4G97A 1K82A 4YUVA 1UK6A 3RBAA 3SAJA 1O94C 1WHSA 1VP9A 4P92A 4CF7A 5E6UB 2HSJA 4EA7A 3M9LA 3PXAA 1BX0A 1DC7A 1E60A 4ZCSA 4G0ZA 2WUEA 3GDFA 2W2OA 3F74A 1FSSA 3RWBA 4NU5A 5JWRA 3FPFA 2UXDM 3N39C 1XEXB 2HU8A 3LXXA 4K6MA 4B74A 2JBAB 1VBMA 1KYWA 2J4FA 3E46A 1DAIA 2Z9BA 3PK0A 4XRRA 5FCDA 2IEAA 2OESA 1CFJA 3F92A 3ROZA 4CM9D 3UMYA 3HACA 3NOQA 3OJEA 1CJVC 2VYND 3AX6A 2QTFA 3LYUA 2Y77A 1BFDA 1P9WA 5IT0A 1BRMA 2B7LA 3N2IA 4DV6M 1YZUA 1JAYA 1K7FB 1PEKE 3AESA 5I8ZA 4AW9A 1C4KA 5DDIP 1UR5A 3RU7A 1ABEA 2W2LA 4I6GA 3TI9A 4B2PA 1EBUA 1QAOA 5HS4A 2FP3A 1MHPA 3HSSA 3MB8A 2J9FA 3AJ8A 3NIWA 1FP7A 2QD3A 1XRJA 1Q3TA 3MJSA 4ZEMA 1F06A 2GASA 3A0RB 3ZZTA 3W04A 2ZJ5A 3FPLA 4ZALA 5IJWA 1AB6A 2ZAMA 3BJRA 3GAZA 1UM8A 1A9QA 1NE7A 3P0JA 4I9NA 4X3OA 3DV0A 4D9JA 3DLAA 4XTRA 3TQRA 4A16A 4RVOA 5LL6P 4YCSA 1QF7A 3E7XA 5K51A 1JEYB 2FXIA 3V8BA 2AZ4A 3UJDA 2A33A 4MS4A 3U6MA 1QPBA 4E2FA 1TCAA 4PRZA 5G02A 4QPNA 5EZYF 2IF0A 1P1BA 5TRTA 5KQPA 2IYNA 2VP6A 2YJ4A 3EULA 3FRJA 3RYIB 4B3IA 4BMNA 3THYA 4H1VA 1HDYA 5BXQC 3HU5A 1J0AA 2PPLA 3U56A 4Q37A 4KEAA 3GLFE 2A7QA 5CDFA 5LMZA 2Q2OA 4B71A 2QTCA 3IUMA 1V1MA 2E82A 1LK7A 2C00A 2WWWA 3H4TA 3LT2A 3QVGA 4HX5A 2NX2A 5GOZA 4EY6A 1HDCA 1YBFA 4KV7A 1O5IA 1PWHA 3L8DA 4CKBB 4Y2TA 1ORTA 3G68A 1SU4A 4CN9A 4EHAA 2XY4A 2AFIB 2ZI5A 2BMAA 3UENA 1UP7A 1B1AA 4Y2JA 3DCIA 2X2PA 1W76A 4PYLA 3B51X 5BN5B 5K4GA 4N7BA 3DO8A 4QQFA 1T24A 2ZI7A 5FPPA 3AKYA 2VIIA 2BE9A 1IG3A 5HF5A 1BXKA 3CLHA 3IOEA 4UXIA 4JLSA 3SEAA 3QYBA 1BD3A 1IYZA 1CJTC 1EH5A 3L1UA 4MIKA 4PHFA 1KR5A 5D8DA 1P7YA 3FSJX 5IAJA 4PNEA 4RTMA 5JS2A 3QFFA 2JK1A 4QATA 3U0VA 2XSZA 3N3AC 5FX2A 3JPYA 1J1IA 3B6MA 4X20B 1M2EA 1NUQA 2ZW9A 3VZCA 2VYNA 1MGPA 4QDZA 5CA0A 1JXAA 1XDGA 1V47A 3KHSA 3GEMA 4L0QA 3ZZ1A 5CDUA 1NXVA 5T4FA 2FPGB 4D8TA 4RORA 4EGFA 1CZLA 3KYBA 2EKQA 5B6JA 1GSOA 1BOFA 3VSAA 4RTPA 3QBVA 4LYAA 5DTIA 4RO0A 1ZJZA 4HEJA 2PNJA 1GN8A 4MUJA 2WOJA 2BSQA 4P0PB 1A4RA 1F12A 2GF2A 2QL9A 3AHIA 1NFRA 3K5WA 3MD9A 2IOFA 4D8VA 4WBNF 5C4IA 3H19A 4F12A 3Q3CA 1Z5WA 4UVDA 5COBA 1LY1A 1UJ2A 2PIDA 5CVEA 3MK6A 2OYSA 4Q02A 2QHOB 3LDGA 1XJ0A 3L93A 4MKGA 1N2ZA 4NULA 2DETA 3R77A 3GFPA 3V4LA 3AVTA 4DR1B 3LP8A 2GK6A 2Q5EA 3DXZA 2J45A 2G08A 2X5OA 5SZHB 1QJCA 1CRZA 4A82A 4X92A 1JBEA 2WU0A 5DTEA 2H11A 4GEGA 2PUEA 2BLLA 1JFLA 1GVNB 3WRYC 3AI7A 3LBHA 4NH4A 4BRSA 3BZUA 4OAQA 1NU6A 3JY6A 5K3DA 5KJ6A 1GQ2A 2REQA 1IY2A 2Y1CA 1AA9A 1O95D 1VMKA 4NBWA 4TWAA 3JU3A 4WMLA 3EGWA 3P2MA 4BP8A 1JZQA 5B3JC 2O1WA 2A4KA 4BGIA 3FMFA 3JD0A 1Q5PA 3QP9A 3WLKX 1Z2EA 1L2CA 1EP2B 3HP7A 4R4JA 1WLSA 3EVGA 4C5AA 4ZHQB 2BOVA 3PNLA 3TJMA 2ZUCA 3L41A 3B6EA 3HABA 2RHMA 3NBAA 1SKAA 1EFKA 4AS2A 2I4NA 5EQFA 4F2GA 3LLUA 1KL7A 3SAWA 4GWGA 4DUPA 2NWQA 4RTRA 4MAFA 1REQA 2XMDA 2WKPA 4Y2SA 1YWGO 2BGNA 4HPXB 3FUTA 3CO5A 4LHWA 2B1QA 1KO8A 2FPOA 3G88A 4H7KA 4TLEA 5CT8A 4ZU6X 3K35A 3RSGA 3BT7A 3UT6A 3OY7A 1V8PA 4IDPA 4WIAA 3M4ZA 1OFIA 2G25A 1MU5A 2DVWB 1YB4A 3KC2A 2HFJA 2OC4A 1PQPA 4OH7A 3BEOA 5EUBA 1XTPA 3T0IA 1M1YB 3T3IA 3DTVB 3PQFA 1YDEA 5AVTA 2X1VA 5F7JA 3OUUA 1RQNA 1NVWQ 4UU1A 3ZWYA 4WCDA 4EA6A 1QZXA 3J80S 3CPSA 5KSYA 4KACA 1VGQA 2GQ0A 4QO7A 3RVMA 2O8EA 1NZFA 3NBMA 621PA 1E3JA 4CV3A 2XCSB 1JFRA 2XE6A 3ZHZA 2BDTA 3NWBA 3VYSB 2DAKA 2FMUA 3ZBUA 7REQA 2MJ5B 1NBMD 1D8TA 4UKDA 4ZT7A 1W1WA 2VQ3A 4RENA 3ZV5A 4AWBA 4F2WA 5A4DA 5KNCD 4B79A 1XNQB 3LKDA 3HBAA 1Y33E 2Z3XA 3D3WB 4NQZA 5DWDA 1IAVA 2HW8A 4XB2A 5C80A 1NT2A 3ANLA 1IHDA 1Q1BA 2GK3A 2XI4A 4MI3A 3AUYA 2RK6A 4Q4JA 3DFZA 4WK0B 4HGYA 2FNAA 1CR2A 3FNFA 1H5UA 3NALA 3SC6A 4OM8A 3RS7A 1TDJA 4EW6A 2YOFA 2XZPA 1CY6A 4EKNB 2BMFA 1U9JA 2RJ3A 3VBEA 2WT9A 3EOBI 1QX4A 2IDKA 4MQ5A 5E1MA 3WJ1A 1IQ0A 1R2YA 3G8BA 1TVKB 1UQRA 1XTZA 1TIKA 3TLKA 1HZZC 1IHYA 1V4VA 1VKNA 4IXMA 4B6SA 1IVSA 1L4LA 2F8SA 4XFDA 1JR2A 1L7OA 5A71A 5ICCA 3EFOB 3LHDA 4WY5A 5JU6A 5EJFA 1NP7A 4ZOCA 4O2BB 2DKLA 1N5OX 3O6VA 4YI5A 5DSZA 1JG2A 3OZFA 4HB3A 1YCHA 1ZI6A 3M7GA 4MPDA 5BNFA 5BMOA 3X1YA 3J81k 3EPJA 2PZKA 4FPXA 4IDOA 3WMRA 3MXTA 3RS0A 3GPYA 4QNMA 3N07A 4PC3A 3SXUB 2QJOA 2J6CA 1N6PA 1DIRA 4JR2A 1QK4A 5EEHA 3UQZA 5DNUA 5E7JA 2C7GA 1IK4A 1R4GA 4UM5A 2B92A 4LRWA 1J1ZA 4FZVA 1SOWA 1WXDA 3D8NA 3S8YA 2JLSA 1YZFA 4PPNA 5FLEX 4LZLA 2I87A 4ESOA 2J67A 4RKRA 4JLBA 2BDUA 1AZTA 3DKRA 5L4NA 1AGXA 4BX0A 4ZQIA 1ZGAA 4C0HA 1Z9BA 2HTFA 3T5BA 5TS2A 1IMJA 2JJQA 4MVJM 5ALNA 1VIYA 3NC1C 2I34A 3A37A 4UBOA 1CZNA 5I7VA 1DFGA 1FP6A 2FR8A 4H4EA 5JW6A 3B1VA 4UBMA 2R1VA 2PGLA 3CVUA 1XTIA 1AC5A 2LH0A 3RGWS 1OIZA 4FGZA 2B94A 2AE2A 1XTUA 1IVYA 1ZIOA 2W2MA 3G8DA 3BMXA 4K9PA 2WOOA 1AK9A 1JLKA 3DTYA 3FLBA 3VOBA 2HN9A 5C51B 1STOA 1T5HX 1BXRB 3CLRC 3JALA 5E4YA 3U60B 2XD9A 5KWSA 4HH1A 1ICEA 1ZH2A 1AXGA 2X8BA 5IBPA 1B0UA 3WB2A 5KQDA 1G5RA 1D04A 1OV6A 3O0TA 1MN6A 1P3Y1 2ZSFA 1A71A 3H9JA 2I3BA 4J1TA 4O4LA 4UAUA 4G5QA 2YYAA 4B5LA 2BPOA 4YRPA 1U5BB 3VC3A 5HNKA 5JNTA 2QGNA 3D0QA 3KKQA 2R4EA 1SUIA 1MDFA 2EFEB 3NYIA 4DABA 4RVCA 4YRJA 5DX0A 4QASA 1I01A 4PX9A 3N7UA 3AUUA 1J09A 1PZHA 3AUSA 2AJCA 2G9RA 4Q9LA 4KAAA 3REGA 3WLNA 4ABTA 5BR8B 1ARZA 1R8SA 4ZC1A 2H63A 3HVUA 1UBFA 1IFYA 1JHYA 1F8UA 1YRQA 2FK7A 2PY6A 2VYVA 4C4XA 3ID6C 5FPSA 3JWHA 1SG0A 2YTZA 1PJ3A 1ZGGA 2VDJA 4R2XA 3B78A 1B0AA 4KK4A 3KT0A 4LMBA 5EFZA 2JJ8A 4OLFA 4O02B 5EYPB 3U3RA 5C46F 1IDN1 4D6PA 3SR4A 4FYPA 2W37A 3KQHA 1W9MA 1XN1A 2FY8A 2GM3A 2REQB 3D0RA 3DAOA 2O0JA 2GLXA 1RHJA 4X97A 2HQBA 1FNBA 5E6SB 3DC2A 3EBPA 4I55F 1J97A 2FPWA 5ERGB 5A6SA 4Y18A 4GOMD 5K0EA 1NN1A 1JXMA 4DEYA 1Z45A 2C3OA 2EC5A 3CKYA 4KIJA 4PYNA 3THXB 4O1IA 1L4NA 3ICPA 5LP6F 2E87A 4QXAA 1VBKA 1Z8DA 2RHJA 3KG2A 4WERA 3WK5A 3HWSA 3C48A 5JBIA 3JSXA 1PVOA 5KYWA 2VPPA 3NXKA 1GUDA 4F45A 1JNYA 1LEHA 5IH7A 1LBEA 3DLIA 3BERA 4OF4A 3SX0A 3PS9A 3TI7A 5BW6B 2WG0A 4EB0A 5JAUA 4ZDWA 1U4OA 1A7KA 3P32A 4YCNA 2PJDA 1HGXA 4ARCA 4HDSA 4QU5A 4EG6A 4TYNA 2C95A 2PLNA 5IT9S 3ZBPA 5FLXA 2OHOA 3VUEA 3GWZA 4ARUA 3L0SA 1KKLA 4CM1A 1E92A 1R6DA 3QK7A 4J4HA 3THSA 1A50B 1LI5A 1ZH0A 4HWPA 3HR7A 1L3CA 2BKVA 1VMIA 3GC6A 4RV5A 3DZKA 1WRBA 1L0BA 1SQSA 2ORYA 3WL7A 2VKQA 4WZBB 4JLOA 9LDTA 3H3XA 1NVAA 1LDGA 2Q9UA 5E0KB 3N8GA 3QF4B 2OO3A 1H05A 1IN8A 2WM8A 3MTDA 3I83A 1HWYA 3KIPA 1MIOB 5CCBA 2JI4A 3IXLA 1M0WA 3ILKA 1L7VC 5AESA 4CCYB 1GRQA 2ATVA 2VT7A 3FTCA 4QRH