3T38A

Corynebacterium glutamicum thioredoxin-dependent arsenate reductase cg_arsc1'
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
204
structure length
199
Chain Sequence
LHTNILNRIANELALTYQGVFSAETINRYIFESYVSLARTAKIHTHLPILAEGFAKDRLHALAVAEGKVASPVPQVLFICVHNAGRSQIASALLSHYAGSSVEVRSAGSLPASEIHPLVLEILSERGVNISDAFPKPLTDDVIRASDYVITMGCGDVCPMYPGKHYLDWELEGEDKIQEIIEEIDGRIRELWKSIQLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arsenate Reductase
publication title Corynebacterium glutamicum survives arsenic stress with arsenate reductases coupled to two distinct redox mechanisms.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Oxidoreductase
total genus 69
structure length 199
sequence length 204
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1060 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3t38A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3t38A02
3HVRA 2ID7A 2CWDA 3ILYA 4LDZA 1Z18A 3JPWA 3EAFA 5BRAA 5B3JA 3N53A 2PUEA 2MSKA 3K9CA 4G0XA 3JY6A 4HNQA 3SNKA 3GT7A 2R48A 5FBHA 1BDIA 3BRQA 5HKOA 4HNSA 2A9OA 1U0SY 1J56A 1QNLA 3NBMA 4EYGA 1GCGA 3MMNA 4N0QA 3SG0A 8ABPA 2LBPA 4RXUA 5I4CA 3QLVC 4ZMSA 3CTPA 5JS1A 4MAAA 3OLYA 4EYKA 2FMKA 2E4ZA 2XDYA 1DZ3A 3RVJA 1JL3A 3N0RA 4Z9BA 4RY8A 4H3HB 3CZCA 4MR8B 2FQYA 3RVPA 2TMYA 4E7PA 1ZGGA 3CG0A 1D2AA 2FVYA 4G0YA 1BVHA 3NNNA 3ILHA 3H1FA 2LPMA 2MYNA 3JVDA 3I5AA 4N47A 3BRSA 3Q7SA 4MS3B 3RQIA 3IP9A 1RZRD 3NNDA 2YHAA 4MR9A 4Z4IA 1P8AA 5D2CA 2P9HA 1QQBA 3F7NA 4QICA 2JVKA 3RVMA 4ZPJA 2QSJA 3QLVA 3Q9SA 3BBLA 4NCBA 2FQWA 4KMRA 4MS4B 4ZYLA 1KRXA 1JFVA 3H1EA 3T95A 3B2NA 1JFTA 4MR7B 4JB2A 3IP5A 1NXPA 4LE0A 4RU1A 3HZHA 3LKBA 3O74A 4QPJC 4JA2A 5TPZD 5IX8A 1C4WA 5KC8A 2PUCA 2FEWB 4OATA 5IUJC 3C3KA 4RWEA 3CU5A 2H0AA 4EVRA 2MSLA 4YR7A 3Q15C 2RGYA 1D1QA 3OQNA 1YTUA 3FFXA 3O75A 1KRWA 1SXHA 2NT3A 4JP1A 2RJNA 3LUCA 1PNRA 1UDRA 1ZITA 1FQWA 4F8JA 3QLUC 1RZRA 5ED4A 4W5OA 1Z15A 4G0QA 4JOQA 4P98A 2DRIA 3MQ4A 1GCAA 1LJLA 1SXIA 2VYCA 1W9HA 4EVQA 3HEBA 1ZDMA 1BAPA 1T34A 3JS5A 4XAQA 2JVJA 4MR8A 4PE5B 4Z4FA 2FKAA 5DLEA 1OXKB 2L18A 1P2FA 2IYNA 4ETIA 3HJFA 4XARA 3M9XA 5JNTA 3C6QA 3T8YA 2HQRA 5TPZA 4YRZA 3LTEA 3F6CA 2PL9A 2ZAYA 4MS3A 5IBQA 5CNMA 4LZLA 1A0OA 1D5WA 4FE4A 2WY2D 4L4UA 3HUTA 3O2QB 1K66A 3OM1A 5JNUA 3N0XA 4TN5A 2VK2A 3H5IA 3EQ2A 1JF8A 1SXGA 2M1ZA 3QLUA 3HDVA 2LP4Y 3EQZA 4JASB 5FWXB 3HK2A 3QLTA 1URPA 4G97A 3MA0A 4S05A 4MR7A 5DGCA 4RY0A 2WJAA 1USGA 3F73A 3QX9A 2A9PA 2R4QA 1U04A 3CRNA 3KYIB 3E3MA 3DBIA 5T3YA 1ZY2A 5CNIA 4F3TA 3MF4A 4MRMB 2PMCA 2B4AA 5E3JA 1Z17A 1QO0D 1E6MA 1YMVA 1F4VA 1NXVA 3D02A 3DLBA 3SY8A 4G0ZA 3UUGA 4W5RA 4YS6A 5EWJB 3O2JA 4RDCA 1DC8A 1Y1LA 4JAVC 1FSPA 3KTOA 1JHZA 2E4WA 2JK1A 3ROTA 2HSGA 5DCLA 1JYEA 3OLXA 1SRRA 1EFAA 3KS9A 1QQAA 2F8SA 5FBKA 3KSMA 4RKRA 2YHBA 1U2PA 2V0NA 3M6MD 4QYMA 4RKQA 5F64A 4FB4A 4YWHA 3RVKA 4D74A 4KFCA 1HEYA 5TQ0B 1JYFA 3OLVA 4PYRA 1YIOA 3O1HB 4WXEA 1JDNA 2JBAB 4OG2A 1I3CA 2AYXA 1DJMA 2FMHA 3SAJA 1ISSA 5EWMB 2QV0A 1W25A 5TQ2B 2PUDA 1TVMA 1QO0A 1C0EA 2L2QA 1Z16A 4TLLB 4PICA 5IC5A 1EWVA 5KQMA 1LBIA 5FWXA 1RNLA 1DCFA 2M98A 4RXTA 4Z99A 3A0RB 3IP6A 4KK4A 1DRKA 1YMUA 2KYRA 1YS6A 2WJWA 3DGFC 2FXIA 2PLNA 3QK7A 2P4UA 1GLGA 5DKFA 3HSYA 4MRMA 3VNBA 1NXXA 4EGSA 3URMA 1YS7A 2NZVG 1YK0A 1E6KA 4B09A 5KQPA 1LJUA 2FSPA 3A3KA 2R47A 1L5ZA 3BILA 1QP7A 1CYEA 4ZMRA 3TX6A 4MS1B 2Q5CA 3EJWA 3KLOA 4RV5A 4F11A 5EWLB 3ROFA 4OLAA 4EYOA 4KZKA 4UHKA 4EYQA 1QP4A 2E4XA 1USIA 2FMIA 2VUHB 3N6VA 4Z0NA 1NXOA 3EULA 5JNRA 2B1JA 2GKGA 3CZ5A 2MYPA 1MB3A 3D8UA 3LUFA 2HPHA 4PZ0A 6CHYA 1KMIY 4IGAA 1NXTA 5EWMA 4MLDA 2GBPA 1VLZA 3L49A 5PNTA 1NXSA 2AYZA 4IILA 3FFTA 1XHEA 5TQ2A 3DZDA 2FQXA 1BDHA 5T7BA 4RK5A 1DBQA 2X7XA 1Z2DA 3NNSA 1QP0A 1A04A 3H6HA 4HNRA 3HS3A 4XLTA 5IULC 2IPLA 3RVQA 5IUNC 3LMKA 2GWRA 3O1JC 4KPYA 3KG2A 1PHRA 1PEYA 2IPNA 4LE1A 3IPCA 3I42A 5CHYA 1TMYA 1FFGA 3G1WA 3H5TA 3OO0A 4PEVA 5KQLA 1PUXA 2CD7A 3HDGA 1ZAYA 3RVOA 1JWLA 1M2EA 3N75A 3CNBA 4WWHA 5GOTA 3RVRA 2HQBA 4WT7A 5JNSA 1LK0A 3FFWA 4WXMA 3P9YA 3TB6A 3L6UA 1VPWA 4MGEA 3OQOA 1ABFA 3W9SA 1DRJA 3DGEC 1FFWA 1ZHHA 2IPAB 3QX8A 2QVGA 2QW1A 2A9RA 4MS4A 5DTEA 3T6KA 4KK3A 3KLNA 1AB6A 4TMYA 4HYEA 5HM6A 1YVUA 3H5WA 5EWLA 4O1IA 1A2OA 5FWYB 5BR1A 1ZH4A 3LUGA 3FMVA 3HCWA 3N0WA 1DC7A 1LBHA 1XHFA 4LRQA 3KJXA 2HJ9A 4ML3A 5GQSA 4NQRA 4Z4GA 2RJOA 1M5UA 4FE7A 4Z4EA 4JB0A 1VRVA 4EY3A 4IMJB 3UK0A 2PE5A 4RSMA 1U2QA 1E2BA 3F6PA 4IRXA 4RK0A 4MYRA 6ABPA 1JLKA 1GUBA 1NY5A 2FLWA 1L5YA 1EWTA 1MIHA 3KHTA 4MQFB 1XWWA 2WB4A 3IP7A 1NTRA 3OMWA 4YLEA 4F12A 3I45A 1R8JA 3JTEA 3QELB 4ETMA 2O20A 4LE2A 3A10A 2FW0A 3O21A 1DBPA 3QEMB 1DP4A 3HV2A 2GX6A 2A9QA 4KV7A 5C5CA 4G86A 2FEPA 5HSGA 4NV3A 2R25B 3JVIA 2F8TA 4N41A 1ZH2A 2QR3A 4H60A 4E7OA 2FN8A 3GV0A 3DLHA 3MYYA 4L85A 3BREA 3EODA 3OLZA 5TPWB 4GNRA 1Z25A 2FTKE 1ZN2A 3KYJB 5KWSA 3RH0A 4M88A 4Z4CA 1NXWA 3Q41A 5TE9A 2JVIA 3FGZA 2I6FA 1USKA 4NCAA 4XASA 4YGXB 1Z13A 2E4VA 2H3HA 4KVFA 3LUJA 1MAVA 4N03A 4H3KB 1D1PA 4XFKA 3RVLA 3LOPA 4G0OA 5FWYA 1BA2A 3SQNA 4TLMB 1MB0A 3H75A 1E6LA 3C3MA 4RK6A 4NICA 5JNVA 1P6UA 2OQRA 4Z4HA 1M5TA 3GRCA 4W5QA 4W5TA 4EUKA 3R0JA 4G0MA 4LX8A 1DBWA 3KKEA 1Z12A 2CHFA 1GUDA 1ZGZA 2FN9A 1JX6A 1QMPA 4N0PA 5EWJA 5HQJA 5KC9A 1ZESA 5BQ3A 2BGGA 3RVSA 2GI4A 4WZZA 1D4ZA 3GBVA 2PAFA 2JCGA 4MQFA 5ABPA 3CFYA 3RVNA 3HXMA 4KQ9A 4OTZA 4KQCA 3QELA 1CHNA 2WMYA 2IKSA 2IOYA 2QZJA 2W42A 4YV7A 3QEMA 5IEJA 4IMIB 3IDOA 5TQJA 4S04A 3H5OA 1F51E 3GA5A 3H5VA 3CKMA 1JBEA 1PEAA 2NUBA 2QU7A 5TQ0A 2JBAA 3EGCA 3LUAA 4YO7A 4Q7EA 5TPWA 3CLKA 2HQOA 3EDCA 1NATA 2OENG 4O1HA 4ZJPA 4DN6A 1ZVVA 2LIVA 4KRFA 4DADA 1IIBA 3TMYA 2PUBA 4RK7A 4RS3A 3I09A 2NT4A 3LKVA 3OO1A 3K4HA 2JRLA 4Q6BA 2MYTA 2PUAA 3E61A 3H1GA 5BRJA 2L19A 4YCSA 3OMXA 2MSWA 4XXHA 5CNKA 2WRZA 3H5LA 1RXIA 4MQEB 2FLKA 1BDJA 3NHMA 1VKRA 2VUIB 4CBVA 1QPZA 4ETNA 4QYWA 1EWKA 4WUTA 4W5NA 5IEBA 4RY9A 1DG9A 1M2FA 4F06A 5C5EA 4YP9A 2ZWMA 4Y9TA 4N76A 3TD9A 4RZSA 5CNJA 2PUFA 1YK1A 1APBA 3C97A 4RXMA 1K68A 1PNTA 3Q7RA 2RDMA 4OBBA 2LUOA 4KREA 1ABEA 1AB5A 3M9WA 1U8TA 5JS2A 3SM9A 1RPJA 4MS1A 1ISRA 3VNAA 4OLBA 1S8NA 1Z2EA 1JH9A 5JNWA 1EAYA 1EHCA 3KCNA 3Q7TA 4KNYA 4D6YA 4UHJA 2FMFA 3GWGA 3OLWA 3T38A 3GL9A 1Z26A 2E4YA 3HUUA 1TLFA 4P1ZA 4D6XA 3O2SB 2QVCA 3FDFA 2L17A 3NHZA 2MYUA 5KI6A 2JB9A 4MLCA 1JFSA 1QKKA 3GYBA 4IF4A 5KQGA 2PUGA 1DCKA 2FEKA 3OM0A 1MVOA 3S99A 3MM4A 3CG4A 5IUKC 1H9CA 1JDPA 5B3JC 4RK1A 2CHEA 3G85A 1RXEA 2QXYA 3CHYA 3A0UA 1SD5A 4MQEA 4EVSA 1KGSA 2IPMA 3JPYA 3N8IA 4GPAA 3QEKA 1OXBB 3TO5A 3UKJA 3OQMA 3LUDA 4Z9AA 4DQDA 4MPTA 1CEYA 4G0PA 4RK4A 2IDMA 1TM2A 4O5AA 1P6QA 3MIZA 2J48A 3HO1A 2PKXA 3H6GA 3C3WA 1TJYA 4MR9B 1FFSA 9ABPA 2WWVD 3CS3A 2NZUG 3LFTA 1B00A 4Q6WA 3LUKA 2ID9A 2E4UA 2PL1A 3GBPA 3HM9A 1WETA 7ABPA 4LDAA 3LUHA 3IPAA 2N9UA 1DCMA 3O1IC 2PJUA
chains in the Genus database with same CATH superfamily
5EN4A 1QQ5A 1PL0A 3WB9A 1D0VA 1A7AA 4TMXA 1E3SA 3ZC3A 5EQFA 4Y7CA 4ER3A 3WAGA 1PR3A 3NBZC 2JLBA 3OFKA 3L82B 3OLCX 1B15A 2HMSA 4G4SP 4ZVQA 4LWPA 3T9CA 3SP1A 3GGCA 4UTRA 5B37A 5C81A 4J1TC 4WMLA 1UZUA 4W5HA 1NR1A 1JIUA 2YMLA 1Z6XA 3OOJA 1R5LA 1JFVA 2D2VA 4EO7A 5DJ5A 1KQGA 1FXWA 2ZDHA 3TTTA 1WXEA 1SXHA 4CFYA 4D82A 3GT4A 3FTNA 5ITSA 4D3DA 2NIPA 4JOQA 4LNAA 2O8VA 1NFRA 3ICQB 4PE5B 5GKNA 2WWRA 4RKYA 3HUTA 1X3LA 1Z75A 5HF6A 1XROA 1D6MA 4DPMA 4BLCA 1V96A 1XTVA 3OEHA 1NXVA 3FD9A 5BSTA 1EA5A 3EHEA 2EFEB 5KTMA 1RWMA 1L5SA 3OZTA 4OQFA 1R0LA 1W49A 3LK7A 4LSZA 4NPHA 2VBIA 4B85A 1M74A 1NDQA 3SU8A 1N0VC 2O8CB 4E07A 2OQVA 3I1IA 3VAAA 4X44A 4UZSA 4KO8A 4LDJA 1P77A 1E5VA 1IUPA 5C35A 3QK7A 1HOTA 5DPMA 4PO9A 5BSUA 2HSDA 3FPAA 3RYCB 4L22A 4XQCA 1U0LA 1QP7A 3E8XA 1H3EA 2G04A 1TR8A 1HTTA 2GPYA 2I34A 4KFSA 4KDRA 2B36A 4FR5A 1PJ3A 1KVQA 4RVDA 1GEEA 5PNTA 3T41A 4X7RA 1XHEA 2LNHC 2XNDD 4RZ2A 3JQ8A 1G17A 4C20A 3TLCA 5IJ9B 3Q7IA 3E22B 2PMDA 1ZAYA 1U1EA 4CHGA 1L7NA 1QYRA 5KTTA 4J0GA 4JL5A 4WCDA 1PQUA 4PLWA 1G2PA 2O7VA 1A2OA 3V8RA 7ADHA 1QVWA 1S3FA 3S70A 2IVFA 2RHDA 4U2FA 2JAOA 5CUQA 4RK0A 5AKZA 3RS8A 5LD2C 1NJ2A 4WY8A 1EFUB 2YBDA 3EGEA 2REBA 5FP0A 2A0WA 5ITZB 4L85A 3AF2A 1JR3D 3WNDA 3OT1B 1XTRA 1TYDE 3MTIA 1UOEA 5CAEB 1OH6A 3G9ZA 4G1FA 2F55A 3DAFA 4KLZA 4GSLA 3SEAA 4IR7A 4ANFA 4TLCA 2I80A 3DE3X 5IAGA 4AKIA 4LG1A 4CT5A 4WURA 4XYGA 2HU8A 3P4UA 5DBHX 3V1KA 1Z8FA 2NXNA 3PVCA 1VMDA 4UXHA 3E5RA 2GLXA 1VHJA 3FN4A 3ZGNA 4JEIA 1IIBA 3CX4A 3MAGA 3CVXA 2XA1A 4J7CA 3M83A 2WSYB 1NBAA 1E2KA 4L2IB 1XZPA 1NY6A 3MOIA 3WK6A 1XK6A 2BGJA 3OTQA 1F6WA 2YC2C 2RK6A 3UKOA 2O2DA 2ZWMA 4M76B 3DAYA 1HFWA 4I99A 2OUKA 4YBRA 3MJVA 2YHIA 3CEAA 3GCZA 4LVCA 5TVKA 4PSAA 4OU7A 2P2DA 1S8NA 3KDSE 3WL5A 1Z88A 4FFNA 1Q7EA 1ZH6A 4KR7A 4D6XA 3TIXB 4HJXA 1W36B 1RPTA 1E9CA 4MARA 4EY6A 1W5EA 5C4IA 2XYGA 4MPTA 1M1ZA 2IDMA 4LYHA 2EHJA 5GOZA 4NKRA 3CS3A 3URKA 3T99A 5B1YA 4KTTE 4K9LA 1VLLA 5J4HA 3AK4A 4RGBA 1D1TA 2C97A 5E3HA 4ZU1X 2IVZA 3ZCPA 1QIFA 2GYYA 4UM7A 2DOKA 4HSGA 1CDZA 2OAP1 1ZH0A 4UMEA 5B4TA 2Q29A 5LB4A 4EJMA 2X1LA 4ZZ3A 2X8JA 4DR5M 2D1FA 2YL2A 4QU8A 4MR9A 4XX0B 3VU3A 5BNIA 4MMYB 4L6CA 2IYUA 3PNKA 3OHSX 4L8VA 4A3VB 1GA6A 3GU3A 2GEDA 1Q5PA 3I32A 1VCHA 3WO0A 4K9OA 4REQA 2VDBB 4GKKB 3F5QA 2GN8A 4OHFA 1FNBA 3USCS 1HE1C 2ZI6A 4GNKA 3UOWA 4P4UA 2G88A 4EJSB 2WYIA 1HWYA 1LKZA 5TPZA 1DG1G 1RQ7A 1TXGA 4FINA 5BY2A 3B6EA 3I53A 2RGDA 1BVYF 4ZVLA 1Z7BA 2H1IA 1OWNA 4FM9A 4FYIA 2Y0TA 3NUGA 5HUJA 1R8YA 3SIXA 3LI2A 1WF3A 1AK2A 3GLFA 3GRVA 3N07A 4E09A 5A3SA 2HO4A 1FBNA 4TV9A 5BSHA 1OLXB 2H9YA 2IUTA 5K03A 1U0TA 3NTUA 3PI7A 3QTTA 1QPBA 5AXBA 1V9SA 5EWMB 2WE8A 3H11B 2MCFA 1TUEA 2JY7A 1OYWA 1GP2A 1WPXA 5LP6B 1DIGA 5B4VA 1B41A 4KE9A 2C0PA 3D4NA 2XB4A 3EGWA 3SYMA 2ZBKB 3HA5A 1SAYA 4NBNA 1W5SA 1V9LA 4WOBA 5J2UB 2WJ6A 4EUNA 3NBXX 1SCDA 1Z8HA 4WY2A 3RF7A 3D2LA 1USIA 4JV5M 3BORA 4PZPA 5EJCA 4UVHA 1UMKA 4XKJA 3CVVA 5GVRA 4G23A 4DWVA 1K27A 3MINB 3U1TA 4GLBA 4CR6A 1QBGA 4BL5A 4LYGA 3A28A 4GBGA 4E22A 2J0UB 2QBYA 4MAMA 3ASZA 3EN0A 4NY1A 3RDPA 4GH9A 3M7IA 3MUOA 1GR1A 1RLOA 4DV0M 1V4NA 5FHQA 4OJQA 1ENZA 2Z9BA 2DAKA 1FDSA 4KN9S 1AV6A 2QPLA 3T3EA 5EJFA 1F8GA 5JT1A 4LMBA 3KZVA 3N3AC 5E2AA 3WHLA 1MENA 5EMHA 1N32B 4V1CI 1O95C 5FULA 2V3WA 4Q15A 4OPMA 3KLBA 4JUAA 1GUAA 1UJ2A 3V8PA 3T7CA 4JQOA 2OHXA 3AOGA 4BO3A 1CW2B 1M76A 6Q21A 5JJCA 1KFVA 1RWXA 3W2GA 4L9WA 1OE0A 2JVIA 2RB4A 2WT9A 3V46A 1GL7A 2E21A 2OO7A 3NT2A 4DV5M 3RARA 2DAEA 3F8SA 4FTWA 1X7XB 5GJCA 1M1YA 1H5UA 4OFBA 4DR6B 1EINA 3FZYA 4LTMA 1J8DA 2WHPB 2JCGA 3CFYA 4AXXA 1ISJA 2IY7A 2AOXA 5D6OA 3VOTA 2D00A 1JBEA 2AKYA 1NATA 1U0BB 4EYSA 1IBLM 2ZI4A 2OCKA 4JJ6A 1ISPA 4B3BA 1PT9A 1Q91A 3S6JA 1N2EA 2KWIA 3J7AC 4O0MA 2NQTA 1RW4A 4WDQA 3UA3A 1UT5A 3GFBA 4UEJA 4OHPA 5KO2A 3TOVA 2RAFA 3RU3A 1HT1E 3CEPB 3A7EA 4KB5A 2QTZA 4UHJA 3Q98A 4NE7A 4U63A 1NMXA 4R3NA 2BI4A 1TLFA 4YRMA 3OQIB 3U13A 4BFSA 2OMEA 1VP9A 4RLFA 4RY2A 5LQUA 2IBMA 5IMSA 3A6PC 1VHQA 3LV8A 2GRUA 1BXGB 1MQ8B 3KM0A 5CIYA 1M5RA 3RGSA 4ZCQA 3RAJA 2TSYB 1W36D 2HIHA 4CM9D 5KHAA 3FWPA 3AR2A 1T3TA 4Y8VA 1WETA 1GPWB 1W59A 4KXLA 1UDAA 1V0JA 3GLGE 3NASA 1KU0A 5AYVA 3A9SA 3N70A 2LWIA 3GMDA 2GD0A 4BB5A 3A14A 1LY1A 4I19A 4FNAA 1U9JA 5FUBA 2MSDB 3WFJA 1IZ0A 3W06A 3P4YA 4YCJA 1C9EA 3OZAA 5DZSA 3T5GA 5BQOA 4U7JA 3QUQA 4KMOA 1J20A 4I1YA 4TKUB 1J07A 1ZRMA 4EKEA 4N5IX 3FKJA 1I4OA 1ARZA 5B12A 3TOZA 2CXRA 4QELA 1MRSA 3HNOA 3EWAA 1VJ5A 3ZKAA 4CEIA 5TR9A 4W1SA 1W2WB 4GX2A 1ZVJA 3K2IA 4RU1A 2EQ5A 3CKYA 3KBOA 5TT0A 1F38A 1ZPDA 4EPYA 2H7VA 4DC9A 5ERYA 3KJQA 3TVTA 2DVWB 5ARCA 1Z5ZA 4NXNB 4GUDA 1A69A 2ZXUA 1NF2A 3WYEA 2A6PA 5LMNB 3IT3A 1GNRA 4JP8A 1Z6QA 2QMHA 4DABA 1JG6A 3R74A 1H0KA 1QQ6A 1GM5A 4DF3A 4GBMA 5LPNA 3Q85A 3KQLA 3MF4A 2HM7A 1ADCA 3TSZA 1PYOA 3QYAA 1E1MA 3ZI0A 3ND7A 1XGKA 4L4XA 4TLDA 3OCYA 2CSUA 3A1WA 1YE8A 2IEGA 3F6RA 3FWKA 5TEVA 2FN7A 3GPCA 4DYVA 4AUNA 3K0CA 1NKVA 5KDDA 2XUAA 3O8BA 2GJSA 1I4LD 5HFAA 2HCFA 3CRQA 4EAAA 2ZIXA 3LS2A 3U62A 1ZJ5A 2X0RA 4F5ZA 3L02A 1NI5A 4XK8F 3TX6A 4IJ5A 3KLOA 3D7RA 5EWLB 4DWJA 4EITA 5LQJA 4PTYA 3RLFA 1Q17A 2IZ0A 4KXQA 2EKPA 3BICA 2XD4A 1FOEB 2P8JA 2RE8A 2RH8A 3GJ8A 221PA 4D26A 2IJGX 1TA0A 4L6IA 1VC2A 4KPYA 1RM3A 1PR0A 2GWRA 4BRZA 1ULZA 3NM4A 5CTJA 1PFKA 2XUDA 5EA2A 4AZSA 4MHTA 3L7LA 3S5UA 3W9YA 4FSDA 4MGZR 4DC0A 5KWVA 3FSGD 3GLSA 3GB9A 4K9DA 1XLTA 4UM8B 3ZE8A 3PXDA 2Q5LA 4X61A 5JQWA 1Q7RA 5HVNA 3P94A 1TJNA 5HKAA 1O0BA 4M1OA 1THTA 1GRRA 1BXRB 1IC6A 4C89A 5MN6A 4QYXA 4IQ0A 2X8JB 4JGIA 2XB2A 4ITUA 3REQA 2QQGA 3RVBA 1Q92A 1ZKDA 2HWWA 2PLWA 3BXGA 3KAJA 2EEZA 3HWSA 5YASA 2BMJA 4REQB 4EI7A 4UPVA 4CLEA 1NUAA 5KYTA 1XCGB 5K3SA 1D3AA 2CMHA 1YNOA 5TGZA 2WUVA 3ZU4A 4RH3A 2WUFA 4HFRA 4M1ZA 4HYTA 1U2RA 3ZC7B 1KAQA 2VH1A 4HGYA 1UPAA 4JNKA 4LGYA 4B3FX 3GPBA 5JLAA 3SFTA 1PBNA 4LVUA 4AECA 4KV9A 4OVZA 3U6LA 1O6GA 2R1VB 3O73A 3T15A 4IV0A 2EF1A 2CWWA 4RF5A 1JH9A 2RAUA 2JIPA 1ETUA 5DV9A 2QW0X 2ZJ7A 4OVKA 3A2LA 2N0SA 4EUEA 5DTJA 4Q12A 5I7UA 4C2TA 2ZR7A 2IZ7A 2Y1EA 3N5CA 1XZAA 2QNRA 2BSQA 2HFKA 1E5DA 3DZBA 3B8EA 5L7YA 1MDBA 1ZHFA 1WUHS 4A92A 1QIJA 4N18A 1X7WA 1JG7A 1FJ2A 2GH1A 5F1KA 4FD3A 3O47A 1LPOA 4LDAA 5DP1A 1JIVA 2N9UA 1PYGA 2A5GA 4E1AA 1EE1A 1TU0A 4LV5B 1B93A 1M6NA 4V1CB 2B3DA 3TLAA 1BRMA 3J27B 1Y63A 4TYNA 4JT2A 5B64A 1I5OA 2PAAA 4CGYB 4K6GA 1JB0F 1BN7A 4DDHA 3FZNA 4RMGA 4MOWA 4HB4A 4WJLA 3I30X 1LTKA 2A9JA 4K0KM 1WO8A 4IBIA 9ATCA 2P9QA 2P7IA 2YCBA 5ALXA 3T3PB 2H06A 4IICA 1A9XA 4ER5A 3WLHA 3OPNA 3RUHA 521PA 4KEAA 4EYEA 4KIGA 1XEWX 1FXUA 4I4IA 2FK8A 5CHEA 3SD7A 1HFKA 5CNMA 1XMQM 2X0NA 3U16A 5CVJA 5G53C 3UM9A 2OSBA 2XMQA 4HFNA 1MRNA 1NW9B 1A8UA 2EVWX 2FW8A 2ECQA 1NNSA 3BWXA 3FLAA 4EHKA 3L7DA 4CWAA 1DWUA 1DC8A 2PNJA 3LW7A 3UW1A 3CRZA 1G3RA 3ZWAA 4ER0A 4M3NA 1BJTA 4KAJA 2CFOA 2L69A 2SECE 1Y4ZA 1IXYA 2WJ3A 2EBWA 2VHYA 5C1DA 4PNPA 3OOYA 3VU8A 4OXKA 3RFXA 5TQ2B 2ECKA 4LXTA 2CRUA 3HXTA 2IYPA 2QL6A 4HVAA 1LQUA 3EOAI 1ZRNA 3RBXA 1FZTA 3EQ6A 4O2AA 2P9EA 3G68A 4MGIR 2JWSA 3ONDA 5JCZA 3SHVA 2XYPA 3ZWXA 1CE8A 3SHQA 5E7QA 1SVSA 2X5KO 2YWJA 3QSYA 2ZBDA 2RIRA 3W34A 2HD4A 1B0AA 4NC9A 4V02A 2QE7A 3IJRA 3LUFA 3ZJUA 5CT4A 5C53B 1VLZA 3L49A 1UAGA 2O0MA 4PYNA 1E0KA 1AG9A 2CXNA 5EJ2A 4HWOA 1B8OA 3H6HA 1E61A 3DBVO 4WBNF 4B6GA 3KG2A 3QE4A 5E2BA 2HK8A 4K46A 3QY9A 1X7DA 3QMWA 1H65A 5KOYA 2AHMA 1MVNA 5THXA 1L7DA 2N35A 4PX9A 3W05A 2A9RA 4KPFC 1OREA 1QHIA 4KNVA 3G9QA 3ADDA 2VTKA 3S8YA 4Z4EA 1TO6A 3HBJA 4LCJA 1N5DA 1LI5A 5DE3A 1MIHA 3TAHA 1PGQA 3VSBA 2B78A 3KW6A 2VH2A 2UUCB 4ZT3A 2IW3A 4OGFA 3KPJA 5M2QA 1B1CA 3UMYA 1H9AA 4AX4A 1AN9A 3QUSA 4CEIB 1SUFA 5HRUA 4IJEA 2BGRA 4BZWA 3BE6A 5KB3A 3HDJA 5JNLA 1HYGA 2VKQA 1R0XA 3NP7A 3HRIA 3RBZA 4R2XA 2P0YA 1GDDA 3H17A 1SUBA 5HOQA 1RSZA 1SUEA 1PEAA 3V7UA 3U7QA 2DT8A 2WNIA 3EGCA 1MJFA 1NL3A 5KNCA 1O97C 2QX7A 4EI2A 5KSPA 3EVNA 2BM1A 4RV9A 3OWHA 4Z86A 3OMXA 5FLXA 1AE1A 1GGJA 3NHMA 2HLPA 3FYUB 4CHTB 2B99A 1DTWB 4RJKA 9GPBA 4UUBA 3EC7A 1DOZA 5CCDA 3NWJA 4UBNA 2DAIA 4AURA 2AE1A 1ELOA 3AJ9A 2XBUA 1AUAA 3K1AA 5GM1A 2NQ8C 1OH8A 1T4BA 2O54A 8AT1A 1O95D 4IZIA 3BXPA 1B3BA 4DIUA 2E6UX 1AQ6A 1CUFA 3OX3A 3AI7A 1QSGA 2VTVA 4MCIA 4ES6A 4BGVA 2GHRA 3MWKA 2IIVA 4D9JA 4FYHA 2QRKA 2B8WA 2IHTA 2VYNA 1L8LA 1T8RA 4GECA 3HDQA 4I55F 3EHDA 4DGSA 2FG7C 2EKBA 3H9BA 5KNDA 4LOHA 2B34A 1UBSB 1RJGA 4GO1A 4DG8A 2EAUA 2EKKA 5F3WA 4ZAZA 2HRBA 2AI2A 4KXVA 4A0RA 2B6HA 4HWRA 1XZ8A 2XF2A 3CWCA 5EEGA 3LSTA 3UB2A 3T95A 3VOAA 1JEAA 4UOZA 1T4CA 2B82A 4MW1A 3DKPA 1NHGC 4EVIA 3A3NA 4JYCA 4ZAXA 1IUOA 1YKSA 2WWGA 5FB3A 1H6AA 4GQIA 1DO8A 2ZAOA 1FVXA 3VBEA 2OV6A 3B48A 2EGHA 1U3FA 3E3LA 4FFBB 3C6QA 1LLUA 4FJ1A 3WZLA 4GKBA 1MABB 4INAA 3CSSA 3FW1A 3QLUA 1XKTA 1FTGA 3DFZA 3K5WA 2LV8A 3DW3X 3B70A 1CQJB 3FBGA 1YRYE 4KVAA 4GE0A 2PRYA 3H9QA 3L5KA 1SCIA 2AQHA 2XTAA 4HEA1 3DLBA 4CGZA 3A9VA 3N2ZB 5JPIA 3PPVA 3RROA 2F5SA 4FWDA 4QECA 2QQ8A 3ILXA 1U7PA 4NZMA 4PPFA 5D51S 3G17A 1OV6A 1Q2UA 1SBZA 2EBHX 3LPAA 2Z2IA 3B1JA 3THYA 1LC0A 1QE0A 2FXIA 4PXSA 3JWEA 2ORED 4JT4A 3JQGA 3A6ZA 2P41A 2A94A 1KZ7B 2QN1A 3ZGXA 2I1QA 3QOYA 3CJTA 2HPHA 5JS6A 1II8B 1EEXB 4MUEA 2NSJA 1XZHA 3IE0A 4EQ6B 3NMUF 2DXIA 5C8YF 3MB5A 3CTMA 2QM0A 1ZICA 4PEVA 3S8EA 2PJRA 4CDRA 4ERXA 1ACJA 2BP7B 5F3RA 3H1PA 4LC1A 1AKTA 5JLJA 2XNDA 2VP3A 3Q0TA 4ZWNA 1UEIA 3P0IA 1EFVA 2X6QA 4M4SA 4DDWA 4FYWA 5FTWA 3I2HA 5IKXA 1OF1A 1YCFA 4KXXA 3OP4A 1LPAB 8ADHA 2PD4A 2O3TA 3JTEA 5DXJA 3L06A 4QUJA 4B3RM 4CMCA 3BEDA 4M1TA 3SE0A 3DO6A 5C5DA 3ZCSA 4PZ9A 4GBED 4ENSA 3BREA 1PQ4A 4UAJA 3KXEC 5KWSA 1M0EA 5GIOE 3NW9A 4QTZA 2BFAA 1BA2A 1Z6AA 3JVUA 3R7WA 4HDNA 2BEUA 3FBWA 2J41A 4QEKA 1FRNA 3CA8A 1ZESA 4ZK2A 1JR3A 5AQ1A 5DX1A 1AUQA 4OTZA 2DULA 3ZH2A 3GEHA 3NPMA 1T6YA 4IMIB 1IEXA 3LBAA 4OJTA 4KIUA 1F7UA 1IM2A 4L9SA 3LQ4A 5CEFA 1FMFA 2PUBA 3PJGA 3JZIA 5CP8A 5H59A 1P1IA 1UFQA 1GQYA 5AESA 4M9CA 1XQ1A 3RAFC 3LVVA 4YT8A 4AZ3A 4CF7A 1PE0A 2ZWVA 2WHEA 2GO7A 2QJTA 3RWOA 2Q46A 1QG6A 2WTAA 2GVDC 4QT4A 2ZBPA 5F2KA 3K2LA 1XQ9A 1GNSA 3IIKA 3JR7A 4PCZA 4J0HA 4YAGA 3UY4A 4N8SA 4L4ZA 3TNYA 1M0WA 3VH2A 4HLNA 1MNAA 3R5JA 4G65A 1I2ZA 2GJ4A 4E5UA 5DTIA 1QLJA 4ZP1A 2JJ2D 5DXFA 3BH0A 4P22A 2A5FA 3QZUA 4MA0A 2B37A 3GY0A 3NORA 1M0TA 4RENA 5M7EA 1EVIA 2VPYA 3PC7A 1HF3A 3NIWA 4FR2A 2OG1A 4JLJA 4FN4A 2JGEA 5E9JA 3K92A 1QG2A 3V34A 4D98A 3U09A 3D3QA 1CRPA 1B0UA 4JI6M 4AQYB 3WBKA 4J16A 1G66A 1CXZA 2DWLA 1E2IA 4QVKA 4BECA 4A8JC 3IESA 1REQB 2FJUA 1E3JA 1TQ4A 4Z4IA 5D2CA 1GXSB 2HI0A 2DB3A 1T1EA 4O4JF 6ADHA 2QJFA 1RBZA 4Q01A 1YMQA 4NJOA 4TWIA 1J90A 3G7NA 3UK1A 1H85A 4OHBA 3L4JA 2WVAA 3ZEIA 5FR2A 2NU8B 1GN9A 3WIDA 1Q3CA 3K9OA 3MQ4A 5AJWA 5B6PA 5IH3A 4UNRA 4E5MA 3RB8A 1TM4E 4N6NA 3Q9UA 1BXZA 1WXFA 1B23P 3T8YA 1LNQA 2HQRA 4UHHA 1TZKA 3M6LA 4UUNA 5ENVA 4F9GA 1CJMA 4MGHA 4ZHQB 1HSOA 4PG7A 2CHGA 3PKIA 1VLVA 3AUYA 3DA1A 1NN5A 1JF8A 5G0VA 4FEYA 1QGDA 4MQ6A 2WI8A 1WBDA 3N2LA 1N5MA 2PSEA 2BCGY 2DLDA 2FZLA 1WDKA 1TMOA 1XEFA 1Y8RB 4JITA 4B1FA 3LLSA 5CFZA 4OHYA 1WDWB 3O0TA 4DMHA 1JQ3A 4ND7A 3U7QB 2VDWB 3UMCA 1RRCA 3WYGA 1OTHA 2Y4NA 5THKA 4U2CA 3BSYA 1WVMA 4P7BA 2IXGA 3AQ4A 4D8UA 5FNZA 2Y6UA 3QVWA 2BWEA 4ZVVA 4DIBA 5KQPA 3R7NA 1CJTC 3LHIA 1TM3E 4BFZA 1VEJA 4AG5A 5HZHA 9LDTA 3K16A 5L3VA 2P40A 2J5YA 3PC2A 1TM5E 3HXQA 1HYBA 3IVCA 1UBGA 1W5BA 1S2OA 2Q50A 2GBPA 3WK5A 3OM9A 3FFTA 3JD0A 4TQGA 5EVCA 2GVNA 3R5KA 5AW6A 1XHBA 3WAKA 3H2KA 1KH1A 5LMCA 3ELWA 3DMPA 2IOFK 3O0DA 4E08A 3B7WA 4FWGA 3CVWA 2AFIB 4QOHA 2CD7A 2FSGA 4TYPA 3RYCA 3K9QO 1TIPA 1Z74A 2G4VA 1R6AA 3V8MA 4LTDA 5DNUA 2XZUA 1MMFB 2GAAA 4OKIA 1P1FA 1LVUA 1P5RA 3UC5A 4BUZA 3G8BA 2B92A 2HZBA 2VBGA 4MVXA 4GMFA 5F3WB 3H1TA 3UFXB 1U8XX 4TMTA 1P1BA 3R2JA 4Q4CA 4JC5A 4B4WA 5JYEA 2V4ZA 3E22A 2AWOA 4RIGA 2VHVA 1XZMA 4PD2A 2G6TA 4ME6A 3QITA 2AS0A 1V16A 1XMOB 1NZDA 4HP8A 1Z22A 2GM5A 3U1BA 3A4MA 1EGAA 4YCCA 4HAYA 3SHOA 3PDUA 3UT6A 4AQ7A 3VYWA 3FPSA 4DVGA 2HXSA 3SK0A 4YMHA 3UJ6A 1LVGA 1P72A 5EWJA 2PZJA 4CV1A 4F96A 1TF2A 1EFUA 3I4LA 2RHJA 2ZREA 1JDBB 4FHFA 3OZXA 3TCNA 4MCJA 3PFWO 5ITZA 2VKTA 3T7SA 2QX6A 3DW1X 3B7GA 4JUFA 3OT1A 3ODPA 4IO0A 3UJ3X 5CAEA 3QBTA 3D1JA 5K0NA 1RABA 1N6RA 2RB5A 4X85A 3G2HA 3LXMA 1J8YF 4GU5A 1DQRA 2WJ4A 3JQ6A 4JBYA 1VCNA 3RHFA 1MO4A 3CCCA 4H7IA 2LVQD 4R9SA 3VYVA 5AHRA 2WKRA 3IEXA 4UNPA 4X71A 4X3CA 1CD5A 2ZBRA 4ALKA 1VPLA 5B7NA 5EAIA 1P33A 1MVOA 2IK8A 3IDAA 3HVIA 1JJIA 3ZX4A 2ZJ8A 4L2IA 1BWPA 4YUYA 1GL3A 3WGZA 5DHFA 5FUWA 3JQGB 1XLWA 2DKLA 1IM5A 3LUHA 4IV8A 5I8ZA 5K0LA 3BWVA 4HNQA 4HUJA 1YA6A 2O52A 4PAQA 1OYYA 2CL7X 1ZOOA 2WWXA 4KSCA 2NUAB 1G5TA 2ZIVB 4PINA 1MOQA 4CM9A 2XEXA 3OTWA 1G0OA 1WW8A 2BZ1A 4PC1A 3JYPA 4AY6A 5D7NA 1QR6A 4EG0A 1GHTA 3GFGA 4G0WA 2R4JA 3RWBA 3RD5A 3H4MA 2YVUA 2BMFA 2AEJA 2ZANA 1P8AA 1O97D 2G4CA 2QXTA 4MZXA 1P4RA 5LM3A 3QMMA 4KUEA 1BQEA 1HE5A 3SSOA 3MCWA 3EK2A 2KHZA 1P29A 4JP1A 3ENKA 4P58A 1Z15A 4QPCA 1GRQA 1UJNA 2XH9A 4G0UA 1FPQA 2E0IA 3IMCA 4R1SA 5CM9C 1HDRA 4D3ZA 4LMAA 5ALQA 1NZJA 3QBDA 1HORA 1OIPA 2OCYC 3OT5A 4XX0A 5JNUA 3SJUA 3H5IA 1XCMA 4RTMA 1GABA 1SOAA 3MA0A 4GGPA 1EXVA 1R0CA 4B7FA 4M2LA 4HDNB 1UJ5A 1QE3A 1YQTA 2J7PD 1J8FA 1QAMA 4MYDA 3NTOA 3S55A 2GZSA 4JSRA 4LXGA 3VSCA 2BGKA 1ECFA 2J4DA 3CRW1 2OV8A 4QE3A 2YRXA 1E9DA 4PFJA 3ZDQA 3HSKA 3M9LA 1KKMA 3LNCA 2K5UA 4AZ3B 5AKJA 3TBKA 1JYSA 3GPLA 1GNQA 4MUFA 4CRWB 4PSKA 4DANA 1Y9JA 1V92A 4HEJA 4R98A 3WFZA 4BV9A 4MP8A 3CCFA 2X9LA 2Z43A 3AL3A 3PRYA 1OLXA 1KR5A 3W5SA 1PBTA 2BHLA 2PYZA 3ZLUA 5JSUA 2OXFA 3M1IA 3EIUA 5EWMA 1NVGA 3WDLA 4YAUA 4JBWA 2P2CA 5LP6A 2IYRA 2IP4A 1P2DA 5A9RA 3BTUA 4GVXA 2J0EA 4CMAA 3S2ZA 4IXMA 5J2UA 2KEBA 1WSBA 2J6BA 5J5VA 2YIJA 2QJOA 1B0PA 4GMDA 1AKQA 2HK7A 4AW4A 2Z04A 1EUYA 3D3NA 3WRXC 4IDCA 3MINA 2D0OB 1V35A 4EMTA 3ZVRA 2J0UA 4FC6A 2P62A 5A5FA 3HEMA 3FSGA 3M6UA 3F9IA 2NUPB 3EDYA 1CSEE 3RK1A 4Y6GB 3ETJA 3NTVA 3COJA 4YJ2A 3BZWA 4FWHA 3PNVA 4F38A 2NTVA 5ABPA 4DCTA 1GGMA 4KQ9A 2D3TA 1HQKA 4EUSA 2IOYA 2CXHA 5I7VA 4ZAWA 5HCUA 3GA5A 1ATIA 3ESYA 4Q03A 4B2YA 5CVEA 3AQIA 1ZVVA 1Q3TA 3NHRA 2P4EA 4EMSA 3RNLA 4UKDA 3R8CA 4CDNA 4JZKA 2L82A 2ATEA 3EIWA 4N76A 1X7XA 2GD2A 1H23A 2IWRA 1D04A 2YVKA 1H2ZA 3C8MA 4MYSA 4FSXA 1UJ4A 2WHPA 2Y1KA 1CVIA 4G1CA 4I46A 4ZQGA 3UN1A 1EIZA 4F4DA 1EHCA 3KCNA 3NTXA 1EK1A 4JBHA 3OZBA 4B0OA 2B83A 3ETEA 1YJXA 4Y1GA 1TADA 2PFSA 2XFTA 1LFDB 4P7KA 2QDKA 3OKAA 4YRAA 4W63A 5P21A 1Q1GA 1N36M 5KCMA 3M4YA 4MEBA 1J9ZA 1XVUA 5KWIA 3QSGA 4TL7A 1T2UA 1JSXA 1PZFA 2KNAA 2J31A 2PL1A 1FJXA 1YV9A 4AJHA 4JSYA 3IPAA 4O08A 1R9MA 1AV7A 2VHUA 1R5NA 1JU3A 1LW7A 1NNUA 4BNWA 8GPBA 1RRFA 4ENTA 1JEOA 2FWIA 3V8VA 3EXFA 4B34A 3OQIA 2X2FA 1EVJA 3TB4A 4NOKA 3UCEA 2V45A 1BXGA 4IKOA 2O7NA 4JLAA 4ROTA 3DJYA 4TS3A 4E7PA 4OGKA 1JWAB 3OCCA 1EIWA 2E9SA 5JPDA 2I6XA 1XZDA 1IVSA 2QT9A 5KBYA 4HC4A 4ZPJA 5A9TA 4ARSA 2OQ4A 3M1AA 1E0AA 4O2BB 4KDEA 1T5DX 2FN3A 2I9PA 3G23A 2ZSKA 3HJTA 5LMUB 3U3KA 1WKCA 3IJ5A 5EIBC 1RQ2A 4OAQA 2NSDA 4DLUA 4HHEA 3VNSA 3D8HA 4TKUA 1GA4A 3BXXA 3TWMA 2NLOA 4HBZA 1V16B 1LZKA 1SY7A 5T4FA 4ZGBA 4LI3X 5LZ7A 3DM9B 2MH8A 2M6LA 3LCRA 3VPBA 3RRBA 3DBIA 4F3TA 1CS4C 5EWJB 5FI5A 4JAVC 3ZV4A 2EGUA 2B5VA 2AMFA 3OY2A 1XWFA 4V0KA 2EFJA 4Z0TA 1EWQA 1I2MA 4XDYA 1M2KA 1Q22A 4BOYA 1T1GA 1YFLA 2XTNA 3A36A 3DV0B 1QF6A 1KZYC 2WMDA 4FNGA 3T1OA 2ZYAA 3K71B 2FXVA 2FSSA 1YCGA 2KYRA 2Y99A 3DGFC 5ALKA 1TEVA 5BNFA 4IZ6A 4DCGA 1ZVMA 2WTBA 2X4LA 2H8KA 3JXEA 2KNZA 3SLRA 3W5IA 2FJPA 2JARA 4J0EA 2OO5C 1XCLA 2HF7A 4L5AA 4R83A 3PWSA 1D2GA 4EATA 2AOWA 4LF4B 2DWNA 1MA0A 3PXUA 4L8WB 4FFDA 3DEIA 3FPGA 4B0PA 4CIAA 1YZYA 5FUXA 1D2RA 2AL7A 1A27A 3W7VA 2G80A 1RR6A 4YJHB 3CXRA 3ORSA 5DH9A 4A2PA 2O4UX 3OF3A 5CJ2A 4MS4A 3SBJA 1IHYA 3JQ9C 4TMYA 4I4NA 5EWLA 2JBWA 5F4BA 3N0WA 2HJ9A 1TW3A 4Z4GA 4X95A 4MB2A 2Z8ZA 4BWFB 1XMPA 4U6SA 3I6YA 3EUEA 3OQBA 3P2OA 3QP9A 2C2KA 2NNWB 4IJFA 1T5LA 4B3JA 4W9MC 4E7OA 4BO1A 2LRHA 5C80A 4LF8B 1CUHA 1HLDA 1KJIA 1N92A 4TT3D 4DVJA 2I6FA 1RDFA 3SX2A 2E4VA 1T8WA 2D5AA 1TEXA 1RQNA 1C80A 1PP4A 4D4GA 1FDOA 2PX2A 4HGZA 1BKYA 4EGJA 4WZZA 3T61A 4Q4DA 2YNMD 1NU8A 4U39A 1BXRA 4Y2TA 1F2VA 1BDMA 1IOVA 1OTRA 4NDAA 1VDZA 3BE8A 1L5VA 2VHJA 3LP8A 4MQEB 5T5QA 2A2ZA 2QKYA 5FTKA 4P86A 1VKJA 4RY9A 4RFSB 2CFTA 3V4FA 1KNQA 3ZWPA 3LC0A 3F3YA 2L0XA 4FXPA 2IF2A 2PXHA 3HJUA 2INGX 5I9MA 2WJIA 3SCZA 4LRWA 1Z6YA 1P2VA 2IT1A 3ZTWA 2OGTA 1CUGA 2HT1A 2I1LA 3JW8A 3L92A 3ZOZA 3CJRA 1BGWA 2KLBA 2DZOB 4KBYA 3SQLA 4NV0A 5JXHA 4WE3A 3HI6A 2J48A 4FDUA 4E3ZA 4KUGA 2AW5A 5B1HA 3JWJA 1VCIA 2R1VA 1O95A 3U6QA 2ORYA 3EC1A 2DWUA 2QM7A 3N74A 4DB2A 5BRAA 2PUEA 4LXXA 2J3HA 4RHYA 2GXSA 4X41A 1U2TA 5EJ7A 2HHAA 3AEYA 5IVPA 3W2HA 1P9RA 2FMKA 3CLVA 1GNTA 1XD2B 2GEBA 1TB4A 5J1TB 5J23A 4NHOA 1PGNA 2Y1FA 5AKEA 2HMUA 4YIHA 3AF4A 1RI1A 4MS3B 4AG3A 3EVDA 4ZIRB 4U5XA 5ICCA 3RU7A 4PW0A 4QICA 3JYLA 2BWBA 3W3AD 3N0TA 5I9LA 3DMRA 3NBFA 3U3OA 4RD6A 2ZQ5A 4BEVA 4V1CA 2C1EA 5F78A 5KNCH 4TLBA 3E4RA 4QLOA 1VG1A 1ZNZA 3FVWA 4MEJA 2FSHA 4Z4FA 4CGYA 2FSUA 1N2IA 3M9XA 2PL9A 1MX1A 2WPDD 3NYWA 1OSNA 3QVKA 5M29A 4YJ2B 3V32A 2GZ1A 1MX0A 1ZY2A 3JAMA 1G6Q1 3CLTC 1C9KA 1GFWA 5BVHB 3GEGA 3GGGA 1T2DA 5EFOA 1U90A 3P0JA 3F97A 3JVVA 2IX9A 3TDNA 4MRVA 4XZ3A 1G4HA 4WZBE 4QDTA 5LQCA 2X2PA 1U3GA 1FDIA 1O9HA 4U8HA 4MYHA 3ZE1B 1Z0SA 4B44A 2X4DA 1UMDB 3HGIA 2GAOA 2JY6B 3EUWA 3R76A 1DGBA 4R5MA 3Q3HA 3P9PA 4YHBA 2H2IA 4BNTA 1PDWA 3I4YA 5KNDH 3GLGB 4ZAYA 3PIIA 1JHOA 3UBMA 4CPDA 3N6VA 1W6UA 4WCFC 1XD9A 5JNRA 4LCBA 4JI0B 3MD9A 1IOWA 2ODTX 2FY8A 3IA2A 4C7MA 5TQ2A 3OPQA 2Q6TA 2A9KA 1HYEA 3SJBA 3OZUA 5I8WA 1SC6A 4CIWA 1MX9A 3RVRA 2WJVA 2RHMA 2ZBUA 4JP2A 4WFIA 3TE7A 4JLBA 3H2JA 1T2AA 5LD2B 3NWEA 1VMKA 1R4MB 4DZTA 3FOWA 2I9KA 4DLXA 1SC3A 3W2EA 2Q8PA 3EXFB 3R09A 4EG1A 2DKFA 1A9ZA 5AHWA 3ZHXA 3LRPA 1K4MA 3GNTA 1QYDA 4TL8A 4O25A 1EWTA 3FHJA 1L7VC 1A76A 3ESCA 5FAKA 3G7UA 4C0QC 3FRIA 4HEA6 4G86A 1KTIA 8MHTA 4E0BA 2X42A 5TQVA 2FZKA 3LC2O 3UMGA 4TVKA 4OV6B 3A1DA 1OTXA 2G82A 4W5WA 3IQHX 1ZYUA 3GRZA 1XAGA 1VDLA 1NBME 4RMIA 1SOVA 1E1YA 3BK7A 5FDFA 2PGLA 5AI8A 2MR5A 2CHFA 3FVTA 3W4JA 1QOZA 3V8QA 3ZI7A 3AR3A 4UEOA 1IB6A 2GAIA 4OHOA 2JGIA 5F7JA 3D4PA 3QMVA 2DYKA 4Q5IA 3DXZA 4MKXA 1OIVA 2JBAA 2W58A 5IJXA 3TOCA 4CJ6A 2GTPA 4KE7A 1YR9A 1OOEA 1FVHA 4Y2VA 1UJ6A 2I8CA 2ZCJA 5H82A 1MX3A 1QPZA 1EWKA 3BDIA 4X3OA 4UPEA 1AO0A 2QEQA 1QX4A 2C31A 1H0RA 3DOJA 3P2JA 5CPBA 1GL9B 4TZ0A 3A3YA 3E84A 4XH9B 4Z0PA 1JQAA 3LC1O 2WZBA 4WIAA 2DPHA 5AUQA 4KVZA 1KOLA 3FYUA 4CHTA 3NKFA 1DTWA 4BMVA 3LCMA 3NIBA 2E4UA 3TL4X 2GS9A 4RIEA 4S1PA 3LGSA 2VSOA 3I39X 1AQLA 1UKAA 3OESA 3ZXYA 2A9OA 2JJ2A 2QDXA 4A0HA 3PL5A 2X40A 2BVNA 4GI5A 1FRQA 2QSUA 2H5IA 3QYEA 2R46A 1XYVA 3TRIA 2BV3A 3UXHA 1ZK0A 3CH4B 3HCPA 4PAOA 4U9HS 5IC4A 4Y1EA 4MZDA 4YASA 4TMVA 3ND9A 2PWBA 1H2FA 1UQTA 3AKEA 1GU1A 4MS4B 5AK4A 4RH1A 3IALA 5EXXA 5DSZA 3IXQA 1K4KA 2MSLA 4N0DA 2YMMA 3PC8C 5CEJA 4UCQA 3DWFA 4G0QA 4ZI3A 5ALGA 1P2GA 1CY7A 2XKBA 3NBQA 3ZDYB 2L18A 4C0JA 3VR4D 2JEOA 1Q0ZA 3L79A 4YRSA 4L78A 3FOZA 4X62B 1FZQA 5FTMA 5IKPA 2I2WA 1T6ZA 4PN3A 1ODLA 1EG7A 3IVXA 2DMRA 2SICE 5J4KA 1Z17A 1QO0D 4LTNA 2WZJA 4AB1A 2VUSA 3OHPA 3F98A 4IDPA 1ZK4A 3HCNA 1BH6A 4FFBA 2W2XA 1OQAA 4OG2A 1X9GA 1C30B 2D6FA 1MABA 3OTOM 2BKVA 2R1ZA 3I05A 4HZIA 1CQJA 1S3IA 3D6AA 4CKZA 3AKZA 4CKBB 4L5JA 1CUSA 2NTJA 3PWTA 3SHGB 3PZBA 2HCTA 1DIBA 4OP3A 1R10A 4RD2A 2XUZA 1K9VF 2E4XA 1Q7GA 1M34E 2BR4A 1FRZA 1OWLA 1P5HA 1CDOA 3F0TA 1DIRA 5EERA 3AFHA 1I80A 2CLEB 4ALIA 2X6TA 3VR3D 1NMQA 5CXXA 1YOVB 1Y81A 5JSKA 2JJ8A 5JWRA 3WQHA 2O7QA 1A72A 1Y9ZA 4MVJE 3VKGA 1XL1A 2HCJB 3A9WA 2MR9A 3K31A 4DR2M 4UJ3A 4J7AA 1II8A 2F3UA 4AG6A 2BRUC 2VL7A 1XMJA 4KYVA 3I45A 2Q8QA 4EQ6A 1FRVA 4LF7B 5IZ4A 2VXCA 3Q0IA 5E0KB 3JZDA 5CLHA 2FUCA 3UPDA 1A9RA 3O9MA 5ALJA 5KU1A 2V74B 1I1OA 2BP7A 3BWMA 2CCJA 2Q8NA 1NSFA 1G41A 4H3KB 5EMMA 4FMCF 5BW4A 4QEDA 5FSWA 2OK7A 3CBQA 5BUSA 4Z4HA 2AXQA 1DEKA 3BD7A 3U37A 4Y2SA 1FRFS 3FG9A 2HL7A 2IITA 1X8LA 1XKXA 3OZSA 4GPBA 2QU7A 5IW8A 5KYWB 2KHHA 5CVUA 2PGAA 3OO1A 4ZEWA 5T4EA 4A73A 1CUJA 1MAUA 4JQCA 5A9SB 4HJRA 4BQFA 1VPDA 2J3KA 3H9GA 2ZS9A 5F7XA 1TUGA 1IN4A 4HQOA 4G5XA 4UQPA 3AR8A 2FKNA 4RFLA 1AKRA 2ZJ3A 3L6OO 1KQOA 2IUUA 5KTSA 2P2LA 2BGUA 3KQOA 2XNSA 2P7HA 4KVGA 2IPOA 2LVPC 2Q2NA 4RVCA 5KI6A 2E6KA 2VJYA 1I14A 4DLPA 1BHSA 1JDPA 3LCVB 4FQ7A 2JZ0A 2IPMA 5ICFA 3DPSA 4RK4A 4PIVA 1V8BA 1G7CA 1I9GA 3TAUA 1MTZA 3EAFA 3CPSA 1EHIA 3DMYA 4L5BA 1AKWA 3U56A 5DYGA 3GLVA 4UU7A 4BEBA 5A3VA 1IY9A 1PFYA 5LJIA 4P3XA 1GG8A 4JU8A 5F1YA 1C9DB 4L72A 4MR8B 2QN2A 2LHCA 3ANTA 2QZ9A 3HVUA 5TVGA 5KOIA 4FZRA 5A5EA 2JIZD 2GLUA 1IH8A 3UH0A 3K4QA 1T0UA 5KNBD 2XRZA 2G5TA 2AG6A 4II2A 2D06A 1EWRA 4LFCB 4RYLA 3E05A 4F2HA 3ISJA 3ZXSA 4XAQA 1DAHA 3CZRA 1KH3A 2QL5A 4QXRA 4J4HA 1UM8A 1REQA 4QODA 4WKGA 1JTFA 5BSMA 5EJ9A 5FUMA 1GXSA 4QTTB 1ZBDA 1DPFA 4MW5A 2N46A 4PNEA 1QDLB 2JAUA 5LQMA 3C8UA 1I94M 5EKDA 1NLUA 2NU8A 4AJEA 1Y1LA 1EDEA 3D3EA 3ZDRA 4QXQA 1ZAEA 3TFQA 2ODWA 4YWHA 4AKSA 3IQXA 4RA9A 2JBAB 2GNPA 4B87A 2VJNA 2ZU6A 4NK5A 4ZHQA 5KX5B 1K82A 2J7PA 4H16A 4YCAA 5F52A 2FNAA 4NMXB 3UOAB 2Y05A 1DCFA 2DKOA 3L6EA 2Q2EB 2QGZA 2PQ6A 4OM7A 5FORA 2J45A 5DNAA 1VIMA 3FWNA 3G0IA 3Q3GE 4D3XA 5GONB 3KUXA 1Y8RA 2R0IA 1R5JA 3MRVA 1IHXA 3QVJA 3BMXA 5ALSA 4LAFA 4C4AA 3KOOA 4RULA 2VDWA 5IVHA 5K3BA 4K88A 1KMIY 2V7EA 4EDHA 2NADA 2NQ2C 3BHNA 5JJ5A 2H8GA 1Y3CE 2QE6A 4OAPA 4D9MA 3O1JC 3UWKA 3TMAA 1RM0A 4PAGA 1XPRA 4C43A 1NHGA 4D9BA 4OIFA 3H97A 4I1RA 3PFIA 3U3MA 3RUCA 3N8KA 4WTOA 4MW0A 2ZTVA 4HGNA 3W8RA 2CZCA 4K3VA 3D0QA 4HGQA 4U3JA 4BVEA 1XXLA 3SXUB 1IZ9A 1C3OA 2GN1A 2CSXA 3D7MA 3PF9A 1VBKA 2GX6A 4ARAA 3HO6A 2AFIA 2X0KA 2XE4A 1V5FA 4F1KA 3TVYA 3QLJA 1G1MA 3FGZA 4E2WA 2XXJA 3IUEA 5KQRA 3ZS8A 5K8UA 4MV0A 3BRWD 3I8OA 1BEUB 3QXJA 2FH5B 2BF4A 4LDPA 4B3TM 1GTSA 3UFXA 1XEXA 1Z4PX 2KBFA 1B43A 4QYIB 4FBGA 2XE8A 4AZWA 2H51A 5K0ZA 4MJXA 1V1MB 1W4ZA 4PV7A 4Y2RA 3QOXA 5IH7A 3A4YA 1FFDA 3GJ4A 3IP3A 2FLKA 4QYWA 4B7GA 3EVTA 1PRYA 2O59A 1YK1A 3ACBA 3BS4A 1DAKA 4RHTA 2YVAA 3ODGA 2JI4A 3KKPA 2YV4A 4XWAA 2R00C 3FMPB 3LZDA 2R6AA 2I7DA 3IMKA 3BQ9A 5JD5A 1Y7IA 5AVYA 4RK1A 1K7CA 3GAMA 4Z1MD 3LBYA 2QENA 2YZ2A 1E3TA 4DHEA 1H8ED 4JQYA 4M0UA 3L8FA 5TMEA 1Q7CA 5KNLA 1I6KA 5KSOA 1ORTA 1CX9B 5ARBA 2B4RO 2R48A 4PFKA 1HGXA 1Z4MA 3W7AA 3PP8A 2O25A 3RK0A 2JGDB 4DR4B 2XCSB 4NCXA 4TMWA 4E6EA 4YAWA 2OVFA 1K7FB 3WNBA 5FTJA 1SQ5A 3GMIA 5CIWA 2EZ4A 5ESDA 4KMRA 1X2BA 3PT5A 1XC7A 4ZGGA 1LGYA 4QWWA 4OAOA 1HNXM 1E3EA 3RT9A 5CVTA 2NUAA 4MV3A 4LJ6A 1KRWA 2H1RA 5C0OE 4ZVOA 4DJJA 1P4AA 1KWGA 1KJZA 1W9HA 4QUDA 1WUJS 1RRMA 5CBKA 4X94A 2DPGA 4NS1A 1E8DA 4FMDF 1Q1QA 4ZRDA 1F20A 5CIQA 4FMBB 1C4OA 1U5BB 1YRHA 2XLJA 2DHCA 1TM7E 3QLTA 5HXAA 2C20A 2JI9A 1KOJA 5A05A 4X1YB 2JFHA 3F9CA 2HU7A 4JI5M 1PKEA 4DCNA 5IK2D 1TDHA 1I7DA 3ZV5A 4YP5A 4M9SA 1VXRA 1E9AA 2G77B 3P9NA 1M2NA 3KQHA 3CF6R 4FW8A 3SZ3A 2C8JA 2ZTUA 3EEYA 3UK2A 2FGJA 2D13A 3N5KA 2RH5A 4G8CA 3KDAA 3FGNA 5COBA 1JXQA 4PZYA 3GDFA 3NO4A 4YRJA 3FPEA 4AF6A 3ZNNA 5EESA 4K9QA 2RONA 3RS4A 3I6ZA 3TNJA 1A77A 3JARB 2AG5A 2A86A 4CF3A 2VQDA 4KUHA 4FYYA 4JY7A 5BV7A 3AI2A 3BUSA 3QU5A 2NVWA 4Z0NA 5IM4A 3D8RA 5DHPA 6CHYA 4N0EA 1SZCA 3R4CA 3K8QA 3TKAA 4JVSB 2J5KA 1GAXA 5ERGB 4AFNA 1IN7A 1K8QA 4XRRA 3ZY6A 2Z3ZA 1G8JA 4DZRA 4BB6A 5I7HA 2N1MA 4K9RA 4MI6A 3MBIA 1UBOS 3HDGA 4YV0A 1XZIA 5DT9A 4NNOA 1I0IA 1U8YA 1WQ4A 2ZRAA 5JRJA 3AVYA 3H4IA 3W9SA 2YXNA 3QOFA 1MHPA 3OETA 3IKLA 2GBCA 4C4TA 3HJSA 5EMKA 1V26A 5DLYA 4HVCA 3EIOA 5DK6A 4DV2M 2EOAA 2IHNA 3G3EA 2WR8A 4X90A 1VL6A 3MYYA 1ICEA 2X3YA 3G5AA 3D6TB 4N3CA 4KQWA 1Z5BA 4WN9B 4EJ6A 3KP1E 1IXRC 3EG9B 1UAAA 3LHKA 4F7WA 3NRJA 4OQZA 5ITRA 1QIIA 3QKWA 3W6PA 3AHIA 5H7XA 1D4AA 2J3IA 1JW9B 1Z28A 5HQJA 4GHLA 2JG3A 4TT3A 5TGTA 1EM6A 4IW3B 4E2YA 5K5EA 1CHNA 1ADYA 4C7BA 3ZUGA 3D59A 1ZJZA 1XKQA 2CDRA 2Y0PA 2NUPA 4LFAM 2ETVA 2O5RA 1SCUA 1AHPA 3RSHA 1E9VA 2ZB7A 5JALA 3A31A 2AJDA 2YNMA 1XO1A 4BVGA 1GV1A 3DLCA 2JIOA 2RGRA 5FBZA 1ZNWA 1TOAA 1HI9A 3N2IA 4CCYB 6REQB 1IMJA 1P3QQ 2GBLA 4RA9B 4EW3A 4W5JA 5B4UA 3MTEA 1C1KA 3TQSA 3QYBA 2AXEA 2OSVA 5KQGA 4CM5A 2X41A 3LDFA 3AG5A 4ZD6A 3MMSA 2LVOC 1IHOA 2ZCUA 1SD5A 5BWLA 2DE0X 4EG3A 2Y0EA 2E48A 3PEWA 2YH2A 3GRRA 4P32A 4FDTA 2QNJA 4GXRA 2FW9A 1C1HA 4V0LA 3KZXA 5HKOA 1VRWA 5K05A 4GDFA 4R2WA 3U4GA 5GV8A 1RZ3A 4JEHA 4IM7A 3MWEA 1J2EA 4IEIA 1MZPA 4ZO7A 4TYYA 1ULBA 1YDGA 2H4HA 3BRSA 5E8RA 2PGOA 1SQSA 4HAOA 1B2LA 4TTVA 2Y1OA 3J80S 5IJWA 2ZUUA 1E5QA 2C1XA 3GCXA 3BE5A 1Y6ZA 3B1YA 1X1SA 4KR2A 1NHWC 4U3JB 1DDGA 4LGCA 1QZTA 2P6PA 4MW7A 1C3OB 4WD3A 3ZIDA 3OQJA 3JWIA 2R4EA 3KLMX 3BT7A 3W3AA 2HBYA 1TJ4A 1GGFA 1HFJA 4G5GA 5BWCA 3U4IA 5JEDA 2MINA 3KU1A 4N4AA 1CUBA 3WLRA 2ODBA 2WP0A 4KKVA 1P8JA 3C7DB 3OE5A 1C14A 5JMWA 1OZFA 3C5EA 1URPA 4O2BA 4S1OA 3LCJA 1Z9BA 2ZWPA 3ELBA 3H0KA 3C16C 2NOAA 4G9EA 3GDHA 2IGBA 4PLGA 2WPDA 1XEXB 2XADA 3LSYA 3KWFA 4RKQA 1J09A 1NP3A 3NYRA 1CR2A 4PO1A 1BC5A 4PLCA 1WB9A 4TLLB 4DNFA 1KS9A 4OHXA 3V7WA 1WBBA 1OFHA 3KYBA 2WWFA 4I5SA 4KK4A 1CUDA 2YINC 4IJVA 4P80A 4KO1S 5LA6F 4Q34A 4OMFG 1ZK3A 2I3AA 2AI1A 3B78A 4C14A 3WR5A 3UJ9A 1IXSA 2AX3A 4LOJA 5EINA 4DJFC 1YE3A 4JB3A 4PC7A 3L1VA 4KYIB 4PLYA 4ZMBA 4R9UC 3LZ6A 3T0IA 2R5NA 1E4OA 2AEFA 3PUKA 3DV0A 1WAMA 1IBMB 4GYYA 3NDJA 4FLEA 5L4LA 3S2GA 3K2BA 4EJ2A 3VYTB 3F47A 1P7ZA 1FEZA 2ZIWB 1U3VA 2FPMA 2GZ3A 3U7GA 1Y5MA 3KLNA 1FSZA 2VQ6A 5F9MA 3P9ZA 1RAGA 1LBHA 3WWOA 4X63A 3PQDA 4JENA 5FFFA 1ECJA 1PI3A 4QO7A 3ANLA 1VRVA 1PT8A 5B3AA 1GKYA 2PLAA 3ZLBA 2CLIB 3PFNA 4NBLA 1V3VA 3OMWA 4LSWA 4L5IA 2NXCA 2V4UA 2ERCA 4QRDA 1WV0A 1YHNA 2BBTA 4YJHA 4DBLC 4YPFA 2J8ZA 2JCBA 1HKHA 4NPAA 1L2DA 5C32A 2ZWOA 1T9BA 4LV6A 3ZR4B 5DM70 2YWBA 4QFCA 5HS6A 4BATA 4MICA 1RQGA 3A1UA 3FGPA 2GSDA 1SMKA 5EXDA 5K4AA 2IHYA 4UDNA 3D5QA 4H1UA 2BW0A 4TTPA 5C1OA 3OTHA 4RAOA 1NR7A 2OENG 5FOVA 5CA1F 4HOYA 3DCJA 4MTCA 4U5QA 4IKPA 3BPSA 3GXOA 5C8ZA 2HA2A 4OQEA 1RHQA 3FLBA 4LECA 1EDDA 1R6VA 2WLSA 4PYMA 4LF5M 3NJ8A 2XT9A 1H93A 2XWJI 2XUKA 3PE4A 4BCDA 1PJTA 4GPIB 4YDRA 3FIJA 4X97A 3HX3A 4JKIA 1UC8A 3RS9A 4L8RC 3KJZA 1QGAA 1NVBA 4TN1A 3PKJA 3OCUA 4HFMA 3NHPA 3R7DA 4MQEA 4ZZ1A 5A7GA 3TO5A 3C43A 3DYVA 2O1SA 4RFSA 5CH8A 4X66B 3IKJA 4J90A 3ZV3A 4HQKA 3QV1A 1JRLA 1E92A 5CB6A 1X94A 2OCPA 4QTYA 3C41J 4Q4AB 1AQJA 4A8JB 3I83A 3H4TA 4ND4A 3VGJA 5IVIA 5AW4A 3SARA 4YLYA 3HA7A 4WOCA 2DNAA 4RVFA 2IUEA 1IULA 1MR3F 4IDHA 1LTQA 1TECE 1RYYA 4MB7A 4H17A 4LF6M 1TCAA 1LS6A 3UQYS 3PDJA 3UK7A 3BULA 3G5MA 1XA0A 3REOA 1PX2A 1V11B 5KVQA 1K1EA 2PX0A 4MK4A 5CB0A 2Z83A 1U0JA 2C3UA 4J1TA 1UDRA 3MCZA 4IHJB 1YQXA 1USWA 1E5TA 1E3MA 1D9XA 1XD2A 5LVAA 3AKYA 4MS3A 4BV8A 4FFRA 4ZIRA 5LXTA 1YHYA 3THXB 1WULS 1FYVA 1MG5A 5C8DA 5FWXB 3FOBA 4DR3B 1J25A 3DUWA 1MOPA 4KT0F 3E3MA 4BVFA 3VR4A 4HMPA 4LZJA 3VTFA 4RPHA 1TZBA 1Q74A 5SZIA 2XTJA 2RSLA 1Z6TA 4RF4A 4BQQA 4FGLA 2RHLA 3P2EA 5I9SA 2OBLA 1T9AA 3HADA 2VSXA 4KP7A 1QO0A 1SCUB 2QLTA 2W2MA 1WP4A 1JT9A 1YQQA 3O8OA 1KQPA 4DV6B 2W2VA 4WY5A 4P9NA 4LY3A 5BVHA 2XNCA 3MK31 2BR5A 1E0JA 1JG1A 5F3DA 1KKLA 5K8JB 2E5FA 1W0CA 2YYZA 4UU0A 2DUUA 2FPWA 2RHBA 5LUAA 3SYLA 4YY3M 3ZDZB 2CXQA 2LGJA 3GJ5A 2YWHA 1WUYA 2OUIA 4WW0A 1UMDA 4WINA 1QRAA 1RXCA 3HKEB 2GK6A 4IFTA 3NT4A 4WXMA 2Q4OA 1A71A 1H4VB 3ADCA 4CEHB 4RTRA 2A67A 3L0SA 2IPAB 3GLGA 5LNK1 1CUYA 1ISIA 2B7CA 3PHLA 4MXDA 4D4IA 1W44A 1ZD8A 3KZKA 3VR3A 2E2WA 3E15A 2NVOA 3F6PA 3MWEB 4E1BA 3P0FA 4IOMA 3PQ7A 3E7WA 3QEMB 1X70A 1Q11A 3DMFA 3QTBA 3PFHA 1S6YA 1SKYE 4GKJB 3C3CA 1M67A 2PGDA 3BMCB 3UMVA 4TUYF 2HMTA 4B3CA 2WABA 3SM3A 3LUJA 3SDBA 1R4MA 3W79A 5JWHA 1PW7A 5F7OA 1E6LA 2A57A 4EFMA 4R40A 2BGGA 4PC6A 2A0XA 4ER7A 2CE7A 4ENWA 1EE9A 1BIFA 1TC2A 1P44A 3SLKA 3S2UA 1GPLA 1UPCA 2MINB 4URWR 5ILQA 2QSFX 4IH4A 2Z0MA 1PJSA 2W2TA 3DTTA 4BC0A 4QOGA 3CWZA 2OO5A 1WPGA 2CL6X 2CXOA 4EPTA 3F9RA 2YZ7A 1H6DA 4DLTA 4ALLA 2RK3A 5AJXA 2FB9A 4KAAA 4MS1A 2IZ1A 2PDAA 5ITTA 3KXKA 1JAXA 4F1JA 4P1ZA 2C5HA 1X1TA 2G70A 4PYQA 2CJWA 3SHFA 3GHYA 1X3SA 2WKWA 1EGHA 4X93A 2L09A 4CV3A 2VJKA 3OY7A 1GPNA 1RMQA 4YMLA 3R6LA 4JT9A 1L2CA 1QGED 2HHLA 1IXSB 3ZWCA 3ZW9A 3QE9Y 4BC1A 5B7PA 4GM0A 4AJJA 4CF6A 1E7YA 4AMGA 3U81A 1FS6A 2WILA 1NSYA 1NVUQ 3NBIA 4BO6A 1CV2A 5CLLA 5JVDF 4ZRNA 1F8YA 1LW6E 4Y2HA 1RE1A 1M9NA 4ZCRA 2H9IA 4BNFA 2AGVA 5INTA 4PYKA 3HY5A 4OGWA 4I9GA 2AZTA 5MGNA 1PJ8A 2QTFA 2GEKA 4JB2A 3DULA 3DZCA 1T8TA 4DJAA 4RTOA 2JIZA 1OU0A 4G01B 4NFYA 2GOYA 2FPRA 4B74A 1YZ3A 1V47A 4DBLE 1X87A 2YZMA 2D7DA 1LLDA 5KNBA 1VKHA 4PRYA 5B58T 1HT3A 3SPXA 2QQEA 1D5WA 1GR0A 1D0KA 1Z68A 4QHTA 5ICEA 5DVZA 1UINA 3TTXA 3L6RA 3GN2A 4F0JA 5L40A 3OT4A 2M60A 3K5IA 3KYIB 2PFKA 4D79A 1Z5OA 5CLFA 4DCCA 3W5DA 1R0KA 2Z5VA 3A6EA 1QHXA 1QQAA 1MUUA 4FZ5A 2OOBA 2CVFA 3VC2A 4MM3B 4IIJF 4GYWA 4D0NA 2HJHA 1HETA 3COZA 4IPTA 4AT1A 1SCAA 4E2ZA 3QX7A 1R6TA 2BUAA 1YACA 1PJIA 3OEED 1FMCA 5AR1A 1YAHA 1DRKA 1LPBB 2EATA 2EG9A 1LBEA 3TTSA 3Q2OA 1NW6A 2EWMA 5K2OA 2P9FA 3ES9A 4WEQA 3IEUA 3M6WA 3WJAA 3NB0A 3VTAA 2BM9A 1C7QA 4MJ3A 3WGUA 3E9MA 3WIOA 4TXHA 1TH3A 2ZYVX 3OZWA 1C30A 3CGGA 4R3UC 1FDUA 3KB1A 3HLYA 1Z5VA 4IILA 2BMWA 4F56A 2FQXA 5M3BA 2DF8A 1L7MA 5IVDA 1FFBA 1ZMXA 3GEMA 5IULC 4UNQA 2WD8A 1WTCA 1SB9A 4DSUA 3I2FA 4CKBA 1T5IA 1OX5A 4X24A 3HCDA 4DDTA 4JLNA 3WLAA 1PQYA 4MGEA 4MVJI 1CZNA 2XZFA 3W2FA 3VFDA 4AN0A 3W8EA 1ZH4A 4JC0A 3SYKA 4WGGA 2JGRA 4BBAA 4MYRA 3WGLA 2JJ1D 2XCOA 2J9ZB 3VHXB 3WRWA 1NPDA 3EXEB 2XE7A 1VL1A 1DWOA 1O5IA 1MOSA 4HK4A 3V8BA 3OVMA 1SQGA 1YOVA 2J4FA 3PRJA 4BGEA 3EQ7A 4HDSB 2Q1YA 5LB2A 1Z13A 4HDAA 1EBUA 1MAVA 3G2KA 4UE3S 4MVCA 4BB9A 3SNHA 4YEDA 2H3EA 2O8NA 1OX4B 1W47A 4F21A 2O3UA 4BKRA 1YDEA 4NBSA 4CV0A 2X77A 1MB4A 2JGJA 2FR1A 2Q3BA 2I2BA 1X8JA 3WGNA 2I22A 2GI4A 1DTSA 1ZN8A 2HB6A 1AT1A 1ZNYA 3QA3E 4KWHA 1ZG3A 2HLHA 5JC8A 5EI5A 4MQ4A 1UH5A 3E9QA 2KS6A 3BRWA 4OHRA 4WZBB 2BWJA 5LXTB 1DNPA 1I5RA 3IMGA 3KVYA 2EC5A 3GNLA 1RQXA 1CUAA 4FQ8A 3MOSA 3NJ4A 3RS0A 1WHCA 2YWFA 4II7A 5EG5A 1PVOA 4PF1A 3HI4A 2AXNA 3KVOA 3ROPA 3RREA 1SHLA 2FQQA 5KYWA 2VQEB 1J22A 2VDOB 5DNYA 4MLCA 1IEQA 3OECA 2ZTHA 1IB0A 3O8OB 4Z1OA 2QRJA 5CVDA 5A9SA 2V98A 4HL4A 2ANBA 1J23A 2D5LA 1JQBA 4YB8A 4YT5A 4I8DA 1II0A 4WLOA 4JYAB 3LK6A 3UV6A 3L8DA 3UGKA 4OHCA 3DMDA 4HVTA 2ZB8A 4Z1MA 3GJSA 1N1DA 4RADA 1HTBA 2YV2A 3IG5A 5FTNA 3SZRA 3ASYA 1H8EA 2DY1A 2H52A 1N3LA 1DRVA 1J9GA 1E20A 1AJEA 3EMKA 4X45A 1EP2B 3A6DA 5P8WA 2MYNA 2UXCB 3PFKA 5FUYA 3F2IA 4G4GA 3QY0A 1N8NA 2P9TA 1ODIA 4N3NA 4JJFA 3RJ9A 3RHTA 4N5NA 2XWQA 4IIDA 2RGBA 5TNXA 3JRWA 4I50F 4LJKA 4EHIA 2HR1A 5IBRA 4EVQA 3FNHA 4MR8A 2IUYA 5UKDA 4DUYB 1H1DA 2QS9A 2PX6A 4Y1RB 3OIUA 5KPJA 1CJSA 1H94A 2Y8EA 5DK4A 1IQRA 1QK4A 4OHUA 1GTJ1 3JWGA 3GQVA 4TN5A 1RXVA 4AS2A 4YRIA 1HEIA 4BWYA 3ZCVA 3LGXA 4S05A 4G5HA 1GVNA 3CC8A 4JI3B 4JUCA 2YXLA 4C30A 2EZ9A 2FRVA 2VWPA 3E1KA 3FX2A 4Q4HB 5FOWA 2XRYA 1L3IA 1SRRA 1B4DA 3BZBA 4N9WA 3D3KA 4QXMA 1R50A 1MQ9A 1AXGA 1V4BA 4BO0A 2B8TA 5J4LA 4AJPA 3L2OB 5IK2A 2C7OA 1KJJA 1C0EA 3NZEA 5FEUA 1HA3A 3KE9A 2C57A 3K8OE 2NO4A 2XUFA 2ONJA 1T43A 3HSYA 4BFYA 2XDWA 1UWVA 4EZBA 4B5KA 2CVHA 1E3WB 4MS1B 4QGBA 3EJWA 2BHRA 1L1TA 4F9EA 1LQTA 2Q2QA 2ZIAA 4NHEA 2CJWB 4EWLA 1YDMA 3LWNA 3NANA 3H5AA 5KX5A 3UTCA 1FNNA 5T7BA 1SZDA 4QUBA 3T35A 3ONEA 2IYVA 5IAJA 2F2TA 4JBGA 3WZMA 1FFXB 2A1IA 1PUXA 2C00A 4YPVA 2QX4A 1QE5A 2QP9X 4YR9A 1QV9A 4UASA 5GONA 3O8RA 1RAHA 4F84A 3W8FA 2H7XA 2ZFUA 3WTBA 1HL7A 2X76A 1DEHA 1ZGAA 4RSMA 2F3RA 3WMGA 3ONFA 3KKQA 4HH0A 4H6WA 4NBRA 5PGMA 4NV3A 3N1UA 2XUPA 3HJCA 5B2FA 4JWTA 3A6LA 4A36A 1XU7A 5L51A 3GJZA 3TNFA 2PRJA 1ULHA 3PYMA 3WMFA 1KI8A 3LCCA 4TXLA 3V9AA 1R4ZA 4IJQA 2CXSA 2NZJA 1M5TA 2NZWA 5LIRA 5AM1A 5HFJA 2Q3LA 2IFTA 5G3YA 5KC9A 3SXUA 1O1YA 4C0SA 3TLJA 4X64M 2XLBA 2F1RA 1AKYA 1BSVA 3MPOA 2HA6A 1H6BA 1QTRA 1EVEA 1CB0A 2BOVA 5HF5A 1ICIA 3EIQA 3SSMA 2NSHA 4LRSB 5IEBA 1KXZA 4P16A 1QGUB 3L41A 5DHAA 1PO7A 5L3QB 4X65M 4V3CA 3WSWA 1KEKA 1GL6A 3X0DA 1LLFA 4QYIA 1M34B 2FMFA 4HTFB 4P81A 1WNFA 3GRPA 3GR6A 1ESMA 3LYUA 1V1MA 4K2HA 4PQEA 2QTNA 3QJGA 2OORC 4OREX 2I7NA 2Z8YM 1YL5A 2FE4A 4NAVA 2PVSA 2EWWA 3LUDA 1LU9A 1R0ZA 1JDJA 2DFKB 1FJGM 4RTKA 3D9QX 5IAKA 4F45A 2OP0A 3JYHA 2W6NA 5IN4A 1WMSA 1KZ4A 2Q4EA 2JXNA 5K6RA 1NJFA 4ZEMA 3CSUA 4M0LA 4F46A 4MQBA 1SBYA 5IT0A 1Q3KA 3K2QA 3AJEA 1YKGA 2P3LA 4U6NA 3U4CA 1EXNA 4BP8A 4IVNA 5E1BA 2NGRA 1W7AA 1PSZA 2LD4A 1JB9A 3NDPA 3CW9A 4S35A 2PH3A 4B71A 3FPCA 2OO9A 4JT8A 3H2BA 2QYOA 5HPYB 1KK2A 3RVMA 4RV4A 1JVBA 1UKCA 1W5FA 2LCFA 2BTQB 4IJWA 3PGJA 1CULC 3LX5A 4TGLA 2JGDA 3M5PA 5C8XA 5EIBD 2OXCA 1D2HA 3GJ7A 4W5OA 1NBMD 7REQB 1GU7A 1KBZA 4JLMA 1BHO1 1QIEA 1VYUA 3HYCA 3ZV6A 3HDYA 2OYRA 4JK3A 3RBAA 1KJQA 1YRBA 4JBNA 4WXHA 3HGTA 1KWKA 4BMYA 1G19A 3I9V1 3HLKA 3L3BA 4MW4A 4F5DA 1YMVA 1F4VA 1ENOA 1FMTA 1XTJA 4LFBB 2NSLA 2JP7A 1Y42X 4M8NE 2XVYA 4D74A 1L7OA 4WLFA 4BNDB 1D2MA 3DQQA 1YB1A 1U5BA 4BO2A 2ZLBA 1JJAA 1HQCA 1JNYA 1LFAA 1AUOA 2WUEA 3AP3A 3IUQA 5A5VA 3VH1A 2YWEA 3EB9A 3WGJA 1WD7A 4X1YA 3RGPA 4WCFB 2IYEA 4GIPA 3L5OA 4M1SA 3HZRA 4FUQA 4MKZA 4W7HA 3VKWA 1AHNA 4BAUA 1E2PA 3D0OA 5E26A 1MP0A 3MMZA 3G9XA 4INPA 3ROZA 3B20A 4KZPA 4LCEA 1CP2A 4YC7A 5A3JA 5DNYB 4GKVA 3CJQA 3C24A 3U4AA 2XXBA 1OT3A 4DDMA 2ZJAA 1G5FA 1ISFA 5FYDA 1N5LA 4XVUA 1F1BA 3Q72A 2EWVA 4KXYA 1JVNA 2PMWB 3AKCA 3OO0A 4A6DA 3IX7A 5GOTA 1LK0A 3JARA 3UJCA 1FFYA 1PTJC 3SQDA 3LT1A 2JIQA 3RJZA 4LNUB 4R7TA 4MH0E 1NQ5A 1N2GA 1QOPB 3W3AH 4YXWD 3JALB 5GQSA 1U7UA 4IBJA 5CVVA 1CDDA 2JGAA 1SG6A 1NAHA 2VN8A 2IU4A 1UP4A 1VSUA 1XWWA 3TF5A 4ZYZA 5HCIA 4J2OA 1ESEA 4LE2A 3MAJA 3WBFA 1DBPA 4OBWA 3QWLA 5DHRA 1SCKA 4XWYA 1E2LA 1GFIA 4IOJA 4PDIA 1JALA 4JJZA 1H0SA 3OBBA 4H4DA 5IHPA 4MRRA 4EEXA 4XYLA 3WLEA 1HE8B 1Y1KE 5K3OA 1D7AA 2HSEA 4J7XA 2PMBA 1A4RA 2ZYWX 3T34A 4N40A 1VIVA 4UN2B 2W98A 3UZUA 2O48X 5D6NA 2XQIA 2B8EA 4B6JA 1KJ9A 1H22A 2ZRIA 2OZVA 1WB5A 5FJIA 1GG2A 1NXQA 5CJPA 3FY4A 4WN9A 3W3ZB 3MUNA 1GVNB 3EG9A 4FC7A 4YREA 3MIIA 3UJ7A 5IVKA 4FP9A 3W77A 4JI4B 1KVSA 2IOFA 2QMUA 2HL6A 3DVQX 2DWCA 1V3TA 1ISRA 1IN8A 3QNWA 1CRLA 1A7KA 1VE6A 1TL7C 3NAZA 4I4TA 1Z26A 1G5RA 2IYQA 4R2IA 3TCKA 1YA4A 4RTPA 3ZZ1A 4AMBA 1ZC4A 2CHEA 4BGIA 3JAKB 2QTVA 2FPPB 3U6KA 3AOEC 2XZPA 4XB6B 5IBCA 3FAKA 2BKLA 3W8NA 3R20A 3MQ2A 1CEYA 1N4DA 2NQ8A 1BG6A 2VHXA 1P9LA 1XZQA 2HSJA 4MCHA 2OZKA 1POXA 1DO2A 1TU3A 5F51A 1GO2A 4MUNA 4DPKA 1L1QA 4CCYA 3PA6A 1J33A 2CD9A 3HVRA 6REQA 1Z4JA 4UBLA 1LC3A 2CJFA 1CQZA 5LKAA 3SLGA 2HEIA 4LRYA 1GRCA 4TT8A 1E0DA 3DL0A 1PJCA 4MVJD 2O3QA 1NUQA 3QJYA 1QGOA 2JFVA 4AO6A 3MXOA 3FI0A 2Y71A 1RVV1 4FCVA 1D0MA 2QT0A 4PTLA 5EIWA 4ZFNA 4LY6A 1FUYB 1M10A 4EGAA 3QFTA 5AW5A 4XDGA 3IV9A 2P77A 5CB4B 3GELA 1XDDA 3FKEA 3ET4A 4UAVA 4U7TB 2QD1A 1TEHA 1M72A 4R6WA 1IMOA 5AUPB 1RC8A 4R2KA 1MQSA 3V2HA 4Q4LA 4B4OA 4J0FA 3GGOA 1V5WA 1PR2A 1VA4A 3G89A 4BN5A