3T38A

Corynebacterium glutamicum thioredoxin-dependent arsenate reductase cg_arsc1'
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
204
structure length
199
Chain Sequence
b'LHTNILNRIANELALTYQGVFSAETINRYIFESYVSLARTAKIHTHLPILAEGFAKDRLHALAVAEGKVASPVPQVLFICVHNAGRSQIASALLSHYAGSSVEVRSAGSLPASEIHPLVLEILSERGVNISDAFPKPLTDDVIRASDYVITMGCGDVCPMYPGKHYLDWELEGEDKIQEIIEEIDGRIRELWKSIQLSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arsenate Reductase
publication title Corynebacterium glutamicum survives arsenic stress with arsenate reductases coupled to two distinct redox mechanisms.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Oxidoreductase
total genus 69
structure length 199
sequence length 204
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1060 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3t38A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3t38A02
1Z15A 4F12A 2IPAB 2PUEA 3TD9A 1OXKB 1NATA 3LUKA 4N47A 3HM9A 3HJFA 4E7PA 4M88A 3KYJB 5KQLA 1Z17A 1NXPA 2PUAA 1DG9A 3KTOA 4Z4GA 3OQNA 3GBPA 1U2QA 2J48A 2JVIA 5IUKC 3CLKA 2IPMA 3I09A 3CG4A 4NQRA 3KS9A 9ABPA 3QK7A 2IKSA 3QLUA 5JNRA 4TLMB 3E3MA 4XASA 4FB4A 4G0ZA 4RZSA 1MAVA 2HQBA 3QELA 4KQCA 3MYYA 4LX8A 3LUJA 4Z4CA 3MIZA 1QO0D 5CHYA 4OLAA 4EVSA 4EY3A 4RSMA 1DBQA 2PE5A 2MSKA 4Z4EA 1AB6A 1Z13A 3C3KA 2ID9A 2JK1A 4RS3A 3C6QA 4ZMRA 1RPJA 4LE1A 1M5UA 1JYEA 1ZGGA 3LKBA 2H3HA 4RXTA 2GBPA 1YK1A 4TMYA 3TMYA 4RV5A 3IDOA 5GOTA 1YVUA 1DJMA 3LTEA 4MQEB 4RXUA 3CU5A 1YS7A 2GWRA 5IEJA 4HNQA 4OTZA 1TLFA 1JYFA 5TQJA 2FQYA 4XFKA 4W5NA 1NXTA 3SY8A 1SD5A 2E4YA 4RKRA 2FEPA 2H0AA 2QVGA 4S04A 2ZWMA 4KFCA 3QLVC 1Z12A 4JASB 3DLBA 1GCGA 4LDAA 1M2EA 3MMNA 2P9HA 2JVJA 2A9PA 2FQXA 2WJWA 3BRQA 3FFWA 2NZUG 3H5IA 3N0WA 4MRMA 4XLTA 4D6YA 1S8NA 1A04A 4RK6A 2FVYA 3KSMA 1B00A 1E6LA 3HDGA 1RZRD 1JWLA 1ZDMA 2HQRA 5FBHA 1WETA 2PUCA 1DC8A 2FN8A 3UKJA 3CKMA 3B2NA 2LBPA 3Q7TA 1GCAA 2A9OA 2FMFA 4KK4A 3OMWA 3FFTA 4FE4A 1QP7A 3F6CA 3DZDA 4ZMSA 3HCWA 1KRXA 4L4UA 3OO1A 2ID7A 1JFTA 5JS1A 2RJOA 3A0UA 3A3KA 3QLUC 3CZ5A 2E4WA 2MYNA 3MA0A 4XAQA 5KQGA 1VLZA 1L5ZA 3GYBA 1D2AA 3L6UA 4HNSA 4MYRA 3TX6A 2B4AA 4W5TA 4Z4IA 3OM1A 3RVMA 1PEYA 3JTEA 2GKGA 3RVLA 2NZVG 4ZPJA 3QEMB 2L18A 1XWWA 4IILA 1NXVA 4FE7A 1JFSA 4MQFB 5BRAA 3SM9A 1GUBA 4MPTA 3I42A 5DGCA 4EVRA 2E4ZA 2JVKA 5GQSA 3GT7A 2CD7A 3RVOA 5TE9A 4QICA 3LOPA 2QU7A 4KV7A 3RQIA 1Y1LA 3H5LA 2LUOA 1BAPA 2B1JA 3N0RA 2QVCA 4LDZA 2MSLA 3O1HB 2W42A 1MB0A 5IULC 2M1ZA 5D2CA 5EWJA 1ZN2A 3RVPA 3MF4A 1C4WA 1JBEA 1FFGA 5DLEA 4H3KB 4F06A 2PJUA 3W9SA 2GI4A 4YLEA 3EGCA 2R47A 4QYWA 2MYUA 4MAAA 1MB3A 2RJNA 1Z16A 2YHBA 1JX6A 3M9WA 2FN9A 1D1PA 3A10A 1YIOA 5EWJB 2FKAA 4Z4FA 3LFTA 5T7BA 3N6VA 3DLHA 4JP1A 3HUUA 2R25B 2FLWA 2VUHB 4O1IA 1Z18A 3HVRA 3OO0A 4MR7A 3F73A 2PL1A 3LUDA 1RNLA 3C97A 3HS3A 4RXMA 3RVKA 2VK2A 5CNMA 1YMUA 3FMVA 2E4UA 2M98A 1D1QA 3EQ2A 4IRXA 4RK5A 3HK2A 3GBVA 4IMIB 3A0RB 1NXSA 3K9CA 1JHZA 3SG0A 2E4VA 3FFXA 6ABPA 1VPWA 4Y9TA 1OXBB 4ZYLA 4WZZA 4W5RA 1R8JA 5EWLA 1SXGA 2FMKA 3O2QB 3KCNA 1VRVA 5KWSA 1EAYA 4IF4A 4MR8A 5DCLA 4UHKA 3Q7SA 4P1ZA 1ZESA 1QP0A 1CEYA 3HXMA 3LUGA 3N53A 3Q7RA 4OATA 4ETIA 4G0YA 1JF8A 5B3JA 3ROTA 1J56A 5I4CA 3EODA 1DP4A 3QELB 2CHEA 1MIHA 2WRZA 4MLDA 1BDJA 4PEVA 1BDIA 3LKVA 1JH9A 3N8IA 3QX8A 2PUGA 5TPZD 4DQDA 5BRJA 1PNTA 4MLCA 5FWXA 4WXEA 2FTKE 2TMYA 1EFAA 2PL9A 1RXEA 1ZH4A 3I45A 4EYQA 5KQMA 1ABEA 2IYNA 3G1WA 4JA2A 4RK0A 4YWHA 3LUCA 3HO1A 3OLWA 3UUGA 3O75A 4PYRA 1M2FA 2IOYA 2PKXA 3JS5A 2VYCA 3IP7A 1CYEA 1A0OA 1YMVA 3Q15C 1Z2EA 1JLKA 2QZJA 2ZAYA 3LUHA 1NY5A 1JL3A 2PMCA 3Q41A 4MGEA 2HPHA 1Z2DA 1P8AA 3HV2A 4PICA 3C3MA 5FWXB 2F8SA 4KREA 3RH0A 4ETNA 1RXIA 4XXHA 4DN6A 1KGSA 2JBAA 4G86A 5EWMA 3GL9A 3CG0A 4ZJPA 1QP4A 2WB4A 3TO5A 5KQPA 3ILYA 1EWVA 1SRRA 1ZH2A 5CNIA 1URPA 5TQ2A 3EQZA 3HZHA 3T95A 1F51E 3QEKA 1USKA 3CZCA 1U0SY 2IDMA 1A2OA 5FWYA 5FBKA 2CWDA 4Q6WA 3SAJA 3HSYA 4NICA 4Q6BA 1JFVA 3MM4A 4MRMB 5HKOA 1L5YA 3JPWA 2RDMA 3R0JA 5IEBA 3H6GA 1QO0A 1DRJA 1TM2A 2L19A 3CFYA 1PHRA 1GLGA 3DBIA 4KZKA 3OLYA 4PZ0A 4EYOA 1K68A 2LP4Y 5FWYB 1U04A 4RY9A 4LRQA 1YS6A 4LZLA 5CNJA 4YP9A 4G0QA 1DBWA 3HDVA 4H60A 2AYXA 2GX6A 4L85A 1T34A 3Q9SA 2DRIA 1NXOA 1TJYA 3IP9A 4OG2A 1CHNA 4OBBA 1E6KA 5B3JC 4KMRA 4IGAA 3EAFA 3CRNA 3EDCA 1D5WA 3L49A 4RWEA 4RU1A 4MS3A 3VNAA 1E2BA 4LE2A 1LBIA 4KVFA 3G85A 3URMA 4F11A 1SXHA 3I5AA 4IMJB 2R48A 4NCAA 1H9CA 2FLKA 4G0MA 4RY0A 5JNUA 4JAVC 3H1EA 2WMYA 5IUJC 3BILA 4PE5B 5IUNC 1Z26A 3KHTA 1TVMA 4MR9A 2VUIB 1DZ3A 1F4VA 3QX9A 5JS2A 3D8UA 3KKEA 3H1GA 4Z4HA 2PAFA 2CHFA 3UK0A 1FFWA 2FXIA 5C5CA 4NCBA 3EULA 3O74A 4TN5A 3N0XA 3LUFA 1DBPA 4YS6A 1PNRA 4XARA 4YO7A 1U2PA 2L17A 1NTRA 1W25A 2OENG 3O1IC 4Q7EA 4QPJC 5JNWA 2XDYA 1RZRA 4RY8A 2PLNA 4EYGA 6CHYA 1U8TA 4MS4A 4E7OA 2BGGA 4YGXB 3CS3A 1MVOA 4JB2A 1YK0A 3O2JA 3H5TA 3GA5A 4S05A 2YHAA 3ROFA 4F8JA 3F7NA 4KNYA 1ZITA 1ZAYA 3T38A 5HSGA 1IIBA 2PUBA 5IC5A 1ABFA 4UHJA 4HYEA 4RDCA 2L2QA 2V0NA 4D74A 2QXYA 1JDNA 5BQ3A 4N03A 4D6XA 1DCFA 1QNLA 4MR7B 1ZGZA 2LPMA 3OQMA 2NT4A 4HNRA 1AB5A 5T3YA 3JVIA 2NT3A 1XHEA 4YR7A 3OLZA 2QW1A 4G97A 2MYTA 1KMIY 3H6HA 4O5AA 4RKQA 4JOQA 3IPAA 3OMXA 4G0PA 3C3WA 1TMYA 3EJWA 3KLOA 4WXMA 5DKFA 3GRCA 5EWLB 1APBA 2KYRA 4F3TA 1FFSA 3IP6A 2FEKA 5ABPA 5IBQA 5KC9A 3OM0A 3QLTA 4MR8B 3H75A 3NBMA 1C0EA 2WJAA 4W5OA 1ISSA 3IPCA 2FSPA 5KI6A 2NUBA 2HSGA 1HEYA 3IP5A 4ML3A 3O21A 4P98A 3M9XA 5PNTA 1KRWA 2FW0A 1Z25A 3H5VA 3RVRA 4YV7A 1USGA 2WWVD 3DGEC 1P6QA 4MQEA 1QKKA 1PEAA 4H3HB 1W9HA 4OLBA 3FGZA 4LE0A 2P4UA 5BR1A 4QYMA 2E4XA 4KRFA 4RK7A 3T8YA 5HQJA 1BDHA 4G0XA 1XHFA 3HUTA 4O1HA 2FQWA 2I6FA 3OQOA 3VNBA 3SNKA 4EUKA 4YCSA 4EGSA 2QSJA 4MS1A 4EYKA 4JB0A 2Q5CA 3SQNA 5IX8A 3NHMA 3KLNA 2FMIA 1YTUA 3BREA 1PUXA 1QQBA 5KC8A 3NNDA 4Z9BA 2JBAB 3CHYA 5EWMB 3GWGA 1D4ZA 1DRKA 2PUFA 1NXXA 4N76A 1USIA 4TLLB 3RVJA 1FSPA 4MS1B 3JY6A 1BA2A 3H1FA 2MYPA 2JCGA 3D02A 2O20A 5TQ2B 5C5EA 1BVHA 3BRSA 3NHZA 3RVSA 2QV0A 3P9YA 5CNKA 5ED4A 3KYIB 1QMPA 1ZVVA 4KQ9A 3M6MD 3JVDA 4RK1A 1ZHHA 1ISRA 3S99A 5JNSA 2HJ9A 2F8TA 1LJUA 3OLXA 1EWKA 1VKRA 4GNRA 1P6UA 3QEMA 4W5QA 1ZY2A 1P2FA 4YRZA 4MQFA 3O2SB 5TPZA 3CTPA 4ETMA 1EWTA 1K66A 4WT7A 4G0OA 5TPWA 5E3JA 3E61A 3JPYA 3NNSA 4NV3A 5DTEA 3TB6A 3O1JC 7ABPA 4N41A 1E6MA 3HEBA 4GPAA 2RGYA 4N0PA 4DADA 2N9UA 1NXWA 2OQRA 3KG2A 2FMHA 4WWHA 2LIVA 1QQAA 4MS3B 1GUDA 5TQ0A 3DGFC 4KPYA 2QR3A 5TPWB 1SXIA 3LUAA 2AYZA 3ILHA 3F6PA 4Z99A 4MR9B 3H5WA 3OLVA 4WUTA 5HM6A 2A9QA 4EVQA 3FDFA 2WY2D 4N0QA 1JDPA 4Z9AA 2A9RA 2FEWB 1QPZA 4KK3A 1I3CA 1DCKA 1UDRA 2JRLA 4RK4A 2R4QA 1FQWA 3NNNA 3K4HA 3LMKA 3MQ4A 5TQ0B 1EHCA 3RVQA 4B09A 5F64A 4CBVA 3GV0A 3N75A 3RVNA 2HQOA 2IPLA 3H5OA 5JNTA 5JNVA 3T6KA 1DCMA 8ABPA 1LJLA 3BBLA 2IPNA 1LBHA 2MSWA 1DC7A 3KJXA 3QLVA 1M5TA 4MS4B 4Z0NA 2JB9A 2PUDA 2X7XA 3CNBA 1LK0A
chains in the Genus database with same CATH superfamily
4O2BB 4HEOA 4E07A 2CHGA 2RH5A 4LECA 1V3TA 5G0UA 1KAMA 2IELA 2YYYA 1N5IA 3KS9A 2YXDA 3OLCX 2VF4X 4OKIA 2QTRA 4OQLA 4JNCA 4A92A 4WJZA 1VRWA 2FFBA 3X2FA 1ZOLA 1NWCA 3FKJA 3KT0A 3FZEA 1DC4A 3GEBA 5CM9C 4JSYA 3K1AB 3U60B 2FPWA 1I6WA 1JHAA 3VVMA 2BW0A 4JB8A 4R2JA 3FZNA 4UUPA 1CUHA 4DT1B 2JBWA 2FRXA 3N0WA 4YP5A 1S8NA 3Q2OA 4D81A 4RZUA 1X94A 3AU9A 1GV1A 4L4UA 3ZDXB 1PS9A 5JS1A 1OLUA 2PA3A 5BSFA 5ALHA 1GZVA 2C9BA 3WGOA 4JKOA 3V1NA 2XT6A 4YUWA 2J31A 5BNTA 1L7AA 1G1MA 4NESA 3GQVA 3MWFA 5D6OA 2AFRA 4UPEA 4PHFA 3ZI0A 2OYSA 3LUDA 4RXMA 1DQYA 4KQ2A 4OFZA 3QXJA 4RA9B 1XTPA 4M9XA 4FPXA 4AK9A 2JZNA 1HF3A 1JKJB 2IZ5A 5LZ5A 2ZRFA 4JBNA 3VOAA 4G5FA 4WERA 3GJYA 3ZPXA 4X8LA 2EO2A 1C7IA 2EWMA 4RLHA 4MH0R 2WC1A 3BXPA 3BL8A 5B1HA 3S6JA 4J3JA 3U5ZA 4RDHA 1JL3A 3I1IA 1CKEA 2W43A 5FLEX 4XM2A 1X8LA 2HCFA 4C0XA 5TR9A 2A1TS 1DWPA 2W0SA 4YASA 4HQFA 2DPXA 5HCUA 4QA9A 4J0KA 3I37X 2QZZA 4CMEA 2G9UA 2O4UX 4L07A 4BEVA 1UMDB 2QROA 4ITUA 5D51S 1N5DA 3QTLA 4ENWA 2OHVA 1XCGB 1AKTA 4OG2A 2GXUA 2H1RA 1ACLA 4EPYA 3GLFE 4D26A 5C8YB 2R48A 4UZFA 4ZT2A 4QPPA 3W7AA 1BWQA 3C5CA 3CLSD 1YXMA 2FXVA 4D4HA 2EKFA 1EFPB 2I5PO 4X85A 3SHFA 3A4VA 1J5EB 4ALKA 2ZR8A 1YLAA 1M1UA 5FUXA 3DF9A 2YHAA 3E3LA 1PL8A 5KNDD 3Q6IA 4X92A 2CE7A 2NAFA 5DBIA 3CRQA 3GRKA 3RKRA 3ZY3A 1NHGA 4O4IB 3IMCA 3PA8A 4KR0A 3F71A 4L5YA 2P8JA 3JWGA 2WIAA 3DFUA 4J0QA 4WA7A 1WD5A 4FP9A 2A57A 1E9EA 5FNVA 3GJ8A 2WEKA 5AHKA 3G2JA 2PJDA 3O4IA 4D5GA 1FP2A 3DMFA 2IYFA 2FFAA 2JHFA 4L7VA 3EDMA 4DNFA 1VQ1A 2QTVA 2ZPUA 1E9DA 1UPUA 1WXQA 1GGNA 2QJFA 1OCEA 2EDAA 4YJDA 3RVJA 3B7NA 3LK6A 1ICEA 5EKXA 4MJLA 1H2YA 4N01A 2UXDB 1D5CA 4FONA 2Z08A 1DEKA 3BJZA 3UWKA 5JFTA 2W2TA 4OGLA 5DXJA 7ABPA 2J0EA 3JW8A 4AP9A 3X2SA 4BX9A 1G17A 2X5JO 5I8ZA 2Q49A 4AVYA 1EINA 4EJ0A 5CD1A 1TI7A 2VK8A 3IDQA 1P7WA 5GKNA 4NDNE 1ZCBA 5LUBA 1WUJS 4GH9A 3WYGA 3GK3A 3GV0A 1B41A 5ALKA 2DECA 3BMQA 1R6AA 1AQYA 1P2VA 3LVVA 2Y99A 4G26A 4GX2A 2XKKA 2XEPA 2D4AA 2FZCA 3SF8B 4FMPA 3ZKWA 1NSYA 2Q9AA 1JR2A 1UM9A 1VLVA 1W85A 2C2GA 2IT1A 3RYCA 2ZXEA 4PRZA 2CNBA 1DAFA 1RPJA 2VQ3A 3ANYB 1Z59A 1K6XA 2XZFA 1Z33A 2ZYUX 3I2IA 2B8NA 1EVYA 3R0XA 3V8EA 5BXQC 2NO7A 5KNDA 3DV0A 3TQIA 2QLNA 5AHXA 4GUDA 3W5DA 4DQXA 3VKHA 2OBNA 3NNDA 3ICQB 2WZJA 3BSSA 4UUMA 4F0JA 1MX5A 5K8VA 1JXQA 2IPOA 3D4LA 1U65A 1Q19A 5GZ6A 3VVBA 3JTEA 4BN5A 1UK9A 3H9CA 2QT1A 4XUGB 5AW9A 4LSZA 4J4BA 3G8YA 2B92A 1Q7TA 1XTRA 3NDIA 1POXA 4LRTA 1CR2A 2VK1A 3WICA 1RS0A 1K6IA 3CV3A 1H66A 1D1TA 2FKAA 4YEDA 5TT0A 2QJTA 1SCIA 2FQ1A 4PLWA 1XXLA 2E4UA 5CDFA 2GN0A 1SVMA 5AYVA 2G67A 3VPDA 4BOYA 2QV7A 1T6BY 1RT9A 3MN1A 3D5QA 4D8TA 3M6LA 4I9NA 3EFOA 3I0NA 4E5NA 3GXBA 3U5TA 2DZOB 3IAXA 3I2JA 1SOMA 5DHPA 1W93A 2GAAA 1Y82A 4OHXA 1NOKA 4MGEA 3ZHXA 4PICA 2EFHB 2M60A 2ZSIA 1Z2CA 2R5NA 1N7IA 4F4CA 2ISQA 5BXYA 1GTVA 3PEUA 3EPKA 3SS7X 1UT5A 3PC6A 4QDJA 3AG6A 3DZCA 2OGSA 2P3LA 4Q19A 3F6EX 3FOWA 1XIVA 1RKQA 3DPIA 3EAFA 3IHLA 1CQIA 3G0CA 1PT8A 1P61B 2Q2WA 2ZTVA 5JHHB 4G0MA 2PT6A 1B8NA 4D82A 2Z3VA 4WKBA 5IDQA 4JELA 1NY6A 5KQRA 2H8KA 4NEHB 3VKWA 3GOQA 4LVUA 1KWGA 4OJTA 4ZCMA 4QEZA 1KEWA 4WCFB 5AVWA 3KR2A 2D7CA 4GOJA 4EB0A 3L06A 3KQSA 3WIDA 5A5DA 2BDUA 2OHOA 1CVLA 4V3BA 2PMFA 5B57C 2FPOA 3UJ9A 1HQCA 3AP3A 3VO9A 4QPDA 4RKWA 1G2QA 2NSLA 1J8MF 1K5GA 2YZNA 2CV0A 5BQOA 4KDRA 2XZLA 1ZMUA 1Y1TA 3DE3X 2G9RA 4H1VA 3AVXA 1IDOA 2XF3A 4HYTA 5JROA 1JNXX 2BZ1A 2WWVD 3A11A 4NFYA 4HRVA 4M8IA 3ZVMA 3ZE9A 2WIDA 4C3ZA 3HB0A 1KE1A 1JT9A 3HZRA 1NE7A 3ZD8A 4DR7B 3NDRA 2IEIA 3A1UA 3EQ6A 2EX4A 4O2AF 1G9TA 3OESA 2I2AA 4DB2A 1VE7A 1UFQA 2QTMA 1GP2A 1ZR2A 1DFGA 3HHWA 1V8OA 1IBKB 2O8BB 3KLBA 3L7CA 4L9AA 3AU8A 3HFSA 2XHZA 3I9V6 5LZ4A 4OHOA 3QOFA 3WRVA 5EEHA 2VTBA 1NT2A 4DC9A 2QWXA 1EGAA 2XCIA 3VH2A 5CX1A 3RS0A 2WPNA 4KVGA 3O9VA 1WMFA 7AT1A 2WY2D 5C3UA 2BUAA 4P82A 4TKUB 1WUKS 5E1OA 4DV2M 4QODA 1E96A 2HQOA 4MP8A 4WEQA 2QSZA 3BBLA 4JA0A 3CUUA 3KKQA 4KPUB 3BE6A 2JC3A 3OECA 1OB2A 4PIMA 1JH8A 1BHSA 1PF7E 5DE3A 4K0KB 1YCGA 4IBFA 1AG9A 3AF6A 3O4RA 4JS0A 4ZOAA 3MERA 2YW2A 4MWOA 2DWZB 4IIJF 4UEKA 3HHZA 5CHYA 4IQ8A 2E6UX 2IEYA 1HQYE 3TTUA 4BX8A 4DR3B 1DV2A 3K8QA 1VG1A 2XBMA 1XYYA 2AG0A 4DRXA 3FMPB 4IKPA 3CH7A 1CFJA 1Y3AA 3VA7A 1WY7A 5LZ2A 1WXGA 2ZRKA 2DPHA 4HLNA 4UBIA 3EG5A 3TTYA 1Z07A 1TL7C 1E6WA 4U02A 2Z2XA 3N07A 4IXMA 2BHTA 3LX5A 1W49A 1DAEA 4NPAA 4HF7A 1VA4A 2QTCA 3WWPA 4RTLA 1WW2A 2OBBA 3ZDFA 1KEKA 1M8KA 1LDGA 1GPLA 2UXCM 1VFNA 1OFUA 3K3PA 4WN9B 3MC1A 4FE7A 2XRZA 5FUQA 3EOAI 1R2YA 3V7FA 5AVZA 4C08A 3LOPA 2P27A 2M9MA 4EFKA 5BN4A 4BLQA 1BKYA 3EBOA 2H2DA 3MF4A 1L7RA 3KYCA 3QSYA 3BD6A 3D8RA 1N6IA 5J59A 3A10A 1W4AA 5LL6P 5GGXA 3WB1A 4WZBB 1D1SA 1EJBA 3ORSA 4CQNA 5FTNA 1RHJA 3KJFA 1C1XB 3NUQA 1S1MA 1JXAA 4CMEC 4FYIA 1GR1A 4IY1A 4PPGA 4BFZA 4WX2B 1IEXA 4Q4HA 1V96A 1CEYA 1EU1A 2Z5LA 4NZZA 1DQRA 3OFKA 5JAIA 4TKLA 1EK2A 2JAPA 3GEGA 4Q00A 3M1LA 13PKA 3FCXA 2IODA 3B1VA 4MGIR 2QZ4A 4V0QA 1EXMA 3SDBA 1RJDA 4OMCA 4Z3DA 4LJYA 4B76A 4QZVA 3PXXA 1E58A 2XNJA 1KYTA 4E5VA 2IDMA 4DQVA 3PE3A 3RS9A 4TWRA 4XX1A 3NVKI 3P2KA 1UT6A 1TT7A 2E89A 4J3NA 2G25A 4D25A 2RCYA 4OGWA 4L85A 5AVXA 1MC1A 4MOWA 4HGOA 4XIGS 1Z0UA 4BAZA 4MS3A 3LP6A 1K4MA 3VJMA 4IUCS 4BZXA 5KU1A 3QW2A 4L4RA 4HAWA 4HO1X 3Q6NA 1TYEB 3X0DA 2A78A 2NOAA 2AE1A 4TROA 4R9SA 2HLHA 2YZMA 2ZATA 4EEKA 4BWFB 2NV0A 1C3OB 2WHYA 2FPMA 3RYHA 1W73A 1I33A 1EFTA 5EUBA 2G08A 1TKRA 3IB6A 4NYMR 4BB6A 5JIBA 3UT0A 3NU1A 4RPCA 3DQPA 3QJ5A 2F4VB 1ZP6A 1DMRA 4N7JA 1NVWQ 4PNHA 4JCCA 2EBWA 1GCIA 1HR0M 3NRBA 2DNAA 1NW4A 2XQIA 3KTDA 1G6Q1 4U7HA 5IX8A 5SY9A 1YB4A 3K6RA 4A6DA 5EIBD 1M1YE 4MRNA 4OKSA 1CDOA 2VF8A 1NNUA 1L1QA 1U63A 5FR2A 3EARA 4EFDA 1E2KA 5LXTA 1BGVA 2DI0A 1H94A 3PC7A 2WFMA 4LZOA 4PQFA 3CLSC 4EA6A 3BH7A 4ZO7A 4HBZA 4Z8XA 1LWNA 1GUDA 3MTBA 3D1LA 2HWYA 3VI4B 4AY2A 4JT2A 1L4FA 2OM2A 4XGKA 3QVGB 4ZTUB 1OI4A 2WZQA 5CUQA 2VJMA 3PC8A 3ZWOA 2HJWA 5JAPA 2AF4C 2V5VA 3HP1A 3BYZA 1WM1A 5ELMA 4Z4GA 4ZGGA 5IUKC 1K6EA 2BCEA 4LJ8A 3INRA 3BQMB 1GG8A 4LJSA 1L5RA 3TMKA 3V4OA 2HTEA 4X7PA 4JYAB 4GMXA 2JGLA 4CHTB 3HDJA 5A6VA 5JFGA 3NWBA 4PF1A 2MMCA 4CTMA 4RXTA 4W9RA 4X93A 1YMQA 3U7EB 4K2HA 3KSDO 4QDTA 4OI4A 3L0PA 2OY0A 5DW0A 5TQJA 1QIIA 2X4IA 1FRVA 3HVIA 2XWSA 4P32A 4LDAA 3CLTC 5EMHA 1W6UA 1OI2A 2D13A 4MHTA 2W6PA 2ACVA 1PFWA 2LNDA 4PT5A 1YQEA 1WIVA 3QIVA 3ZGLA 2XMGA 1W8DA 2KI5A 5JWRA 1PLLA 1WOMA 1Q21A 3UK2A 2B8TA 3I42A 3KJIA 2O6LA 3VO8A 3LRPA 1KR2A 2QT0A 2VHXA 3QFTA 2BRUA 1I7QB 3QKSB 1SCDA 3IG8A 3IAHA 3DVAA 2W6CX 4DPLA 2IYXA 4Q82A 2XNCA 3MUNA 5G3ZA 1N2OA 3LLCA 4ZK6A 3OZTA 2I7TA 4DDKA 2Z8YA 3W1EA 2VWHA 2NPOA 4MEBA 4BBAA 1C0KA 1IBRA 4C6TB 2IW3A 3ZLJA 3CRVA 1VLLA 4LVNA 2ONYA 3BBPA 4JKIA 1UJ5A 3INNA 3PNBA 1XNRM 1AK2A 1J56A 4AS3A 2X7HA 1DVRA 2WU1A 3HACA 1WHTA 5NULA 4RQAA 4IDPA 5G4KA 5BRJA 3SZRA 3ZK8A 2HA5A 2TMYA 4BFSA 3L4KA 4MYCA 3LBFA 3LUHA 4RHYA 1P8AA 1YOVB 3GCZA 3O8LA 4TYMA 5EE9A 4D6PA 1UJMA 2CF5A 2IHYA 3UMBA 1F5NA 2AH5A 4IG9A 3HB7A 2GBFA 4ZDKA 3UV6A 1N9GB 4R8MA 2EJVA 1PYDA 1V8FA 2VLBA 3NYIA 2PZEA 1E92A 3ASVA 4PC3A 2D0OB 1U3UA 4Q24A 1WS6A 1DZ3A 2AFIE 3OFSA 5DDIP 3IUNA 4FS8A 3PDIA 4RD6A 1UR5A 1BTOA 3LCRA 1CDDA 4PY2A 2Z58A 3QXGA 4ODIA 1SNYA 4IBJA 5CPBA 4I81A 3P0JA 3CR7A 1TLLA 3EXHC 1J24A 3E18A 2LTAA 1E2FA 1R4MB 2RAPA 3V2IA 3I6BA 4FYKA 2JAWA 4U2DA 3ZV4A 1VKZA 1R4ZA 1VL8A 2W2OA 5IKOA 2H51A 5DM4A 4AIRA 1P3QQ 1XDUA 4EENA 2O50A 2BDEA 4DIOA 1T1IA 2B8EA 3GH1A 2AEEA 1PR3A 4YV7A 1QTQA 4YLGA 3FG9A 2BHSA 2Q3LA 4Z6KA 4CN9A 2P4UA 4ZEOA 4CM3A 2B0JA 1T5SA 3PZBA 2R8EA 4S1VA 4HAXA 3S44A 4K05A 1LQTA 2ZE6A 3SX4A 2NO4A 3WE7A 3G5AA 4AZ3A 4UATA 1BA2A 1QCZA 3O9ZA 3QVKA 1HNNA 1F06A 3RVSA 5KQDA 5ALWA 5A3QA 2CT8A 1DBIA 1KJZA 3T7JA 4EG1A 1S96A 2JGFA 1K66A 3LDGA 5DTEA 1GL7A 5JY1A 1DUSA 3ZWBA 2H18A 2DENA 1GL6A 1E5QA 3NRJA 3UMJA 4YFVA 1U7OA 5C8XA 5ALMA 4ZYXA 3V2HA 3UMFA 3BHMA 2D7HA 3O4GA 4RLSA 4S3MA 4EKYA 3WIEA 1SIBE 1VZ3A 5IN4A 3C7AA 1LDYA 3TTXA 4B80A 2EJTA 4LA4A 1XZMA 4JLDA 4KYIB 1RXYA 4Y2TA 3RC7A 2GAIA 4M1QA 5HZHA 3UYLA 1XVUA 3TOZA 4DLKA 5A4MS 5I9MA 4ZKDA 5JNRA 3G13A 4M0WA 1Q57A 1EVQA 5HYVA 4L3OA 4WGGA 1N57A 2A3RA 1GRRA 3NT4A 4JH0A 4RS3A 5LP6C 3WK9A 4HUQA 1M34A 4EA9A 2A5DA 2Q9CA 2VWGA 5DBOA 4DLYA 4INZA 1VMIA 2OXFA 1HT2E 3R5SA 3T1HB 4U7JA 3HFGA 1O96A 3RJ9A 3AV3A 1ZX1A 1U4OA 4YREA 5FR1A 1YDGA 3HRHA 4DCSA 2YXLA 4L0MA 3KXKA 4FOTA 3B9BA 5DULA 4Z51A 1LTKA 4ZALA 4MPTA 1BFUA 5M2QA 4KVZA 1CC1S 2G1PA 1AKRA 3A6JA 4MCJA 3GVCA 4O8CA 3GX1A 3AUKA 3CKYA 3B3FA 4KGZA 1GNRA 2F1OA 2VRNA 1PWYE 4ME6A 5JO9A 1GPH1 1SIOA 3F5DA 4IIGA 5A6SA 3AEQB 1E2DA 5F9FA 4ND5A 2W8ZA 3N6VA 1SQFA 2GZ3A 3Q9UA 1KI6A 4O4LB 1WZCA 2VQDA 2C3UA 4R2WA 1ZSVA 1NXSA 5L3RA 4CG2A 1SBTA 1XUOA 1KHHA 4PHHA 3QFHA 2WOOA 4CMKA 2OCDA 4FCCA 4WXEA 5ADVA 2HRCA 4BQPA 4C7OA 2O6HA 4JU8A 4X63A 2FSHA 3I72A 1CE8A 3OX2A 3JWJA 1EA7A 2NU9B 3OBBA 1CJBA 1Q12A 4HV4A 3K35A 1E3TA 4JD5A 5C18A 4NNPA 3VKVA 4LF6B 2G36A 4UVGA 3KEFA 1JDUA 4RD4A 1Z5UA 1IXSA 4F04A 4EYOA 4PG4A 3T5PA 1GZ6A 1WMEA 2YHUA 4BC0A 3ICEA 2QTWB 3PUIA 2ZKIA 3IECA 1KJYA 1MMFB 3ASYA 3HZOA 3EIHA 1XPOA 4FOSA 2QYTA 1AX9A 2TMKA 3SAVA 5F21A 5HR5A 1RWBA 1Z4KA 2ZK7A 3K70C 2GJ8A 4BMOB 3VDXA 3ZYCA 1U0NA 1HNXB 3ETLA 1L0BA 2GO7A 2V7WA 2OHJA 4RIHA 2JFQA 5G2OA 1M7HA 1M1NB 1PRBA 2C07A 3AR7A 3WX0A 2J7KA 1XC8A 2IYPA 3O8RA 1GWNA 3LQRA 1WDLA 3QPVA 1J33A 2FFJA 4G0PA 2R5FA 1JPUA 5HJ2A 3G2NA 2HAEA 3GLGA 2OZKA 1DWUA 2CFCA 4XI9A 2C7RA 5L8VA 3M83A 3R1IA 3N28A 4MRAA 3NYWA 1JIJA 2GEKA 1PTJA 1VIYA 1FC0A 3DLIA 4PBRA 4XIFA 2NVBA 2RG7A 2XD9A 2YIJA 1J06A 3AI3A 2G71A 5EWMB 2IKQA 5CX4A 3UO8B 4NMWA 3GP1A 1KGDA 2WVHA 2E5WA 3CVJA 1PDWA 2JCGA 3HSSA 3NETA 3U4IA 3CVXA 1KO5A 5KYNA 2CXQA 3AYXB 4A2QA 4FCTA 3NP7A 3KVYA 3DO6A 3PG5A 4M99A 4ZVUA 4GMGA 3OTIA 3TM4A 1KZHA 1SIUA 1UBJS 2SECE 3AHGA 1EVZA 3CWZA 1KAHA 5JNTA 2JAOA 1ZUIA 4J94A 3DEHA 3OCUA 2C0PA 2QB5A 3P96A 4DJFC 2VHWA 2JB9A 1LK0A 1UDBA 1JAYA 3JV7A 3DMNA 3DE2X 1GQFA 2GXQA 3LAWA 5I9SA 5DFLA 5EGSA 3SSNA 5FFNA 1SELA 3IBYA 4F2WA 4BNGA 2ZDGA 3V7NA 4EVSA 1KFEB 2O5VA 1V7ZA 2P1ZA 3E9CA 3T1OA 2I9PA 1M5UA 3RREA 1S01A 2GBPA 3UQZA 3FWPA 2ISSD 3RIYA 3H5NA 1B6TA 2BSAA 3IVXA 1H2XA 1J0XO 1X13A 5ITYA 4G9BA 4YDHB 1K7SN 1C3XA 1HFEL 1OBCA 1G8YA 2W83A 4W8HA 5K0FA 4TRNA 2X9NA 5ALQA 1SAYA 4LI0A 3OIDA 4R8RA 5IP5A 1N7HA 3DZDA 3L7OA 4UVEA 1B7GO 3HPRA 2EJWA 3DOCA 2WB2A 4RJ2A 1VLZA 4CEJA 2ZIEA 5I7HA 3I2FA 2VHYA 1A5SB 2XLJA 1PT7A 3A31A 2X0DA 2WLSA 3MWDB 3WBFA 5HW0A 1LSSA 3O1HB 2QUKA 1ACMA 1K75A 3KV3O 3MG9A 4UQLA 4K40A 3U13A 1UMKA 3KELA 3W78A 4Q5IA 2ZRGA 3KSZO 3HVRA 3C8UA 1XROA 4LWPA 3OE5A 4PLGA 4RK5A 1D03A 1OXBB 4ZYLA 4YT5A 5IWAM 4EKIA 4D7AA 4X1YA 2BP7A 2BM1A 3B20A 4Q3KA 2BNKA 4TS9A 4MLDA 1II8B 3HXOA 3UA3A 1W9MA 2CNKA 1KC3A 4GGOA 4RK0A 2P0EA 4BEJA 4KZPA 1R5JA 1FIUA 2G3QA 4PR3A 4Q1EA 3PK0A 2HPHA 4G63A 2V7PA 4YALA 4XXHA 1E4YA 1HDYA 2NYUA 4DN6A 3L2AA 5LM3A 1GAWA 3KO8A 1ZH2A 3L8HA 4RVNA 1P1BA 1KO7A 1GKYA 2RDMA 5FEMA 3DBIA 3ZJUA 3QFSA 4B44A 1F0YA 1Z68A 1ORHA 5AKKA 3HB9A 5I8PA 5FOXA 4H1TA 2PH3A 5K5EA 1FDTA 3GIDA 1J7KA 3P71T 3FWNA 5K3OA 2Y1FA 3GGJA 3W6UA 2GCIA 2PGNA 1RQ7A 2F3PA 2XDYA 4GYWA 5JASA 2BWJA 2OHHA 2JGDB 3EEFA 4LGCA 1CUXA 3T38A 1A8PA 3UB2A 2PCJA 3C14C 4E31A 4N03A 1TAGA 5C4GB 2JD2A 5FLXS 3ADPA 2GRAA 1SCJA 2CLOB 4TX1A 1TMYA 3GRCA 1Y8QA 3LHSA 5BRNA 4XTRA 4MKGA 1H3EA 1E2LA 1JEQA 2I0FA 2WZCA 3FHCB 2XB4A 2BLLA 4QOIA 4JI5M 5JVDB 1Q15A 1V47A 2RBKA 2C7GA 2HRRA 3GRRA 4XJTA 2AYYA 4MPPA 1RKUA 3TAHA 1U2DC 1V9CA 1JG1A 1EFDN 1KI7A 2PHZA 3JAWB 1KAQA 2GPJA 5FA5A 4C07A 3BBZA 3QENA 2ECOA 1Q92A 2IWRA 5AOCA 5CYGA 1Z0IA 1XKQA 4C5BA 3O1JC 1PK8A 4WCDA 1P4HA 3AVWA 3W5VA 2IE0A 4G4OA 3H9JA 3E84A 5J3JA 3RM3A 5AVTA 3ZNPA 5FBQB 3UWMA 4B3IA 4CL3A 1TQ2A 2OR3A 2J9FA 5AM4A 4IHJF 2P62A 4I3HA 3C41J 3ZLVA 1L5VA 4ZQGA 2NU7B 1A8IA 5J4VA 5K2MA 3ROQA 3NXKA 5LOVF 1DFHA 4KXQA 2CNLA 4YX9A 4C2BA 2WUDA 4DUPA 2PK3A 2VPXA 4BMSA 4OI0A 2D7JA 4DR2M 1E1MA 4N54A 4D4GA 4LDJA 1HTWA 1C3EA 2HX1A 2QSYA 2AGVA 1EXNA 3JRWA 3N7AA 4ERNA 4IDNA 4PIPA 4H7HA 1ZGAA 2RGCA 1T0UA 2BEJA 1NXTA 3GRVA 3HDHA 3TZBA 4NHEA 3A70A 1P1CA 4HTFA 4PM4A 3NW9A 1M2EA 4BX0A 1T3TA 1P4SA 3S2YA 4YMHA 4YXWA 2FN8A 3PJFA 1H6AA 4UNQA 3RKUA 1JIUA 3R7NA 3A3KA 2XH9A 2LCQA 1WVGA 1Q16A 2IYAA 3O26A 1FRZA 2UYYA 4KCGA 5KYXA 1CG6A 3QM1A 5HIKA 5E6UA 2R7AA 3K1ZA 4LNHA 2DPGA 2LUOA 1WU7A 4QFCA 1O77A 5I5EA 4D56A 3FCCA 1CJSA 3AUFA 3ZV5A 3MBKA 1NNEA 4CRWB 3ERCA 4NNOA 4RABA 5HIIA 3RFTA 3KJZA 1DNPA 4BMYA 4XDZA 4JOBA 3K9BA 5IVIA 1XL1A 4KBGA 3UJ6A 1K7EB 2IEBA 1DIRA 4FDVA 3IAFA 3CJTA 5B2EA 3IV7A 3FCEA 1TYBE 2R1VA 4CEIA 2X1LA 3PPXA 3OF2A 2EZUA 1B0AA 4O63O 1TF0B 3BFVA 4PEVA 1VKNA 1I2CA 1FFAA 5M5BA 2MJ5B 3IT2A 3NGMA 4HGNA 3AJEA 2IYZA 4YRFA 3W4JA 2UVDA 1CVRA 4S0ZA 4X84A 3V4VB 3K1YA 2YVUA 5BVHA 2Z6QA 2VG8A 5HNKA 1FNMA 1U7HA 5EA2A 3VPBA 3GEPA 4QM7A 2YCLA 4ON9A 4BKUA 3IODA 2ZYSA 3MWYW 4QXPA 4V0KA 4RVUA 2C0QA 1MD9A 4XTCS 1R0CA 3LNCA 1DBWA 1Z4QA 5DRTA 1L8QA 2O5RA 4YV0A 4CZ2A 4OFWA 3RABA 4S0XA 1C81A 4GX1A 2GF0A 2X58A 2DFNA 4DHEA 4FI3F 2GBIA 3H83A 4W7HA 4KH1A 1PTJC 5LN1A 3JQ7A 4HH1A 1RADA 4HMPA 5TY0A 4DVGA 1W1UA 4RY8A 1FDSA 1NQUA 1CUEA 3OJOA 3ZJTA 1YK0A 4J07A 1GUZA 4B7AA 4NCKA 3E9MA 4XB2A 4PTZA 1ZL0A 5F12A 1ORRA 3J81S 1Q02A 5FWNA 2IYTA 1H3FA 1U5BB 4YR9A 3IO5A 3O95A 1LDBA 2X0FA 2FSPA 3UG7A 3VYTB 2OAP1 2I76A 5A7FA 1D0MA 2DKFA 4ER7A 4QG3A 3BWBA 4Q01A 1QGDA 3GT4A 4R41A 3UYKA 2P8SA 5T41A 1R4NA 1VHJA 3E15A 1Q0HA 4CXMA 3KUDA 1JILA 4JP5A 4GLFA 4TOIA 4LF4B 1NI4A 2XXAA 1SKQA 1IOLA 4V2UA 3E9SA 4EPVA 4AXXA 1UPFA 2BBTA 1KL7A 1FEZA 1V35A 5AK5A 1I9CA 4NBLA 2XXJA 1XG5A 5CLGA 3Q8KA 1Q3HA 4MITA 1Z29A 2HAKA 1G19A 5B6IA 5JW6A 2EP8A 5LYJB 2AYZA 1SCKA 1QH8B 2A9QA 3QYPA 2O8EA 4I6EA 2A9RA 5DGIA 3ND7A 1HNZB 4YJHB 1UDRA 5K3AA 4ZAYA 1DEOA 4MB7A 3ZN2A 4C21A 1GU7A 1WJGA 3OPYB 4M98A 2I3GA 4JI6B 2O3UA 4TL8A 3EWAA 4F12A 1DIGA 2V4UA 1LJ8A 1M2KA 4YRRA 4Q3BA 1QQ7A 1HC7A 2PAAA 4UVHA 221PA 4P4NA 1ULZA 2W2LD 3N2GA 3DE0X 4MKHA 4FEGA 2QD3A 2E85A 4CGZA 1BH6A 4H17A 1YDEA 4DQLA 2HWXA 3ZU2A 4P7KA 4FOOA 4FCVA 1NOIA 3DFIA 1H1LB 3HVJA 2OUKA 3R5FA 1T5BA 2QXTA 2ADMA 3GUUA 4RK6A 1AXRA 1DFIA 4E03A 3F4BA 3TLGB 3JYQA 1L5MA 3JQDA 2FSVC 1RHKA 1LRLA 1PEYA 4K1XA 4P58A 4JFAA 2UYQA 1CWUA 3RSZA 1WMAA 2CD7A 3RJTA 5M04A 2W37A 2ZVDA 1C1HA 3DBRB 1OYVA 1X87A 3F1KA 1GV0A 1C7YA 2CGEA 3B5JA 3OKAA 2OE2A 4R2XA 2Y2VA 3K4QA 4C88A 3OF3A 1FYFA 4UUBA 3THWB 4B6FA 3KSAC 5K51A 4EPXA 5AVSA 1A9TA 3DS8A 4X3OA 5HK8A 2VSFA 1YA6A 3VSAA 4RIIA 1R0SA 3IIJA 3C3BA 1VSQA 5DJ5A 1TEZA 3HWSA 1CUVA 1Z0AA 2DH6A 4K6KA 1BMDA 1VE1A 4NBUA 1U02A 3RRMA 4OUDA 5C5DA 2FHPA 4DWJA 1QFZA 3EDYA 5KTTA 4MIYA 3JS5A 1YMVA 4C30A 1QAMA 2PMCA 4PSDA 4KREA 3RH0A 1E79D 4RM2A 3I9KA 3L05A 1JA1A 5H37D 3EQZA 2FMTA 1U8FO 3GU3A 2W2LA 1V37A 4Q1AA 1JG3A 5EHGA 1ZNYA 5GONF 1U1FA 1BW9A 3CLTD 4PZ0A 2WWWA 2XZDA 1P0PA 1TT5A 4AQYB 3P32A 1UMBA 1S5PA 4V02A 1UKCA 2V74B 4N48A 1YRLA 2XQFA 1EUYA 4LOAA 3L6CA 1CJTC 4MS4A 1P9WA 4HYYA 1C7FA 3I51A 1CFZA 2HK8A 3VTKA 4OH7A 1LZLA 3BE4A 3RWBA 2HBQA 1PZFA 4D6XA 2OGTA 1Q0QA 3RIMA 1D0KA 2C4MA 1FVHA 4BNJA 4IJ5A 3I4YA 4K9KA 4JOQA 3AJ9A 3C3WA 5JFOA 3IKJA 4C0LA 3AM3A 5KNBD 3JQRA 2EG9A 1GTSA 4JI7M 3MJHA 1XHLA 2NXCA 1M1XB 4IKOA 3T35A 3VHLB 5FFFA 1H0SA 1RYBA 3W6PA 5CITA 4H7FA 3RLIA 3ZU6A 4ZVOA 4GSLA 3BM5A 1M0TA 5L7YA 2JEZA 2ZXUA 5A3JA 2LNHC 5DM2A 2IOFA 3PGJA 2WJJA 3NHZA 3CF4A 4RF3A 3MB5A 1EUDA 1N6LA 5DBEX 5JNSA 3F1LA 2ZAGA 2A35A 5U9CA 2YZGA 2XGNA 4MIOA 5D01A 1QHHB 2QF7A 3UMCA 2W2VA 4GYJA 3CJQA 1EP1B 3MELA 1U0TA 4DEYA 2IBMA 2DQSA 4ZJYA 4EF6A 2J3JA 3IX7A 4FX2A 4XFJA 3L84A 2DHDA 1E79A 3DAHA 2L4EA 2EWWA 4I4NA 2XTJA 1DCKA 2J5YA 4DV6M 2VR1A 5B4VA 1OBFO 4BV8A 3TNYA 4O59O 3SDSA 5C5IA 2XZOA 1HE5A 3CUYA 3DW1X 2Q2QA 1JNYA 2F1KA 3CF0A 4BVFA 4ZI7F 1UXOA 4DIMA 1IBLM 2IU0A 2B1RA 3WTCA 4TLMB 1YUMA 4BRZA 1QGED 1SC9A 1MV8A 2J6HA 4RSMA 3KAJA 1L1FA 2YIVX 5FHQA 2IV3A 3NYQA 1JA0A 1W48A 1FX0A 2V8OA 2XE6A 4J9UE 1FU4A 3W4KA 4AKIA 5U4QA 4EGCB 1T4DA 3CU5A 1LLCA 1MEJA 1QLJA 4EG7A 1ZIOA 1RI4A 4I1PA 3DDHA 4X41A 3ZDRA 2JLXA 3HL0A 3FVVA 2AHRA 1QG2A 3WGTA 1DC8A 3QBTA 4DVJA 3LW7A 1PYOA 4KK4A 1PJSA 2W6OA 5KNBA 3GGDA 1WQ3A 1NIPA 1YC2A 3PE4A 1CDZA 1E8NA 3L5OA 3DF7A 1FLDA 3WGMA 4PPYA 4A5SA 5K3DA 2QRVB 2JAQA 1HX7A 5TSDA 3TQHA 1RBYA 2OFOA 2DBVO 1FXWF 2R46A 3OZVA 3WNVA 1PV1A 1RQNA 3V5NA 1D1PA 1JG4A 3ANMA 2SKCA 3OC0A 3PKJA 5KWEA 3TRKA 3ZLTA 1K63A 2A9FA 3SG0A 3OWOA 3ZHTA 2CFRA 1V8DA 3HNRA 2F1HA 4NBNA 1GITA 4Q4JA 4UREA 5ARCA 1ODTC 2X15A 2E0IA 4I8DA 1RTTA 4TGLA 3A3OA 1NYTA 4PLVA 3KQTA 3GUHA 2Z3WA 2JCXA 3L7NA 4JLKA 4LBWA 2FPIB 3IAEA 2ZUDA 1JHRA 3R4VA 1VOTA 3EXHA 1QQTA 1XEFA 3IXMA 4Q93A 1QB8A 4IO0A 4A8JC 2Y1EA 3LYLA 4QYIB 2XRYA 5E6JA 4ZYZA 5GINE 3G2OA 3DEZA 4DKJA 3C3AA 1VXRA 5GZ1A 1T34A 4F96A 2OORC 5K05A 4L73A 1JDBB 1P2BA 1B16A 1IDN1 1KOJA 3PFKA 4IYRA 3S81A 2P2NA 1SQ5A 2OLKA 1PGJA 4Q7EA 4AMVA 4B4WA 2FGKA 4YIHA 2JJ1D 3D8TA 3Q4GA 1BCRB 3ONEA 3HCRA 2K0BX 2ZG6A 3MGBA 4QE3A 3C7KA 2WYIA 3CSUA 3EYWA 2PXXA 4G84A 4AMZA 4NRDA 3W2HA 4MLZA 4FYJA 2OKCA 2QL9A 5K4GA 5LKRA 3INYA 3VGPA 4MMYB 5B4UA 1I5EA 2O9JA 1WXFA 3HA3A 4ZHQF 4HGPA 3T0GA 3ICWA 4DARA 3BFPA 4BVLA 4MB2A 4E2YA 1FPMA 1AH2A 4LRYA 4X0EA 4IZOA 5BNWA 2COEA 4BV2A 3D3EA 4QYMA 2YOFA 2A88A 3BGSA 2GAOA 1FPQA 2Z5VA 1S2GA 4F9TA 1OI7A 1O5TA 1THMA 4K9LA 4MTCA 4OHRA 4U8GA 5IHXA 4JUBA 4Y1RA 3V8QA 4GKKB 1OMOA 4MW9A 4UOQA 3VK7A 5KX5A 4BNNA 5F33A 1IWPB 5BR8M 2FX2A 3OUTA 4I2NA 4QBFA 2W4MA 1IG3A 2B83A 4ZK2A 1TZKA 1N34M 1TUIA 3C3YA 1NQWA 4G0OA 2KS6A 4NXNB 1WXHA 4K87A 4MPJA 4HN2A 4C4ZA 3H8SA 4QUAA 3DH0A 1J8QA 5F51A 1L7QA 2H2AA 4BUZA 5LP6A 4JBLA 5LQRA 2VHUA 4TYYA 5C53B 5LKAA 5HM6A 2B2CA 1IAQA 3HX3A 2BGLA 3OZAA 2PS1A 3IPXA 3NEPX 5C3MA 5DNVA 4QQRA 5LVAA 2WUFA 4RKUF 2ZAIA 3TXYA 3AQ4A 2IOFK 2Q46A 3PEVA 1BDMA 5JUWA 1ZC3A 2O3RA 3K70D 1ENOA 2VK4A 1T0IA 4XYMA 4BWYA 4C0SA 2PRSA 1QJCA 2BE9A 4QGBA 1YSCA 5LB2A 1M76A 1OZHA 1Z22A 2JGNA 1EJ6A 2PKQP 3PQFA 4ZWNA 5C8ZA 2CHUA 4C0JA 1XZ8A 3EZ2A 1V5FA 1TF7A 1QTRA 1VGQA 2JJ1A 5H80A 4RPKA 1NDHA 1P77A 3C3PA 2OB2A 3IDOA 4OW0A 4JFRA 2R96A 3LTEA 2DAIA 1MC4A 3COJA 2QMZA 2OG1A 2DERA 3E1GA 4JI1M 4PNEA 3R6TA 5AESA 4UJ5A 2ZRPA 1FU8A 3TWOA 4H7KA 1X19A 4WL0A 3JWEA 1EDOA 3GLQA 3O8OA 4GBMA 3RUAA 2C1EA 5MN4A 2PYDA 4L74A 2JLVA 1BU8A 1CUWA 3HR7A 3DXFA 3CRZA 2CF6A 4U9UA 1ZOSA 4DMGA 3UTDA 2UVQA 1QVWA 5FOVA 3KJQA 3CNLA 2H7YA 5CAEB 1CUZA 1TMKA 2WWXA 2EERA 1ZONA 3ZBPA 5H70A 4OOFA 2QRJA 2DMRA 4IINA 1RZVA 4OK6A 2FG5A 3H4IA 1HEIA 1TUBA 3ZVRA 4NYJR 3FDIA 3RB8A 4R8SA 2VSNA 4E6EA 3ESYA 1WB6A 3K4PA 5BW5A 2VDUE 4Y9TA 1RLTA 4EHAA 3RAFC 4W5RA 1Q6ZA 1U80A 3TD6A 4PCUA 4G4SO 3HXPA 4KTVE 1U3VA 4DGSA 1A2KC 2WT4A 2RSLA 3D6HA 2PX2A 2ZS7A 5B53A 4O8ZA 5F2OA 2VPTA 1PIWA 4UCQA 2ODWA 2PKEA 3OLWA 1E1DA 3LXXA 4C3OB 1X8XA 2ARKA 1MT3A 4RAQA 1D0VA 4IV8A 5BV0A 1TM5E 3A4IA 2YVAA 4A15A 3GVIA 3U6PA 2AKAB 3R6WA 2GHIA 5IANA 2F4NA 3TKLA 5SYMA 1OW3B 1ZMVA 3GJQA 3FWHA 5JMOA 1MC5A 5L4LA 4OHWA 4ARSA 4IGAA 2X6TA 5IXSA 1IOVA 1E2BA 1MX3A 2VATA 3L7IA 3EC1A 4RY0A 4RMJA 4YWJA 3WDMA 5K0CA 3WWOA 4WZAA 2ZROA 3QPWA 3Q0TA 1KZGB 5B55A 4UTZA 2P77A 1WR8A 2PLNA 2WSYB 3DDSA 5BWLA 4IIVA 3MPUA 4AUEA 4KE8A 1L1ZA 4AKTA 4F8JA 3L8YA 1M0EA 1UBSB 1IIBA 4KXFB 1WL8A 3GLFB 2P2SA 5CLQA 1OWMA 3H19A 1Y5IA 1TKBA 3CF6R 3G2PA 3TPZA 4K8RB 4TL7A 2D1YA 2XD4A 4N3CA 3E6AA 5FPKA 1KI8A 1EQUA 2D3WA 5KI6A 4ML3A 4JLMA 2L7IA 2YC4C 1NQ5A 2I7CA 5E7MA 1J09A 1AV6A 1MQ8B 4G8JA 5J5VA 4P7GA 3SNKA 2DFPA 4JXJA 4OVZB 1O6FA 1JHOA 5HEKA 1XCLA 1PWZA 4PRYA 1JSRA 1BVHA 4CM6A 5CT9A 4AY6A 1V25A 1X1SA 2BC9A 2IHVA 4RK1A 3UQYS 3ZNQA 3PPYA 5MN6A 5AQEA 4DDTA 2WLTA 3EIXA 4QTYA 3A6EA 3I76A 1XMQM 5J63A 2XWPA 4XD7D 1IN4A 3MINB 3EY9A 3KG2A 1QPBA 4JV5M 2GM4A 3R8FA 4RE6A 4JJGA 2HSWA 3ZJ4A 4MR9B 2OD9A 2FSGA 1J00A 3GDFA 2Q4OA 1NBME 1QIKA 4ID9A 3OD1A 5DN9A 1XDSA 3H5OA 1RYYA 4YUAA 3CXRA 1I4OA 1L8LA 4L2IB 2EZ9A 4YMTA 2RH9B 1V7QA 3KOYE 5J47A 1C4XA 2E5LM 3E3MA 1YQXA 4MVJE 3WBJA 3IL2A 2I80A 5DGDA 1AB6A 2JCYA 2HT6A 3AR8A 4FBLA 1WB5A 1II9A 3PHLA 3ZZTA 1X1CA 2I1LA 2ZYDA 4DCUA 3OQJA 3EQ8A 4OY3A 4B3FX 3W7VA 2OC9A 1YTLA 5AUPB 1XA0A 2Y71A 2JVJA 4E2ZA 4O4HB 1JDVA 1MJGM 1L7MA 3PWSA 4D99A 2FUG6 4F5EA 4FGUA 2RC6A 3P4YA 1U0EA 1NF2A 3WLIA 5AJVB 1Z36A 1M74A 5KKAA 4AX4A 4IILA 4TVKA 3FSEA 4OHVA 3RVOA 3FYHA 3SKYA 4QTZA 2WI8A 5IDYA 5FOUA 4MKFA 1Y9EA 1RWOA 3E5RA 4KXVA 3BIJA 4B3BA 3TIIA 4HEHA 1C4WA 3EGVA 3R5HA 5EUQB 4RL4A 4BLCA 4ZEWA 4LX0A 2GN1A 1MENA 4EG0A 1YIOA 1TF5A 4NOJA 3ZDBA 4E5MA 5HXAA 2A7XA 3R44A 1VKOA 2NO1A 3AR4A 3GFQA 4XD7A 1WDMA 4HPJB 5KHLB 4KAAA 3TCXB 2VJCA 1XB2B 1Y6QA 5KSPA 1YZYA 4N1AA 2LVBA 3WAKA 4D9KA 3JWPA 1UZLA 2ZI6A 3W1VA 2BGTA 1RCTE 4O02B 1K27A 4WLOA 1MOPA 2IY9A 3ENKA 4CF4A 5B1YA 3PYXA 4HZUB 1NUSA 5BSVA 3GAFA 4WOJA 1E4EB 2XECA 5TVKA 5KNCH 2JAHA 1XTIA 4JT9A 1DIHA 1X92A 1Q11A 1TTEA 3Q85A 1YU6A 3UFXB 3LY9A 4AG3A 4E08A 2Y9MB 3AUXA 5BMVB 5E6SB 5L3VA 3KSJA 1TMGE 3OKPA 3VXKA 4Q3DA 2BMDA 4XDHA 4F5WA 2AR7A 2KNZA 2FPGB 4F45A 1VG0B 1NRIA 2FLVA 4LRUA 4I55A 5KKNB 1FFWA 2BMAA 4JVOA 3JATA 1MGPA 3PTLA 4DYHA 4QIHA 4F72A 4CI0B 1PKXA 1FMTA 3GDOA 2AQIA 2XZPA 1U2DA 3HYRA 1VXOA 3VNSA 3VV3A 1U1EA 3MCTA 1JXMA 3MXOA 3G1TA 4MDFA 4XQ9A 3NH6A 3CONA 3PITA 3CVUA 4EHDA 1HDEA 4IWNA 1RHUA 3ZK9A 4DQKA 4PTLA 5J9FA 2WMNB 1K3TA 2FEKA 4BNZA 1I51A 3JQ8A 4HDMB 2HSGA 2C5AA 3RKSA 3PL1A 1PLKA 3AI1A 1GL3A 4ZO4A 5E1MA 1RMYA 3OX1A 2HRBA 3NHRA 2PO5A 3OA0A 1CR1A 4OH1A 3MJ5A 3CHYA 3ZTTA 1S3FA 4AECA 1CRQA 3QGMA 5B7NA 1H0HA 1UBGA 4MUXA 3NUGA 5ILGA 4EIWA 5TT1A 3RYTC 1DO8A 4C7VA 4PYIA 4GNRA 2ZULA 1CP2A 1TK3A 3OU6A 1F4IA 1L3CA 3WO1A 3EIUA 2BJHA 3O6VA 2H54A 3V8RA 2HA7A 5CVDA 4ALJA 3D6AA 4FFBB 3K0AB 3DXYA 2QR3A 3L82B 4CM5A 4MYHA 5JAMA 1CB0A 3QMWA 4U2GA 2J8ZA 3NJRA 2ZU0C 5EIEA 3L07A 4GP6A 3NVDA 3CX3A 4WE3A 5KJFA 1J21A 3ABQB 1UK6A 4PHTA 4R3UC 1YUBA 1OFHA 3PPVA 4YAOA 4US0R 5B2FA 1EBUA 1OIVA 1M2JA 2PBLA 2ZE7A 5KDDA 4RF4A 2XSZA 2VP0A 1N2SA 3AHCA 1XNQM 4YMIA 1O3YA 2C03A 3O3CA 5T6MA 4BO3A 4HDAA 1M1ZA 4TKMA 3PDCA 1WJ7A 4UTRA 1O0SA 4FNAA 3GA7A 4GXQA 3GAAA 1NRJB 4BNDB 4BO0A 4E11A 4Y1GA 1J1UA 2XVAA 3QUQA 2O8DA 3KTAB 4CTKA 3NXSA 2QMHA 3E70C 1AHIA 1B0PA 4KFUA 3HP4A 1U0BB 1DIOB 3G2MA 1V3VA 3VKGA 5DEIA 1ZJJA 3V8MA 2ORWA 3QHPA 4MI9A 1T9AA 1ZN8A 2IPXA 3P2EA 2DQYA 2MH8A 1I6MA 5TMPA 1GNPA 1KJQA 1IVYA 2EF0A 1GNSA 5HQTA 2J41A 3BXXA 2ZREA 4WURA 1M9NA 3I30X 3M4XA 4FU0A 1TIPA 1LBEA 1OROA 2CXSA 3H5LA 1JQKA 3HCNA 4LXQA 2WIGA 1P80A 1NX6A 5F77A 3BTVA 5FTJA 4BDSA 3FBGA 5ICSA 3FOFC 3UG6A 2WHPA 2P7IA 4BU0A 1NULA 1QRSA 1OYYA 1TD1A 1UP7A 2EDCA 2ZE5A 3D43A 3H17A 1G9SA 4H9GA 4ZICA 4QNRA 4WACA 3WADA 4NZPA 3A37A 1PZMA 3MUOA 3BSWA 2GEJA 2VHEA 1W36B 4GPIB 4JDPA 2PZGA 4QO7A 2P4EA 1RC8A 2EIXA 2FOXA 2LRHA 1H5UA 1T8UA 1MIHA 1AZLA 2XVZA 4PPNA 3UXYA 5CTAA 4DLWA 5FWXA 3FI0A 2CE2X 2XTMA 2ZYWX 3B7WA 1Q1BA 1DINA 2H9AA 2QIOA 4UMFA 1FFCA 4BIMA 4I4TB 3QVSA 1Q77A 3KKPA 2H5IA 4OX9Y 2AVDA 2C00A 2WU3A 4F7WA 4CLOB 1NW3A 2L19A 3A9TA 3Q8MA 1Q0ZA 1TCUA 5JAQA 5FWYB 2PYZA 1J07A 3O8CA 3ZQJA 4DM3A 1R0YA 3OOSA 4GM4A 4XVQA 4RWEA 2R1TA 5FNVF 4G1FA 3A6ZA 4KVFA 3ENNA 5A04A 2IS2A 1QE3A 4C89A 2CLKB 1MU5A 2WA1A 3LWZA 4PAWA 2PAFA 4EO9A 1H2ZA 1VL6A 5JS7A 4XARA 4AYTA 2KEBA 2OENG 3KVWA 2ZPAA 5JEDA 5I7WA 5EE1A 3BHNA 4GXNA 1C3VA 4KIJA 4FHDA 4MUHA 1VLMA 4JQOA 1L7PA 1XLTC 1M2OB 1QNLA 4BIIA 3EMDA 1Y9ZA 2XDQA 1L5LA 1CJCA 4U0JA 1XKXA 2B9EA 3UA4A 1ZM9A 4Q66C 4WAUA 1A82A 2OD7A 4EG3A 4URUR 2Y8EA 3LP8A 4HDRA 4BMPB 2IS1A 4ONEA 3AEKA 1D2GA 3L7MA 721PA 4RW0A 4YCSA 4CMCA 1ZUNB 5HJ7A 1JHXA 1LU9A 2EX0A 4BNKA 3T1YM 5EHQA 2OKGA 2Q2EB 2RI0A 4MVXA 3SXPA 3S27A 1TU4A 2RGBA 1YQWA 1MDBA 2ESRA 3HEBA 2QZ9A 4D0GA 3SXUA 3PQEA 1C30B 1WSWA 1GFWA 1KYZA 3KOOA 4DCVA 1M1YB 3S5JA 3A9RA 4HX2A 1EMDA 3MTEA 1YS4A 3I1YA 3LKZA 4UEWA 3R41A 2KBFA 2GFHA 1VA5A 4JBXA 2PUEA 2RHHA 1YE8A 3HN7A 4R0VA 5FLKA 4DV5B 2YIDA 3TBFA 1PQUA 1V6AA 2W8BA 3QOWA 2H92A 3JR5A 2FSVA 4QDKA 1YQUA 4MV6A 2GUWA 3BUSA 4OSEA 4EI8A 5KVCA 1Z62A 4IJWA 3X1YA 1YAHA 2XDWA 2BM0A 4PAMA 1NU8A 2PT9A 3M5PA 3G79A 1E5LA 2ZYTX 5KWVA 1M8GA 2QVGA 1GGHA 3VC7A 3VU8A 4FQ8A 2XCOA 3L43A 1O5OA 3J7TA 7GPBA 1D4AA 3CKMA 2QUJA 2WP0A 4L9RA 3U7RA 5SZHB 4TTRA 4B74A 2XBLA 3O1LA 5KQGA 4KQHA 1KJ8A 1GZUA 3OM1A 5J1TB 3ZZ1A 3L0OA 2OAQ1 1F20A 1KYWA 4PCAA 4AG5A 3A4YA 1Z5ZA 4I1OA 1ISMA 1LUAA 1CZOA 4L6IA 5IULC 1G5TA 4NL4H 3RQSA 5C1BA 4RYDA 4UHCA 5FBLB 3H86A 3AEZA 2QR2A 3K2IA 4X66B 3QU7A 3JAKA 2BAGA 4GQIA 1Q95A 4CM1A 2LTUA 3FOAA 2FDXA 2NU8A 1N4AA 3PD1A 3A2MA 1RJGA 3HKEA 1XEXA 1XTSA 4P1ZA 3WSVA 5AW4A 3VR4D 4YXWD 1EWQA 4YRAA 3A6HA 5GMOA 4RH0A 1L2BA 5C7OO 3U61B 1FYXA 1LPNA 3NONA 1A8SA 4Y30A 4ZJZA 3ZX5A 3L79A 5CG2A 4M60A 4IS2A 4MZXA 2IX3A 1KI3A 4OFXA 3JYOA 5LUAA 2QM7A 1YB1A 1WEHA 3K16A 2NQTA 1ZXBA 4UKDA 1Q0PA 4PSVA 1NLFA 2HA3A 4TTVA 3WRXC 4HNAB 3D4IA 1LTMA 1TM2A 4DQ0A 4PLPA 5TJHA 5DIFA 5SY4A 4B79A 4ZU3A 2R86A 3COSA 3L0CA 3HGTA 1PZGA 1T5LA 4P9NA 2O0HA 5HILA 5IUNC 5IJAA 5JS2A 3U0BA 5K0SA 4YBZA 4DTIA 2FXIA 4B81A 5E6RA 2UKDA 5KTPA 3IAS1 5EY5B 5KOIA 4GP9A 2P6RA 5IM5A 1FP7A 3C98A 1P2TA 2Q0HA 3RO7A 1ONBA 3SYLA 1NP3A 4LDRA 4GLBA 2G5TA 2HMYB 2NT3A 1XHEA 3DBOB 2REQB 2AFIB 3H6HA 1GSHA 3NASA 1GKLA 1T2CA 5FCDA 1L1TA 2CXTA 3RJ5A 5AUOB 1E3MA 2X86A 1DT5A 3W8DA 2IHNA 4R8VA 1M2VA 1CS0A 4RA6A 1N0IA 5LBIA 2WSFF 1L5FA 4R3NA 4DDUA 4DLUA 4FYMA 4TLLB 1O57A 3ET5A 4M87A 2D5AA 1TYAE 3PFFA 3LQFA 1TA4A 3UATA 3VR4A 1Z7YA 3OIVA 2O5CA 2ONZA 3F96A 5B6JA 4B3DA 2AJ8A 3TZLA 4PQEA 1P60A 3PP8A 4H0FA 4R84A 4TQUS 2B2NA 2XB9A 4UOEA 5HKBA 4BGDA 1FBNA 2Z09A 4HQRA 4RS4A 2A1UB 2AZ4A 3B3JA 3RIXA 1Z0JA 2NSHA 1P5RA 1C7RA 2ATXA 5D87A 1CNMA 1Y33E 2OO7A 1VJ1A 2EBHX 4YRGA 5C1IA 2WK1A 3EGDA 2IKSA 3H2JA 1ZD3A 2FZGA 5L6LB 1I4WA 1PDOA 3PPIA 1QO0D 1XFAA 2P9QA 2ZSAA 4IGIA 3C3KA 2D74A 4R4JA 2H1HA 4A6PA 4Q9LA 2RHRA 3KXEC 1LI4A 3TMYA 1YBVA 1LQUA 3VPAA 4QGHA 1YS7A 3LQYA 4HQKA 5KTSA 4E4TA 4C1NA 4GHWA 3TIXB 5FYDA 3GLVA 1JEAA 3JARA 5HF5A 3L7JA 1EK5A 3ETJA 1NBIA 5BOVA 4XPIB 4REQA 3ZCBB 4FK8A 1L5HB 1NKVA 4R81A 1NVUQ 4HSGA 2ZUWA 4D3YA 1V5GA 1P9LA 1D2AA 1Z0DA 3LXRA 2B4AA 4JVSB 4LOKA 4B6QA 3VPHA 5C4IA 4C4PA 3A6LA 4TWJA 2PNFA 1KQOA 4DA4A 5EJ9A 2EHDA 1A69A 4MA5A 4CEHA 3OP1A 1UBTS 1AJEA 5JV5A 3B74A 1O6BA 1P81A 3GFRA 4AJ2A 1OBOA 1IN8A 3VZCA 4ZAXA 4BBJA 2QM3A 1XZLA 3GJZA 4DV0M 2QYSA 2FZEA 2OCYC 4IQ4A 5JH7B 2A84A 4A8JA 3TQRA 3OZ7A 1H6CA 5A5EA 3KWJA 1NT4A 4P3KA 3F9CA 1GKKA 1YZ3A 1NPDA 5HWSA 4BFUA 1GRCA 3HXMA 1W7AA 4LY0A 4UHDA 5I4CA 2ZUEA 2AEMA 1Y7PA 3C2QA 2JZ0A 1YGPA 2O0JA 2OORA 4DQDA 3PCRB 1TJPB 5F7XA 2D54A 3H9EO 1C80A 1ZRNA 4EB6A 4PGHA 3HJGA 2JHGA 3U3ZA 2IXGA 3RTAA 4ZXFA 4NZNA 3ZDZB 1FS6A 2CWDA 1NNSA 3HYLA 1QO0A 5ALVA 4QRIA 3CVYA 3W5BA 5GV8A 1VBFA 3OLYA 1V5EA 3KEGA 1FFYA 4LZLA 1IM2A 4BFWA 2XQGA 2ZUTA 1V9SA 1P5ZB 1GEEA 3CZAA 4V1CI 2ZBEA 3TRHA 1F17A 1SPXA 4RD2A 3I4FA 4C7MA 2WF8A 1NBWB 2ACWA 2PGJA 1P72A 4Z0HO 4GO1A 4RFLA 2H00A 3L6BA 4GX0A 2O2IA 4JIMA 4WKCA 4LF9M 3BGWA 4H7PA 4MW5A 3GI1A 4AYWA 2J1LA 3NT5A 4FDLA 5JISA 1KKLA 1XVLA 1Z0SA 1VGRA 5LXTF 1LRJA 1EVJA 2X7JA 2NV6A 3RC1A 3CMMA 1JN0A 3T15A 3L7KA 3P2YA 4IBEA 4GAEA 3T3EA 1K06A 3BHJA 2AK3A 3VH4A 4MR8B 5HFAA 3Q8GA 1CJUC 4IGFA 4GOMD 1RJ9A 4A0GA 4I5EA 1ZMBA 3FPCA 1QYDA 1QP8A 3VX3A 2BCGY 1BYIA 4PO9A 3KQHA 2Q5HA 2ZIZA 1E7RA 3REQA 2J0VA 2PXAA 3E21A 1TAHA 3KD3A 3FAKA 3DQZA 5FXMA 2DQZA 3FIUA 5ED4A 2PGOA 1WB4A 1PVOA 1HYEA 4CDNA 3COWA 4BFVA 3EA5A 2HM7A 3DWEX 5JYEA 3CTWB 1YL6A 2BFBA 1QDRA 3OH8A 4BVEA 1J8YF 2PR7A 4E6PA 3G2HA 1WCXA 3OTOM 1QCYA 4O2BA 4GMDA 1Z6QA 3K9QO 3KIPA 1X1BA 3DKPA 4IMRA 5L3SB 3MT0A 4PDGA 1U2QA 1ZNXA 1UM8A 3HU5A 5TMEA 5TIIA 2PX3A 2BUCA 1JQEA 3WGNA 4IDDA 4XYLA 5FBVB 3ZWKA 1U7WA 3WIVA 1EVIA 1ZRSA 1EUQA 3MHPA 3DKRA 2BWEA 3C43A 3ZTWA 4POOA 1KK1A 4BMDA 4AY5A 1UBUS 2PZKA 1I4LD 1C1DA 4XLTA 1QONA 4M36A 4W6QA 1FUIA 2G5PA 3P9NA 1B00A 4X1KA 1VHWA 2WYHA 1QOZA 2XOXA 4QFBA 3E82A 5JC1A 5JWHA 2V7XA 4ZMSA 5HQ3A 4MVWA 4KHPM 2HNKA 1HURA 1PRYA 1W29A 5CA0B 4HXFB 1DB3A 2ZDHA 3FTNA 4KN9S 5KQSA 3ETHA 3NPAA 2GLTA 2HA0A 2H0QA 3QSGA 3MMSA 4AJ1A 4R9NA 1RCFA 3VX4A 4MUGA 2J3EA 2EFDB 3BXHA 4Z9FA 2TYSB 1DPGA 4G3OA 5AIBA 2ZZKA 4RA9A 3SHGB 4YPFA 5KU7A 4MLPA 3VDUA 2Z8YM 4I2VA 3KDPA 5HMLA 3GFFA 7CATA 1PTKA 4ETIA 3HDYA 2EU8A 1C1YA 2XUZA 2FP4A 3QX8A 3LUCA 3V4FA 1UZAA 4RF0A 2PKXA 2UVPB 2CLSA 5LMCA 3T1QA 2AD5A 5ICEA 1EWRA 5T4EA 1GQQA 1EIJA 3OJ0A 1G5FA 3RU9A 1GJRA 5I7SA 2PQMA 1R5BA 3RYFB 4DGQA 4MJ7A 3BL6A 3GQ5A 3TLKA 2CWWA 4UTOA 2DTDA 2REBA 1KFJB 2DWCA 1TJNA 4DABA 2O23A 3HNOA 2EAUA 4PS1A 4UBLA 3AM5A 1YHZA 4I6GA 1SUDA 1Y3IA 4I1YA 5EVCA 4IOKA 1Y4ZA 5K0NA 4G0WA 1XMVA 3KHTA 4HOYA 2X0JA 3RW9A 1SBYA 3W9YA 1QK4A 3I2YX 3IAM1 3D6MA 1HA3A 2BGGA 2NZ2A 1PZEA 3AERB 5EERA 3H4MA 3P2MA 2HDHA 1SCQA 5G1NA 3GWZA 2MCFA 1QWOA 3V2UA 3RSHA 4I8XA 4X6XA 3ST7A 2IU3A 5AW0A 3VZSA 5EWLB 1AMOA 5E4YA 3PHBE 4YQYA 1KBZA 3GEEA 5I3CA 1SUFA 4NCHA 5ER6A 4DSNA 4AROA 4RPGA 3H5VA 2FN4A 2D2VA 1C29B 3UAZA 4EECA 1F0PA 4D9JA 2PEZA 4IDFA 3HCEA 4FINA 2R68A 2VNIA 3OZRA 5E1BA 3DMRA 4EJ2A 4ARZA 4XB1A 4AJJA 3HO8A 4HDNA 1Z75A 1L5GB 2QHXA 4XGRA 3WYFA 3VAZA 5FPSA 4P8RA 5CGZA 1OC4A 5IKXA 3GZTB 3U4HA 1G60A 3ZC7B 2Z8XA 3EK2A 3QE3A 3W5JA 1V6CA 5BT8A 2N9UA 2WM8A 1LNQA 1MX1A 4V0ME 4BLWA 1G66A 3K6SB 1JEJA 1H0RA 4ZYWA 1UBMS 4J1SA 3CGWA 3HKDB 3BOSA 4GX5A 4WOPA 3FB1A 3OCCA 1QH0A 2ORED 4YCNA 2FW8A 4CGYA 3LP5A 3P9IA 2MSWA 2DG2A 2XOKD 3DUWA 1S3IA 4AN0A 3HJFA 8ADHA 3RGGA 1XRMA 1G8FA 4P3NA 3BN3A 3IBSA 3DZ8A 2BCJQ 1CY4A 1RRFA 5HFNA 2HK7A 4RQTA 3R3JA 4OHMA 5EXTA 4RD0A 5KTKA 2NP7A 1MRNA 3T7RA 1Q6YA 2WPDD 3SFVA 4D45A 4E2WA 4AKSA 1CY1A 2O8CB 2C78A 4Z7JA 4DLAA 3B6JA 3H9UA 5DGXA 1MXFA 5THQA 1W19A 4WXRA 2TMGA 3G9ZA 3C9PA 3SY8A 3CQ9A 2PX5A 2XODA 4NI5A 3X1JA 2ZJBA 4BQQA 1XD2B 1IH8A 3BQNB 1GD1O 3CSSA 4B3RB 3SWWA 2FR8C 3PX7A 2BIFA 4GWGA 1P17A 3MA0A 1P9NA 1OC2A 1L5ZA 1AA6A 2VDOB 3TLYA 2F43B 5EE3A 2WJZB 3TVDA 4BKQA 1GZ3A 5DYNA 4L15A 3FCAA 4UFPA 4MW0A 4QQFA 3O7WA 1WSBA 1ZVMA 4P38A 7MDHA 4AMGA 5LWQA 3M9WA 4ZEVA 1FMCA 3AONB 3C16C 1EM8B 1N33M 3X2EA 2H59A 3RGSA 4M8KA 2VXYA 2J3HA 1U9JA 2VYND 2VP2A 1DX6A 3IBCA 3SPXA 2ZTUA 3TSAA 4FWTA 2A7QA 5A3RA 2L69A 1MAAA 1UDCA 1PR5A 2FPSA 3UV3A 5CLJA 3VZBA 2R62A 1KH3A 5CJPA 2WNIA 2G8NA 4Q7MB 2EBFX 2IZ6A 1ZH4A 2DLDA 2BZSA 1NYLA 4OLHA 2JFNA 3EIQA 1Z2EA 2PGIA 2XOKA 4JI4B 1T4GA 2QL5A 3N39C 3X1DA 2UUOA 3DXXA 3PT5A 2V0CA 3HSYA 2FQQA 5FPPA 5ALGA 4HX5A 4NBVA 2VJNA 4DNOA 2LP4Y 2WPDA 3C39A 4P22A 3Q2KA 5BT9A 3ZS9A 2QUIA 4OBBA 2A9VA 1VJDA 2QU8A 4D3SA 1HSOA 3I4VA 1L4GA 3PRHA 3EVTA 2KBEA 2WYUA 3C45A 3AHHA 3FH0A 3DEFA 1LEHA 3TRJA 3TUIC 1SKYE 4QLAA 1VE3A 4CUKA 3BSYA 2L17A 1W25A 3EXIB 1Z8NA 1CDEA 5IAKA 2XEXA 2IQ5A 2BFCB 5F9MA 3D7RA 1S2DA 1NONA 4CG1A 3L27A 2DFVA 4NYMQ 2XYPA 2W6JD 4P7JA 4Q9HA 3OMXA 4I14A 2ZUVA 4RNCA 3K9PA 3LDFA 3PIDA 3FLAA 3MJDA 2GGSA 4PPFA 5GVSA 3A6DA 4L7QA 3GG2A 2FF7A 3KUXA 3DUFA 2WU4A 4HRYA 1PEAA 4R2MA 2E4XA 4AUMA 5BN3A 4I4LA 4G5GA 1RXWA 4G4GA 4RJIA 1THGA 2D5IA 1EGMB 2G6TA 2L6OA 4I7EA 3BULA 2VYNA 2ZM5A 4Y1FA 1OQYA 1D4ZA 1D8TA 2VAXA 3BKXA 3COYA 4Z9XA 1CX9B 1FSPA 5IC6A 4M0KA 1E3WB 2C9DA 2PH7A 4P54A 2WG0A 3SLKA 3BXFA 5ALRA 1N5MA 4DL9A 5BOSA 2ENUA 4YA6A 3X1MA 4KXYA 3MT9A 1JVBA 2QQFA 5AW7A 2BM8A 2QQ5A 2JI7A 5J2TB 3BMCB 4N41A 1EYZA 5CDSA 3TE7A 4LF8B 3HJUA 3QKWA 5CBKA 3ZNNA 4NJMB 3TLMA 3TAUA 3A2NA 2A94A 2JFVA 3EHEA 3FMFA 1RPTA 4HLDA 4KPUA 5J2UB 1NXQA 4HB0A 3B13B 2ZIUB 3J27B 5CVTA 5B30A 1DXYA 2SNIE 1HFKA 3RGPA 2PMKA 4MWTA 1G8SA 1PJ8A 1Y4AE 4QYXA 2AN5A 3WQSB 4LXIA 4YK7A 5L4NA 2XUAA 4NE9A 3G8BA 1KEEA 1NQOA 3W8NA 4BNMA 2R11A 3SSOA 2Y0PA 1CK4A 2JNHA 4CM4B 4HNGA 2HPVA 2QY9A 4R40A 1NUAA 4UNIA 3ZWQA 2PLRA 2IS6A 5L7WA 1VG8A 1R6DA 1T36A 5DCUA 1KFCB 4XQCA 3ECAA 1K86A 3V4LA 2O2GA 4UN2B 5LFAA 4KFCA 1QC5B 4RTPA 3B1YA 4RY2A 2PL5A 1ZW1A 2I7DA 4MPDA 2W6JA 5EJAA 4DLNA 1VIDA 4MAFA 1Z0KA 3VLFB 3EPPA 3TVTA 4ZU1X 4MIEA 1KJWA 4MYRA 1SQSA 4CM9D 1I7PA 4OV6B 1ADCA 2JZOA 4RV4A 3HL4A 3LV8A 4ZOEA 1VHQA 4PU0A 4E5YA 2GK7A 5IK2D 2H4HA 1DG3A 2Q99A 1ZMOA 5DHFA 4GD3Q 3LXUX 1PFKA 1C8BA 2IUYA 2LCIA 2XZTA 2GI4A 1C8VB 3N7TA 3LD9A 1WAMA 2NYVA 5MFPA 3HJHA 2O8FB 1YQQA 1EFVB 1RBZA 3RG8A 4MVJG 1IE3A 4HKTA 3IUBA 3SYNA 2ZBDA 4LZNA 4WNYA 5EJGA 5K03A 3VTAA 3RC2A 2Q5LA 3AR3A 5BV1A 4BC1A 2IDKA 5COAA 2FGJA 1ND5A 3C7DB 3BMXA 5AM5A 1E32A 3RTEA 5FTLA 1S8AA 3L1VA 5EMNA 4ALLA 3O84A 1QHFA 1KMHB 2HEIA 3NANA 4AYXA 4YAFA 2WKQA 3F6RA 1E98A 2QUZA 2YWJA 2BFWA 2RE8A 2FETA 2D7EA 1UKYA 4CFSA 1QBKC 1C9EA 3WWYA 3CZCA 2E1RA 4UBNA 1TGVA 4NRWA 1T1EA 2CLLB 1XLTA 2QOEA 5A9TA 1KMCA 4CR6A 4IUDS 3QTTA 4CIYA 4Y2YA 4EKEA 4B3SM 5AKLA 4EG5A 3IUQA 1Q5PA 3CH5A 1TB4A 4NENB 1DJOA 1N5JA 3NGXA 2FJ0A 1RIIA 2K9DA 3TVYA 4YPVA 1HKHA 3MK31 1U2PA 1SCUB 4R9VA 1ISGA 1KWKA 3ZH9B 5D7BA 3KTFA 2VT6A 2H1OA 2PX4A 3WMXA 2BEWB 4RSGA 4G56A 2HV9A 1YB7A 1Y1SA 2XR1A 2YJ5A 1YBHA 5IC5A 1XA4A 1DBSA 3KB6A 4AY4A 8AT1A 1CIVA 2GNPA 3TCNA 1RBQA 4L22A 4CM9A 3K8ZA 1FFXA 1G64A 2A58A 3KDAA 1N2XA 1LPAB 5IK2A 3TRFA 1FX1A 4E2FA 1ZEMA 2HYDA 3VHXB 5K3CA 3D6TB 3WTBA 3T3HA 4WVFA 2JGKA 2XF2A 4DAEA 1NUQA 3WKCA 3DGEC 1PR1A 1W9HA 1WU8A 2CK3D 5AM0A 2LKDA 1W35A 2DY0A 4B6EA 2QYHA 1XA3A 3KOXE 2UDPA 2JIZD 2Y0EA 2R7LA 1O97C 1U0OC 3G0BA 3QVWA 1XZIA 4OXXA 2PX0A 3U31A 5IJZA 3OZSA 1CETA 1DIAA 1MGOA 4IVRA 1QF9A 2A14A 1B42A 1R12A 4RO0A 4TV8B 3CPHA 3RFVA 2JFOA 1E0AA 2XH8A 2YY5A 1JTEA 2Q9BA 5EPOA 2WJIA 1E3JA 4FR5A 1WB9A 5LP1A 4DKXA 2ZT5A 3PEWA 3G68A 2JJ2D 4YT8A 2ST1A 2J3MA 1Q44A 5K4HA 2VOJA 4HVLA 3THYB 3UAYA 5K9ZA 3RVQA 3ADCA 3TTSA 4OX9M 2CKDA 5LC1A 3EZYA 1E9RA 1TX4B 2QN7A 3CIOA 2OBLA 1I3LA 4MYSA 4PAOA 4CQMB 2DOKA 1OHHD 1N6PA 1M2WA 1CUUA 1Q1QA 2OHXA 4HNHA 3WA6A 5LJLA 4CHTA 3CY6A 1CQWA 2GDJA 3W5SA 3ZU5A 5BR4A 3GJ7A 1AQNA 1P2UA 4WZ6A 4QKQA 1DKRA 2YRFA 2BF4A 2Q5QA 3OOWA 2BGNA 2CBGA 1DZIA 3FW1A 1TQ4A 5HUJA 1Y3BE 4HNQA 4QHYA 5KOHB 1MX9A 5H1YA 1JU9A 1RYFA 2CDBA 2Z1MA 5TS3A 5F7ZA 5F3WB 5CLFA 1RWMA 4BNTA 1UH5A 1K0FA 5GPBA 1DL5A 5DV9A 4G0VA 4WY5A 3EZ7A 4UARA 3EVEA 2F5NA 3KZCA 2GKGA 3SSMA 1DKUA 1W5EA 3QKSA 5DASA 4YJGB 2Y20A 1PL7A 2CK3A 3DCYA 3G0DA 2FE1A 2YXNA 2HO4A 1ZCFA 1VP9A 2XHEA 2ZIWB 3BC1A 2JIZA 5JD3A 2XSZD 4XIYA 4JT4A 1T6NA 1SZCA 1VE5A 2VTVA 2WMOB 4RFSA 4GT1A 3UC9A 2IYUA 3O94A 4ZYYA 1F8GA 1A7AA 4IGKA 2EKZA 1I9GA 4YMSA 3PNQA 3WRXA 3DM5A 4A2PA 1UL1X 3H0KA 4D3ZA 1PJ4A 3U3OA 2DAPA 3HXKA 2QEQA 2CXUA 2JJ2A 2LD4A 4IM7A 5AXDA 2VJQA 1HSZA 2ZBUA 4GICA 5HF6A 1KVQA 4TUWA 1X2EA 3ADOA 1PNTA 4WCFC 1YOVA 4DCPA 1DOZA 1MAWA 1OBVA 1SVNA 3TQSA 3Q11A 2WAMA 1LX7A 2VHTA 2GOYA 4AJKA 2Q4DA 4Y9RA 3S40A 1X9GA 1HOXA 1B0UA 2PD4A 1OHHA 3PPWA 1C4KA 4TQGA 3SGLA 2XE8A 4MWCA 1SG6A 1JB9A 3UGTA 2Y3IA 3PNOA 3QQ5A 3UJ7A 1NPTO 2C5HA 2BD0A 3OZUA 1TJYA 2OZPA 4MI3A 4LS3A 3EC7A 1FTGA 2Q5JA 4ZFNA 3PICA 4J7CA 2CNOA 3KOWE 3BWEA 1LCIA 1D2NA 4K9NA 2FK7A 2NSJA 3EXEB 1JQ5A 1SN7A 3PNYA 1HY3A 3GNTA 2QHOB 1U2EA